BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81882_g1_i1 len=543 path=[1:0-542]

Length=543
                                                                      Score     E

ref|XP_008227272.1|  PREDICTED: uncharacterized protein LOC103326806  63.9    3e-10   
ref|XP_010910258.1|  PREDICTED: uncharacterized protein LOC105036...  60.5    4e-09   
ref|XP_010910256.1|  PREDICTED: uncharacterized protein LOC105036...  60.5    5e-09   
ref|XP_004491235.1|  PREDICTED: leucine zipper protein 4-like iso...  60.5    1e-08   
ref|XP_008798386.1|  PREDICTED: uncharacterized protein LOC103713286  59.3    1e-08   
ref|XP_010910259.1|  PREDICTED: uncharacterized protein LOC105036...  58.9    2e-08   
ref|XP_010910257.1|  PREDICTED: uncharacterized protein LOC105036...  58.9    2e-08   
ref|XP_004491234.1|  PREDICTED: leucine zipper protein 4-like iso...  58.5    4e-08   
ref|XP_007213346.1|  hypothetical protein PRUPE_ppa027227mg           57.0    7e-08   
emb|CBI24266.3|  unnamed protein product                              57.8    8e-08   
ref|XP_002270722.1|  PREDICTED: uncharacterized protein LOC100255134  57.0    9e-08   Vitis vinifera
ref|XP_003617229.1|  hypothetical protein MTR_5g089290                55.8    3e-07   
ref|XP_010247487.1|  PREDICTED: uncharacterized protein LOC104590496  54.7    4e-07   
ref|XP_010034258.1|  PREDICTED: uncharacterized protein LOC104423469  53.5    1e-06   
ref|XP_007015258.1|  RPM1-interacting protein 4 (RIN4) family pro...  53.1    2e-06   
gb|KGN48091.1|  hypothetical protein Csa_6G430670                     53.9    2e-06   
ref|XP_006575621.1|  PREDICTED: uncharacterized protein LOC102667968  53.1    2e-06   
gb|KDP43175.1|  hypothetical protein JCGZ_22727                       52.8    3e-06   
ref|XP_008449643.1|  PREDICTED: uncharacterized protein LOC103491...  53.1    5e-06   
ref|XP_002871888.1|  hypothetical protein ARALYDRAFT_488838           52.0    5e-06   
ref|XP_008449644.1|  PREDICTED: forkhead box protein G1 isoform X2    52.0    7e-06   
ref|NP_001031906.1|  RPM1-interacting protein 4 (RIN4) family pro...  50.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286609.1|  hypothetical protein CARUB_v10002334mg           50.8    1e-05   
ref|XP_010313243.1|  PREDICTED: uncharacterized protein LOC104644747  50.4    1e-05   
ref|XP_007146139.1|  hypothetical protein PHAVU_006G015600g           51.2    2e-05   
ref|XP_011036392.1|  PREDICTED: uncharacterized protein LOC105133931  50.1    2e-05   
ref|XP_002314011.2|  hypothetical protein POPTR_0009s07190g           50.4    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010931824.1|  PREDICTED: uncharacterized protein LOC105052...  50.4    2e-05   
gb|AFK43661.1|  unknown                                               50.4    2e-05   
ref|XP_009588910.1|  PREDICTED: uncharacterized protein LOC104086...  52.8    3e-05   
ref|XP_006369649.1|  hypothetical protein POPTR_0001s28010g           49.7    3e-05   
ref|XP_009588911.1|  PREDICTED: uncharacterized protein LOC104086...  52.4    4e-05   
ref|XP_011090174.1|  PREDICTED: uncharacterized protein LOC105170933  50.4    4e-05   
ref|XP_006356391.1|  PREDICTED: uncharacterized protein LOC102601745  50.1    4e-05   
ref|XP_010519820.1|  PREDICTED: lysine-specific demethylase 7A        49.3    5e-05   
ref|XP_007141510.1|  hypothetical protein PHAVU_008G202100g           49.3    5e-05   
ref|XP_009794992.1|  PREDICTED: uncharacterized protein LOC104241759  49.7    6e-05   
ref|XP_010931825.1|  PREDICTED: uncharacterized protein LOC105052...  48.9    6e-05   
gb|KFK26209.1|  hypothetical protein AALP_AA8G216800                  48.9    7e-05   
emb|CDX70878.1|  BnaC03g09620D                                        48.9    8e-05   
ref|XP_010454225.1|  PREDICTED: uncharacterized protein LOC104736013  48.5    1e-04   
gb|AFK33855.1|  unknown                                               48.9    1e-04   
gb|EPS59770.1|  hypothetical protein M569_15036                       48.1    1e-04   
emb|CDX88889.1|  BnaA03g07600D                                        47.8    2e-04   
ref|XP_009131739.1|  PREDICTED: uncharacterized protein LOC103856382  48.1    2e-04   
ref|XP_007148389.1|  hypothetical protein PHAVU_006G204500g           48.1    2e-04   
ref|XP_004513236.1|  PREDICTED: kininogen-1-like                      48.1    2e-04   
ref|XP_010420753.1|  PREDICTED: uncharacterized protein LOC104706276  47.0    3e-04   
ref|XP_006470526.1|  PREDICTED: uncharacterized protein LOC102626760  47.0    3e-04   
gb|KHN38394.1|  Dihydropyrimidinase                                   49.7    3e-04   
ref|XP_006400507.1|  hypothetical protein EUTSA_v10015114mg           47.0    4e-04   
ref|XP_009120883.1|  PREDICTED: uncharacterized protein LOC103845749  47.0    4e-04   
ref|XP_006583972.1|  PREDICTED: fe(2+) transport protein 3, chlor...  47.0    4e-04   
ref|XP_010099807.1|  hypothetical protein L484_004382                 46.2    5e-04   
emb|CDX85786.1|  BnaA02g00270D                                        46.6    6e-04   
emb|CDY40070.1|  BnaC02g00600D                                        46.6    6e-04   
ref|XP_006446312.1|  hypothetical protein CICLE_v10018107mg           46.2    6e-04   
ref|XP_010493018.1|  PREDICTED: uncharacterized protein LOC104770...  46.2    6e-04   
ref|XP_009125337.1|  PREDICTED: uncharacterized protein LOC103850350  46.6    7e-04   
ref|XP_010493016.1|  PREDICTED: uncharacterized protein LOC104770...  46.2    7e-04   
gb|KEH33367.1|  RPM1-interacting protein 4 (RIN4) family protein,...  47.0    8e-04   
emb|CDY14003.1|  BnaC09g38230D                                        46.2    0.001   
ref|XP_010673773.1|  PREDICTED: uncharacterized protein LOC104890102  45.8    0.001   



>ref|XP_008227272.1| PREDICTED: uncharacterized protein LOC103326806 [Prunus mume]
Length=93

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            HREE+  R SVPQFGGWDQ    G + TNYT+VFTQAR +RKQ+K++L
Sbjct  3    HREEKNVRRSVPQFGGWDQ---NGPDPTNYTVVFTQARANRKQNKTDL  47



>ref|XP_010910258.1| PREDICTED: uncharacterized protein LOC105036194 isoform X3 [Elaeis 
guineensis]
Length=86

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  65   EERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +E+ R  +VPQFGGWDQK GG    TNY++VF+QAR +RKQ+K+EL
Sbjct  5    KEKNRWKAVPQFGGWDQKSGGA---TNYSMVFSQARANRKQNKTEL  47



>ref|XP_010910256.1| PREDICTED: uncharacterized protein LOC105036194 isoform X1 [Elaeis 
guineensis]
Length=89

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 3/46 (7%)
 Frame = +2

Query  65   EERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +E+ R  +VPQFGGWDQK GG    TNY++VF+QAR +RKQ+K+EL
Sbjct  5    KEKNRWKAVPQFGGWDQKSGGA---TNYSMVFSQARANRKQNKTEL  47



>ref|XP_004491235.1| PREDICTED: leucine zipper protein 4-like isoform X2 [Cicer arietinum]
Length=134

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
             +E+ P +SSVPQFGGWDQK  G    T+Y++VFTQARE++K  K++L
Sbjct  3    QKEKIPTKSSVPQFGGWDQKAPGA---TDYSMVFTQARENKKHQKTDL  47



>ref|XP_008798386.1| PREDICTED: uncharacterized protein LOC103713286 [Phoenix dactylifera]
Length=87

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            H +E+    ++PQFGGWDQK GG    TNY++VF+QAR +RKQ+K+EL
Sbjct  3    HLKEKNGWKAIPQFGGWDQKAGGA---TNYSMVFSQARANRKQNKTEL  47



>ref|XP_010910259.1| PREDICTED: uncharacterized protein LOC105036194 isoform X4 [Elaeis 
guineensis]
Length=85

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +2

Query  77   RRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R  +VPQFGGWDQK GG    TNY++VF+QAR +RKQ+K+EL
Sbjct  8    RWKAVPQFGGWDQKSGGA---TNYSMVFSQARANRKQNKTEL  46



>ref|XP_010910257.1| PREDICTED: uncharacterized protein LOC105036194 isoform X2 [Elaeis 
guineensis]
Length=88

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 3/42 (7%)
 Frame = +2

Query  77   RRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R  +VPQFGGWDQK GG    TNY++VF+QAR +RKQ+K+EL
Sbjct  8    RWKAVPQFGGWDQKSGGA---TNYSMVFSQARANRKQNKTEL  46



>ref|XP_004491234.1| PREDICTED: leucine zipper protein 4-like isoform X1 [Cicer arietinum]
Length=136

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 3/43 (7%)
 Frame = +2

Query  74   PRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            P +SSVPQFGGWDQK  G    T+Y++VFTQARE++K  K++L
Sbjct  10   PTKSSVPQFGGWDQKAPGA---TDYSMVFTQARENKKHQKTDL  49



>ref|XP_007213346.1| hypothetical protein PRUPE_ppa027227mg, partial [Prunus persica]
 gb|EMJ14545.1| hypothetical protein PRUPE_ppa027227mg, partial [Prunus persica]
Length=87

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +2

Query  80   RSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R SVPQFGGWDQ    G + TNYT+VFTQAR +RKQ+K++L
Sbjct  4    RRSVPQFGGWDQ---NGPDPTNYTVVFTQARANRKQNKTDL  41



>emb|CBI24266.3| unnamed protein product [Vitis vinifera]
Length=135

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +R+E+    SVPQFGGWDQK GG    TNY+++F+QAR ++KQ K+++
Sbjct  50   NRKEKNAWMSVPQFGGWDQKTGGA---TNYSMIFSQARANKKQQKADI  94



>ref|XP_002270722.1| PREDICTED: uncharacterized protein LOC100255134 [Vitis vinifera]
Length=88

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +R+E+    SVPQFGGWDQK GG    TNY+++F+QAR ++KQ K+++
Sbjct  3    NRKEKNAWMSVPQFGGWDQKTGGA---TNYSMIFSQARANKKQQKADI  47



>ref|XP_003617229.1| hypothetical protein MTR_5g089290 [Medicago truncatula]
 gb|AET00188.1| RPM1-interacting protein 4 (RIN4) family protein [Medicago truncatula]
Length=130

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 3/41 (7%)
 Frame = +2

Query  80   RSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +SSVPQFG WDQK  G    TNY++VFTQAR ++KQ K++L
Sbjct  12   KSSVPQFGAWDQKTMGA---TNYSMVFTQARANKKQQKTDL  49



>ref|XP_010247487.1| PREDICTED: uncharacterized protein LOC104590496 [Nelumbo nucifera]
Length=68

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGWDQK GG    T+Y++VF++AR +RKQ+K+++
Sbjct  2    SVPQFGGWDQKAGG---ATDYSMVFSRARANRKQNKADI  37



>ref|XP_010034258.1| PREDICTED: uncharacterized protein LOC104423469 [Eucalyptus grandis]
 gb|KCW51078.1| hypothetical protein EUGRSUZ_J00684 [Eucalyptus grandis]
Length=84

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGWD K  G    T+Y++VFT+AR +RKQHKS++
Sbjct  12   SVPQFGGWDHKAPGT---TDYSMVFTRARANRKQHKSDI  47



>ref|XP_007015258.1| RPM1-interacting protein 4 (RIN4) family protein, putative [Theobroma 
cacao]
 gb|EOY32877.1| RPM1-interacting protein 4 (RIN4) family protein, putative [Theobroma 
cacao]
Length=89

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 3/49 (6%)
 Frame = +2

Query  56   VHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
             HR E     SVPQFGGWDQK  G    T+Y++VF++AR +RKQ K+++
Sbjct  2    AHRTENNAWMSVPQFGGWDQKGPGA---TDYSMVFSRARANRKQQKTDI  47



>gb|KGN48091.1| hypothetical protein Csa_6G430670 [Cucumis sativus]
Length=133

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R+E  R  SVP+FGGWD    G    +NY++VFTQAR DRKQ K++L
Sbjct  4    RKENNRWRSVPEFGGWDHNAPGA---SNYSVVFTQARADRKQQKTDL  47



>ref|XP_006575621.1| PREDICTED: uncharacterized protein LOC102667968 [Glycine max]
Length=109

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +E RP   SVPQFGGWDQ + G     +YT++FTQARE++K  K+ L
Sbjct  4    QEIRPPVMSVPQFGGWDQNEPGA---IDYTVMFTQARENKKHQKANL  47



>gb|KDP43175.1| hypothetical protein JCGZ_22727 [Jatropha curcas]
Length=83

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 52/107 (49%), Gaps = 28/107 (26%)
 Frame = +2

Query  56   VHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSELpthppppppph  235
            + + E+   +SVPQFG WDQK  G    TNY++VF+QAR ++KQ K+++           
Sbjct  1    MEKREKNGWTSVPQFGAWDQKDPGA---TNYSVVFSQARANKKQQKTDI-----------  46

Query  236  isafsappphykqqhyqphhhqNTTFAAISEDASLKRKKWFLSYFSC  376
                           +    +Q    A  ++D S+ RKK  L+Y +C
Sbjct  47   --------------KHPGIGYQRVVIAPTTQDDSVLRKKKILTYINC  79



>ref|XP_008449643.1| PREDICTED: uncharacterized protein LOC103491464 isoform X1 [Cucumis 
melo]
Length=167

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R+E  R  SVP+FGGWD    G    +NY++VFT+AR DRKQ K++L
Sbjct  4    RKENNRWRSVPEFGGWDHNAPGA---SNYSVVFTRARADRKQQKTDL  47



>ref|XP_002871888.1| hypothetical protein ARALYDRAFT_488838 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48147.1| hypothetical protein ARALYDRAFT_488838 [Arabidopsis lyrata subsp. 
lyrata]
Length=99

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            + VPQFGGWDQK  G  + TNY++VF+QAR +RKQ+K+
Sbjct  11   TPVPQFGGWDQK--GPNDATNYSVVFSQARANRKQNKA  46



>ref|XP_008449644.1| PREDICTED: forkhead box protein G1 isoform X2 [Cucumis melo]
Length=124

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R+E  R  SVP+FGGWD    G    +NY++VFT+AR DRKQ K++L
Sbjct  4    RKENNRWRSVPEFGGWDHNAPGA---SNYSVVFTRARADRKQQKTDL  47



>ref|NP_001031906.1| RPM1-interacting protein 4 (RIN4) family protein [Arabidopsis 
thaliana]
 gb|AED92713.1| RPM1-interacting protein 4 (RIN4) family protein [Arabidopsis 
thaliana]
Length=99

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            R E    + VPQFGGWDQK  G  + TNY++VF++AR +RKQ+K+
Sbjct  4    RRENAAWTPVPQFGGWDQK--GPNDATNYSVVFSKARANRKQNKA  46



>ref|XP_006286609.1| hypothetical protein CARUB_v10002334mg [Capsella rubella]
 gb|EOA19507.1| hypothetical protein CARUB_v10002334mg [Capsella rubella]
Length=96

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = +2

Query  68   ERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            + P  + VPQFGGWDQ   G  E TNY++VF++AR +RKQ+K+
Sbjct  3    QNPGWTPVPQFGGWDQ--NGPNEATNYSVVFSKARANRKQNKA  43



>ref|XP_010313243.1| PREDICTED: uncharacterized protein LOC104644747 [Solanum lycopersicum]
Length=74

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFG W+QK       TNY++VF+QAR +RK+HKS+L
Sbjct  2    SVPQFGEWEQKTPSE---TNYSMVFSQARANRKKHKSDL  37



>ref|XP_007146139.1| hypothetical protein PHAVU_006G015600g [Phaseolus vulgaris]
 gb|ESW18133.1| hypothetical protein PHAVU_006G015600g [Phaseolus vulgaris]
Length=114

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            RE++  + SVPQFGGW+ K GG    T+Y++VF+QAR ++K  K++L
Sbjct  4    REKKATKMSVPQFGGWEHKSGG--VPTDYSMVFSQARANKKTQKTDL  48



>ref|XP_011036392.1| PREDICTED: uncharacterized protein LOC105133931 [Populus euphratica]
Length=84

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFG WD K       TNY++VFT+AR +RKQHKS++
Sbjct  11   SVPQFGAWDSKNPVP---TNYSMVFTRARANRKQHKSDV  46



>ref|XP_002314011.2| hypothetical protein POPTR_0009s07190g [Populus trichocarpa]
 gb|EEE87966.2| hypothetical protein POPTR_0009s07190g [Populus trichocarpa]
Length=102

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFG WD K       TNY++VFT+AR +RKQHKS++
Sbjct  29   SVPQFGAWDSKNPVP---TNYSMVFTRARANRKQHKSDV  64



>ref|XP_010931824.1| PREDICTED: uncharacterized protein LOC105052643 isoform X1 [Elaeis 
guineensis]
Length=115

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/46 (46%), Positives = 34/46 (74%), Gaps = 4/46 (9%)
 Frame = +2

Query  65   EERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +E+    +VPQFGGWDQK G      +Y++VF++AR +R+Q+K+E+
Sbjct  5    KEKNTWMAVPQFGGWDQKTGA----MDYSMVFSKARANRQQYKNEI  46



>gb|AFK43661.1| unknown [Lotus japonicus]
Length=110

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = +2

Query  56   VHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            + R+++P + SVPQFGGW+ K  G    T+Y++VF QAR ++K  K++L
Sbjct  1    MDRKKKPAKMSVPQFGGWEHKAQGVP--TDYSMVFNQARANKKNQKTDL  47



>ref|XP_009588910.1| PREDICTED: uncharacterized protein LOC104086369 isoform X1 [Nicotiana 
tomentosiformis]
Length=324

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 6/51 (12%)
 Frame = +2

Query  59   HREERPRRS---SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            HR+  P R+   SVPQFG WDQK       TNY++VF+QAR +RK HKS+L
Sbjct  240  HRDVSPMRTGWLSVPQFGEWDQKTPSE---TNYSVVFSQARANRKHHKSDL  287



>ref|XP_006369649.1| hypothetical protein POPTR_0001s28010g [Populus trichocarpa]
 gb|ERP66218.1| hypothetical protein POPTR_0001s28010g [Populus trichocarpa]
Length=84

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 48/97 (49%), Gaps = 27/97 (28%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSELpthppppppphisafsappph  265
            SVPQFGGW+ K       T+Y++VFTQAR +R+QHKS++           ++A       
Sbjct  11   SVPQFGGWNSK---NPVPTDYSVVFTQARANRRQHKSDVRHASLGNERELLAA-------  60

Query  266  ykqqhyqphhhqNTTFAAISEDASLKRKKWFLSYFSC  376
                            A   ED+ +KRKK FL+Y +C
Sbjct  61   ----------------ANQQEDSVMKRKK-FLTYINC  80



>ref|XP_009588911.1| PREDICTED: uncharacterized protein LOC104086369 isoform X2 [Nicotiana 
tomentosiformis]
Length=320

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 6/51 (12%)
 Frame = +2

Query  59   HREERPRRS---SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            HR+  P R+   SVPQFG WDQK       TNY++VF+QAR +RK HKS+L
Sbjct  236  HRDVSPMRTGWLSVPQFGEWDQKTPSE---TNYSVVFSQARANRKHHKSDL  283


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 5/48 (10%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            H+E+RP   SVPQFG WDQK GG  +C     V  QAR D+K+HK ++
Sbjct  123  HQEKRP--MSVPQFGVWDQKSGGSPDCAK---VPPQARADKKRHKHDI  165



>ref|XP_011090174.1| PREDICTED: uncharacterized protein LOC105170933 [Sesamum indicum]
Length=155

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 5/39 (13%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVP+FGGWD     G+  TNY++VF+QAR ++K+HKSEL
Sbjct  11   SVPEFGGWD-----GKSETNYSVVFSQARANKKKHKSEL  44


 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGWD   G  +  TNY++VFT AR  +K+HKSEL
Sbjct  75   SVPQFGGWD---GKAQNETNYSVVFTHARAHKKKHKSEL  110



>ref|XP_006356391.1| PREDICTED: uncharacterized protein LOC102601745 [Solanum tuberosum]
Length=135

 Score = 50.1 bits (118),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 36/51 (71%), Gaps = 6/51 (12%)
 Frame = +2

Query  59   HREERPRRS---SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            HR+  P ++   SVPQFG W+QK       TNY++VF+QAR +RK+HKS+L
Sbjct  51   HRDVSPMKTGWMSVPQFGEWEQKTPSE---TNYSMVFSQARANRKKHKSDL  98



>ref|XP_010519820.1| PREDICTED: lysine-specific demethylase 7A [Tarenaya hassleriana]
Length=108

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (65%), Gaps = 4/51 (8%)
 Frame = +2

Query  50   MDVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            MD  RE   R + VPQFG WDQ        T+Y++VF+QAR +RKQHK+ +
Sbjct  1    MDKKRES-VRWAPVPQFGAWDQNSAVA---TDYSVVFSQARANRKQHKANV  47



>ref|XP_007141510.1| hypothetical protein PHAVU_008G202100g [Phaseolus vulgaris]
 gb|ESW13504.1| hypothetical protein PHAVU_008G202100g [Phaseolus vulgaris]
Length=101

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVP+FGGWDQ+  G    TNY++VFTQ R+++K  K+ L
Sbjct  12   SVPKFGGWDQEAPGA---TNYSMVFTQVRQNKKHKKTSL  47



>ref|XP_009794992.1| PREDICTED: uncharacterized protein LOC104241759 [Nicotiana sylvestris]
Length=129

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFG WDQK       TNY++VF+QAR +RK HKS+L
Sbjct  57   SVPQFGEWDQKTPSE---TNYSVVFSQARANRKHHKSDL  92



>ref|XP_010931825.1| PREDICTED: uncharacterized protein LOC105052643 isoform X2 [Elaeis 
guineensis]
Length=87

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 31/39 (79%), Gaps = 4/39 (10%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +VPQFGGWDQK G      +Y++VF++AR +R+Q+K+E+
Sbjct  12   AVPQFGGWDQKTGA----MDYSMVFSKARANRQQYKNEI  46



>gb|KFK26209.1| hypothetical protein AALP_AA8G216800 [Arabis alpina]
Length=99

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 3/45 (7%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            R E    + VPQFGGWDQ    G + TNY++VF++AR +RKQ+K+
Sbjct  4    RRENAGWTPVPQFGGWDQH---GSDATNYSVVFSKARANRKQNKA  45



>emb|CDX70878.1| BnaC03g09620D [Brassica napus]
Length=98

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 3/40 (8%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            + VPQFGGWDQK   G + T+Y++VFT+AR +RK +K+++
Sbjct  11   TPVPQFGGWDQK---GIDATDYSVVFTKARANRKLNKADV  47



>ref|XP_010454225.1| PREDICTED: uncharacterized protein LOC104736013 [Camelina sativa]
Length=98

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            + VPQFGGWDQ   G  + TNY++VF++AR +RKQ+K+ L
Sbjct  10   TPVPQFGGWDQ--NGPNDETNYSVVFSKARANRKQNKAGL  47



>gb|AFK33855.1| unknown [Lotus japonicus]
Length=118

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 3/40 (8%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            ++VPQFGGWDQ   G    T+Y++VFTQAR  +KQ K +L
Sbjct  11   TTVPQFGGWDQSAPGA---TDYSMVFTQARAKKKQQKIDL  47



>gb|EPS59770.1| hypothetical protein M569_15036 [Genlisea aurea]
Length=103

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 5/51 (10%)
 Frame = +2

Query  50   MDVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            MD HR +R    SVP+FG WD K     E TNY++ F++AR +RK+HK +L
Sbjct  1    MDNHRGDRI---SVPRFGAWDGKTRS--EITNYSMAFSEARANRKKHKHQL  46



>emb|CDX88889.1| BnaA03g07600D [Brassica napus]
Length=95

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 32/40 (80%), Gaps = 3/40 (8%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            + VPQFGGWDQK   G + T+Y++VFT+AR +RK +K+++
Sbjct  7    TPVPQFGGWDQK---GIDATDYSVVFTKARANRKLNKADV  43



>ref|XP_009131739.1| PREDICTED: uncharacterized protein LOC103856382 [Brassica rapa]
Length=99

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 3/47 (6%)
 Frame = +2

Query  62   REERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            R E    + VPQFGGWDQK   G + T+Y++VFT+AR +RK +K+++
Sbjct  4    RRENAGWTPVPQFGGWDQK---GIDATDYSVVFTKARANRKLNKADV  47



>ref|XP_007148389.1| hypothetical protein PHAVU_006G204500g [Phaseolus vulgaris]
 ref|XP_007148390.1| hypothetical protein PHAVU_006G204500g [Phaseolus vulgaris]
 gb|ESW20383.1| hypothetical protein PHAVU_006G204500g [Phaseolus vulgaris]
 gb|ESW20384.1| hypothetical protein PHAVU_006G204500g [Phaseolus vulgaris]
Length=106

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGWDQ+  G    T+Y++VFTQAR ++K  K+ +
Sbjct  11   SVPQFGGWDQRAPGD---TDYSMVFTQARANKKHQKTNI  46



>ref|XP_004513236.1| PREDICTED: kininogen-1-like [Cicer arietinum]
Length=128

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = +2

Query  80   RSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            + SVPQFGGW+ K  G    T+Y++VF  ARE++K HK++L
Sbjct  11   KMSVPQFGGWEHKPHG--VPTDYSMVFNMARENKKNHKTDL  49



>ref|XP_010420753.1| PREDICTED: uncharacterized protein LOC104706276 [Camelina sativa]
Length=98

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            + VPQFGGWDQ   G  + TNY++VF++AR +RKQ+K+
Sbjct  10   TPVPQFGGWDQ--NGPNDETNYSVVFSKARANRKQNKA  45



>ref|XP_006470526.1| PREDICTED: uncharacterized protein LOC102626760 [Citrus sinensis]
Length=84

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +R+E+    +VPQFG WD K  G    T+Y++VF++AR +RKQ K+++
Sbjct  3    NRKEKNGLMTVPQFGAWDHKDPGA---TDYSMVFSRARANRKQQKADV  47



>gb|KHN38394.1| Dihydropyrimidinase [Glycine soja]
Length=583

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGWDQ + G     +YT++FTQARE++K  K+ L
Sbjct  2    SVPQFGGWDQNEPGA---IDYTVMFTQARENKKHQKANL  37



>ref|XP_006400507.1| hypothetical protein EUTSA_v10015114mg [Eutrema salsugineum]
 gb|ESQ41960.1| hypothetical protein EUTSA_v10015114mg [Eutrema salsugineum]
Length=98

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            + VPQFGGWDQK   G + TNY++VF++AR +RK  K
Sbjct  11   TPVPQFGGWDQK---GPDATNYSVVFSKARANRKLSK  44



>ref|XP_009120883.1| PREDICTED: uncharacterized protein LOC103845749 [Brassica rapa]
Length=102

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = +2

Query  50   MDVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            M+  RE     + VPQFGGWDQK   G + TNY++VF++AR +RK +K
Sbjct  1    MEKRRENNTGWNPVPQFGGWDQK---GSDETNYSVVFSKARANRKLNK  45



>ref|XP_006583972.1| PREDICTED: fe(2+) transport protein 3, chloroplastic-like [Glycine 
max]
Length=115

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = +2

Query  68   ERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            ++P + SVPQFGGW+ K  G    T+Y++VF QARE +K   ++L
Sbjct  6    KKPVKMSVPQFGGWEHKPAGVP--TDYSMVFNQAREKKKTQMNDL  48



>ref|XP_010099807.1| hypothetical protein L484_004382 [Morus notabilis]
 ref|XP_010108506.1| hypothetical protein L484_001258 [Morus notabilis]
 gb|EXB80475.1| hypothetical protein L484_004382 [Morus notabilis]
 gb|EXC19585.1| hypothetical protein L484_001258 [Morus notabilis]
Length=81

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 3/39 (8%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            SVPQFGGW+ K  G    T+Y++VF++AR +RKQ K++L
Sbjct  2    SVPQFGGWEHKSPG---RTDYSMVFSRARANRKQKKTDL  37



>emb|CDX85786.1| BnaA02g00270D [Brassica napus]
Length=113

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            SVPQFG WDQK GGG    +Y++ FT+ RE RKQ+K
Sbjct  14   SVPQFGDWDQKSGGG-AMPDYSMDFTKIREMRKQNK  48



>emb|CDY40070.1| BnaC02g00600D [Brassica napus]
Length=113

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            SVPQFG WDQK GGG    +Y++ FT+ RE RKQ+K
Sbjct  14   SVPQFGDWDQKSGGG-AMPDYSMDFTKIREMRKQNK  48



>ref|XP_006446312.1| hypothetical protein CICLE_v10018107mg [Citrus clementina]
 gb|ESR59552.1| hypothetical protein CICLE_v10018107mg [Citrus clementina]
Length=84

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = +2

Query  59   HREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            +R+E+    +VPQFG WDQK       T+Y++VF++AR +RKQ K+++
Sbjct  3    NRKEKNGLMTVPQFGAWDQK---DPRATDYSMVFSRARANRKQQKADV  47



>ref|XP_010493018.1| PREDICTED: uncharacterized protein LOC104770311 isoform X2 [Camelina 
sativa]
Length=98

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            + VPQFGGWDQ   G  + TNY++VF++AR +RKQ+K+
Sbjct  10   TPVPQFGGWDQI--GPNDETNYSVVFSKARANRKQNKA  45



>ref|XP_009125337.1| PREDICTED: uncharacterized protein LOC103850350 [Brassica rapa]
Length=113

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 1/36 (3%)
 Frame = +2

Query  86   SVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            SVPQFG WDQK GGG    +Y++ FT+ RE RKQ+K
Sbjct  14   SVPQFGDWDQKSGGG-AMPDYSMDFTKIREMRKQNK  48



>ref|XP_010493016.1| PREDICTED: uncharacterized protein LOC104770311 isoform X1 [Camelina 
sativa]
Length=98

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = +2

Query  83   SSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKS  196
            + VPQFGGWDQ   G  + TNY++VF++AR +RKQ+K+
Sbjct  10   TPVPQFGGWDQI--GPNDETNYSVVFSKARANRKQNKA  45



>gb|KEH33367.1| RPM1-interacting protein 4 (RIN4) family protein, putative [Medicago 
truncatula]
Length=150

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = +2

Query  80   RSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSE  199
            + SVPQFGGW+ K  G    T+Y++VF  ARE++K HK++
Sbjct  51   KMSVPQFGGWENKSKGVP--TDYSMVFNIARENKKNHKTD  88



>emb|CDY14003.1| BnaC09g38230D [Brassica napus]
Length=125

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 3/35 (9%)
 Frame = +2

Query  89   VPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHK  193
            VPQFGGWDQK   G + TNY++VF++AR +RK +K
Sbjct  37   VPQFGGWDQK---GSDETNYSVVFSKARANRKLNK  68



>ref|XP_010673773.1| PREDICTED: uncharacterized protein LOC104890102 [Beta vulgaris 
subsp. vulgaris]
Length=94

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 4/51 (8%)
 Frame = +2

Query  50   MDVHREERPRRSSVPQFGGWDQKKGGGEECTNYTLVFTQAREDRKQHKSEL  202
            M+ H +++ R++ VPQFG W+ K G   E +NY++VF+QAR  RKQ K+ +
Sbjct  1    MERHGKDKGRKA-VPQFGAWEHKGG---ESSNYSVVFSQARAHRKQAKTVI  47



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533345884428