BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81877_g1_i1 len=849 path=[827:0-848]

Length=849
                                                                      Score     E

gb|ADV02768.1|  putative low temperature and salt responsive prot...  74.7    5e-14   
ref|XP_006428345.1|  hypothetical protein CICLE_v10013710mg           71.6    2e-12   
ref|XP_006480341.1|  PREDICTED: hydrophobic protein LTI6B-like is...  69.7    4e-12   
ref|XP_003554596.1|  PREDICTED: hydrophobic protein LTI6A-like        69.7    4e-12   
ref|XP_010271058.1|  PREDICTED: hydrophobic protein RCI2B             69.7    4e-12   
gb|KHG20782.1|  Hydrophobic RCI2B -like protein                       69.3    5e-12   
ref|XP_004230367.1|  PREDICTED: hydrophobic protein LTI6A             69.3    5e-12   
ref|XP_010694119.1|  PREDICTED: hydrophobic protein LTI6A             69.3    6e-12   
ref|XP_007031274.1|  Stress-induced hydrophobic peptide               69.3    6e-12   
ref|XP_007163285.1|  hypothetical protein PHAVU_001G221700g           68.9    8e-12   
ref|XP_011087564.1|  PREDICTED: hydrophobic protein RCI2B             68.6    1e-11   
ref|XP_009589211.1|  PREDICTED: hydrophobic protein LTI6A-like is...  68.9    1e-11   
ref|XP_009589212.1|  PREDICTED: hydrophobic protein LTI6A-like is...  68.6    1e-11   
ref|XP_006428346.1|  hypothetical protein CICLE_v10013304mg           68.2    2e-11   
ref|XP_010094907.1|  Hydrophobic protein LTI6A                        67.8    2e-11   
gb|ACU14699.1|  unknown                                               67.4    3e-11   Glycine max [soybeans]
ref|XP_002512586.1|  Hydrophobic protein LTI6A, putative              66.6    5e-11   Ricinus communis
ref|XP_009412350.1|  PREDICTED: hydrophobic protein RCI2B             66.2    7e-11   
gb|ACA66247.1|  cold-induced plasma membrane protein                  66.2    7e-11   Musa ABB Group [cooking banana]
gb|AFK38849.1|  unknown                                               65.9    1e-10   
ref|NP_001060390.1|  Os07g0635900                                     65.9    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009799132.1|  PREDICTED: hydrophobic protein LTI6A-like        65.5    1e-10   
ref|XP_009616085.1|  PREDICTED: hydrophobic protein LTI6A-like        65.5    1e-10   
ref|XP_003536025.1|  PREDICTED: hydrophobic protein LTI6A-like        65.5    1e-10   
ref|NP_187240.1|  Hydrophobic protein RCI2B                           65.5    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ACU14391.1|  unknown                                               65.5    2e-10   Glycine max [soybeans]
gb|ACU14681.1|  unknown                                               65.5    2e-10   Glycine max [soybeans]
ref|XP_007206183.1|  hypothetical protein PRUPE_ppa013857mg           66.2    2e-10   
ref|XP_003555775.2|  PREDICTED: hydrophobic protein LTI6A             66.2    2e-10   
ref|XP_009611658.1|  PREDICTED: hydrophobic protein RCI2B-like        65.1    2e-10   
ref|XP_006358521.1|  PREDICTED: hydrophobic protein LTI6A-like        65.1    2e-10   
gb|EAY73580.1|  hypothetical protein OsI_01464                        65.1    2e-10   Oryza sativa Indica Group [Indian rice]
gb|ACV50425.1|  cold induced plasma membrane protein                  65.1    2e-10   Jatropha curcas
ref|XP_010040900.1|  PREDICTED: hydrophobic protein LTI6B-like        64.7    2e-10   
gb|AAQ84111.1|  Clt1                                                  64.7    3e-10   Citrus trifoliata [hardy orange]
ref|XP_010070102.1|  PREDICTED: hydrophobic protein LTI6A-like        64.7    3e-10   
ref|XP_004230366.1|  PREDICTED: hydrophobic protein LTI6A             64.7    3e-10   
ref|XP_010040901.1|  PREDICTED: hydrophobic protein LTI6B-like        64.7    3e-10   
ref|XP_002884539.1|  low temperature and salt responsive protein ...  65.1    3e-10   
ref|XP_009417776.1|  PREDICTED: hydrophobic protein LTI6B             64.7    3e-10   
ref|XP_009366021.1|  PREDICTED: hydrophobic protein RCI2B             64.7    3e-10   
gb|AAF26091.1|AC012393_17  low temperature and salt responsive pr...  64.7    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009366018.1|  PREDICTED: hydrophobic protein RCI2A-like        64.7    3e-10   
gb|AHL20265.1|  stress-induced protein                                64.7    3e-10   
ref|XP_004494505.1|  PREDICTED: hydrophobic protein LTI6B-like        64.3    4e-10   
ref|XP_008776672.1|  PREDICTED: hydrophobic protein RCI2B-like        64.3    4e-10   
gb|AFI47457.1|  low temperature and salt responsive protein           63.9    5e-10   
gb|ABD33207.2|  Protein of unknown function UPF0057                   63.9    5e-10   Medicago truncatula
ref|XP_008370335.1|  PREDICTED: hydrophobic protein RCI2A             63.9    6e-10   
ref|XP_008776670.1|  PREDICTED: hydrophobic protein LTI6B             63.9    6e-10   
ref|XP_004967634.1|  PREDICTED: hydrophobic protein LTI6B-like is...  63.9    7e-10   
ref|NP_001151840.1|  hydrophobic protein LTI6B                        63.5    7e-10   Zea mays [maize]
ref|XP_002993149.1|  hypothetical protein SELMODRAFT_136629           63.5    7e-10   
ref|XP_004967637.1|  PREDICTED: hydrophobic protein LTI6B-like is...  63.5    7e-10   
ref|XP_003626132.1|  Hydrophobic protein LTI6A                        63.5    8e-10   
gb|EPS73096.1|  stress-induced hydrophobic peptide                    63.5    8e-10   
gb|EYU19377.1|  hypothetical protein MIMGU_mgv1a0175922mg             63.5    9e-10   
ref|XP_002884538.1|  predicted protein                                63.5    9e-10   
ref|XP_010674472.1|  PREDICTED: hydrophobic protein RCI2B             63.2    9e-10   
gb|AEJ20974.1|  cold-inducible protein                                63.2    1e-09   
gb|AFC41201.1|  PM-YC3.6-Lti6b                                        68.6    1e-09   
ref|XP_002279333.3|  PREDICTED: hydrophobic protein LTI6A             63.2    1e-09   Vitis vinifera
ref|NP_001147508.1|  LOC100281117                                     63.2    1e-09   Zea mays [maize]
gb|EYU35366.1|  hypothetical protein MIMGU_mgv1a017610mg              63.2    1e-09   
ref|XP_008246326.1|  PREDICTED: hydrophobic protein LTI6B-like        63.2    1e-09   
ref|XP_004967635.1|  PREDICTED: hydrophobic protein LTI6B-like is...  62.8    1e-09   
ref|NP_001147403.1|  hydrophobic protein LTI6A                        62.8    1e-09   Zea mays [maize]
ref|XP_006658870.1|  PREDICTED: pentatricopeptide repeat-containi...  68.2    1e-09   
ref|XP_004958446.1|  PREDICTED: hydrophobic protein LTI6A-like        62.8    1e-09   
ref|XP_010035796.1|  PREDICTED: hydrophobic protein RCI2B             62.8    1e-09   
ref|XP_009414164.1|  PREDICTED: hydrophobic protein LTI6B-like        62.8    2e-09   
ref|XP_007207409.1|  hypothetical protein PRUPE_ppa014548mg           62.8    2e-09   
ref|XP_008246327.1|  PREDICTED: hydrophobic protein RCI2B             62.8    2e-09   
ref|XP_003626135.1|  Hydrophobic protein LTI6B                        63.2    2e-09   
gb|AFP99877.1|  plasma membrane protein Am244                         62.8    2e-09   
ref|XP_006408015.1|  hypothetical protein EUTSA_v10021802mg           63.9    2e-09   
gb|KCW82305.1|  hypothetical protein EUGRSUZ_C03713                   64.3    2e-09   
ref|XP_009774465.1|  PREDICTED: hydrophobic protein RCI2B             62.4    2e-09   
gb|KCW44804.1|  hypothetical protein EUGRSUZ_L01633                   63.9    2e-09   
tpg|DAA41564.1|  TPA: hypothetical protein ZEAMMB73_862570            62.4    2e-09   
ref|NP_001054591.1|  Os05g0138300                                     62.4    2e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003568974.1|  PREDICTED: hydrophobic protein LTI6B             62.4    2e-09   
tpg|DAA41563.1|  TPA: hypothetical protein ZEAMMB73_862570            62.4    2e-09   
ref|NP_187239.1|  Hydrophobic protein RCI2A                           62.0    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EAY96485.1|  hypothetical protein OsI_18385                        62.8    3e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004302327.1|  PREDICTED: hydrophobic protein RCI2A-like        62.0    3e-09   
gb|AFK81273.1|  rare cold-inducible protein 2A                        61.6    4e-09   
gb|AAV88601.1|  low temperature and salt responsive protein           61.6    4e-09   Cenchrus americanus [bulrush millet]
gb|ABK22915.1|  unknown                                               61.2    5e-09   Picea sitchensis
gb|ADK27677.1|  plasma membrane protein 3-2                           61.2    5e-09   
ref|XP_003626131.1|  Hydrophobic protein RCI2B                        61.2    5e-09   
emb|CDX80578.1|  BnaC07g28660D                                        61.6    6e-09   
ref|XP_004302326.1|  PREDICTED: hydrophobic protein RCI2A-like        61.2    6e-09   
ref|NP_001152633.1|  hydrophobic protein LTI6A                        60.8    8e-09   Zea mays [maize]
ref|XP_008370336.1|  PREDICTED: hydrophobic protein RCI2A-like        60.8    9e-09   
ref|NP_001107634.1|  LOC100135422                                     60.8    9e-09   Zea mays [maize]
gb|ADC45381.1|  stress-induced hydrophobic peptide                    60.5    1e-08   
gb|ACN26849.1|  unknown                                               60.5    1e-08   Zea mays [maize]
dbj|BAG54793.1|  plasma membrance protein3                            60.5    1e-08   Puccinellia tenuiflora
ref|XP_009134856.1|  PREDICTED: hydrophobic protein RCI2A-like        60.5    1e-08   
gb|ACH60980.1|  rare cold inducible protein                           60.5    1e-08   Pseudotsuga menziesii
gb|ACH60977.1|  rare cold inducible protein                           60.5    1e-08   Pseudotsuga menziesii
dbj|BAD34658.1|  plasma membrane protein 3                            60.1    1e-08   Leymus chinensis
gb|ABQ41924.1|  low temperature and salt responsive protein           60.1    1e-08   Sonneratia alba
ref|XP_011092211.1|  PREDICTED: hydrophobic protein RCI2A-like is...  60.1    1e-08   
ref|XP_002440557.1|  hypothetical protein SORBIDRAFT_09g003060        60.1    1e-08   Sorghum bicolor [broomcorn]
ref|XP_003557909.1|  PREDICTED: hydrophobic protein LTI6A             60.1    2e-08   
ref|NP_001232820.1|  hydrophobic protein LTI6A                        60.1    2e-08   
emb|CDY49985.1|  BnaC03g34420D                                        60.1    2e-08   
gb|ADE77881.1|  unknown                                               59.7    2e-08   
emb|CDM82662.1|  unnamed protein product                              60.1    2e-08   
gb|ACH61000.1|  rare cold inducible protein                           60.1    2e-08   Pseudotsuga macrocarpa
ref|XP_006382256.1|  hypothetical protein POPTR_0005s00390g           59.7    2e-08   
ref|XP_002993150.1|  hypothetical protein SELMODRAFT_229736           59.3    2e-08   
ref|XP_011092210.1|  PREDICTED: hydrophobic protein RCI2A-like is...  59.7    3e-08   
ref|XP_002964158.1|  hypothetical protein SELMODRAFT_227480           58.9    3e-08   
ref|XP_004960430.1|  PREDICTED: hydrophobic protein LTI6B-like        58.9    4e-08   
ref|XP_009365456.1|  PREDICTED: hydrophobic protein RCI2B-like        58.9    4e-08   
ref|XP_008350586.1|  PREDICTED: hydrophobic protein RCI2B-like        58.5    5e-08   
ref|XP_002440556.1|  hypothetical protein SORBIDRAFT_09g003050        58.5    6e-08   Sorghum bicolor [broomcorn]
ref|XP_001765492.1|  predicted protein                                58.5    6e-08   
gb|ACJ09619.1|  putative low temperature and salt responsive protein  58.5    7e-08   Cupressus sempervirens
gb|ABK96638.1|  unknown                                               58.2    8e-08   Populus trichocarpa x Populus deltoides
ref|XP_002318921.1|  hypothetical protein POPTR_0013s00340g           57.4    1e-07   Populus trichocarpa [western balsam poplar]
ref|NP_001050200.1|  Os03g0370600                                     57.4    2e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008445856.1|  PREDICTED: low temperature-induced protein l...  56.6    3e-07   
ref|XP_004143609.1|  PREDICTED: hydrophobic protein RCI2A-like        56.6    3e-07   
ref|XP_006375710.1|  hypothetical protein POPTR_0013s00340g           56.6    3e-07   
gb|EAY90184.1|  hypothetical protein OsI_11748                        56.6    3e-07   Oryza sativa Indica Group [Indian rice]
gb|ADD54613.1|  unknown                                               56.6    4e-07   Linum usitatissimum
ref|XP_004986964.1|  PREDICTED: hydrophobic protein LTI6A-like        56.2    4e-07   
ref|XP_009365454.1|  PREDICTED: hydrophobic protein RCI2B-like        55.5    8e-07   
ref|XP_004306234.1|  PREDICTED: hydrophobic protein LTI6A-like        55.5    8e-07   
gb|EMT05681.1|  Low temperature-induced protein                       55.1    1e-06   
gb|ADK27676.1|  plasma membrane protein 3-1                           55.1    1e-06   
ref|XP_009133311.1|  PREDICTED: low temperature-induced protein l...  54.7    2e-06   
sp|Q9ARD5.1|LT02_HORVU  RecName: Full=Low temperature-induced pro...  54.7    2e-06   Hordeum vulgare [barley]
gb|ACG48459.1|  hypothetical protein                                  54.3    2e-06   Zea mays [maize]
ref|XP_010667244.1|  PREDICTED: low temperature-induced protein l...  54.3    2e-06   
ref|XP_004984830.1|  PREDICTED: low temperature-induced protein l...  54.3    2e-06   
ref|XP_010694118.1|  PREDICTED: hydrophobic protein RCI2B-like        54.3    2e-06   
ref|NP_565897.1|  Low temperature and salt responsive protein         54.3    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004237520.1|  PREDICTED: salt stress-induced hydrophobic p...  54.3    2e-06   
dbj|BAG54794.1|  plasma membrance protein3                            53.9    2e-06   Puccinellia tenuiflora
ref|XP_002277985.1|  PREDICTED: low temperature-induced protein l...  53.9    2e-06   Vitis vinifera
ref|XP_001751863.1|  predicted protein                                53.9    3e-06   
ref|XP_007206184.1|  hypothetical protein PRUPE_ppa013857mg           47.8    3e-06   
ref|XP_008339336.1|  PREDICTED: hydrophobic protein RCI2B-like        53.9    3e-06   
ref|XP_010067264.1|  PREDICTED: low temperature-induced protein l...  53.9    3e-06   
ref|XP_009614515.1|  PREDICTED: salt stress-induced hydrophobic p...  53.5    3e-06   
ref|XP_008233373.1|  PREDICTED: low temperature-induced protein l...  53.5    3e-06   
ref|XP_009141770.1|  PREDICTED: salt stress-induced hydrophobic p...  53.5    3e-06   
ref|XP_008792165.1|  PREDICTED: low temperature-induced protein l...  53.5    3e-06   
ref|XP_006436212.1|  hypothetical protein CICLE_v10033283mg           53.5    3e-06   
gb|EPS71255.1|  stress-induced hydrophobic peptide                    53.1    5e-06   
ref|XP_001776246.1|  predicted protein                                53.5    5e-06   
ref|XP_008362678.1|  PREDICTED: low temperature-induced protein l...  53.1    5e-06   
ref|XP_008347209.1|  PREDICTED: salt stress-induced hydrophobic p...  53.1    6e-06   
gb|KEH25679.1|  low temperature and salt responsive family protein    52.8    7e-06   
ref|XP_002311114.1|  hydrophobic family protein                       52.8    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002465219.1|  hypothetical protein SORBIDRAFT_01g034350        53.1    7e-06   Sorghum bicolor [broomcorn]
ref|XP_010253524.1|  PREDICTED: low temperature-induced protein l...  52.8    7e-06   
ref|XP_002440508.1|  hypothetical protein SORBIDRAFT_09g002150        52.8    7e-06   Sorghum bicolor [broomcorn]
ref|XP_004137807.1|  PREDICTED: low temperature-induced protein l...  53.1    7e-06   
ref|XP_008369468.1|  PREDICTED: low temperature-induced protein l...  52.4    9e-06   
ref|XP_003558174.1|  PREDICTED: low temperature-induced protein l...  52.4    1e-05   
ref|XP_002278351.2|  PREDICTED: salt stress-induced hydrophobic p...  52.8    1e-05   Vitis vinifera
gb|ACG26760.1|  hypothetical protein                                  52.4    1e-05   Zea mays [maize]
ref|XP_004489845.1|  PREDICTED: hydrophobic protein RCI2A-like        52.0    1e-05   
ref|XP_002465426.1|  hypothetical protein SORBIDRAFT_01g038670        52.0    1e-05   Sorghum bicolor [broomcorn]
gb|EMT15831.1|  Low temperature-induced protein                       52.0    1e-05   
ref|XP_008789047.1|  PREDICTED: salt stress-induced hydrophobic p...  51.6    2e-05   
ref|XP_007151809.1|  hypothetical protein PHAVU_004G076700g           51.6    2e-05   
ref|XP_010244973.1|  PREDICTED: low temperature-induced protein l...  51.2    3e-05   
ref|XP_011077044.1|  PREDICTED: salt stress-induced hydrophobic p...  50.8    4e-05   
ref|XP_009380674.1|  PREDICTED: salt stress-induced hydrophobic p...  50.8    4e-05   
ref|XP_008355643.1|  PREDICTED: salt stress-induced hydrophobic p...  50.8    4e-05   
ref|XP_009409551.1|  PREDICTED: salt stress-induced hydrophobic p...  50.4    5e-05   
ref|NP_001049776.1|  Os03g0286900                                     50.4    5e-05   Oryza sativa Japonica Group [Japonica rice]
sp|P68178.1|ESI3_THIEL  RecName: Full=Salt stress-induced hydroph...  50.4    5e-05   Elymus elongatus [tall wheatgrass]
gb|AER00467.1|  BLT101                                                50.4    6e-05   
ref|XP_006382257.1|  hypothetical protein POPTR_0005s00400g           51.2    6e-05   
ref|XP_003524635.1|  PREDICTED: salt stress-induced hydrophobic p...  50.1    8e-05   
ref|XP_001764858.1|  predicted protein                                50.1    8e-05   
gb|AFW88281.1|  hypothetical protein ZEAMMB73_701475                  50.1    8e-05   
ref|XP_008376314.1|  PREDICTED: salt stress-induced hydrophobic p...  49.7    9e-05   
gb|KDP46158.1|  hypothetical protein JCGZ_06669                       49.7    9e-05   
gb|ACJ09630.1|  putative early drought-induced protein                50.1    1e-04   Cupressus sempervirens
dbj|BAD34659.1|  plasma membrane protein 3                            49.3    1e-04   Leymus chinensis
ref|XP_007145051.1|  hypothetical protein PHAVU_007G205900g           49.3    1e-04   
gb|KCW58686.1|  hypothetical protein EUGRSUZ_H01335                   49.7    2e-04   
gb|AAT77365.1|  putative drought induced protein                      48.5    2e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ADC67798.1|  hypothetical protein POPTRDRAFT_563785                48.5    2e-04   Populus balsamifera [balsam poplar]
dbj|BAK07288.1|  predicted protein                                    49.3    2e-04   
ref|XP_009618269.1|  PREDICTED: uncharacterized protein LOC104110473  49.7    4e-04   
ref|XP_008442650.1|  PREDICTED: low temperature-induced protein l...  48.1    4e-04   
ref|XP_003550093.1|  PREDICTED: hydrophobic protein RCI2A-like        47.4    6e-04   
emb|CDY31781.1|  BnaC01g27370D                                        47.4    6e-04   
ref|XP_009333742.1|  PREDICTED: salt stress-induced hydrophobic p...  47.4    6e-04   
ref|XP_006843259.1|  hypothetical protein AMTR_s00080p00112800        47.8    6e-04   
ref|XP_006298933.1|  hypothetical protein CARUB_v10015055mg           47.4    6e-04   
ref|XP_010668344.1|  PREDICTED: salt stress-induced hydrophobic p...  47.0    7e-04   
ref|XP_009113358.1|  PREDICTED: UPF0057 membrane protein At1g57550    47.0    8e-04   
gb|EPS65277.1|  hypothetical protein M569_09505                       47.0    9e-04   



>gb|ADV02768.1| putative low temperature and salt responsive protein isoform 
1 [Ipomoea batatas]
 gb|ADV02769.1| putative low temperature and salt responsive protein isoform 
2 [Ipomoea batatas]
Length=57

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/39 (90%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            GSTATC+DILLAI+LPPLGVFLKFGC++EFWICCLLTLF
Sbjct  4    GSTATCIDILLAIILPPLGVFLKFGCQVEFWICCLLTLF  42



>ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina]
 gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina]
Length=104

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            GSTATCVDILLA++LPPLGVFLKFGCK EFWIC LLT+
Sbjct  50   GSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTI  87



>ref|XP_006480341.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Citrus 
sinensis]
 ref|XP_006480342.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Citrus 
sinensis]
 gb|KDO56403.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis]
 gb|KDO56404.1| hypothetical protein CISIN_1g035437mg [Citrus sinensis]
Length=58

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            GSTATCVDILLA++LPPLGVFLKFGCK EFWIC LLT+
Sbjct  4    GSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTI  41



>ref|XP_003554596.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max]
 gb|KHN14207.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATC+DILLAI+LPPLGVFLK+GCK+EFWIC +LTLF
Sbjct  5    STATCIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF  42



>ref|XP_010271058.1| PREDICTED: hydrophobic protein RCI2B [Nelumbo nucifera]
Length=57

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DILLAI+LPPLGVFLKFGCK+EFWIC LLTLF
Sbjct  5    GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTLF  42



>gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum]
Length=57

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATC+DILLAI+LPPLGVFLKFGC++EFWIC +LTLF
Sbjct  5    STATCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF  42



>ref|XP_004230367.1| PREDICTED: hydrophobic protein LTI6A [Solanum lycopersicum]
 ref|XP_006358520.1| PREDICTED: hydrophobic protein LTI6A-like [Solanum tuberosum]
 dbj|BAC23051.1| low temperature and salt responsive protein [Solanum tuberosum]
Length=56

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST TCVDILLAI+LPPLGVFLKFGCK+EFWIC LLTLF
Sbjct  4    STMTCVDILLAIILPPLGVFLKFGCKVEFWICVLLTLF  41



>ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris]
Length=56

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATC+DILLAI+LPPLGVFLKFGCK+EFWIC +LT F
Sbjct  4    STATCIDILLAIILPPLGVFLKFGCKVEFWICLVLTFF  41



>ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobroma cacao]
 gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao]
Length=58

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATCVDILLAI+LPPLGVFLK+GC++EFWIC +LTLF
Sbjct  5    STATCVDILLAIILPPLGVFLKYGCEVEFWICLVLTLF  42



>ref|XP_007163285.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris]
 gb|ESW35279.1| hypothetical protein PHAVU_001G221700g [Phaseolus vulgaris]
Length=57

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            GSTATC+DILLAI+LPPLGVFLK GCK+EFWIC LLT+
Sbjct  4    GSTATCIDILLAIILPPLGVFLKHGCKVEFWICLLLTI  41



>ref|XP_011087564.1| PREDICTED: hydrophobic protein RCI2B [Sesamum indicum]
Length=57

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DILLAI+LPPLGVFLKFGCK+EFWIC LLT+F
Sbjct  4    GTATCIDILLAIILPPLGVFLKFGCKVEFWICLLLTIF  41



>ref|XP_009589211.1| PREDICTED: hydrophobic protein LTI6A-like isoform X1 [Nicotiana 
tomentosiformis]
Length=75

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST TCVDILLAI+LPPLGVFLKFGC++EFWIC LLTLF
Sbjct  4    STMTCVDILLAIILPPLGVFLKFGCQVEFWICVLLTLF  41



>ref|XP_009589212.1| PREDICTED: hydrophobic protein LTI6A-like isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009774466.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana sylvestris]
Length=56

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST TCVDILLAI+LPPLGVFLKFGC++EFWIC LLTLF
Sbjct  4    STMTCVDILLAIILPPLGVFLKFGCQVEFWICVLLTLF  41



>ref|XP_006428346.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 ref|XP_006428347.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 ref|XP_006480340.1| PREDICTED: hydrophobic protein LTI6A-like [Citrus sinensis]
 gb|ESR41586.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 gb|ESR41587.1| hypothetical protein CICLE_v10013304mg [Citrus clementina]
 gb|KDO56401.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis]
 gb|KDO56402.1| hypothetical protein CISIN_1g035460mg [Citrus sinensis]
Length=58

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI+LAI+LPPLGVFLKFGCK+EFWIC LLT+F
Sbjct  5    GTATCIDIILAIILPPLGVFLKFGCKVEFWICLLLTIF  42



>ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis]
 gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis]
Length=57

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 37/42 (88%), Gaps = 0/42 (0%)
 Frame = -2

Query  644  IKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ++   +ATCVDILLAI+LPPLGVFLKFGC+ EFWIC LLTLF
Sbjct  1    MRGQGSATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLF  42



>gb|ACU14699.1| unknown [Glycine max]
Length=57

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT +DILLAI+LPPLGVFLK+GCK+EFWIC +LTLF
Sbjct  5    STATYIDILLAIILPPLGVFLKYGCKVEFWICLVLTLF  42



>ref|XP_002512586.1| Hydrophobic protein LTI6A, putative [Ricinus communis]
 gb|EEF50038.1| Hydrophobic protein LTI6A, putative [Ricinus communis]
Length=56

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              ATC+DILLAI+LPPLGVFLK+GCK+EFWIC +LTLF
Sbjct  4    GAATCIDILLAIILPPLGVFLKYGCKVEFWICLILTLF  41



>ref|XP_009412350.1| PREDICTED: hydrophobic protein RCI2B [Musa acuminata subsp. malaccensis]
Length=57

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C++ILLAI+LPPLGVFLKFGCK+EFWIC LLTLF
Sbjct  5    GTARCIEILLAIILPPLGVFLKFGCKVEFWICLLLTLF  42



>gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group]
Length=57

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C+DILLAI+LPPLGVFLKFGC++EFWIC LLTLF
Sbjct  5    GTANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLF  42



>gb|AFK38849.1| unknown [Lotus japonicus]
 gb|AFK49304.1| unknown [Lotus japonicus]
Length=54

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATCVDI+LAI+LPPLGVFL+FGCK+EFWIC LLT+
Sbjct  2    GTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTI  38



>ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group]
 sp|Q8H5T6.1|LTI6A_ORYSJ RecName: Full=Hydrophobic protein LTI6A; AltName: Full=Low temperature-induced 
protein 6A [Oryza sativa Japonica Group]
 dbj|BAC16385.1| putative low temperature and salt responsive protein [Oryza sativa 
Japonica Group]
 gb|AAS72305.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group]
 gb|AAT37941.1| low temperature-induced low molecular weight integral membrane 
protein LTI6a [Oryza sativa Japonica Group]
 dbj|BAF22304.1| Os07g0635900 [Oryza sativa Japonica Group]
 gb|EAZ04833.1| hypothetical protein OsI_27011 [Oryza sativa Indica Group]
 gb|EAZ40796.1| hypothetical protein OsJ_25274 [Oryza sativa Japonica Group]
 gb|ABR25530.1| hydrophobic protein lti6b [Oryza sativa Indica Group]
 dbj|BAH00311.1| unnamed protein product [Oryza sativa Japonica Group]
Length=56

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATC+DI+LAI+LPPLGVF KFGC IEFWIC LLT F
Sbjct  4    STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFF  41



>ref|XP_009799132.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana sylvestris]
Length=56

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
               TC+DILLAI+LPPLGVFLKFGCK EFWICCLLTLF
Sbjct  2    GAMTCIDILLAIILPPLGVFLKFGCKCEFWICCLLTLF  39



>ref|XP_009616085.1| PREDICTED: hydrophobic protein LTI6A-like [Nicotiana tomentosiformis]
Length=56

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
               TC+DILLAI+LPPLGVFLKFGCK EFWICCLLTLF
Sbjct  2    GAMTCIDILLAIILPPLGVFLKFGCKCEFWICCLLTLF  39



>ref|XP_003536025.1| PREDICTED: hydrophobic protein LTI6A-like [Glycine max]
 gb|KHN24195.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              ATC+DILLAI+LPPLGVFLK+GC++EFWIC +LTLF
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF  42



>ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana]
 sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature 
and salt-responsive protein LTI6B [Arabidopsis thaliana]
 gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis 
thaliana]
 gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana]
 gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana]
 gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive 
protein LTI6B) [Arabidopsis thaliana]
 dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|ABG25095.1| At3g05890 [Arabidopsis thaliana]
 dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
 gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana]
Length=54

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  2    STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF  39



>gb|ACU14391.1| unknown [Glycine max]
 gb|KHN26202.1| Hydrophobic protein LTI6A [Glycine soja]
Length=57

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              ATC+DILLAI+LPPLGVFLK+GC++EFWIC +LTLF
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF  42



>gb|ACU14681.1| unknown [Glycine max]
Length=57

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              ATC+DILLAI+LPPLGVFLK+GC++EFWIC +LTLF
Sbjct  5    GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF  42



>ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
 gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
Length=93

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 38/42 (90%), Gaps = 1/42 (2%)
 Frame = -2

Query  644  IKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            I+MG TAT VDI++AILLPPLGVFLKFGC+ EFWIC +LTLF
Sbjct  38   IRMG-TATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLF  78



>ref|XP_003555775.2| PREDICTED: hydrophobic protein LTI6A [Glycine max]
Length=104

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              ATC+DILLAI+LPPLGVFLK+GC++EFWIC +LTLF
Sbjct  52   GAATCIDILLAIILPPLGVFLKYGCQVEFWICLVLTLF  89



>ref|XP_009611658.1| PREDICTED: hydrophobic protein RCI2B-like [Nicotiana tomentosiformis]
Length=56

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            GST T +DILLAI+LPPLGVFLKFGC+ EFWIC LLTLF
Sbjct  3    GSTLTFIDILLAIILPPLGVFLKFGCEAEFWICVLLTLF  41



>ref|XP_006358521.1| PREDICTED: hydrophobic protein LTI6A-like [Solanum tuberosum]
Length=56

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST TC+DILLAI+LPPLGVFLKF C++EFWIC LLTLF
Sbjct  4    STMTCIDILLAIILPPLGVFLKFKCQVEFWICVLLTLF  41



>gb|EAY73580.1| hypothetical protein OsI_01464 [Oryza sativa Indica Group]
 gb|EEE54356.1| hypothetical protein OsJ_01354 [Oryza sativa Japonica Group]
Length=56

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C+DIL+AI+LPPLGVFLKFGCK+EFW+C LLT F
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLTFF  41



>gb|ACV50425.1| cold induced plasma membrane protein [Jatropha curcas]
 gb|KDP23328.1| hypothetical protein JCGZ_23161 [Jatropha curcas]
Length=57

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DILLA++LPPLGVFLKFGCK EFWIC LLT+
Sbjct  5    GTATCIDILLAVILPPLGVFLKFGCKAEFWICLLLTI  41



>ref|XP_010040900.1| PREDICTED: hydrophobic protein LTI6B-like [Eucalyptus grandis]
Length=55

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            M  T  C+DI+LAI+LPPLGVFLKFGC++EFWIC +LTLF
Sbjct  1    MSGTMNCIDIILAIILPPLGVFLKFGCQVEFWICLVLTLF  40



>gb|AAQ84111.1| Clt1 [Citrus trifoliata]
Length=54

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATCVDI+LA++LPPLGVFLKFGCK EFWIC LLT+
Sbjct  2    GTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTI  38



>ref|XP_010070102.1| PREDICTED: hydrophobic protein LTI6A-like [Eucalyptus grandis]
Length=57

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ST TC+DIL+AILLPPLGVFLK+GCKIEFWIC LLT+
Sbjct  4    STFTCIDILVAILLPPLGVFLKYGCKIEFWICLLLTI  40



>ref|XP_004230366.1| PREDICTED: hydrophobic protein LTI6A [Solanum lycopersicum]
Length=56

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +T TC+DILLAI+LPPLGVFLKF C++EFWIC LLTLF
Sbjct  4    NTMTCIDILLAIILPPLGVFLKFNCQVEFWICVLLTLF  41



>ref|XP_010040901.1| PREDICTED: hydrophobic protein LTI6B-like [Eucalyptus grandis]
Length=57

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ST  CVDILLAI+LPPLGVFLKFGC++EFWIC LLT+
Sbjct  5    STMNCVDILLAIILPPLGVFLKFGCQVEFWICVLLTI  41



>ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis 
lyrata subsp. lyrata]
Length=67

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  2    STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF  39



>ref|XP_009417776.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis]
 ref|XP_009417777.1| PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis]
Length=54

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DIL+AI+LPPLGVFLKFGCK+EFW+C LLT+
Sbjct  2    GTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLTI  38



>ref|XP_009366021.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri]
 ref|XP_009366022.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri]
Length=54

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI+LAILLPPLGVFL+FGC  EFWIC +LTLF
Sbjct  2    GTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLF  39



>gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis 
thaliana]
Length=67

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  2    STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF  39



>ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri]
 ref|XP_009366019.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri]
Length=54

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATCVDI++AILLPPLGVFL+FGC  EFWIC +LTLF
Sbjct  2    GTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF  39



>gb|AHL20265.1| stress-induced protein [Olea europaea]
Length=58

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI++AILLPPLGVFL++GCK+EFWIC LLT+
Sbjct  5    GTATCIDIIVAILLPPLGVFLRYGCKVEFWICLLLTI  41



>ref|XP_004494505.1| PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum]
Length=54

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATCVDI+LAI+LPPLGVFLKFGC +EFWIC +LT+
Sbjct  2    GTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTI  38



>ref|XP_008776672.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera]
 ref|XP_008776673.1| PREDICTED: hydrophobic protein RCI2B-like [Phoenix dactylifera]
Length=57

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             T  C+DILLAI+LPPLGVFLKFGCK+EFW+C +LTLF
Sbjct  5    GTVNCIDILLAIILPPLGVFLKFGCKVEFWLCLVLTLF  42



>gb|AFI47457.1| low temperature and salt responsive protein [Medicago sativa]
Length=54

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATCVDI+LAI+LPPLGVFLKFGC +EFWIC +LT+
Sbjct  2    GTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTI  38



>gb|ABD33207.2| Protein of unknown function UPF0057 [Medicago truncatula]
 gb|AES82353.2| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI++AI+LPPLGVFLKFGC +EFW+C +LTLF
Sbjct  2    GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF  39



>ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica]
 ref|XP_008345581.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica]
Length=54

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI++AILLPPLGVFL+FGC  EFWIC +LTLF
Sbjct  2    GTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLF  39



>ref|XP_008776670.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera]
 ref|XP_008776671.1| PREDICTED: hydrophobic protein LTI6B [Phoenix dactylifera]
Length=57

 Score = 63.9 bits (154),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DIL+AI+LPPLGVFLKFGCK EFWIC LLT+
Sbjct  5    GTATCLDILIAIILPPLGVFLKFGCKAEFWICLLLTI  41



>ref|XP_004967634.1| PREDICTED: hydrophobic protein LTI6B-like isoform X1 [Setaria 
italica]
Length=57

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLKFGCK+EFW+C LLT
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT  39



>ref|NP_001151840.1| hydrophobic protein LTI6B [Zea mays]
 ref|NP_001152948.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG43609.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG44549.1| hydrophobic protein LTI6B [Zea mays]
 tpg|DAA54255.1| TPA: hydrophobic protein LTI6B [Zea mays]
Length=57

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLKFGCK+EFW+C LLT
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKVEFWLCLLLT  39



>ref|XP_002993149.1| hypothetical protein SELMODRAFT_136629 [Selaginella moellendorffii]
 gb|EFJ05789.1| hypothetical protein SELMODRAFT_136629 [Selaginella moellendorffii]
Length=58

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +TATC++ILLAILLPP+GVF K+GC+IEFWIC LLT+F
Sbjct  5    TTATCLEILLAILLPPVGVFFKYGCEIEFWICLLLTVF  42



>ref|XP_004967637.1| PREDICTED: hydrophobic protein LTI6B-like isoform X4 [Setaria 
italica]
Length=56

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TA CVDIL+AI+LPPLGVFLKFGCK EFWIC LLT 
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCKFEFWICLLLTF  40



>ref|XP_003626132.1| Hydrophobic protein LTI6A [Medicago truncatula]
 gb|ABD33197.1| Protein of unknown function UPF0057 [Medicago truncatula]
 gb|AES82350.1| low temperature and salt responsive family protein [Medicago 
truncatula]
 gb|AFK36815.1| unknown [Medicago truncatula]
Length=54

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI+LAI+LPPLGVFLKFGC +EFWIC +LT+
Sbjct  2    GTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTI  38



>gb|EPS73096.1| stress-induced hydrophobic peptide [Genlisea aurea]
Length=57

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DIL+AI+LPPLGVFLK+GC IEFWI  +LTLF
Sbjct  5    GTATCIDILVAIILPPLGVFLKYGCGIEFWISLILTLF  42



>gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata]
Length=54

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 37/40 (93%), Gaps = 1/40 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            MGS AT VDI++AILLPPLGVFLKFGC++EFWIC +LTLF
Sbjct  1    MGS-ATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLF  39



>ref|XP_002884538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=54

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATCVDI++AILLPPLGVFL+FGC +EFWIC +LTL
Sbjct  2    GTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTL  38



>ref|XP_010674472.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris]
 ref|XP_010674473.1| PREDICTED: hydrophobic protein RCI2B [Beta vulgaris subsp. vulgaris]
Length=54

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            STAT +DI+LAI+LPPLGVFLK+GCK+EFWIC +LTL
Sbjct  2    STATFIDIILAIILPPLGVFLKYGCKVEFWICLVLTL  38



>gb|AEJ20974.1| cold-inducible protein [Caragana jubata]
Length=54

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI+LAI+LPPLGVFLKFGC +EFWIC +LT+
Sbjct  2    GTATCIDIILAIILPPLGVFLKFGCNVEFWICLVLTI  38



>gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b]
Length=726

 Score = 68.6 bits (166),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT V+I+LAI+LPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  674  STATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLF  711



>ref|XP_002279333.3| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera]
 ref|XP_010659763.1| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera]
Length=53

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             ATC+DILLAI+LPPLGVFLKFGC+ EFWIC +LT F
Sbjct  2    AATCIDILLAIILPPLGVFLKFGCQAEFWICLVLTFF  38



>ref|NP_001147508.1| LOC100281117 [Zea mays]
 gb|ACG27760.1| hydrophobic protein LTI6B [Zea mays]
 gb|AFW79486.1| hydrophobic protein LTI6B [Zea mays]
Length=57

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA C+DIL+AI+LPPLGVFLKFGCK+EFW+C LLT
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKVEFWLCLLLT  39



>gb|EYU35366.1| hypothetical protein MIMGU_mgv1a017610mg [Erythranthe guttata]
Length=56

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +TAT +DIL+AI+LPPLGVFL+FGC IEFWIC +LTLF
Sbjct  4    NTATFIDILVAIILPPLGVFLRFGCGIEFWICLILTLF  41



>ref|XP_008246326.1| PREDICTED: hydrophobic protein LTI6B-like [Prunus mume]
Length=57

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA  VDIL+AILLPPLGVFLKFGC +EFWIC LLT F
Sbjct  5    GTANFVDILIAILLPPLGVFLKFGCHVEFWICLLLTFF  42



>ref|XP_004967635.1| PREDICTED: hydrophobic protein LTI6B-like isoform X2 [Setaria 
italica]
 ref|XP_004967636.1| PREDICTED: hydrophobic protein LTI6B-like isoform X3 [Setaria 
italica]
Length=56

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TA C+DIL+AI+LPPLGVFLKFGCK EFWIC LLT 
Sbjct  4    GTANCIDILIAIILPPLGVFLKFGCKFEFWICLLLTF  40



>ref|NP_001147403.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG27364.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG47392.1| hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI+LAI+LPPLGVF KFGC +EFWIC +LT F
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTFF  41



>ref|XP_006658870.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like 
[Oryza brachyantha]
Length=678

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STATC+DI+LAI+LPPLGVF KFGC IEFWIC LLT F
Sbjct  626  STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFF  663



>ref|XP_004958446.1| PREDICTED: hydrophobic protein LTI6A-like [Setaria italica]
Length=56

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI+LAI+LPPLGVF KFGC +EFWIC +LT F
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFF  41



>ref|XP_010035796.1| PREDICTED: hydrophobic protein RCI2B [Eucalyptus grandis]
Length=58

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST T +DI+LAI+LPPLGVFLKFGC++EFWIC +LTLF
Sbjct  5    STMTFIDIILAIILPPLGVFLKFGCQVEFWICLVLTLF  42



>ref|XP_009414164.1| PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. 
malaccensis]
Length=54

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+D+L+AI+LPPLGVFLKFGCK+EFW+C LLT+
Sbjct  2    GTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLTI  38



>ref|XP_007207409.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica]
 gb|EMJ08608.1| hypothetical protein PRUPE_ppa014548mg [Prunus persica]
Length=57

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA  +DIL+AILLPPLGVFLKFGC +EFWIC LLT+F
Sbjct  5    GTANFIDILIAILLPPLGVFLKFGCHVEFWICLLLTIF  42



>ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus mume]
Length=54

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT VDI++AILLPPLGVFLKFGC+ EFWIC +LTLF
Sbjct  2    GTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLF  39



>ref|XP_003626135.1| Hydrophobic protein LTI6B [Medicago truncatula]
Length=83

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATC+DI++AI+LPPLGVFLKFGC +EFW+C +LTLF
Sbjct  2    GTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLF  39



>gb|AFP99877.1| plasma membrane protein Am244 [Avicennia marina]
 gb|AGI62243.1| plasma membrane protein [Avicennia marina]
Length=57

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI++AILLPPLGVFLK+GCK EFWIC LLT+
Sbjct  4    GTATCIDIVVAILLPPLGVFLKYGCKGEFWICLLLTI  40



>ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum]
 gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum]
Length=111

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 1/41 (2%)
 Frame = -2

Query  644  IKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            +KMG TAT V+I+LAI+LPPLGVFLKFGCKIEFWIC +LTL
Sbjct  55   LKMG-TATFVEIILAIILPPLGVFLKFGCKIEFWICLILTL  94



>gb|KCW82305.1| hypothetical protein EUGRSUZ_C03713 [Eucalyptus grandis]
Length=142

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            T  C+DILLAI+LPPLGVFLKFGC++EFWIC +LTLF
Sbjct  91   TMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF  127



>ref|XP_009774465.1| PREDICTED: hydrophobic protein RCI2B [Nicotiana sylvestris]
Length=56

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ST T +DILLAI+LPPLGVFLKFGC+ EFWIC LLTLF
Sbjct  4    STLTFIDILLAIILPPLGVFLKFGCEAEFWICLLLTLF  41



>gb|KCW44804.1| hypothetical protein EUGRSUZ_L01633, partial [Eucalyptus grandis]
Length=117

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            T  C+DILLAI+LPPLGVFLKFGC++EFWIC +LTLF
Sbjct  66   TMNCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLF  102



>tpg|DAA41564.1| TPA: hypothetical protein ZEAMMB73_862570 [Zea mays]
Length=56

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATCVDI+LAI+LPPLGVF KFGC  EFWIC +LT F
Sbjct  4    GTATCVDIILAIILPPLGVFFKFGCGAEFWICLILTFF  41



>ref|NP_001054591.1| Os05g0138300 [Oryza sativa Japonica Group]
 sp|Q0DKW8.1|LTI6B_ORYSJ RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced 
protein 6B [Oryza sativa Japonica Group]
 sp|A2Y075.2|LTI6B_ORYSI RecName: Full=Hydrophobic protein LTI6B; AltName: Full=Low temperature-induced 
protein 6B [Oryza sativa Indica Group]
 gb|AAM46894.1|AF503583_1 early drought induced protein [Oryza sativa Indica Group]
 gb|AAS72306.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group]
 gb|AAT37942.1| low temperature-induced low molecular weight integral membrane 
protein LTI6b [Oryza sativa Japonica Group]
 dbj|BAF16505.1| Os05g0138300 [Oryza sativa Japonica Group]
Length=55

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
            M  TA C+DIL+AI+LPPLGVFLKFGC  EFWIC LLT
Sbjct  1    MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLT  38



>ref|XP_003568974.1| PREDICTED: hydrophobic protein LTI6B [Brachypodium distachyon]
 dbj|BAK03378.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48019.1| Hydrophobic protein LTI6B [Triticum urartu]
Length=55

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
            M  TA C+DI+LAI+LPPLGVFLKFGC  EFWIC LLT
Sbjct  1    MAGTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLT  38



>tpg|DAA41563.1| TPA: hypothetical protein ZEAMMB73_862570 [Zea mays]
Length=59

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TATCVDI+LAI+LPPLGVF KFGC  EFWIC +LT F
Sbjct  4    GTATCVDIILAIILPPLGVFFKFGCGAEFWICLILTFF  41



>ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana]
 sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature 
and salt-responsive protein LTI6A [Arabidopsis thaliana]
 gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis 
thaliana]
 gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana]
 gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis 
thaliana]
 gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana]
 gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana]
 gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana]
Length=54

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            STAT VDI++AILLPPLGVFL+FGC +EFWIC +LTL
Sbjct  2    STATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTL  38



>gb|EAY96485.1| hypothetical protein OsI_18385 [Oryza sativa Indica Group]
 gb|EEE62260.1| hypothetical protein OsJ_17047 [Oryza sativa Japonica Group]
Length=92

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
            M  TA C+DIL+AI+LPPLGVFLKFGC  EFWIC LLT
Sbjct  1    MAGTANCIDILIAIILPPLGVFLKFGCGHEFWICLLLT  38



>ref|XP_004302327.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. 
vesca]
Length=57

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA  +DI++AILLPPLGVFLKFGC +EFWIC LLT+F
Sbjct  5    GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIF  42



>gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa]
 gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa]
Length=54

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            STAT VDI++A+LLPPLGVFL+FGC +EFWIC +LTL
Sbjct  2    STATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTL  38



>gb|AAV88601.1| low temperature and salt responsive protein [Cenchrus americanus]
Length=56

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C+DI+LAI+LPPLGVF KFGC +EFWIC +LT F
Sbjct  4    GTANCIDIILAIILPPLGVFFKFGCGVEFWICLVLTFF  41



>gb|ABK22915.1| unknown [Picea sitchensis]
 gb|ABK25743.1| unknown [Picea sitchensis]
 gb|ADM76850.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76851.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76852.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76853.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76854.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76855.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76856.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76857.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76858.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76859.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76860.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76861.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76862.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76863.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76864.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76865.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76866.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76867.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76868.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76869.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76870.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76871.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76872.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76873.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76874.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76875.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76876.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76877.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76878.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76879.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76880.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76881.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76882.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76883.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76884.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76885.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76886.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76887.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76888.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76889.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76890.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76891.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76892.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76893.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76894.1| low temprature induced-like protein [Picea sitchensis]
 gb|ADM76895.1| low temprature induced-like protein [Picea sitchensis]
Length=59

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TA CVDI+LAI+LPP+GVFLKFGC  EFWIC LLT+
Sbjct  4    GTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTI  40



>gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza]
Length=54

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT +DI++AILLPPLGVFLKFGC  EFWIC +LTLF
Sbjct  2    GTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLF  39



>ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula]
 gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular 
solute-binding protein, family 3 [Medicago truncatula]
 gb|AES82349.1| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT VDI+L+ILLPPLGVFLKFG ++EFWIC +LTLF
Sbjct  2    GTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLF  39



>emb|CDX80578.1| BnaC07g28660D [Brassica napus]
Length=66

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
            TA C+DI+LAILLPPLGVFLKFGC +EFWIC  LT
Sbjct  14   TANCIDIVLAILLPPLGVFLKFGCHVEFWICLALT  48



>ref|XP_004302326.1| PREDICTED: hydrophobic protein RCI2A-like [Fragaria vesca subsp. 
vesca]
Length=54

 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
              ATCVDI++AILLPPLGVFL+FGC +EFWIC +LTL
Sbjct  2    GAATCVDIIIAILLPPLGVFLRFGCGVEFWICLILTL  38



>ref|NP_001152633.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACF80942.1| unknown [Zea mays]
 gb|ACG25252.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG48645.1| hydrophobic protein LTI6A [Zea mays]
 tpg|DAA63802.1| TPA: hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI+LAI+LPPLGVF KFGC +EFWIC +LT 
Sbjct  4    GTATCIDIILAIILPPLGVFFKFGCGVEFWICLILTF  40



>ref|XP_008370336.1| PREDICTED: hydrophobic protein RCI2A-like [Malus domestica]
Length=57

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             T   VDIL+AILLPPLGVFLKFGC +EFWIC LLT+F
Sbjct  5    GTLNFVDILIAILLPPLGVFLKFGCHVEFWICLLLTIF  42



>ref|NP_001107634.1| LOC100135422 [Zea mays]
 gb|ABY71210.1| early drought induced protein [Zea mays]
 gb|ACG26762.1| hydrophobic protein LTI6B [Zea mays]
 gb|ACG33537.1| hydrophobic protein LTI6B [Zea mays]
Length=58

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLK+GC  EFWIC LLT
Sbjct  4    GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLT  39



>gb|ADC45381.1| stress-induced hydrophobic peptide [Cleistogenes songorica]
Length=57

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA+C+DIL+AI+LPPLGVFLKFGC  EFWIC LLT
Sbjct  5    GTASCIDILIAIILPPLGVFLKFGCGHEFWICLLLT  40



>gb|ACN26849.1| unknown [Zea mays]
 gb|AFW57543.1| naCl stress protein1 [Zea mays]
Length=58

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLK+GC  EFWIC LLT
Sbjct  4    GTANCVDILIAIILPPLGVFLKYGCGHEFWICLLLT  39



>dbj|BAG54793.1| plasma membrance protein3 [Puccinellia tenuiflora]
 dbj|BAJ88867.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS46527.1| Hydrophobic protein LTI6A [Triticum urartu]
 gb|EMT07358.1| Hydrophobic protein LTI6A [Aegilops tauschii]
Length=57

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C+DI+LAI+LPPLGVF KF C IEFWIC LLT F
Sbjct  5    GTANCIDIILAIILPPLGVFFKFACGIEFWICLLLTFF  42



>ref|XP_009134856.1| PREDICTED: hydrophobic protein RCI2A-like [Brassica rapa]
 emb|CDX74126.1| BnaA03g29210D [Brassica napus]
Length=55

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MG+ AT V+IL+AILLPPLGVFLKFGC +EFWIC +LTL
Sbjct  1    MGA-ATVVEILIAILLPPLGVFLKFGCSVEFWICLILTL  38



>gb|ACH60980.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60983.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60991.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60995.1| rare cold inducible protein [Pseudotsuga menziesii]
Length=62

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  647  IIKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            II    TAT +DILLAI+LPPLGVFLK+ C  EFW+C LLTLF
Sbjct  3    IIMREGTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTLF  45



>gb|ACH60977.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60978.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60979.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60981.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60982.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60984.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60985.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60986.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60987.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60988.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60989.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60990.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60992.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60993.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60994.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60996.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60997.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60998.1| rare cold inducible protein [Pseudotsuga menziesii]
 gb|ACH60999.1| rare cold inducible protein [Pseudotsuga menziesii]
Length=62

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  647  IIKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            II    TAT +DILLAI+LPPLGVFLK+ C  EFW+C LLTLF
Sbjct  3    IIMREGTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTLF  45



>dbj|BAD34658.1| plasma membrane protein 3 [Leymus chinensis]
Length=54

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA C+DI+LAI+LPPLGVFLKFGC  EFWIC LLT
Sbjct  2    GTANCIDIILAIILPPLGVFLKFGCGHEFWICLLLT  37



>gb|ABQ41924.1| low temperature and salt responsive protein [Sonneratia alba]
 gb|ABQ41925.1| low temperature and salt responsive protein [Sonneratia caseolaris]
 gb|ABQ41926.1| low temperature and salt responsive protein [Sonneratia ovata]
Length=45

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -2

Query  623  TCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            TC+DILLAI+LPPLGVFLK+GCK EFWIC LLT+
Sbjct  1    TCIDILLAIILPPLGVFLKYGCKAEFWICLLLTI  34



>ref|XP_011092211.1| PREDICTED: hydrophobic protein RCI2A-like isoform X2 [Sesamum 
indicum]
Length=57

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT +DI++AI +PPLGVFLKF C IEFWIC LLT F
Sbjct  5    STATFIDIVVAIFVPPLGVFLKFACGIEFWICLLLTFF  42



>ref|XP_002440557.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor]
 gb|EES18987.1| hypothetical protein SORBIDRAFT_09g003060 [Sorghum bicolor]
Length=57

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLKFGC  +FWIC LLT
Sbjct  4    GTANCVDILIAIILPPLGVFLKFGCGHQFWICLLLT  39



>ref|XP_003557909.1| PREDICTED: hydrophobic protein LTI6A [Brachypodium distachyon]
Length=56

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 35/38 (92%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +TAT +D++LAI+LPPLGVFLK+GC+IEFWIC +L+ F
Sbjct  4    NTATFIDLILAIILPPLGVFLKYGCEIEFWICLVLSFF  41



>ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays]
 gb|ACG30991.1| hydrophobic protein LTI6A [Zea mays]
Length=56

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT +DI+LAI+LPPLGVF KFGC +EFWIC +LT F
Sbjct  4    GTATFIDIILAIILPPLGVFFKFGCGVEFWICLILTFF  41



>emb|CDY49985.1| BnaC03g34420D [Brassica napus]
Length=55

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 35/39 (90%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MG+ AT V+IL+AILLPPLGVFLKFGC +EFW+C +LTL
Sbjct  1    MGA-ATVVEILIAILLPPLGVFLKFGCSVEFWVCLILTL  38



>gb|ADE77881.1| unknown [Picea sitchensis]
Length=53

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             A C+DILLAI+LPPLGVFLKFGC  EFWIC LLT+
Sbjct  2    AANCLDILLAIILPPLGVFLKFGCNAEFWICLLLTI  37



>emb|CDM82662.1| unnamed protein product [Triticum aestivum]
Length=70

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TA C+DI+LA++LPPLGVF KF C IEFWIC LLT F
Sbjct  5    GTANCIDIILAVILPPLGVFFKFACGIEFWICLLLTFF  42



>gb|ACH61000.1| rare cold inducible protein [Pseudotsuga macrocarpa]
Length=62

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  647  IIKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            II    TAT +DILLAI+LPPLGVFLK+ C  EFW+C LLT+F
Sbjct  3    IIMREGTATFIDILLAIILPPLGVFLKYECHAEFWLCLLLTMF  45



>ref|XP_006382256.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa]
 gb|ERP60053.1| hypothetical protein POPTR_0005s00390g [Populus trichocarpa]
Length=55

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            M     C+DIL+AI+LPPLGVFL+FGC +EFWIC LLT+
Sbjct  1    MAGAVKCIDILIAIILPPLGVFLRFGCGVEFWICLLLTI  39



>ref|XP_002993150.1| hypothetical protein SELMODRAFT_229736 [Selaginella moellendorffii]
 gb|EFJ05790.1| hypothetical protein SELMODRAFT_229736 [Selaginella moellendorffii]
Length=54

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            + AT +D+LLAI+LPPLGVFL+FGC IEFWIC LLT+
Sbjct  2    AGATFIDVLLAIILPPLGVFLRFGCAIEFWICLLLTI  38



>ref|XP_011092210.1| PREDICTED: hydrophobic protein RCI2A-like isoform X1 [Sesamum 
indicum]
Length=76

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             STAT +DI++AI +PPLGVFLKF C IEFWIC LLT F
Sbjct  4    DSTATFIDIVVAIFVPPLGVFLKFACGIEFWICLLLTFF  42



>ref|XP_002964158.1| hypothetical protein SELMODRAFT_227480 [Selaginella moellendorffii]
 gb|EFJ34491.1| hypothetical protein SELMODRAFT_227480 [Selaginella moellendorffii]
Length=54

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            + AT +D+LLAI+LPPLGVFL+FGC +EFWIC LLT+
Sbjct  2    AGATFIDVLLAIILPPLGVFLRFGCAVEFWICLLLTI  38



>ref|XP_004960430.1| PREDICTED: hydrophobic protein LTI6B-like [Setaria italica]
Length=56

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CVDIL+AI+LPPLGVFLK GC  EFWIC LLT
Sbjct  4    RTANCVDILIAIILPPLGVFLKHGCGHEFWICLLLT  39



>ref|XP_009365456.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
 ref|XP_009335547.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
Length=54

 Score = 58.9 bits (141),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT +DI++AILLPPLGVFLK+ C+ EFWIC +LTLF
Sbjct  2    GTATFIDIIIAILLPPLGVFLKYECRAEFWICLVLTLF  39



>ref|XP_008350586.1| PREDICTED: hydrophobic protein RCI2B-like [Malus domestica]
Length=54

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 1/40 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            MGS AT +DI++AILLPPLGVFLK+ C+ EFWIC +LTLF
Sbjct  1    MGS-ATFIDIIIAILLPPLGVFLKYECRAEFWICLVLTLF  39



>ref|XP_002440556.1| hypothetical protein SORBIDRAFT_09g003050 [Sorghum bicolor]
 gb|EES18986.1| hypothetical protein SORBIDRAFT_09g003050 [Sorghum bicolor]
Length=53

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
            +A CVDIL+AI+LPPLGVFLKFGC  +FWIC LLT
Sbjct  2    SANCVDILIAIILPPLGVFLKFGCGHQFWICLLLT  36



>ref|XP_001765492.1| predicted protein [Physcomitrella patens]
 gb|AAR87656.1| small hydrophobic protein 2 [Physcomitrella patens]
 gb|EDQ69753.1| predicted protein [Physcomitrella patens]
Length=58

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  641  KMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            K GSTAT  ++LLAILLPPLGVFL++ C +EFWIC LLT+
Sbjct  3    KGGSTATFCEVLLAILLPPLGVFLRYACGLEFWICLLLTI  42



>gb|ACJ09619.1| putative low temperature and salt responsive protein [Cupressus 
sempervirens]
Length=73

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -2

Query  629  TATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            T TCVDIL+AI+ PPL VFLK GCK+EFWIC +LTL
Sbjct  1    TVTCVDILMAIIYPPLAVFLKSGCKVEFWICVMLTL  36



>gb|ABK96638.1| unknown [Populus trichocarpa x Populus deltoides]
Length=54

 Score = 58.2 bits (139),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            S+   VDILLAI+LPPLGVFLKFGC  EFWIC LLT+
Sbjct  2    SSTNFVDILLAIILPPLGVFLKFGCGAEFWICLLLTI  38



>ref|XP_002318921.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 ref|XP_006375707.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 ref|XP_006375708.1| Hydrophobic protein RCI2A [Populus trichocarpa]
 ref|XP_006375709.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|EEE94844.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53504.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53505.1| Hydrophobic protein RCI2A [Populus trichocarpa]
 gb|ERP53506.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
Length=54

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            S+   +DILLAI+LPPLGVFLKFGC  EFWIC LLT+
Sbjct  2    SSTNFIDILLAIILPPLGVFLKFGCGAEFWICLLLTI  38



>ref|NP_001050200.1| Os03g0370600 [Oryza sativa Japonica Group]
 gb|AAG46140.1|AC082644_22 putative low temperature and salt responsive protein [Oryza sativa 
Japonica Group]
 gb|ABF96175.1| Hydrophobic protein LTI6B, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12114.1| Os03g0370600 [Oryza sativa Japonica Group]
 gb|EAY90185.1| hypothetical protein OsI_11749 [Oryza sativa Indica Group]
 gb|EAY90188.1| hypothetical protein OsI_11752 [Oryza sativa Indica Group]
 gb|EAZ27072.1| hypothetical protein OsJ_11001 [Oryza sativa Japonica Group]
Length=64

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TAT VD+++AI+LPPLGVFLK GC+IEFWIC LLT
Sbjct  11   RTATFVDLVIAIILPPLGVFLKVGCEIEFWICLLLT  46



>ref|XP_008445856.1| PREDICTED: low temperature-induced protein lt101.2 [Cucumis melo]
Length=54

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+I+LAILLPPLGVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFVEIILAILLPPLGVFLRYGCGVEFWICLLLTI  38



>ref|XP_004143609.1| PREDICTED: hydrophobic protein RCI2A-like [Cucumis sativus]
 ref|XP_004171541.1| PREDICTED: hydrophobic protein RCI2A-like [Cucumis sativus]
 gb|KGN50466.1| hypothetical protein Csa_5G175890 [Cucumis sativus]
Length=54

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+I+LAILLPPLGVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFVEIILAILLPPLGVFLRYGCGVEFWICLLLTI  38



>ref|XP_006375710.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
 gb|ERP53507.1| hypothetical protein POPTR_0013s00340g [Populus trichocarpa]
Length=56

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            S+   +DILLAI+LPPLGVFLKFGC  EFWIC LLT+
Sbjct  2    SSTNFIDILLAIILPPLGVFLKFGCGAEFWICLLLTI  38



>gb|EAY90184.1| hypothetical protein OsI_11748 [Oryza sativa Indica Group]
Length=57

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             TAT VD+++AI+LPPLGVFLK GC+I+FWIC LL+ F
Sbjct  4    RTATFVDLVIAIILPPLGVFLKVGCEIKFWICLLLSFF  41



>gb|ADD54613.1| unknown [Linum usitatissimum]
Length=59

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +3

Query  471  SLGDDPNSIDNSRDVPKQSQQTANPKLNLAAKLEEDT*GRQQDSQENVYT  620
            SLG   + +D++RDV K S++ A+P+LNLAA+LEE T  RQQDSQ+ VY 
Sbjct  6    SLGYGVDGVDDARDVSKDSEEQADPELNLAAELEEHTQRRQQDSQDYVYA  55



>ref|XP_004986964.1| PREDICTED: hydrophobic protein LTI6A-like [Setaria italica]
Length=56

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            S  T V I+LAI+LPPLGVFLK G KIEFWIC LL+ F
Sbjct  4    SAVTVVRIILAIILPPLGVFLKHGIKIEFWICLLLSFF  41



>ref|XP_009365454.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
 ref|XP_009335545.1| PREDICTED: hydrophobic protein RCI2B-like [Pyrus x bretschneideri]
Length=54

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              AT ++I+LAILLPPLGVFLK+ C+ EFWIC +LTLF
Sbjct  2    GRATFLEIILAILLPPLGVFLKYECRAEFWICLVLTLF  39



>ref|XP_004306234.1| PREDICTED: hydrophobic protein LTI6A-like [Fragaria vesca subsp. 
vesca]
Length=55

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MG+ ATC ++LLA+ LPPLGV +++GC +EFWIC LLT+
Sbjct  1    MGACATCCELLLAVFLPPLGVVIRYGCGVEFWICLLLTI  39



>gb|EMT05681.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+ILLAILLPP+GVFL++G  +EFWIC LLTL
Sbjct  1    MGSE-TFVEILLAILLPPVGVFLRYGIGVEFWICLLLTL  38



>gb|ADK27676.1| plasma membrane protein 3-1 [Salvia miltiorrhiza]
Length=55

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFW  543
            + ATC+DI++AI+LPPLGVFLKFGCK EFW
Sbjct  2    AAATCIDIIVAIILPPLGVFLKFGCKHEFW  31



>ref|XP_009133311.1| PREDICTED: low temperature-induced protein lt101.2 [Brassica 
rapa]
 ref|XP_009133312.1| PREDICTED: low temperature-induced protein lt101.2 [Brassica 
rapa]
 emb|CDY14420.1| BnaC03g21750D [Brassica napus]
 emb|CDY07689.1| BnaA03g18220D [Brassica napus]
Length=54

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWIC LLTL
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWICLLLTL  38



>sp|Q9ARD5.1|LT02_HORVU RecName: Full=Low temperature-induced protein lt101.2 [Hordeum 
vulgare]
 emb|CAC37082.1| putative membrane protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89049.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=54

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT ++++LAI+LPP+GVFL++G  +EFWIC LLTL
Sbjct  2    ASATFIEVILAIILPPVGVFLRYGLAVEFWICLLLTL  38



>gb|ACG48459.1| hypothetical protein [Zea mays]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+ILLAILLPP+GVFL++G  +EFWIC LLT+
Sbjct  1    MGSE-TFVEILLAILLPPVGVFLRYGIGVEFWICLLLTI  38



>ref|XP_010667244.1| PREDICTED: low temperature-induced protein lt101.2 [Beta vulgaris 
subsp. vulgaris]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+++LAILLPPLGVFL++G  +EFWIC LLT+
Sbjct  1    MGSE-TFVEVILAILLPPLGVFLRYGIAVEFWICLLLTI  38



>ref|XP_004984830.1| PREDICTED: low temperature-induced protein lt101.2-like [Setaria 
italica]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            +TAT V++LLAI LPP+GVFL++GC +EFWI  LLT+
Sbjct  2    ATATFVEVLLAIFLPPVGVFLRYGCGMEFWIDLLLTI  38



>ref|XP_010694118.1| PREDICTED: hydrophobic protein RCI2B-like [Beta vulgaris subsp. 
vulgaris]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            S +T +DI+LAI+LPPLGVFLKFG + EFWIC + T F
Sbjct  2    SDSTFIDIILAIILPPLGVFLKFGIETEFWICVVCTFF  39



>ref|NP_565897.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
 ref|XP_002881622.1| hypothetical protein ARALYDRAFT_482911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AAK97701.1| unknown protein [Arabidopsis thaliana]
 gb|AAL31117.1| At2g38901/At2g38901 [Arabidopsis thaliana]
 gb|AAM15078.1| Expressed protein [Arabidopsis thaliana]
 gb|EFH57881.1| hypothetical protein ARALYDRAFT_482911 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC09610.1| Low temperature and salt responsive protein [Arabidopsis thaliana]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++I+LAILLPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEIILAILLPPVGVFLRYGCGVEFWICLLLTI  38



>ref|XP_004237520.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Solanum 
lycopersicum]
 ref|XP_006340457.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Solanum tuberosum]
Length=54

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWICVLLTI  38



>dbj|BAG54794.1| plasma membrance protein3 [Puccinellia tenuiflora]
Length=54

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+ I+LAI+LPPLGVF K G  I+FWIC LLT+
Sbjct  2    GTATCMQIILAIILPPLGVFFKHGLGIQFWICLLLTI  38



>ref|XP_002277985.1| PREDICTED: low temperature-induced protein lt101.2 [Vitis vinifera]
 emb|CAN63686.1| hypothetical protein VITISV_034114 [Vitis vinifera]
 emb|CAN63348.1| hypothetical protein VITISV_024444 [Vitis vinifera]
 emb|CBI32669.3| unnamed protein product [Vitis vinifera]
Length=55

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TAT +++LLAILLPP+GVFL++GC +EFWI  LLT+
Sbjct  2    GTATFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTI  38



>ref|XP_001751863.1| predicted protein [Physcomitrella patens]
 gb|EDQ83298.1| predicted protein [Physcomitrella patens]
Length=58

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  641  KMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            K G  AT  +ILLAI LPPLGVF K+ C +EFWIC LLT+
Sbjct  3    KGGVAATLCEILLAIFLPPLGVFFKYNCGVEFWICLLLTI  42



>ref|XP_007206184.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
 gb|EMJ07383.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica]
Length=99

 Score = 47.8 bits (112),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  644  IKMGSTATCVDILLAILLPPLGVFLKFGCKI  552
            I+MG TAT VDI++AILLPPLGVFLKFGC I
Sbjct  38   IRMG-TATFVDIIIAILLPPLGVFLKFGCGI  67


 Score = 31.2 bits (69),  Expect(2) = 3e-06, Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 0/20 (0%)
 Frame = -1

Query  528  DSVWVHPWNYLCYLDHHQVI  469
            DS W+ PW YLC+L  HQVI
Sbjct  74   DSFWLSPWYYLCHLHPHQVI  93



>ref|XP_008339336.1| PREDICTED: hydrophobic protein RCI2B-like [Malus domestica]
Length=54

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
              AT ++I+LAILLPPLGVFL++ C+ EFWIC +LTLF
Sbjct  2    GRATFLEIVLAILLPPLGVFLQYECREEFWICLVLTLF  39



>ref|XP_010067264.1| PREDICTED: low temperature-induced protein lt101.2 [Eucalyptus 
grandis]
Length=54

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+I+LAILLPP+GVFL++GC +EFWI  LLT+
Sbjct  1    MGS-ETFVEIILAILLPPVGVFLRYGCGVEFWITLLLTI  38



>ref|XP_009614515.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Nicotiana 
tomentosiformis]
 ref|XP_009769750.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Nicotiana 
sylvestris]
Length=54

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T +++LLAI+LPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVLLAIILPPVGVFLRYGCGVEFWICLLLTI  38



>ref|XP_008233373.1| PREDICTED: low temperature-induced protein lt101.2 [Prunus mume]
Length=54

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LPP+GVFL++GC +EFWIC LLTL
Sbjct  1    MGSE-TFLEVILAIILPPVGVFLRYGCGVEFWICLLLTL  38



>ref|XP_009141770.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Brassica 
rapa]
 emb|CDY18362.1| BnaA04g22250D [Brassica napus]
 emb|CDX93294.1| BnaC04g46020D [Brassica napus]
Length=54

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWICLLLTV  38



>ref|XP_008792165.1| PREDICTED: low temperature-induced protein lt101.2 [Phoenix dactylifera]
Length=54

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS AT ++++LAILLPPLGVFL++GC +EFWI  LLT+
Sbjct  1    MGS-ATFLEVVLAILLPPLGVFLRYGCGVEFWIDLLLTI  38



>ref|XP_006436212.1| hypothetical protein CICLE_v10033283mg [Citrus clementina]
 ref|XP_006485929.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Citrus sinensis]
 gb|ESR49452.1| hypothetical protein CICLE_v10033283mg [Citrus clementina]
 gb|KDO44594.1| hypothetical protein CISIN_1g038161mg [Citrus sinensis]
 gb|KFK36794.1| hypothetical protein AALP_AA4G171900 [Arabis alpina]
Length=54

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWICLLLTV  38



>gb|EPS71255.1| stress-induced hydrophobic peptide, partial [Genlisea aurea]
Length=53

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPPLGVFL++GC  EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAILLPPLGVFLRYGCGAEFWICLLLTI  38



>ref|XP_001776246.1| predicted protein [Physcomitrella patens]
 gb|AAR87655.1| small hydrophobic protein 1 [Physcomitrella patens]
 gb|EDQ58879.1| predicted protein [Physcomitrella patens]
Length=59

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
               T VD+LLAI+LPPLGVFLK+G + EFWIC +LT+
Sbjct  7    GAYTFVDVLLAIILPPLGVFLKYGLQSEFWICLVLTI  43



>ref|XP_008362678.1| PREDICTED: low temperature-induced protein lt101.2 [Malus domestica]
 ref|XP_009378121.1| PREDICTED: low temperature-induced protein lt101.2 [Pyrus x bretschneideri]
Length=54

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAIILPPVGVFLRYGCAVEFWICLLLTI  38



>ref|XP_008347209.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Malus domestica]
Length=64

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LPP+GVFL+FGC +EFWIC LLT+
Sbjct  1    MGS-ETFLEVILAIILPPVGVFLRFGCGVEFWICLLLTI  38



>gb|KEH25679.1| low temperature and salt responsive family protein [Medicago 
truncatula]
Length=54

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T V+++LAILLPP+GVFL++GC +EFWI  +LTL
Sbjct  1    MGSE-TFVEVILAILLPPIGVFLRYGCGVEFWIDVVLTL  38



>ref|XP_002311114.1| hydrophobic family protein, partial [Populus trichocarpa]
 gb|EEE88481.1| hydrophobic family protein, partial [Populus trichocarpa]
 gb|ADC67795.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67796.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67797.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67799.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67801.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67802.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67805.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67806.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67808.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67809.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67810.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67811.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67812.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67813.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67814.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67815.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67816.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67817.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67818.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67819.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67820.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67821.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67822.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67823.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67824.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67825.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67827.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67828.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67829.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67830.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67831.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67832.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67833.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67834.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67835.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67836.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67837.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67838.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67839.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67840.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67841.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67842.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67843.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67844.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67845.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67846.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67847.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67848.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67849.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67850.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67851.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67852.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67853.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67854.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67855.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67856.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67857.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67858.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67859.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67860.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67861.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67862.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67863.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67864.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67865.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67866.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67867.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67868.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67869.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67870.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67871.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67872.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67874.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67875.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67876.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67877.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67878.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67879.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67880.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67881.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67882.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67883.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67884.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67885.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67886.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
Length=54

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAIILPPVGVFLRYGCGVEFWICLLLTI  38



>ref|XP_002465219.1| hypothetical protein SORBIDRAFT_01g034350 [Sorghum bicolor]
 gb|EER92217.1| hypothetical protein SORBIDRAFT_01g034350 [Sorghum bicolor]
Length=61

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  635  GSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             +T T V ++LAI+LPPLGVFLK G K+EFWIC +L+ F
Sbjct  4    DNTVTLVRLILAIILPPLGVFLKHGLKLEFWICLILSFF  42



>ref|XP_010253524.1| PREDICTED: low temperature-induced protein lt101.2-like [Nelumbo 
nucifera]
Length=54

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC IEFWI  LLTL
Sbjct  1    MGSE-TFIEVVLAILLPPVGVFLRYGCGIEFWIDLLLTL  38



>ref|XP_002440508.1| hypothetical protein SORBIDRAFT_09g002150 [Sorghum bicolor]
 gb|EES18938.1| hypothetical protein SORBIDRAFT_09g002150 [Sorghum bicolor]
Length=54

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++ILLAILLPP+GVFL++G  +EFWIC LLT+
Sbjct  1    MGSE-TFLEILLAILLPPVGVFLRYGIGVEFWICLLLTI  38



>ref|XP_004137807.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
sativus]
 ref|XP_004166364.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
sativus]
 gb|KGN58938.1| hypothetical protein Csa_3G736860 [Cucumis sativus]
Length=69

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = -2

Query  641  KMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +MGS AT +++LLAI +PP+GVFL++G  IEFWI  +LT F
Sbjct  13   RMGS-ATFIEVLLAIFIPPVGVFLRYGIGIEFWIDLVLTFF  52



>ref|XP_008369468.1| PREDICTED: low temperature-induced protein lt101.2 [Malus domestica]
Length=54

 Score = 52.4 bits (124),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI LPP+GVFL++GC +EFWIC LLT+
Sbjct  1    MGSE-TFLEVILAIXLPPVGVFLRYGCAVEFWICLLLTI  38



>ref|XP_003558174.1| PREDICTED: low temperature-induced protein lt101.2 [Brachypodium 
distachyon]
Length=54

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT ++++LAI+LPP+GVFL++G  +EFWIC LLT+
Sbjct  2    ASATFLEVILAIILPPVGVFLRYGLGVEFWICLLLTI  38



>ref|XP_002278351.2| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Vitis 
vinifera]
Length=81

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 1/45 (2%)
 Frame = -2

Query  656  IELIIKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++  I MGS  T ++I+LAILLPP+GVFL++GC IEFWI  LLT+
Sbjct  22   LQATIIMGS-ETFLEIILAILLPPVGVFLRYGCGIEFWIDLLLTI  65



>gb|ACG26760.1| hypothetical protein [Zea mays]
 gb|ACG26805.1| hypothetical protein [Zea mays]
 gb|ACG26851.1| hypothetical protein [Zea mays]
 gb|ACG27700.1| hypothetical protein [Zea mays]
 gb|ACG33455.1| hypothetical protein [Zea mays]
 tpg|DAA44810.1| TPA: hypothetical protein ZEAMMB73_772098 [Zea mays]
Length=54

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT +++LLAI LPP+GVFL++GC +EFWI  LLT+
Sbjct  2    ASATFLEVLLAIFLPPVGVFLRYGCGVEFWIDLLLTV  38



>ref|XP_004489845.1| PREDICTED: hydrophobic protein RCI2A-like [Cicer arietinum]
Length=54

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             T T V+++LAILLPP+GVFL++GC IEFWI  +LT
Sbjct  2    GTETFVEVILAILLPPVGVFLRYGCGIEFWIDLVLT  37



>ref|XP_002465426.1| hypothetical protein SORBIDRAFT_01g038670 [Sorghum bicolor]
 gb|EER92424.1| hypothetical protein SORBIDRAFT_01g038670 [Sorghum bicolor]
Length=54

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT +++LLAI LPP+GVFL++GC +EFWI  LLT+
Sbjct  2    ASATFLEVLLAIFLPPVGVFLRYGCGVEFWIDLLLTV  38



>gb|EMT15831.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT ++++LAI+LPP+GVFL+ G  +EFWIC LLTL
Sbjct  2    ASATFIEVILAIILPPVGVFLRSGLAVEFWICLLLTL  38



>ref|XP_008789047.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Phoenix 
dactylifera]
Length=54

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T +++LLAILLPP+GVFL++GC +EFWI  LLT+
Sbjct  1    MGSE-TFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTI  38



>ref|XP_007151809.1| hypothetical protein PHAVU_004G076700g [Phaseolus vulgaris]
 gb|ESW23803.1| hypothetical protein PHAVU_004G076700g [Phaseolus vulgaris]
Length=54

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWI  +LTL
Sbjct  1    MGSE-TFIEVILAILLPPVGVFLRYGCGVEFWIDLVLTL  38



>ref|XP_010244973.1| PREDICTED: low temperature-induced protein lt101.2 [Nelumbo nucifera]
Length=53

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            + AT ++++LAI LPP+GVFL++GC +EFWI  LLT+
Sbjct  2    AAATFLEVILAIFLPPVGVFLRYGCAVEFWIDLLLTI  38



>ref|XP_011077044.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Sesamum indicum]
Length=54

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWI  LLT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWIDLLLTI  38



>ref|XP_009380674.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Musa 
acuminata subsp. malaccensis]
Length=54

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWI  LLT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWIDLLLTI  38



>ref|XP_008355643.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Malus domestica]
 ref|XP_009358176.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Pyrus x bretschneideri]
Length=54

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 1/40 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            MGS  T +++L AI LPP+GVF+++GC +EFWI  LLTLF
Sbjct  1    MGSE-TFLEVLCAIFLPPVGVFIRYGCGVEFWIAVLLTLF  39



>ref|XP_009409551.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Musa 
acuminata subsp. malaccensis]
Length=54

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS AT ++++LAILLPP+GVFL++G  +EFWI  LLT+
Sbjct  1    MGS-ATFLEVILAILLPPVGVFLRYGIGVEFWIDLLLTI  38



>ref|NP_001049776.1| Os03g0286900 [Oryza sativa Japonica Group]
 gb|AAO16991.1| Putative low-temperature induced protein [Oryza sativa Japonica 
Group]
 gb|ABF95363.1| hypothetical protein LOC_Os03g17790 [Oryza sativa Japonica Group]
 dbj|BAF11690.1| Os03g0286900 [Oryza sativa Japonica Group]
 gb|EAY89548.1| hypothetical protein OsI_11082 [Oryza sativa Indica Group]
 gb|EAZ26526.1| hypothetical protein OsJ_10421 [Oryza sativa Japonica Group]
 gb|EAZ26527.1| hypothetical protein OsJ_10422 [Oryza sativa Japonica Group]
 dbj|BAG92185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=54

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            ++AT +++LLAI LPP+GVFL++G  IEFWI  LLT+
Sbjct  2    ASATFLEVLLAIFLPPVGVFLRYGLGIEFWIDLLLTI  38



>sp|P68178.1|ESI3_THIEL RecName: Full=Salt stress-induced hydrophobic peptide ESI3 [Lophopyrum 
elongatum]
 sp|P68179.1|LT01_HORVU RecName: Full=Low temperature-induced protein lt101.1; AltName: 
Full=Blt101.1; Short=Blt101 [Hordeum vulgare]
 emb|CAA80984.1| 54 amino acids [Hordeum vulgare subsp. vulgare]
 gb|AAA21847.1| salt-stress induced hydrophobic peptide [Lophopyrum elongatum]
 dbj|BAB03288.1| hydrophobic polypeptide [Triticum aestivum]
 emb|CAC37081.1| putative membrane protein [Hordeum vulgare subsp. vulgare]
 dbj|BAE07207.1| plasma membrane protein [Triticum aestivum]
 dbj|BAJ85904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT15832.1| Low temperature-induced protein [Aegilops tauschii]
Length=54

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS AT ++++LAI+LPP+GVFL++   +EFWIC LLT+
Sbjct  1    MGS-ATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTI  38



>gb|AER00467.1| BLT101 [Dasypyrum villosum]
 gb|AER00468.1| BLT101 [Dasypyrum villosum]
Length=54

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS AT ++++LAI+LPP+GVFL++   +EFWIC LLT+
Sbjct  1    MGS-ATVLEVILAIILPPVGVFLRYKLGVEFWICLLLTI  38



>ref|XP_006382257.1| hypothetical protein POPTR_0005s00400g [Populus trichocarpa]
 ref|XP_006382258.1| hypothetical protein POPTR_0005s00400g [Populus trichocarpa]
 gb|ERP60054.1| hypothetical protein POPTR_0005s00400g [Populus trichocarpa]
 gb|ERP60055.1| hypothetical protein POPTR_0005s00400g [Populus trichocarpa]
Length=106

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  471  SLGDDPNSIDNSRDVPKQSQQTANPKLNLAAKLEEDT*GRQQDSQENVYTSGCA  632
            SLGD  +SI+NSR+V K+      P    AAKLEEDT  RQ D Q++VY S C+
Sbjct  14   SLGDGVDSINNSREVAKEGYGRTYP----AAKLEEDTKRRQDDGQQDVYASSCS  63



>ref|XP_003524635.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Glycine max]
 gb|KHN30978.1| Low temperature-induced protein [Glycine soja]
Length=54

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +EFWI  +LT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVEFWIDLVLTI  38



>ref|XP_001764858.1| predicted protein [Physcomitrella patens]
 gb|EDQ70300.1| predicted protein [Physcomitrella patens]
Length=54

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MG+ AT V+I+LAI LPPLGVFL++    EFWIC LLT+
Sbjct  1    MGA-ATFVEIILAIFLPPLGVFLRYSIGAEFWICLLLTI  38



>gb|AFW88281.1| hypothetical protein ZEAMMB73_701475 [Zea mays]
Length=60

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +  T V ++LAI+LPPLGVFLK G KIEFWIC LL  F
Sbjct  4    NMVTLVRLVLAIILPPLGVFLKHGLKIEFWICLLLCFF  41



>ref|XP_008376314.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3 [Malus 
domestica]
Length=54

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T  +++LAI+LPP+GVFL+F C +EFWIC LLT+
Sbjct  1    MGSE-TFPEVILAIILPPVGVFLRFSCGVEFWICLLLTI  38



>gb|KDP46158.1| hypothetical protein JCGZ_06669 [Jatropha curcas]
Length=54

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAIL+PP+GVFL++GC +EFWI  LLT+
Sbjct  1    MGSE-TFLEVILAILVPPVGVFLRYGCGVEFWIDLLLTI  38



>gb|ACJ09630.1| putative early drought-induced protein [Cupressus sempervirens]
Length=96

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 1/36 (3%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLT  525
             TA CV IL+AI+LPPL VFLK+GC  EFWIC LLT
Sbjct  23   GTANCV-ILIAIILPPLAVFLKYGCGHEFWICLLLT  57



>dbj|BAD34659.1| plasma membrane protein 3 [Leymus chinensis]
Length=54

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             TATC+DI++AI+LPPLGVFLKFGC  EFWIC LLT 
Sbjct  2    GTATCIDIIIAIILPPLGVFLKFGCGHEFWICLLLTF  38



>ref|XP_007145051.1| hypothetical protein PHAVU_007G205900g [Phaseolus vulgaris]
 gb|ESW17045.1| hypothetical protein PHAVU_007G205900g [Phaseolus vulgaris]
Length=62

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 31/37 (84%), Gaps = 5/37 (14%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKI-----EFWIC  537
             +ATC+DILLAI+LPPLGVFLK+GCK+     +F++C
Sbjct  5    GSATCIDILLAIILPPLGVFLKYGCKVFIIFTDFFLC  41



>gb|KCW58686.1| hypothetical protein EUGRSUZ_H01335 [Eucalyptus grandis]
Length=96

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIE  549
            ST TC+DIL+AILLPPLGVFLK+GCK++
Sbjct  4    STFTCIDILVAILLPPLGVFLKYGCKVK  31



>gb|AAT77365.1| putative drought induced protein [Oryza sativa Japonica Group]
Length=49

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKI  552
            M  TA C+DIL+AI+LPPLGVFLKFGC +
Sbjct  1    MAGTANCIDILIAIILPPLGVFLKFGCGV  29



>gb|ADC67798.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67800.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67803.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67804.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67807.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67826.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
 gb|ADC67873.1| hypothetical protein POPTRDRAFT_563785 [Populus balsamifera]
Length=54

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LPP+GVFL++GC +EF IC LLT+
Sbjct  1    MGSE-TFLEVILAIILPPVGVFLRYGCGVEFXICLLLTI  38



>dbj|BAK07288.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=100

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  611  ILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            +L+AI LPPLGVF+K+ C++EFWIC +LT F
Sbjct  54   LLIAIFLPPLGVFIKYNCEVEFWICLVLTFF  84



>ref|XP_009618269.1| PREDICTED: uncharacterized protein LOC104110473 [Nicotiana tomentosiformis]
Length=161

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIE  549
             GST T +DILLAI+LPPLGVFLKFGC++ 
Sbjct  2    RGSTQTFIDILLAIILPPLGVFLKFGCEVH  31



>ref|XP_008442650.1| PREDICTED: low temperature-induced protein lt101.2-like [Cucumis 
melo]
Length=69

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  656  IELIIKMGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ++ I K   +AT V++LLAI +PP+GVFL++G  IEFWI  +LT F
Sbjct  7    VDRIPKRMGSATFVEVLLAIFIPPVGVFLRYGIGIEFWIDLVLTFF  52



>ref|XP_003550093.1| PREDICTED: hydrophobic protein RCI2A-like [Glycine max]
 gb|KHN19643.1| Hydrophobic protein RCI2A [Glycine soja]
Length=54

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAILLPP+GVFL++GC +E WI  +LT+
Sbjct  1    MGSE-TFLEVILAILLPPVGVFLRYGCGVELWIDLVLTI  38



>emb|CDY31781.1| BnaC01g27370D [Brassica napus]
Length=52

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -2

Query  626  ATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             + ++IL A+L+PPLGVFL+FGC +EFW+  LLT F
Sbjct  2    GSFLEILCAVLIPPLGVFLRFGCGLEFWLSLLLTFF  37



>ref|XP_009333742.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Pyrus x bretschneideri]
Length=58

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 5/43 (12%)
 Frame = -2

Query  638  MGSTATCVDILLAILLP----PLGVFLKFGCKIEFWICCLLTL  522
            MGS  T ++++LAI+LP    P+GVFL+FGC +EFWIC LLT+
Sbjct  1    MGS-ETFLEVILAIILPTSVTPVGVFLRFGCGVEFWICLLLTI  42



>ref|XP_006843259.1| hypothetical protein AMTR_s00080p00112800 [Amborella trichopoda]
 gb|ERN04934.1| hypothetical protein AMTR_s00080p00112800 [Amborella trichopoda]
Length=76

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 1/40 (3%)
 Frame = -2

Query  638  MGSTATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            MGS  T +++LLAILLPP+GVFL++GC +EFWI  LLT+ 
Sbjct  1    MGSE-TFLEVLLAILLPPVGVFLRYGCGVEFWIDLLLTIL  39



>ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella]
 gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella]
Length=54

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = -2

Query  632  STATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            STAT V+ILLAILLPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  2    STATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLF  39



>ref|XP_010668344.1| PREDICTED: salt stress-induced hydrophobic peptide ESI3-like 
[Beta vulgaris subsp. vulgaris]
Length=54

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  626  ATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTL  522
             T ++++L+I +PP+GVFL++G K+EFWIC +LTL
Sbjct  4    QTVLELVLSIFVPPIGVFLRYGIKVEFWICLVLTL  38



>ref|XP_009113358.1| PREDICTED: UPF0057 membrane protein At1g57550 [Brassica rapa]
 emb|CDY71498.1| BnaAnng37700D [Brassica napus]
Length=52

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  626  ATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
             + ++IL AI +PP+GVFLKFGC +EFW+  LLT F
Sbjct  2    GSFIEILCAIFIPPVGVFLKFGCGLEFWLSLLLTFF  37



>gb|EPS65277.1| hypothetical protein M569_09505, partial [Genlisea aurea]
Length=51

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -2

Query  626  ATCVDILLAILLPPLGVFLKFGCKIEFWICCLLTLF  519
            ATC+DILLAILLPPLGVFLKFGCK+EFWIC +LTLF
Sbjct  1    ATCIDILLAILLPPLGVFLKFGCKLEFWICLILTLF  36



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1664082826224