BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81871_g1_i1 len=739 path=[1:0-738]

Length=739
                                                                      Score     E

emb|CBI20385.3|  unnamed protein product                              66.2    2e-10   
emb|CBI20387.3|  unnamed protein product                              63.9    1e-09   
ref|XP_010644255.1|  PREDICTED: uncharacterized protein LOC100255568  65.9    4e-09   
ref|XP_010445807.1|  PREDICTED: uncharacterized protein LOC104728544  65.5    7e-09   
ref|XP_007040801.1|  Uncharacterized protein TCM_016663               65.1    9e-09   
emb|CDP08013.1|  unnamed protein product                              64.3    1e-08   
ref|XP_010054394.1|  PREDICTED: uncharacterized protein LOC104442692  63.9    2e-08   
ref|XP_010481563.1|  PREDICTED: uncharacterized protein LOC104760353  63.5    3e-08   
ref|XP_010644254.1|  PREDICTED: uncharacterized protein LOC100260642  63.2    4e-08   
emb|CAN75530.1|  hypothetical protein VITISV_001347                   63.2    4e-08   Vitis vinifera
ref|XP_002863470.1|  predicted protein                                62.8    5e-08   
ref|NP_199366.1|  uncharacterized protein                             62.8    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398228.1|  hypothetical protein EUTSA_v10001216mg           62.8    5e-08   
ref|XP_002870001.1|  predicted protein                                62.8    6e-08   
ref|XP_002863471.1|  hypothetical protein ARALYDRAFT_494430           62.0    9e-08   
emb|CDP08030.1|  unnamed protein product                              62.0    1e-07   
ref|XP_009101590.1|  PREDICTED: uncharacterized protein LOC103827792  62.0    1e-07   
ref|XP_002867956.1|  hypothetical protein ARALYDRAFT_914755           61.6    1e-07   
ref|XP_002863605.1|  predicted protein                                61.2    2e-07   
ref|XP_006428082.1|  hypothetical protein CICLE_v10024981mg           60.8    2e-07   
gb|KFK23680.1|  hypothetical protein AALP_AAs63807U000100             60.8    2e-07   
ref|XP_010055454.1|  PREDICTED: uncharacterized protein LOC104443651  60.5    3e-07   
ref|NP_193644.1|  uncharacterized protein                             60.5    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445279.1|  PREDICTED: uncharacterized protein LOC104727922  58.2    4e-07   
ref|XP_010654884.1|  PREDICTED: uncharacterized protein LOC100251572  59.7    5e-07   
gb|ABK28253.1|  unknown                                               59.3    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193643.2|  uncharacterized protein                             59.3    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010095740.1|  hypothetical protein L484_003352                 59.7    5e-07   
ref|XP_006414015.1|  hypothetical protein EUTSA_v10024439mg           59.7    6e-07   
emb|CAA16765.1|  hypothetical protein                                 59.3    6e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011013312.1|  PREDICTED: uncharacterized protein LOC105117361  59.3    6e-07   
ref|XP_010104853.1|  hypothetical protein L484_024054                 59.3    7e-07   
ref|XP_011014308.1|  PREDICTED: uncharacterized protein LOC105118132  59.3    7e-07   
emb|CDY39431.1|  BnaAnng05620D                                        59.3    8e-07   
gb|KFK33780.1|  hypothetical protein AALP_AA5G059100                  58.9    9e-07   
ref|NP_199367.1|  uncharacterized protein                             58.9    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006464315.1|  PREDICTED: uncharacterized protein LOC102620...  58.5    1e-06   
ref|XP_007216037.1|  hypothetical protein PRUPE_ppa017443mg           56.2    1e-06   
emb|CBI35870.3|  unnamed protein product                              58.9    1e-06   
ref|XP_007023048.1|  Uncharacterized protein TCM_027053               58.5    1e-06   
emb|CDY38971.1|  BnaC07g18490D                                        58.5    1e-06   
ref|XP_007217587.1|  hypothetical protein PRUPE_ppa019290mg           58.2    2e-06   
ref|XP_006374604.1|  hypothetical protein POPTR_0015s12600g           58.2    2e-06   
gb|KDP40702.1|  hypothetical protein JCGZ_24701                       58.2    2e-06   
emb|CDP21917.1|  unnamed protein product                              58.2    2e-06   
ref|XP_008224917.1|  PREDICTED: uncharacterized protein LOC103324616  58.2    2e-06   
gb|KDP45937.1|  hypothetical protein JCGZ_11840                       57.4    2e-06   
ref|XP_007214131.1|  hypothetical protein PRUPE_ppa018036mg           57.8    2e-06   
gb|KDP38349.1|  hypothetical protein JCGZ_04274                       57.8    3e-06   
emb|CBI35872.3|  unnamed protein product                              57.8    3e-06   
ref|XP_009377262.1|  PREDICTED: uncharacterized protein LOC103965884  57.0    3e-06   
ref|XP_006280029.1|  hypothetical protein CARUB_v10025906mg           57.8    3e-06   
ref|XP_011014307.1|  PREDICTED: uncharacterized protein LOC105118131  57.4    3e-06   
ref|XP_009371589.1|  PREDICTED: uncharacterized protein LOC103960820  57.4    3e-06   
ref|XP_008342346.1|  PREDICTED: uncharacterized protein LOC103405164  57.4    4e-06   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       57.0    4e-06   
ref|XP_003627290.1|  hypothetical protein MTR_8g020780                57.0    4e-06   
ref|XP_002303248.1|  hypothetical protein POPTR_0003s06300g           57.0    5e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010535680.1|  PREDICTED: uncharacterized protein LOC104810911  57.0    5e-06   
ref|XP_007200116.1|  hypothetical protein PRUPE_ppa018880mg           54.3    5e-06   
ref|XP_010434459.1|  PREDICTED: uncharacterized protein LOC104718...  57.0    5e-06   
ref|XP_006464478.1|  PREDICTED: uncharacterized protein LOC102617005  57.0    5e-06   
ref|XP_006388182.1|  hypothetical protein POPTR_0296s002002g          56.6    6e-06   
ref|XP_004152420.1|  PREDICTED: uncharacterized protein LOC101209159  56.6    6e-06   
ref|XP_007040748.1|  Uncharacterized protein TCM_016622               56.6    6e-06   
ref|XP_011036419.1|  PREDICTED: uncharacterized protein LOC105133946  56.6    6e-06   
gb|KDP43572.1|  hypothetical protein JCGZ_16859                       56.6    7e-06   
ref|XP_006380889.1|  hypothetical protein POPTR_0006s01400g           56.2    7e-06   
ref|XP_002308790.2|  hypothetical protein POPTR_0006s01390g           56.2    7e-06   Populus trichocarpa [western balsam poplar]
ref|XP_002528769.1|  conserved hypothetical protein                   56.2    7e-06   Ricinus communis
ref|XP_008228369.1|  PREDICTED: uncharacterized protein LOC103327780  56.2    7e-06   
gb|KEH43306.1|  DUF594 family protein                                 56.2    8e-06   
ref|XP_010650637.1|  PREDICTED: uncharacterized protein LOC104879475  56.2    9e-06   
gb|KDO53052.1|  hypothetical protein CISIN_1g040228mg                 56.2    9e-06   
ref|XP_006437480.1|  hypothetical protein CICLE_v10030709mg           56.2    1e-05   
ref|XP_006380894.1|  hypothetical protein POPTR_0006s01480g           55.8    1e-05   
ref|XP_004303690.1|  PREDICTED: uncharacterized protein LOC101298623  55.8    1e-05   
ref|XP_011013300.1|  PREDICTED: uncharacterized protein LOC105117357  55.8    1e-05   
gb|KFK31555.1|  hypothetical protein AALP_AA6G127100                  55.8    1e-05   
gb|KEH40110.1|  DUF594 family protein                                 55.8    1e-05   
ref|XP_010494654.1|  PREDICTED: uncharacterized protein LOC104771778  55.8    1e-05   
gb|KDP45940.1|  hypothetical protein JCGZ_11843                       55.8    1e-05   
ref|NP_199360.1|  uncharacterized protein                             55.8    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KDP40701.1|  hypothetical protein JCGZ_24700                       55.5    1e-05   
ref|XP_002863469.1|  hypothetical protein ARALYDRAFT_494429           55.5    1e-05   
ref|XP_011018639.1|  PREDICTED: uncharacterized protein LOC105121611  55.5    1e-05   
ref|XP_010692889.1|  PREDICTED: uncharacterized protein LOC104905931  55.5    1e-05   
gb|KFK31554.1|  hypothetical protein AALP_AA6G127000                  55.5    1e-05   
gb|KHN00983.1|  hypothetical protein glysoja_000651                   55.5    2e-05   
ref|XP_008437035.1|  PREDICTED: uncharacterized protein LOC103482584  55.5    2e-05   
ref|XP_006606322.1|  PREDICTED: uncharacterized protein LOC102663983  55.5    2e-05   
emb|CBI20393.3|  unnamed protein product                              55.5    2e-05   
ref|XP_010449404.1|  PREDICTED: uncharacterized protein LOC104731659  55.5    2e-05   
ref|XP_010644262.1|  PREDICTED: uncharacterized protein LOC100258913  55.5    2e-05   
gb|KFK31559.1|  hypothetical protein AALP_AA6G127600                  55.5    2e-05   
ref|XP_010495724.1|  PREDICTED: uncharacterized protein LOC104772863  55.5    2e-05   
ref|XP_010654435.1|  PREDICTED: uncharacterized protein LOC100256613  55.1    2e-05   
ref|XP_004288842.1|  PREDICTED: uncharacterized protein LOC101309774  55.1    2e-05   
ref|XP_007217388.1|  hypothetical protein PRUPE_ppa025953mg           52.4    2e-05   
gb|KFK28578.1|  hypothetical protein AALP_AA7G015200                  55.1    2e-05   
ref|XP_008371249.1|  PREDICTED: uncharacterized protein LOC103434679  55.1    2e-05   
ref|XP_011040393.1|  PREDICTED: uncharacterized protein LOC105136666  55.1    2e-05   
ref|XP_009101588.1|  PREDICTED: uncharacterized protein LOC103827791  55.1    2e-05   
ref|XP_009128802.1|  PREDICTED: uncharacterized protein LOC103853...  54.7    2e-05   
ref|XP_006414011.1|  hypothetical protein EUTSA_v10025163mg           54.7    2e-05   
ref|XP_010441723.1|  PREDICTED: uncharacterized protein LOC104724861  53.5    2e-05   
emb|CDX90102.1|  BnaA08g18820D                                        54.7    3e-05   
ref|XP_010251958.1|  PREDICTED: uncharacterized protein LOC104593691  54.3    3e-05   
ref|XP_006282059.1|  hypothetical protein CARUB_v10028304mg           54.7    3e-05   
ref|XP_010494655.1|  PREDICTED: uncharacterized protein LOC104771779  54.7    3e-05   
ref|XP_010650602.1|  PREDICTED: uncharacterized protein LOC104879460  54.7    3e-05   
emb|CDY26372.1|  BnaA02g23980D                                        54.7    3e-05   
emb|CDX87778.1|  BnaC02g31710D                                        52.0    3e-05   
ref|XP_007221914.1|  hypothetical protein PRUPE_ppa026837mg           54.7    3e-05   
ref|XP_006342534.1|  PREDICTED: uncharacterized protein LOC102605...  54.3    3e-05   
gb|KFK25862.1|  hypothetical protein AALP_AA8G171900                  54.7    3e-05   
ref|XP_006368456.1|  hypothetical protein POPTR_0001s02970g           54.3    3e-05   
ref|XP_008225847.1|  PREDICTED: uncharacterized protein LOC103325459  54.3    3e-05   
ref|XP_006280006.1|  hypothetical protein CARUB_v10025879mg           54.3    3e-05   
ref|XP_010654879.1|  PREDICTED: uncharacterized protein LOC100246334  54.3    4e-05   
ref|XP_006484676.1|  PREDICTED: uncharacterized protein LOC102625373  54.3    4e-05   
ref|XP_002863477.1|  hypothetical protein ARALYDRAFT_494436           54.3    4e-05   
ref|XP_010650601.1|  PREDICTED: uncharacterized protein LOC104879459  53.9    4e-05   
emb|CBI36698.3|  unnamed protein product                              53.9    4e-05   
ref|XP_006282044.1|  hypothetical protein CARUB_v10028286mg           54.3    4e-05   
ref|XP_010481582.1|  PREDICTED: uncharacterized protein LOC104760366  54.3    4e-05   
emb|CAN83022.1|  hypothetical protein VITISV_036395                   53.9    4e-05   Vitis vinifera
ref|XP_010494649.1|  PREDICTED: uncharacterized protein LOC104771771  53.9    4e-05   
ref|XP_010648157.1|  PREDICTED: uncharacterized protein LOC100255511  53.9    5e-05   
ref|XP_006428002.1|  hypothetical protein CICLE_v10025090mg           53.9    5e-05   
gb|KEH43307.1|  DUF594 family protein                                 53.9    5e-05   
ref|XP_006388862.1|  hypothetical protein POPTR_0088s00260g           53.9    5e-05   
ref|XP_010034349.1|  PREDICTED: uncharacterized protein LOC104423580  53.5    5e-05   
ref|XP_010449415.1|  PREDICTED: uncharacterized protein LOC104731663  53.9    5e-05   
ref|XP_010032441.1|  PREDICTED: uncharacterized protein LOC104421...  53.5    6e-05   
emb|CDY39432.1|  BnaAnng05630D                                        53.9    6e-05   
ref|XP_007217306.1|  hypothetical protein PRUPE_ppa015371mg           53.5    6e-05   
ref|XP_010441710.1|  PREDICTED: uncharacterized protein LOC104724...  53.5    6e-05   
emb|CDY38969.1|  BnaC07g18510D                                        53.5    6e-05   
ref|XP_009372850.1|  PREDICTED: uncharacterized protein LOC103961896  53.5    6e-05   
ref|NP_199361.1|  uncharacterized protein                             53.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008228196.1|  PREDICTED: uncharacterized protein LOC103327633  53.5    7e-05   
ref|XP_010032440.1|  PREDICTED: uncharacterized protein LOC104421...  53.5    7e-05   
ref|XP_011040249.1|  PREDICTED: uncharacterized protein LOC105136553  53.5    7e-05   
ref|XP_010441713.1|  PREDICTED: uncharacterized protein LOC104724...  53.5    7e-05   
ref|XP_010650636.1|  PREDICTED: uncharacterized protein LOC104879474  53.5    7e-05   
ref|XP_006374420.1|  hypothetical protein POPTR_0015s07020g           53.5    7e-05   
emb|CBI34045.3|  unnamed protein product                              53.1    7e-05   
emb|CDP19717.1|  unnamed protein product                              53.1    7e-05   
ref|XP_006374419.1|  hypothetical protein POPTR_0015s07020g           53.5    7e-05   
ref|XP_004253121.1|  PREDICTED: uncharacterized protein LOC101249163  53.5    7e-05   
ref|XP_004496124.1|  PREDICTED: uncharacterized protein LOC101496417  53.1    8e-05   
gb|KHN00959.1|  hypothetical protein glysoja_000627                   53.1    8e-05   
ref|XP_006388860.1|  hypothetical protein POPTR_0088s00240g           53.1    8e-05   
ref|XP_011012477.1|  PREDICTED: uncharacterized protein LOC105116722  53.1    9e-05   
ref|XP_003555479.1|  PREDICTED: uncharacterized protein LOC100799916  53.1    1e-04   
ref|XP_002321761.2|  hypothetical protein POPTR_0015s11930g           53.1    1e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006374609.1|  hypothetical protein POPTR_0015s12660g           52.8    1e-04   
ref|XP_011043924.1|  PREDICTED: uncharacterized protein LOC105139246  52.4    1e-04   
ref|XP_007214073.1|  hypothetical protein PRUPE_ppa017743mg           53.1    1e-04   
ref|XP_007227431.1|  hypothetical protein PRUPE_ppb023961mg           51.6    1e-04   
ref|XP_007015633.1|  Uncharacterized protein TCM_041206               52.8    1e-04   
ref|XP_006374598.1|  hypothetical protein POPTR_0015s12510g           52.8    1e-04   
ref|XP_010034767.1|  PREDICTED: uncharacterized protein LOC104424081  52.4    1e-04   
ref|XP_006380760.1|  hypothetical protein POPTR_0007s12830g           52.4    1e-04   
ref|XP_006398229.1|  hypothetical protein EUTSA_v10000780mg           52.8    1e-04   
ref|XP_002863480.1|  hypothetical protein ARALYDRAFT_916927           52.8    1e-04   
ref|XP_010529242.1|  PREDICTED: uncharacterized protein LOC104806182  52.8    1e-04   
ref|XP_010441715.1|  PREDICTED: uncharacterized protein LOC104724856  52.4    2e-04   
ref|XP_009758086.1|  PREDICTED: uncharacterized protein LOC104210813  52.4    2e-04   
ref|XP_007201599.1|  hypothetical protein PRUPE_ppa019270mg           52.4    2e-04   
ref|XP_010481570.1|  PREDICTED: uncharacterized protein LOC104760...  52.4    2e-04   
ref|XP_010481571.1|  PREDICTED: uncharacterized protein LOC104760...  52.4    2e-04   
ref|XP_009595825.1|  PREDICTED: uncharacterized protein LOC104092041  52.0    2e-04   
ref|XP_010441702.1|  PREDICTED: uncharacterized protein LOC104724847  52.0    2e-04   
ref|XP_010494665.1|  PREDICTED: uncharacterized protein LOC104771784  52.0    2e-04   
gb|KCW80598.1|  hypothetical protein EUGRSUZ_C01961                   49.3    2e-04   
ref|XP_010481573.1|  PREDICTED: uncharacterized protein LOC104760360  52.0    2e-04   
ref|XP_006374605.1|  hypothetical protein POPTR_0015s12610g           52.0    2e-04   
ref|XP_006573316.1|  PREDICTED: uncharacterized protein LOC102662...  52.0    2e-04   
ref|XP_010481562.1|  PREDICTED: uncharacterized protein LOC104760352  52.0    2e-04   
ref|XP_006573315.1|  PREDICTED: uncharacterized protein LOC102662...  51.6    3e-04   
gb|KHN00961.1|  hypothetical protein glysoja_000629                   51.6    3e-04   
emb|CDY52752.1|  BnaA07g37670D                                        48.1    3e-04   
gb|KHN43840.1|  hypothetical protein glysoja_039087                   51.6    3e-04   
ref|XP_002863478.1|  hypothetical protein ARALYDRAFT_494437           51.6    3e-04   
ref|XP_006280036.1|  hypothetical protein CARUB_v10025913mg           51.6    3e-04   
ref|XP_006606311.1|  PREDICTED: uncharacterized protein LOC102661...  51.6    3e-04   
ref|XP_006446040.1|  hypothetical protein CICLE_v10018365mg           51.2    3e-04   
ref|XP_007041677.1|  Uncharacterized protein TCM_006509               51.6    3e-04   
emb|CAN83020.1|  hypothetical protein VITISV_036393                   51.6    3e-04   Vitis vinifera
gb|KDO64837.1|  hypothetical protein CISIN_1g047649mg                 50.8    3e-04   
ref|XP_010042029.1|  PREDICTED: uncharacterized protein LOC104431034  51.6    3e-04   
ref|XP_010905306.1|  PREDICTED: uncharacterized protein LOC105032542  51.6    3e-04   
ref|XP_011001065.1|  PREDICTED: uncharacterized protein LOC105108443  51.6    3e-04   
gb|EYU27017.1|  hypothetical protein MIMGU_mgv1a019065mg              51.6    3e-04   
ref|XP_010650638.1|  PREDICTED: uncharacterized protein LOC104879477  51.6    3e-04   
ref|XP_004496121.1|  PREDICTED: uncharacterized protein LOC101495...  51.6    3e-04   
ref|XP_010040125.1|  PREDICTED: uncharacterized protein LOC104428901  51.2    3e-04   
ref|XP_002322521.2|  hypothetical protein POPTR_0016s01380g           51.2    3e-04   Populus trichocarpa [western balsam poplar]
ref|XP_006398219.1|  hypothetical protein EUTSA_v10000775mg           51.2    4e-04   
emb|CBI36708.3|  unnamed protein product                              51.2    4e-04   
ref|XP_002510230.1|  conserved hypothetical protein                   51.2    4e-04   Ricinus communis
ref|XP_002322346.2|  hypothetical protein POPTR_0015s12520g           50.8    5e-04   Populus trichocarpa [western balsam poplar]
ref|XP_010034372.1|  PREDICTED: uncharacterized protein LOC104423603  50.8    5e-04   
emb|CAN77530.1|  hypothetical protein VITISV_041426                   50.8    5e-04   Vitis vinifera
ref|XP_004496298.1|  PREDICTED: uncharacterized protein LOC101495324  50.8    5e-04   
emb|CDY07584.1|  BnaC06g14800D                                        47.8    5e-04   
ref|XP_009128804.1|  PREDICTED: uncharacterized protein LOC103853646  50.8    6e-04   
gb|EAY81637.1|  hypothetical protein OsI_36806                        50.8    6e-04   Oryza sativa Indica Group [Indian rice]
emb|CDX83934.1|  BnaC08g17110D                                        50.8    6e-04   
ref|XP_006374593.1|  hypothetical protein POPTR_0015s12370g           47.8    6e-04   
emb|CBI36717.3|  unnamed protein product                              49.7    6e-04   
ref|XP_006426735.1|  hypothetical protein CICLE_v10025020mg           50.4    6e-04   
ref|XP_003561517.1|  PREDICTED: uncharacterized protein LOC100832608  50.8    6e-04   
ref|XP_007041672.1|  Uncharacterized protein TCM_006503               50.8    6e-04   
ref|XP_006387337.1|  hypothetical protein POPTR_1227s00200g           50.1    7e-04   
gb|EMT19134.1|  hypothetical protein F775_22189                       50.4    7e-04   
ref|XP_004983450.1|  PREDICTED: uncharacterized protein LOC101760534  50.4    7e-04   
ref|XP_006421701.1|  hypothetical protein CICLE_v10006737mg           50.1    7e-04   
gb|KDO39751.1|  hypothetical protein CISIN_1g005146mg                 50.4    8e-04   
ref|XP_006465849.1|  PREDICTED: uncharacterized protein LOC102607...  50.4    8e-04   
ref|XP_002459209.1|  hypothetical protein SORBIDRAFT_02g000570        50.4    8e-04   Sorghum bicolor [broomcorn]
ref|XP_008228365.1|  PREDICTED: uncharacterized protein LOC103327776  50.4    8e-04   
ref|XP_006380891.1|  hypothetical protein POPTR_0006s01430g           50.1    8e-04   
gb|KCW53510.1|  hypothetical protein EUGRSUZ_J02785                   50.1    9e-04   
ref|XP_006388856.1|  hypothetical protein POPTR_0088s00200g           50.1    9e-04   
ref|XP_011043926.1|  PREDICTED: uncharacterized protein LOC105139249  50.1    9e-04   
ref|XP_011008994.1|  PREDICTED: uncharacterized protein LOC105114208  50.1    9e-04   
ref|XP_011043925.1|  PREDICTED: uncharacterized protein LOC105139248  50.1    9e-04   
emb|CDX87780.1|  BnaC02g31690D                                        50.4    0.001   
emb|CDP16262.1|  unnamed protein product                              50.1    0.001   
emb|CAN83215.1|  hypothetical protein VITISV_018465                   50.1    0.001   Vitis vinifera
ref|XP_010650649.1|  PREDICTED: uncharacterized protein LOC100852780  50.1    0.001   
gb|KFK31560.1|  hypothetical protein AALP_AA6G127700                  50.1    0.001   



>emb|CBI20385.3| unnamed protein product [Vitis vinifera]
Length=157

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C++LL+ D  +  +  E++    KSVL  A  +A+++       N TK+      WK +S
Sbjct  49   CEQLLSVD--TVVNPIEVKGDRSKSVLFDACMLAKDLRKL----NKTKR------WKIMS  96

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            +VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+GL E
Sbjct  97   KVWVELLSYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGE  140



>emb|CBI20387.3| unnamed protein product [Vitis vinifera]
Length=131

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C++LL+ D  +     E++    KSVL  A  +A+++       N TK+      W  +S
Sbjct  23   CEQLLSVD--TVVKPIEVKGDRSKSVLFDACMLAKDLRKL----NKTKR------WMIMS  70

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            +VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+GL E
Sbjct  71   KVWVELLSYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGE  114



>ref|XP_010644255.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644256.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
 ref|XP_010644258.1| PREDICTED: uncharacterized protein LOC100255568 [Vitis vinifera]
Length=733

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 61/104 (59%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C++LL+ D  +  +  E++    KSVL  A  +A+++       N TK+      WK +S
Sbjct  625  CEQLLSVD--TVVNPIEVKGDRSKSVLFDACMLAKDLRKL----NKTKR------WKIMS  672

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            +VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+GL E
Sbjct  673  KVWVELLSYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGE  716



>ref|XP_010445807.1| PREDICTED: uncharacterized protein LOC104728544 [Camelina sativa]
Length=819

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 11/97 (11%)
 Frame = -3

Query  647  SCNDKKE---LENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            S N+K E   ++    KSVL +A  +A+E+MN    +N   +      W+ +S+VW  LL
Sbjct  691  SVNNKIEPMLVKGDRSKSVLFEASMLAKELMNLKETSNGDGK------WRVMSKVWVELL  744

Query  476  VYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             YA+SHC+  E V  L +GG+   FV LLMAH+GL +
Sbjct  745  CYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLAD  781



>ref|XP_007040801.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
 gb|EOY25302.1| Uncharacterized protein TCM_016663 [Theobroma cacao]
Length=778

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 23/141 (16%)
 Frame = -3

Query  725  QKQGILCWRQISRKK------PCQRLL--NGDYSSCNDKKELENKYKKSVLPKAVEVARE  570
            +++G+L  R+ ++KK       C+ ++  N D      K +      KSVL  A  +A+E
Sbjct  646  ERRGLLSKRKGNKKKENRVAEACEAIISVNTDVKPVTVKGD----RSKSVLFDASMLAKE  701

Query  569  IMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLL  396
            +        N  +++  + WK LS VW  L+ YA+SHCR + +   L KGG+  TF+ LL
Sbjct  702  L--------NVLEKKGLQKWKLLSRVWVELISYAASHCRANTHAQQLSKGGELLTFIWLL  753

Query  395  MAHYGLQEILE-GEKHSFPEL  336
            MAH+GL E  +  E H+  +L
Sbjct  754  MAHFGLGEQFQINEGHARAKL  774



>emb|CDP08013.1| unnamed protein product [Coffea canephora]
Length=630

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 59/108 (55%), Gaps = 14/108 (13%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            ++  C+ LLN +  +     E++    KS+L  A  +A          N+ K+    + W
Sbjct  518  KRNACKNLLNVN--ALVRAIEVKGDRSKSILFDACRLA----------NDLKKLNDNKMW  565

Query  509  KGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            + +S+VW  LL YA+SHCR + +   L KGG+  TFV +LMAH+GL E
Sbjct  566  EIMSKVWVELLSYAASHCRANAHAQQLSKGGELITFVWILMAHFGLGE  613



>ref|XP_010054394.1| PREDICTED: uncharacterized protein LOC104442692 [Eucalyptus grandis]
Length=750

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 42/120 (35%), Positives = 62/120 (52%), Gaps = 16/120 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C ++L  D S      +++    KSVL     +A+E+   D           +  WK
Sbjct  640  KDACLKILEVDTSV--KPMDVKGDRSKSVLFDGCILAKELKKLD-----------EHKWK  686

Query  506  GLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
             +S+VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+G+ E  +  E H+  +L
Sbjct  687  IMSKVWVELLSYAASHCRAETHAQLLSKGGELVTFVWLLMAHFGIGEQFQINEGHARAKL  746



>ref|XP_010481563.1| PREDICTED: uncharacterized protein LOC104760353 [Camelina sativa]
Length=798

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 11/103 (11%)
 Frame = -3

Query  647  SCNDKKE---LENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            S N+K E   ++    KSVL +A  +A+E+ N    +N   +      W+ LS+VW  LL
Sbjct  691  SVNNKIEPMLVKGDRSKSVLFEASMLAKELGNLKETSNGDGK------WRVLSKVWVELL  744

Query  476  VYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
             YA+SHC+  E V  L +GG+  +FV LLMAH+GL +  +  K
Sbjct  745  CYAASHCKATEHVAQLSRGGELLSFVWLLMAHFGLADQFQINK  787



>ref|XP_010644254.1| PREDICTED: uncharacterized protein LOC100260642 [Vitis vinifera]
Length=721

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C++LL+ D  +     E++    KSVL  A  +A+++       N TK+      W  +S
Sbjct  613  CEQLLSVD--TVVKPIEVKGDRSKSVLFDACMLAKDLRKL----NKTKR------WMIMS  660

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            +VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+GL E
Sbjct  661  KVWVELLSYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGE  704



>emb|CAN75530.1| hypothetical protein VITISV_001347 [Vitis vinifera]
Length=730

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (57%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C++LL+ D  +     E++    KSVL  A  +A+++       N TK+      W  +S
Sbjct  630  CEQLLSVD--TVVKPIEVKGDRSKSVLFDACMLAKDLRKL----NKTKR------WMIMS  677

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            +VW  LL YA+SHCR + +   L KGG+  TFV LLMAH+GL E
Sbjct  678  KVWVELLSYAASHCRANTHAQQLSKGGELITFVWLLMAHFGLGE  721



>ref|XP_002863470.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39729.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=749

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 6/87 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+     E+NN++    +  W+ LS+VW  LL YA+S C+  E V  L
Sbjct  656  KSVLFDASMLAKELQRL--EDNNSRNGYGK--WRVLSKVWVELLCYAASQCKAMEHVAQL  711

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +GG+  +FV LLMAH+GL +  E +K
Sbjct  712  SRGGELLSFVWLLMAHFGLSDQFEIDK  738



>ref|NP_199366.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09181.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95265.1| uncharacterized protein AT5G45530 [Arabidopsis thaliana]
Length=798

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 8/79 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+ N    +N   +      W+ LS+VW  LL YA+SHC+  E V  L
Sbjct  706  KSVLFDASMLAKELQNLKESSNEDGK------WRVLSKVWVELLCYAASHCKATEHVAQL  759

Query  434  KKGGQFYTFVRLLMAHYGL  378
             +GG+   FV LLMAH+GL
Sbjct  760  SRGGELLNFVWLLMAHFGL  778



>ref|XP_006398228.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
 gb|ESQ39681.1| hypothetical protein EUTSA_v10001216mg [Eutrema salsugineum]
Length=813

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 53/97 (55%), Gaps = 6/97 (6%)
 Frame = -3

Query  650  SSCNDKKELENK--YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            S CND + +  K    KSVL  A  +A+E+   D    +      +  W+ LS+VW  LL
Sbjct  695  SVCNDIEPMNVKGDRSKSVLFDASMLAKELQRLDESGGSDDGADGK--WRVLSKVWVELL  752

Query  476  VYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             YA+SHC   E V  L +GG+   FV LLMAH+GL +
Sbjct  753  SYAASHCEATEHVAQLSRGGELLNFVWLLMAHFGLAD  789



>ref|XP_002870001.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46260.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=788

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 13/118 (11%)
 Frame = -3

Query  725  QKQGILCWRQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPEN  546
            +K GI+  R +  K   +++L+ D S   + ++++  + KSVL +   VA+E+   + + 
Sbjct  680  KKMGIINSRSV--KLASEKILSVDTSI--EARDVKGNHSKSVLFEVSSVAKELQKMEKDF  735

Query  545  NNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
               K       WK LS+VW   L +A+SHC     +  L KGG+F  FV LLMAH+GL
Sbjct  736  GKDK-------WKTLSKVWLEFLFHAASHCDGTTRLELLSKGGEFINFVWLLMAHFGL  786



>ref|XP_002863471.1| hypothetical protein ARALYDRAFT_494430 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39730.1| hypothetical protein ARALYDRAFT_494430 [Arabidopsis lyrata subsp. 
lyrata]
Length=798

 Score = 62.0 bits (149),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 10/80 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMN-TDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYY  438
            KSVL  A  +A+++ N  D  N + K       WK LS+VW  LL YA+SHC+  E V  
Sbjct  707  KSVLFDASMLAKKLQNLKDSSNEDGK-------WKVLSKVWVELLCYAASHCKATEHVAQ  759

Query  437  LKKGGQFYTFVRLLMAHYGL  378
            L +GG+   FV LLMAH+GL
Sbjct  760  LSRGGELLNFVWLLMAHFGL  779



>emb|CDP08030.1| unnamed protein product [Coffea canephora]
Length=637

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 59/110 (54%), Gaps = 20/110 (18%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKE---LENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQE  516
            +  C++LLN      N   E   ++    KSVL  A  +A+++ N + +           
Sbjct  526  RVACEKLLN-----VNTDVEPIYVKGDRSKSVLFDACRLAKDLRNLEDDQR---------  571

Query  515  FWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             W+ +S+VW  LL YA+SHCR + +   L KGG+  TFV +LMAH+GL E
Sbjct  572  -WEIMSKVWVELLSYAASHCRPNAHAQELSKGGELITFVWILMAHFGLGE  620



>ref|XP_009101590.1| PREDICTED: uncharacterized protein LOC103827792 [Brassica rapa]
Length=807

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+   D  ++++        W+ LS+VW  LL YA+SHC+  E V  L
Sbjct  710  KSVLFDASMLAKELKRLDESSSSSSASHGDGKWRVLSKVWVELLSYAASHCKATEQVAQL  769

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +GG+   FV LLMAH+GL +  +  K
Sbjct  770  SRGGELLNFVWLLMAHFGLADQFQINK  796



>ref|XP_002867956.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44215.1| hypothetical protein ARALYDRAFT_914755 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 15/108 (14%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYK-KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            KK C+ +++  Y     + E    Y+ KSVL +A  +A+E+   D            + W
Sbjct  688  KKACKEIMD-SYKKVERRYENTKGYQSKSVLVQANILAKELQRID-----------GDMW  735

Query  509  KGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S+VW  +L YA+SHC  ++    L KGG+   FV LLMAH+GL E
Sbjct  736  EVVSKVWVEMLCYAASHCDSKQHAAQLNKGGELINFVWLLMAHFGLGE  783



>ref|XP_002863605.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39864.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=488

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 8/87 (9%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+ N    +N   +      W+ LS+VW  LL YA+SHC+  E V  L
Sbjct  397  KSVLFDASMLAKELRNLKESSNEDGK------WRVLSKVWVELLCYAASHCKATEHVAQL  450

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +GG+   FV LLM H+GL +  E  K
Sbjct  451  SRGGELLNFVWLLMVHFGLADKFEINK  477



>ref|XP_006428082.1| hypothetical protein CICLE_v10024981mg [Citrus clementina]
 gb|ESR41322.1| hypothetical protein CICLE_v10024981mg [Citrus clementina]
Length=742

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 14/113 (12%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            KK C+ +L  D S     ++++    KSVL  A  +A+E+          ++ +  + WK
Sbjct  625  KKACESILKVDTSF--PPRDVKGDKTKSVLFDASVLAKEL----------QELEVGKKWK  672

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +S+VW  LL YA+ HC  R     + +GG+  TFV LLMAH+GL E  E  K
Sbjct  673  LVSQVWVELLSYAAFHCGPRTHAQQVSEGGELITFVWLLMAHFGLVEQFEDNK  725



>gb|KFK23680.1| hypothetical protein AALP_AAs63807U000100 [Arabis alpina]
Length=767

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 37/106 (35%), Positives = 60/106 (57%), Gaps = 18/106 (17%)
 Frame = -3

Query  683  KPCQRLLNGDYSSCNDKKELENK--YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            + C+ +L    SS +D KE + K   +++VL  A  +A+ +          KQ      W
Sbjct  657  QACKEIL----SSVDDLKERKGKRYQRRNVLADASSLAKAL----------KQLNGDMMW  702

Query  509  KGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            + +S+VW  +L YA++HC  ++ V  L +GG+F +FV LLMAH+GL
Sbjct  703  QVMSKVWVEMLCYAATHCDPKQHVALLSRGGEFLSFVWLLMAHFGL  748



>ref|XP_010055454.1| PREDICTED: uncharacterized protein LOC104443651 [Eucalyptus grandis]
Length=711

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 45/81 (56%), Gaps = 13/81 (16%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+ +M    E            WK +S+VW  LL YA+SHCR   +   L
Sbjct  625  KSVLFDASRLAQALMMFKEEK-----------WKIISKVWVELLSYAASHCRATAHAHQL  673

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             KGG+  TFV LLMAH+GL E
Sbjct  674  SKGGELVTFVWLLMAHFGLGE  694



>ref|NP_193644.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA16766.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78911.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE84138.1| uncharacterized protein AT4G19090 [Arabidopsis thaliana]
Length=751

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 11/105 (10%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K   + +L+ D S   + +E++  + KSVL +A  +A+E+   +      K       WK
Sbjct  654  KLASKEILSADTSI--EPREVKGNHSKSVLFEASSLAKELQRVEKNFGEDK-------WK  704

Query  506  GLSEVWAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGL  378
             LS+VW   L +A+SHC     +  L KGG+F  FV LLMAH+GL
Sbjct  705  ILSKVWLEFLFHAASHCDATTRMELLSKGGEFINFVWLLMAHFGL  749



>ref|XP_010445279.1| PREDICTED: uncharacterized protein LOC104727922 [Camelina sativa]
Length=197

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 50/88 (57%), Gaps = 9/88 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++  + KSVL +A  VA+E++  D      K       W+ LS+VW   L +A+SHC  
Sbjct  117  DVKGNHCKSVLFEASSVAKELLKLDKGCEKDK-------WEVLSKVWLEFLFHAASHCDG  169

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
               +  L KGG+F  FV LLMAH+GL +
Sbjct  170  TARLELLSKGGEFINFVWLLMAHFGLGD  197



>ref|XP_010654884.1| PREDICTED: uncharacterized protein LOC100251572 [Vitis vinifera]
Length=696

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 63/117 (54%), Gaps = 17/117 (15%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +R + C+ LL  D     D K ++    KSVL +A  +A+ + + + E          E 
Sbjct  549  NRNEACRLLLEVDL----DPKMVKGDKSKSVLFEACRLAKTLKSLEMEMG--------EK  596

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGE  357
            WK +SEVW  +L YA+SHC   +    L++GG+  T V LLM+H GL E   ILEGE
Sbjct  597  WKMVSEVWVEMLCYAASHCGWIQHGQQLRRGGELLTHVCLLMSHLGLSEQFQILEGE  653



>gb|ABK28253.1| unknown [Arabidopsis thaliana]
Length=328

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KS+L +A  +A+E+++   E  N         WK +S+VW  +L YA++HC  ++    L
Sbjct  229  KSMLFQASMLAKELLHITNERGN------DAMWKVVSKVWVEMLCYAATHCDSKQHAAQL  282

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             KGG+   FV LLMAH+GL E
Sbjct  283  NKGGELINFVWLLMAHFGLGE  303



>ref|NP_193643.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ABE65529.1| hypothetical protein At4g19080 [Arabidopsis thaliana]
 gb|AEE84137.1| uncharacterized protein AT4G19080 [Arabidopsis thaliana]
Length=327

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KS+L +A  +A+E+++   E  N         WK +S+VW  +L YA++HC  ++    L
Sbjct  229  KSMLFQASMLAKELLHITNERGN------DAMWKVVSKVWVEMLCYAATHCDSKQHAAQL  282

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             KGG+   FV LLMAH+GL E
Sbjct  283  NKGGELINFVWLLMAHFGLGE  303



>ref|XP_010095740.1| hypothetical protein L484_003352 [Morus notabilis]
 gb|EXB62123.1| hypothetical protein L484_003352 [Morus notabilis]
Length=734

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 64/119 (54%), Gaps = 18/119 (15%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKK--ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKG  504
            C RLL  D     D K   ++ K  KSVL  A  +A+E+ N + +N           W+ 
Sbjct  625  CTRLLKVD---TEDYKPATVKGKKSKSVLFDACVLAKELRNMEEKNR----------WEF  671

Query  503  LSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGL-QEILEGEKHSFPEL  336
            +S++W GLL YA+  CR   +   L KGG+  T+V LLMAH+G+ +++   E H+  +L
Sbjct  672  VSKIWVGLLSYAACRCRPSPHLDLLGKGGELITYVWLLMAHFGVGKQLYVTEDHATAKL  730



>ref|XP_006414015.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
 gb|ESQ55468.1| hypothetical protein EUTSA_v10024439mg [Eutrema salsugineum]
Length=812

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 59/108 (55%), Gaps = 10/108 (9%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYK-KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            K  C+ +L+  Y     + E    Y+ KSVL +A  +A+E++    +  N+K       W
Sbjct  688  KMACKAILD-SYKVDGQRNENAKVYRSKSVLFQASMLAKELLRIQTQQGNSK------MW  740

Query  509  KGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S+VW  +L YA++HC  ++    L +GG+   FV LLMA +GL E
Sbjct  741  EVVSKVWVEMLCYAATHCDSKQHAAQLNRGGELINFVWLLMAQFGLGE  788



>emb|CAA16765.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78910.1| hypothetical protein [Arabidopsis thaliana]
Length=514

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 8/81 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KS+L +A  +A+E+++   E  N         WK +S+VW  +L YA++HC  ++    L
Sbjct  416  KSMLFQASMLAKELLHITNERGN------DAMWKVVSKVWVEMLCYAATHCDSKQHAAQL  469

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             KGG+   FV LLMAH+GL E
Sbjct  470  NKGGELINFVWLLMAHFGLGE  490



>ref|XP_011013312.1| PREDICTED: uncharacterized protein LOC105117361 [Populus euphratica]
Length=636

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 24/119 (20%)
 Frame = -3

Query  707  CWRQISRKKPCQRLLNGDYSSCNDKKELENKYKK-----SVLPKAVEVAREIMNTDPENN  543
            CWR        + +   D+ S    +E  NK KK     S+L  A ++A+E+ +  PENN
Sbjct  516  CWRS-------EIITPTDWGS----EEFLNKIKKNGNKVSMLRDACKLAKELQS--PENN  562

Query  542  NTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            +T +++    W+ +S++W  +L YA+S+C  +E    L +GG+  T V LLMAH GL E
Sbjct  563  STSEKK----WRMISQIWVEMLAYAASNCGWKEYAQALTRGGELLTRVCLLMAHLGLSE  617



>ref|XP_010104853.1| hypothetical protein L484_024054 [Morus notabilis]
 gb|EXC02089.1| hypothetical protein L484_024054 [Morus notabilis]
Length=801

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 14/94 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVY--YL  435
            KSVL  A  +A+E+           QQ  +E W+ L +VW  +L YA+SHCR + +   L
Sbjct  715  KSVLFDACILAKEL-----------QQFGEEKWEILIKVWVEMLSYAASHCRPEAHAQQL  763

Query  434  KKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
             KGG+  TF+ LLMAH+GL +  +  E H+  +L
Sbjct  764  SKGGELITFIWLLMAHFGLGDQFQINEGHARAKL  797



>ref|XP_011014308.1| PREDICTED: uncharacterized protein LOC105118132 [Populus euphratica]
Length=685

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 66/119 (55%), Gaps = 24/119 (20%)
 Frame = -3

Query  707  CWRQISRKKPCQRLLNGDYSSCNDKKELENKYKK-----SVLPKAVEVAREIMNTDPENN  543
            CWR        + +   D+ S    +E  NK KK     S+L  A ++A+E+ +  PENN
Sbjct  565  CWRS-------EIITPTDWGS----EEFLNKIKKNGNKVSMLRDACKLAKELQS--PENN  611

Query  542  NTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            +T +++    W+ +S++W  +L YA+S+C  +E    L +GG+  T V LLMAH GL E
Sbjct  612  STSEKK----WRMISQIWVEMLAYAASNCGWKEYAQALTRGGELLTRVCLLMAHLGLSE  666



>emb|CDY39431.1| BnaAnng05620D [Brassica napus]
Length=699

 Score = 59.3 bits (142),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 12/81 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+   D EN           W+ LS+VW  LL YA+SHC+  E V  L
Sbjct  612  KSVLFDASMLAKELKRLD-ENGK---------WRVLSKVWVELLSYAASHCKATEQVAQL  661

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+   FV LLMAH+GL +
Sbjct  662  SRGGELLNFVWLLMAHFGLAD  682



>gb|KFK33780.1| hypothetical protein AALP_AA5G059100 [Arabis alpina]
Length=509

 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 56/107 (52%), Gaps = 11/107 (10%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C+ +L     S  D  +++    KSVL  A  +A+++M  + +N   K       W+
Sbjct  395  KVACKTILK--VRSDIDPMDVKGDQSKSVLFDASRLAKDLMEMETKNGKNK-------WE  445

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             LS+VW  LL YA+ HC  +  V  L +G +   FV LLMAH+GL +
Sbjct  446  ILSKVWVELLCYAACHCDTKAHVEQLSRGAELINFVWLLMAHFGLTD  492



>ref|NP_199367.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09182.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95266.1| uncharacterized protein AT5G45540 [Arabidopsis thaliana]
Length=803

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 56/105 (53%), Gaps = 15/105 (14%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C+ +L+ +     D   ++    KSVL  A  +A+E+MN           + +  W+
Sbjct  693  KEACRAILSVNTEI--DPMAVKGDRSKSVLFDASVLAKELMN-----------EGENMWE  739

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
             +S+VW  LL YAS HC  +E    L KGG+   FV LLMAH+GL
Sbjct  740  VVSKVWVELLCYASLHCDSQEHASQLSKGGELINFVWLLMAHFGL  784



>ref|XP_006464315.1| PREDICTED: uncharacterized protein LOC102620009 isoform X1 [Citrus 
sinensis]
Length=356

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 14/113 (12%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            KK C+ +L  D S     ++++    KSVL  A  +A+E+          ++ +  + WK
Sbjct  239  KKACESILKVDTSF--PPRDVKGDKTKSVLFDASVLAKEL----------QELEVGKKWK  286

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +S+VW  LL YA+ HC  R     + +GG+  TFV LLMAH+GL E  E  K
Sbjct  287  LVSQVWVELLSYAAFHCGPRTHAQQVSEGGELITFVWLLMAHFGLVEQFEDNK  339



>ref|XP_007216037.1| hypothetical protein PRUPE_ppa017443mg [Prunus persica]
 gb|EMJ17236.1| hypothetical protein PRUPE_ppa017443mg [Prunus persica]
Length=154

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -3

Query  698  QISRKKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQ  525
            ++  +K C +LL+     C D    +++    KSVL  A  +A+ + + D +   T  ++
Sbjct  33   KLGERKACTKLLD----MCTDILPSKVKGDRSKSVLFDACRLAKALQSLDSDRGWTNGRK  88

Query  524  PQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEK  354
                W+ +S VW  +L YA++ CR       L++GG+  T V LLMAH GL E  +  E 
Sbjct  89   ----WQFVSHVWVEMLPYAANQCRWSGQAQKLRRGGELLTHVWLLMAHLGLTEQFQISEG  144

Query  353  HSFPEL  336
            H+  +L
Sbjct  145  HARAKL  150



>emb|CBI35870.3| unnamed protein product [Vitis vinifera]
Length=1234

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 15/117 (13%)
 Frame = -3

Query  692   SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
             +R + C+ LL  D       KE++    KSVL +A  +A+E+ + + E          E 
Sbjct  1097  NRNEACRLLLEVDTEV--QPKEVKGDKSKSVLFEACRLAKELKSLNMEMG--------EK  1146

Query  512   WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGE  357
             W  +S VW  +L +A+SHC   +    L +GG+  T V LLM+H GL E   ILEGE
Sbjct  1147  WMMVSHVWVEMLCHAASHCGWIQHGQQLGRGGELLTHVSLLMSHLGLTEQFQILEGE  1203



>ref|XP_007023048.1| Uncharacterized protein TCM_027053 [Theobroma cacao]
 gb|EOY25670.1| Uncharacterized protein TCM_027053 [Theobroma cacao]
Length=809

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 62/128 (48%), Gaps = 11/128 (9%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELEN----KYKKSVLPKAVEVAREIMNTDPENNNTK  534
            R +  ++ C+ LL    +       +E     + K  +L K   +A+++ N  P N    
Sbjct  601  RDMQMEEACKELLERGTNILQGNNIMEKLTVARSKPVILSKGCILAKQLQNLKPPN----  656

Query  533  QQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEG  360
             Q  +E W  +++VW  LL YA+ HC  +E   +L  GGQ  T V LLMAH+G+    + 
Sbjct  657  -QARKEKWDMMNKVWVELLTYAAGHCGWKEHAQHLASGGQLLTHVCLLMAHFGISGQFQD  715

Query  359  EKHSFPEL  336
            +   F +L
Sbjct  716  KSFYFLQL  723



>emb|CDY38971.1| BnaC07g18490D [Brassica napus]
Length=687

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 12/81 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+   D    N K       W+ LS+VW  LL YA+SHC+  E V  L
Sbjct  600  KSVLFDASMLAKELKRLD---GNGK-------WRVLSKVWVELLSYAASHCKATEQVAQL  649

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+   FV LLMAH+GL +
Sbjct  650  SRGGELLNFVWLLMAHFGLAD  670



>ref|XP_007217587.1| hypothetical protein PRUPE_ppa019290mg [Prunus persica]
 gb|EMJ18786.1| hypothetical protein PRUPE_ppa019290mg [Prunus persica]
Length=685

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            E++    KSVL  A ++A+++ + + + N   Q++    W+ +S VW  +L YA+SHCR 
Sbjct  586  EVKGDESKSVLFDACKLAKDLESLETKENWENQKK----WQLISHVWVEMLSYAASHCRW  641

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGLQEILE  363
                  L++GG+  T V LLMAH GL E L+
Sbjct  642  NHHAVQLRRGGELLTHVWLLMAHLGLTEQLQ  672



>ref|XP_006374604.1| hypothetical protein POPTR_0015s12600g [Populus trichocarpa]
 gb|ERP52401.1| hypothetical protein POPTR_0015s12600g [Populus trichocarpa]
Length=657

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 17/119 (14%)
 Frame = -3

Query  668  LLNGDYSSCNDKKELENKYK--KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSE  495
            L N +   C+D  E + ++K  KSVL     +AR +++  PE            W  ++E
Sbjct  537  LRNSESRGCDDI-EFQRRWKTSKSVLRGVETLARHLLSLGPEKR----------WWMINE  585

Query  494  VWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPELSFFL  324
            VW  ++ YA++HC  +E    L++GG+  T V LLM H GL E  + E   F EL+ +L
Sbjct  586  VWIEMVAYAAAHCPWKEHTQQLRRGGELLTHVSLLMLHLGLSE--QYEYKRFGELTTYL  642



>gb|KDP40702.1| hypothetical protein JCGZ_24701 [Jatropha curcas]
Length=686

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 65/121 (54%), Gaps = 14/121 (12%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCN-DKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQE  516
            S K+ C ++L  +++  + +++ +  + K S+L     +A E+          + ++ +E
Sbjct  574  SEKEACLKILEANFTDEDVERQIIAGENKNSMLFSGFLLAEEL----------QTKEFEE  623

Query  515  FWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL-QEILEGEKHSF  345
             W  LSEVW  ++ YA+SHC  +E    L+ GG   T V LLMAH+GL +++ E     F
Sbjct  624  KWDVLSEVWIEMIAYAASHCERKEHAQKLRTGGDLLTHVCLLMAHFGLNRQLKEARPFEF  683

Query  344  P  342
            P
Sbjct  684  P  684



>emb|CDP21917.1| unnamed protein product [Coffea canephora]
Length=626

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 11/120 (9%)
 Frame = -3

Query  698  QISRKKPCQ---RLLNGDYSSCNDKKEL-ENKYKKSVLPKAVEVARE-----IMNTDPEN  546
            QI  +  C+   +  + D SS N K+   E     + L KA+EV  +     + +     
Sbjct  490  QIRFRDTCEEAKKFFSRDSSSANRKRNACEKLLNVNALVKAIEVKGDRSKSILFDACRLA  549

Query  545  NNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             + K+   ++ W+ +S+VW  LL YA+SHCR + +   L KGG+  TFV +LMAH+GL E
Sbjct  550  KDLKKLNDKKRWEIMSKVWVELLSYAASHCRANAHAQQLSKGGELITFVWILMAHFGLGE  609



>ref|XP_008224917.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
 ref|XP_008224918.1| PREDICTED: uncharacterized protein LOC103324616 [Prunus mume]
Length=715

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 60/106 (57%), Gaps = 16/106 (15%)
 Frame = -3

Query  683  KPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKG  504
            + CQR+L  + ++  +   ++    KSVL  A  +A+++M         K+Q+    W+ 
Sbjct  607  EACQRIL--EVNTEVEPVAVKGDRSKSVLFDACILAKKLME--------KEQK----WEL  652

Query  503  LSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            +S+VW  LL Y + HCR  + V  L KGG+  TFV LLMAH+G+ E
Sbjct  653  MSKVWVELLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGE  698



>gb|KDP45937.1| hypothetical protein JCGZ_11840 [Jatropha curcas]
Length=361

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 59/110 (54%), Gaps = 15/110 (14%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKEL-----ENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            KK CQ +L+ + ++  D   +     E +  + ++P A  +A+E+   + E ++      
Sbjct  257  KKACQSILDMEDNTIMDLTSIASDWAEGRSYRYLVPYASILAKELKKLEEEQHDK-----  311

Query  521  QEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGL  378
               W+ +S+VW  +L Y   HCR    V  L KGG+F+TFV LL+ H+G+
Sbjct  312  ---WQIMSKVWIEMLCYGVCHCRPYNLVQQLTKGGEFFTFVWLLLTHFGI  358



>ref|XP_007214131.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
 gb|EMJ15330.1| hypothetical protein PRUPE_ppa018036mg [Prunus persica]
Length=675

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 60/108 (56%), Gaps = 15/108 (14%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            +++ CQR+L  + ++  +   ++    KSVL  A  +A+++M+   +            W
Sbjct  564  QQEACQRIL--EVNTEVEPVAVKGDRSKSVLFDACILAKKLMDLKEKK-----------W  610

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S+VW  LL Y + HCR  + V  L KGG+  TFV LLMAH+G+ E
Sbjct  611  ELMSKVWVELLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGE  658



>gb|KDP38349.1| hypothetical protein JCGZ_04274 [Jatropha curcas]
Length=973

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 52/106 (49%), Gaps = 14/106 (13%)
 Frame = -3

Query  683  KPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKG  504
            K C  LLN   ++     +++    KSVL  A  +A ++ N    N           W+ 
Sbjct  864  KACSALLN--VNTVVPPVKVKGDRSKSVLFDACRLASDLQNIPKPNR----------WEV  911

Query  503  LSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            LS VW  +L YA+SHCR       L +GG+  T V LLMAH+GL E
Sbjct  912  LSNVWVEMLAYAASHCRGTNHAQQLGRGGELLTHVWLLMAHFGLTE  957



>emb|CBI35872.3| unnamed protein product [Vitis vinifera]
Length=1298

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 56/99 (57%), Gaps = 11/99 (11%)
 Frame = -3

Query  638   DKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSH  459
             + K+++    KSVL +A  +A+ + + + E         +E W  +SEVW  +L YA+SH
Sbjct  1171  EPKDVKGDKSKSVLFEACRLAKALKSLEME------MGVEEKWMMVSEVWVEMLCYAASH  1224

Query  458   CR--EDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGE  357
             C   +    L++GG+  T V LLM+H GL E   ILEGE
Sbjct  1225  CGWIQHGQELRRGGELLTHVCLLMSHLGLSEQFQILEGE  1263


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 7/65 (11%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGEKHS  348
            WK +SEVW  +L YA+SHC   +    L++GG+  T V LLM+H GL E   ILEGE  +
Sbjct  436  WKMVSEVWVEMLCYAASHCGWIQHGQQLRRGGELLTHVCLLMSHLGLSEQFQILEGE--N  493

Query  347  FPELS  333
             P++S
Sbjct  494  VPKIS  498



>ref|XP_009377262.1| PREDICTED: uncharacterized protein LOC103965884 [Pyrus x bretschneideri]
Length=294

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 63/112 (56%), Gaps = 17/112 (15%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            RQ+  K+ C++LL  + ++  +   ++    KSVL  A  +A+E+           ++  
Sbjct  181  RQV--KEACEKLL--EVNTDVEPVAVKGDRSKSVLFDACILAKEL-----------RKLK  225

Query  521  QEFWKGLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQE  372
             + W+ +SEVW  ++ Y +SHCR + +   L KGG+  TFV LLMAH+G+ E
Sbjct  226  DKKWELMSEVWVEIMSYTASHCRANGHAQLLSKGGELVTFVWLLMAHFGIGE  277



>ref|XP_006280029.1| hypothetical protein CARUB_v10025906mg [Capsella rubella]
 gb|EOA12927.1| hypothetical protein CARUB_v10025906mg [Capsella rubella]
Length=798

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 8/81 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+E+       N   +      W+ L +VW  LL YA+SHC+  E V  L
Sbjct  707  KSVLFDASMLAKELQKLKESRNGDGK------WRVLRKVWVELLCYAASHCKATEHVAQL  760

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+   FV LLMAH+GL +
Sbjct  761  TRGGELLNFVWLLMAHFGLAD  781



>ref|XP_011014307.1| PREDICTED: uncharacterized protein LOC105118131 [Populus euphratica]
Length=662

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 13/96 (14%)
 Frame = -3

Query  638  DKKELENKYKK-----SVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLV  474
            D +E  N+ KK     S+L  A  +A+E+ +   ENN TK+++    W+ +S++W  +L 
Sbjct  559  DSEEFMNEIKKNGKNVSMLYDACTLAKELQSL--ENNWTKEKK----WRMISQIWVEMLA  612

Query  473  YASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            YA+S+C  +E    L +GG+  T V LLMAH GL+E
Sbjct  613  YAASNCGWKEHAQALTRGGELLTRVCLLMAHLGLRE  648



>ref|XP_009371589.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
 ref|XP_009371593.1| PREDICTED: uncharacterized protein LOC103960820 [Pyrus x bretschneideri]
Length=739

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 64/120 (53%), Gaps = 16/120 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C++LL  + ++  +   ++    KSVL  A  +A+E+   +              W+
Sbjct  629  KEACEKLL--EVNTDVEPVAVKGDRSKSVLFDACILAKELRKLEDRK-----------WE  675

Query  506  GLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
             +SEVW  +L Y ++HCR + +   L KGG+  TFV LLMAH+G+ E  +  E H+  +L
Sbjct  676  LMSEVWVEILSYTATHCRANDHAQLLSKGGELVTFVWLLMAHFGIGEQFQINEGHARAKL  735



>ref|XP_008342346.1| PREDICTED: uncharacterized protein LOC103405164 [Malus domestica]
Length=739

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 66/120 (55%), Gaps = 16/120 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C++LL  + ++  +   ++    KSVL  A  +A+E+           ++   + W+
Sbjct  629  KEACEKLL--EVNTDVEPVAVKGDRSKSVLFDACILAKEL-----------RKLKDKKWE  675

Query  506  GLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
             +SEVW  ++ Y +SHCR + +   L KGG+  TFV LLMAH+G+ E  +  E H+  +L
Sbjct  676  LMSEVWVEIMSYTASHCRANDHAQLLSKGGELVTFVWLLMAHFGIGEQFQINEGHARAKL  735



>gb|KDP38344.1| hypothetical protein JCGZ_04269 [Jatropha curcas]
Length=564

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 57/107 (53%), Gaps = 15/107 (14%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            KK C+ LLN D +  +   +++ +   SVL  A  +A ++ N              + W+
Sbjct  455  KKACKVLLNND-NIGDPPVKVKGERTMSVLFDACRLASDLQNI------------PKMWE  501

Query  506  GLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             +++VW  +L YA+SHCR   +   L +GG+  T V LLMAH+GL E
Sbjct  502  VVTDVWMEMLAYAASHCRGTNHAQQLGRGGELLTHVWLLMAHFGLTE  548



>ref|XP_003627290.1| hypothetical protein MTR_8g020780 [Medicago truncatula]
 gb|AET01766.1| DUF594 family protein [Medicago truncatula]
Length=771

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 11/90 (12%)
 Frame = -3

Query  608  KSVLPKAVEVA---REIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDV  444
            KSVL  A  +A   REI N D E       + +E WK +++VW  +L YA+ HC+     
Sbjct  678  KSVLFDAFRLAKNVREIRNDDVE------WETKEMWKFITQVWVEMLAYAACHCQVIHHA  731

Query  443  YYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +L+ GG+  T V LLMAH G+ + L+  K
Sbjct  732  QHLRHGGELLTHVWLLMAHLGITDRLQISK  761



>ref|XP_002303248.1| hypothetical protein POPTR_0003s06300g [Populus trichocarpa]
 gb|EEE78227.1| hypothetical protein POPTR_0003s06300g [Populus trichocarpa]
Length=662

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = -3

Query  533  QQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL----QE  372
            Q+   E WK +SEVW  +L YA+ HC  R+    LK GG+  T VRLLMAH GL    QE
Sbjct  599  QKLEAEKWKVISEVWVEMLTYAAGHCEWRDHAQQLKSGGELLTHVRLLMAHLGLSQQYQE  658

Query  371  IL  366
            IL
Sbjct  659  IL  660



>ref|XP_010535680.1| PREDICTED: uncharacterized protein LOC104810911 [Tarenaya hassleriana]
Length=839

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 49/86 (57%), Gaps = 9/86 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            +++    KS L  A ++A +I     + N       ++ WK +S+VW  LL YA++HC  
Sbjct  742  DVKGDRSKSALFDASKLAHQIQEQQRKGN-------EDMWKVMSKVWVELLCYAATHCNA  794

Query  449  DVY--YLKKGGQFYTFVRLLMAHYGL  378
            + +   L KGG+  +FV LLMAH+GL
Sbjct  795  EQHAAQLSKGGELISFVWLLMAHFGL  820



>ref|XP_007200116.1| hypothetical protein PRUPE_ppa018880mg [Prunus persica]
 gb|EMJ01315.1| hypothetical protein PRUPE_ppa018880mg [Prunus persica]
Length=153

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (52%), Gaps = 13/126 (10%)
 Frame = -3

Query  698  QISRKKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQ  525
            ++  +K C +LL+     C D    +++    KSVL  A  +A+ + + + +   T  ++
Sbjct  33   KLGERKACTKLLD----VCTDILPSKVKGDRSKSVLFDACRLAKALQSLESDRGWTNGRK  88

Query  524  PQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEK  354
                W+ +S VW  +L YA++ CR       L++GG+  T V LLMAH GL E  +  E 
Sbjct  89   ----WQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHLGLTEQFQISEG  144

Query  353  HSFPEL  336
            H+  +L
Sbjct  145  HARAKL  150



>ref|XP_010434459.1| PREDICTED: uncharacterized protein LOC104718409 isoform X1 [Camelina 
sativa]
 ref|XP_010434460.1| PREDICTED: uncharacterized protein LOC104718409 isoform X2 [Camelina 
sativa]
 ref|XP_010434461.1| PREDICTED: uncharacterized protein LOC104718409 isoform X3 [Camelina 
sativa]
Length=787

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 9/89 (10%)
 Frame = -3

Query  638  DKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSH  459
            +  +++  + KSVL +A  VA+E++  D      K       W  LS+VW   L +A+SH
Sbjct  704  EPSDVKGNHCKSVLFEASSVAKELLKLDKGCEKDK-------WAVLSKVWLEFLFHAASH  756

Query  458  C--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            C     +  + KGG+F  FV LLMAH+GL
Sbjct  757  CDGTARLELVSKGGEFINFVWLLMAHFGL  785



>ref|XP_006464478.1| PREDICTED: uncharacterized protein LOC102617005 [Citrus sinensis]
Length=803

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 14/105 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C  +L+   ++  +  E++    KS+L +A  +A+++   D ++           WK
Sbjct  692  KDACDEILS--VNTFAEPAEVKGDRSKSLLFEATMLAKQLKKLDQKSK----------WK  739

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
             +S++W  L  YA+SHC  R     L KGG+  TFV LLM+H+GL
Sbjct  740  LISKMWVELSSYAASHCDARSHAQQLSKGGELITFVWLLMSHFGL  784



>ref|XP_006388182.1| hypothetical protein POPTR_0296s002002g, partial [Populus trichocarpa]
 gb|ERP47096.1| hypothetical protein POPTR_0296s002002g, partial [Populus trichocarpa]
Length=405

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 12/86 (14%)
 Frame = -3

Query  623  ENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--RE  450
            E K +KSVL     +A ++++ +PEN           W  + EVW  ++ YA++HC  +E
Sbjct  291  EWKTEKSVLRGVAVLANQLLSLEPENR----------WWMIREVWIEMVAYAAAHCPWKE  340

Query  449  DVYYLKKGGQFYTFVRLLMAHYGLQE  372
              + L++GG+  T V LLM H GL E
Sbjct  341  HTHQLRRGGELLTHVSLLMLHLGLTE  366



>ref|XP_004152420.1| PREDICTED: uncharacterized protein LOC101209159 [Cucumis sativus]
 ref|XP_004158159.1| PREDICTED: uncharacterized protein LOC101224461 [Cucumis sativus]
 gb|KGN50284.1| hypothetical protein Csa_5G165300 [Cucumis sativus]
Length=757

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 62/119 (52%), Gaps = 16/119 (13%)
 Frame = -3

Query  683  KPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKG  504
            K C+ +L  + +  N   E++    KSVL     +A+            K ++  E W+ 
Sbjct  648  KGCREILAVNVTDAN-PVEVKGDKSKSVLFNGSLLAK------------KLKKYNEKWEI  694

Query  503  LSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
            +S+VW  +L YA+SHCR D +   + KGG+  T V LLMAH+GL E  +  E H+  +L
Sbjct  695  MSKVWIEMLGYAASHCRPDQHAQQVSKGGELITVVWLLMAHFGLGEQFQISEGHARAKL  753



>ref|XP_007040748.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
 gb|EOY25249.1| Uncharacterized protein TCM_016622 [Theobroma cacao]
Length=800

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 42/128 (33%), Positives = 64/128 (50%), Gaps = 21/128 (16%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKE---LENKYKKSVLPKAVEVAREIMNTDPENNNTKQ  531
            R  +  K C+ +L     S N   E   ++    KSVL  A  +A+E+          K+
Sbjct  684  RPNADNKACEEIL-----SVNTDVEPVTVKGDRSKSVLFDASMLAQEL----------KR  728

Query  530  QQPQEFWKGLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-G  360
             + ++ WK +  VW  L+ YA+SHCR   +   + KGG+  TF  LLMAH+GL E  +  
Sbjct  729  LERKDRWKLICRVWVELVSYAASHCRASTHAQRVSKGGELITFFWLLMAHFGLGEQFQIN  788

Query  359  EKHSFPEL  336
            E H+  +L
Sbjct  789  EGHARAKL  796



>ref|XP_011036419.1| PREDICTED: uncharacterized protein LOC105133946 [Populus euphratica]
Length=665

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 38/62 (61%), Gaps = 6/62 (10%)
 Frame = -3

Query  533  QQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL----QE  372
            Q+   E WK +SEVW  +L YA+ HC  R+    LK GG+  T VRLLMAH GL    QE
Sbjct  602  QKLEAEKWKLISEVWVEMLTYAAGHCEWRDHAQQLKSGGELLTHVRLLMAHLGLSQQYQE  661

Query  371  IL  366
            IL
Sbjct  662  IL  663



>gb|KDP43572.1| hypothetical protein JCGZ_16859 [Jatropha curcas]
Length=751

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 57/105 (54%), Gaps = 15/105 (14%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            KK C+++L  + ++     +++     SVL  A  +A+E+          K Q+    WK
Sbjct  644  KKACKKIL--EVNTHFRPTDVKGDGSTSVLFTASMLAKEL-------RKLKAQK----WK  690

Query  506  GLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGL  378
             LS+VW  +L YA+SHC    +   L KGG+  TFV LLMAH+GL
Sbjct  691  ILSQVWVEMLSYAASHCTATCHAQQLSKGGELVTFVWLLMAHFGL  735



>ref|XP_006380889.1| hypothetical protein POPTR_0006s01400g, partial [Populus trichocarpa]
 gb|ERP58686.1| hypothetical protein POPTR_0006s01400g, partial [Populus trichocarpa]
Length=664

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +SEVW  +L+YA+SHCR  E V+ L +GG+  T V LLMAH GL +
Sbjct  590  WEMISEVWVDMLMYAASHCRWKEHVHALSQGGELLTHVCLLMAHLGLSK  638



>ref|XP_002308790.2| hypothetical protein POPTR_0006s01390g, partial [Populus trichocarpa]
 gb|EEE92313.2| hypothetical protein POPTR_0006s01390g, partial [Populus trichocarpa]
Length=666

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +SEVW  +L+YA+SHCR  E V+ L +GG+  T V LLMAH GL +
Sbjct  593  WEMISEVWVDMLMYAASHCRWKEHVHALSQGGELLTHVCLLMAHLGLSK  641



>ref|XP_002528769.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33591.1| conserved hypothetical protein [Ricinus communis]
Length=769

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 62/125 (50%), Gaps = 16/125 (13%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            R    K+ CQ +L  D         ++    KSVL     +A+E+           Q+  
Sbjct  654  RSHEEKRACQCILEVDTEV--KPIAVKGDRSKSVLFDGSMLAQEL-----------QKLK  700

Query  521  QEFWKGLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGL-QEILEGEKH  351
            ++ W+ +S+VW  LL YA+SHCR + +   + KGG+  T V LLMAH GL Q+    E H
Sbjct  701  EKKWETMSKVWVELLSYAASHCRANAHAQQVSKGGELITLVWLLMAHLGLGQQFQINEGH  760

Query  350  SFPEL  336
            +  +L
Sbjct  761  ARAKL  765



>ref|XP_008228369.1| PREDICTED: uncharacterized protein LOC103327780 [Prunus mume]
Length=681

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 11/121 (9%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C+ LL    S+     E++    KSVL  A  +A+ +     E N  K+      W+
Sbjct  567  KNACKMLLK--VSTKILPSEVKGDRSKSVLFDACRLAKALQALGDEENGEKK------WE  618

Query  506  GLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFPEL  336
             +S+VW  +L YA++ CR  +    L++GG+  T V LLMAH+GL E L+  E H   +L
Sbjct  619  LMSDVWVEMLCYAANQCRWSDHAQQLRRGGELLTHVWLLMAHFGLTEKLQISEGHVRTKL  678

Query  335  S  333
            +
Sbjct  679  T  679



>gb|KEH43306.1| DUF594 family protein [Medicago truncatula]
Length=717

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (54%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R + C+ +L  + S      E++    KSVL  A  +A+ + + + E N +K+Q+    W
Sbjct  600  RSQVCKMILRVNTSI--PPSEVKGDRSKSVLFDACRLAKSLQSLETEENWSKEQK----W  653

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S VW  +L +A+S CR       L +GG+  T V LLMAH G+ E
Sbjct  654  EMISHVWVEMLCHAASQCRGLHHARQLSQGGELLTHVWLLMAHLGITE  701



>ref|XP_010650637.1| PREDICTED: uncharacterized protein LOC104879475 [Vitis vinifera]
Length=742

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL  A  +A+ + + + E  N +++     W+ +S VW  +L YA+ HC   E    L
Sbjct  662  KSVLLDACRLAKSLQSLESEKWNNEKK-----WEMMSHVWVEMLCYAACHCPRNEHAKEL  716

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+  T V LLMAH+G+ E
Sbjct  717  TQGGELLTHVWLLMAHFGITE  737



>gb|KDO53052.1| hypothetical protein CISIN_1g040228mg [Citrus sinensis]
Length=831

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 14/107 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C+++LN    +      ++    KSVL     +A+E+          K+ + ++ W+
Sbjct  720  KEACEKILN--VQTYVKPSAVKGDRSKSVLFDGSILAKEL----------KKLEKRDRWE  767

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +S+VW  LL YA++HC  R     +  GG+  TFV LLMAH+GL E
Sbjct  768  LMSKVWLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGE  814



>ref|XP_006437480.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
 gb|ESR50720.1| hypothetical protein CICLE_v10030709mg [Citrus clementina]
Length=831

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 35/107 (33%), Positives = 57/107 (53%), Gaps = 14/107 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C+++LN    +      ++    KSVL     +A+E+          K+ + ++ W+
Sbjct  720  KEACEKILN--VKTYVKPSAVKGDRSKSVLFDGSILAKEL----------KKLEKRDRWE  767

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +S+VW  LL YA++HC  R     +  GG+  TFV LLMAH+GL E
Sbjct  768  LMSKVWLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGE  814



>ref|XP_006380894.1| hypothetical protein POPTR_0006s01480g [Populus trichocarpa]
 gb|ERP58691.1| hypothetical protein POPTR_0006s01480g [Populus trichocarpa]
Length=626

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 56/100 (56%), Gaps = 7/100 (7%)
 Frame = -3

Query  662  NGDYSSCNDKKELENKYKK-SVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWA  486
            N  + S N   +LE+   K SVL    ++A+ + + + ++    +++    W+ +S+VW 
Sbjct  526  NNSWDSYNTILQLEDSSGKVSVLCAGFKLAKSLQSLETQDGWENKRK----WEMISQVWV  581

Query  485  GLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +L YA+SHC  +E    L +GG+  T V LLMAH GL E
Sbjct  582  EMLTYAASHCGWKEHAQALTRGGELLTHVCLLMAHLGLSE  621



>ref|XP_004303690.1| PREDICTED: uncharacterized protein LOC101298623 [Fragaria vesca 
subsp. vesca]
Length=703

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 58/109 (53%), Gaps = 13/109 (12%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            K+ C +L    Y+ C D    +++    KSVL  A  +A+ + +   E N   Q+     
Sbjct  588  KEACTKL----YNVCTDILPSKVKGDRSKSVLFDACRLAKALQSLKTEENWYNQK-----  638

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S+VW  +L YA++ CR  +    L++GG+  T V LLMAH GL E
Sbjct  639  WELMSQVWVEMLSYAANQCRWGDHAQQLRRGGELLTHVWLLMAHLGLTE  687



>ref|XP_011013300.1| PREDICTED: uncharacterized protein LOC105117357 [Populus euphratica]
Length=689

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 24/119 (20%)
 Frame = -3

Query  707  CWRQISRKKPCQRLLNGDYSSCNDKKELENKYKK-----SVLPKAVEVAREIMNTDPENN  543
            CWR        + +   D+ S    +E  N+ KK     S+L  A ++A+E+ +   ENN
Sbjct  572  CWRS-------EEITPTDWGS----EEFMNEIKKKGSNVSMLHDACKLAKELQSL--ENN  618

Query  542  NTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             T +++    W+ +S++W  +L YASS+C  +E    L +GG+  T V LLMAH GL E
Sbjct  619  WTNEKK----WRMISQIWVEMLTYASSNCGWKEHAQALTRGGELLTRVCLLMAHLGLSE  673



>gb|KFK31555.1| hypothetical protein AALP_AA6G127100 [Arabis alpina]
Length=798

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ LS+VW  LL YA+SHC+  E V  L +GG+   FV LLMAH+GL +
Sbjct  732  WRVLSKVWVELLSYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLAD  780



>gb|KEH40110.1| DUF594 family protein [Medicago truncatula]
Length=723

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 52/87 (60%), Gaps = 6/87 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            K VL  A ++A+ +M    E  + ++ + ++ WK +++VW  +L YA+ HC+      +L
Sbjct  631  KYVLFDAFKLAKNVM----EIKDDEEWETKKMWKFITQVWVEMLAYAACHCQVIHHAQHL  686

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
            + GG+  T V LLMAH+G+ + L+  K
Sbjct  687  RHGGELLTHVWLLMAHFGITDRLQISK  713



>ref|XP_010494654.1| PREDICTED: uncharacterized protein LOC104771778 [Camelina sativa]
Length=866

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 47/86 (55%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A+E+        +  ++   E WK +S+VW  LL YA++ C  
Sbjct  767  DVKGDRSKSVLFDGAMLAKELKGL-----SKNKEDDTEMWKIMSQVWVELLCYAATKCGA  821

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  TFV LLMAH+GL
Sbjct  822  IEHAAQLSKGGELITFVWLLMAHFGL  847



>gb|KDP45940.1| hypothetical protein JCGZ_11843 [Jatropha curcas]
Length=764

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVY--YLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFP  342
            W+ LS+VW  LL YA+SHCR + +   + KGG+  T V LLMAH+GL +  +  E H+  
Sbjct  699  WEILSKVWVELLSYAASHCRANAHAQQISKGGELLTLVWLLMAHFGLGDQFQINEGHARA  758

Query  341  EL  336
            +L
Sbjct  759  KL  760



>ref|NP_199360.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09175.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAE99033.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED95256.1| uncharacterized protein AT5G45470 [Arabidopsis thaliana]
Length=866

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+++   +  +N  K       W+ LS+VW  LL YA+ HC    +   L
Sbjct  776  KSVLFDASRLAKDLAEMEKTHNKDK-------WEILSKVWVELLCYAACHCDSTAHVEQL  828

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+   FV LLMAH+GL +
Sbjct  829  SRGGELINFVWLLMAHFGLTD  849



>gb|KDP40701.1| hypothetical protein JCGZ_24700 [Jatropha curcas]
Length=680

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 61/111 (55%), Gaps = 14/111 (13%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKEL--ENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQ  519
            S K+ C ++L  +++  + +K++    + K  +L     +A+++ +T+ E          
Sbjct  560  SEKEACLKILEANFAEDDLEKQIFSTEQMKSFMLVGGYLLAKQLKSTEFE----------  609

Query  518  EFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            E W  +SEVW  ++ YA+SHC  +E    L+KGG   T V +LMAH+GL +
Sbjct  610  EKWDVVSEVWIEMVAYAASHCDWKEHAQKLRKGGDLLTHVCILMAHFGLSD  660



>ref|XP_002863469.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39728.1| hypothetical protein ARALYDRAFT_494429 [Arabidopsis lyrata subsp. 
lyrata]
Length=796

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 13/89 (15%)
 Frame = -3

Query  638  DKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSH  459
            D   ++    KSVL  A  +A+E+           +++ +  W+ +S+VW  LL YAS H
Sbjct  700  DPMAVKGDRSKSVLVDASVLAKEL-----------EKEGRNMWEVVSKVWVELLCYASLH  748

Query  458  C--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            C  +E    L KGG+   FV LLMAH+GL
Sbjct  749  CNSQEHASQLSKGGELINFVWLLMAHFGL  777



>ref|XP_011018639.1| PREDICTED: uncharacterized protein LOC105121611 [Populus euphratica]
Length=727

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -3

Query  530  QQPQEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            Q+ ++ W+ LS+VW  LL YA+ HCR   +   + KGG+  TFV LLMAH+GL +
Sbjct  656  QREEKRWELLSKVWVELLSYAAGHCRATAHAQQVSKGGELITFVWLLMAHFGLAD  710



>ref|XP_010692889.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692890.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692891.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692892.1| PREDICTED: uncharacterized protein LOC104905931 [Beta vulgaris 
subsp. vulgaris]
Length=670

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A E+         TK  + Q  W  +S+VW  +L YA+ HCR       L
Sbjct  584  KSVLFDACRIATEL--------RTKHAKDQ--WNIISKVWVEILAYAACHCRGTHHAQQL  633

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            +KGG+F T V LLMAH G+ E
Sbjct  634  RKGGEFLTHVWLLMAHLGITE  654



>gb|KFK31554.1| hypothetical protein AALP_AA6G127000 [Arabis alpina]
Length=794

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 10/89 (11%)
 Frame = -3

Query  638  DKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSH  459
            D  +++    KSVL  A  +A+E++       N         W+ +S+VW  L+ YA++H
Sbjct  695  DPMDVKGDKSKSVLFDASVLAKELIRLKRGGEN--------MWEVVSKVWVELICYAATH  746

Query  458  C--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            C  +E    L KGG+   FV LLMAH+GL
Sbjct  747  CDSKEHASQLSKGGELINFVWLLMAHFGL  775



>gb|KHN00983.1| hypothetical protein glysoja_000651 [Glycine soja]
Length=718

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (53%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R K CQ +L  +      K  ++    KSVL  A  +A+ + + + + N +K+++    W
Sbjct  601  RDKVCQVILRVNTDVLPSK--VKGDRSKSVLFDARRLAKSLQSLETKRNWSKEEK----W  654

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S VW  +L YA+S CR       L +GG+  T V LLMAH G+ E
Sbjct  655  EMISHVWVEMLCYAASQCRGLHHAKQLSRGGELLTHVWLLMAHLGITE  702



>ref|XP_008437035.1| PREDICTED: uncharacterized protein LOC103482584 [Cucumis melo]
Length=757

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 14/86 (16%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL     +AR            K ++  E W+ +S+VW  +L YA+SHCR 
Sbjct  665  EVKGDKSKSVLFNGSLLAR------------KLKKHNEKWEIMSKVWIEMLSYAASHCRP  712

Query  449  DVY--YLKKGGQFYTFVRLLMAHYGL  378
            D +   + KGG+  T V LLMAH+GL
Sbjct  713  DQHAQQVSKGGELITMVWLLMAHFGL  738



>ref|XP_006606322.1| PREDICTED: uncharacterized protein LOC102663983 [Glycine max]
Length=718

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 57/108 (53%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R K CQ +L  +      K  ++    KSVL  A  +A+ + + + + N +K+++    W
Sbjct  601  RDKVCQVILRVNTDVLPSK--VKGDRSKSVLFDARRLAKSLQSLETKRNWSKEEK----W  654

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S VW  +L YA+S CR       L +GG+  T V LLMAH G+ E
Sbjct  655  EMISHVWVEMLCYAASQCRGLHHAKQLSRGGELLTHVWLLMAHLGITE  702



>emb|CBI20393.3| unnamed protein product [Vitis vinifera]
Length=643

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 12/88 (14%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL  A  +A+E+          K+   ++ WK +SEVW  LL YA+SHCR 
Sbjct  549  EVKGDRSKSVLFDACILAKEL----------KKLNERKRWKVMSEVWVELLSYAASHCRA  598

Query  449  DVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            + +     KGG+  TFV LLM   GL +
Sbjct  599  NTHAQQFSKGGELVTFVWLLMTQLGLGD  626



>ref|XP_010449404.1| PREDICTED: uncharacterized protein LOC104731659 [Camelina sativa]
Length=784

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 65/117 (56%), Gaps = 13/117 (11%)
 Frame = -3

Query  722  KQGILCWRQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENN  543
            K+GI   R ++     +++L+ D S   +  +++  + KSVL +A  VA+E++  + +  
Sbjct  677  KKGIRNSRDVNLGS--KKILSVDTSI--EPSDVKGNHCKSVLFEASSVAKELLKLEEDFG  732

Query  542  NTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
              K       W+ LS+VW   L++A+SH      +  L KGG+F  FV LLMAH+GL
Sbjct  733  KDK-------WEVLSKVWLEFLMHAASHSDGTTRLELLSKGGEFINFVWLLMAHFGL  782



>ref|XP_010644262.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
 ref|XP_010644264.1| PREDICTED: uncharacterized protein LOC100258913 [Vitis vinifera]
Length=735

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 12/88 (14%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL  A  +A+E+          K+   ++ WK +SEVW  LL YA+SHCR 
Sbjct  641  EVKGDRSKSVLFDACILAKEL----------KKLNERKRWKVMSEVWVELLSYAASHCRA  690

Query  449  DVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            + +     KGG+  TFV LLM   GL +
Sbjct  691  NTHAQQFSKGGELVTFVWLLMTQLGLGD  718



>gb|KFK31559.1| hypothetical protein AALP_AA6G127600 [Arabis alpina]
Length=884

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 7/67 (10%)
 Frame = -3

Query  557  DPEN-NNTKQQQPQ----EFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRL  399
            DP N N+T++ +P+    + WK +S+VW  +L YA++ C   E    L KGG+  +FV L
Sbjct  799  DPGNRNDTQEPEPETPDTKMWKMVSQVWVEMLSYAATKCGAIEHAAQLSKGGELISFVWL  858

Query  398  LMAHYGL  378
            LMAH+GL
Sbjct  859  LMAHFGL  865



>ref|XP_010495724.1| PREDICTED: uncharacterized protein LOC104772863 [Camelina sativa]
Length=842

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S+VW  LL YA+SHC+  E V  L +GG+   FV LLMAH+GL +
Sbjct  777  WRVMSKVWVELLCYAASHCKATEHVAQLSRGGELLNFVWLLMAHFGLAD  825



>ref|XP_010654435.1| PREDICTED: uncharacterized protein LOC100256613 [Vitis vinifera]
Length=690

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 15/117 (13%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +R + C+ LL  D       KE++    KSVL +A  +A+E+ + + E          E 
Sbjct  541  NRNEACRLLLEVDTEV--QPKEVKGDKSKSVLFEACRLAKELKSLNMEMG--------EK  590

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGE  357
            W  +S VW  +L +A+SHC   +    L +GG+  T V LLM+H GL E   ILEGE
Sbjct  591  WMMVSHVWVEMLCHAASHCGWIQHGQQLGRGGELLTHVSLLMSHLGLSEQFQILEGE  647



>ref|XP_004288842.1| PREDICTED: uncharacterized protein LOC101309774 [Fragaria vesca 
subsp. vesca]
Length=654

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 11/120 (9%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            R I+ +K  +R+L  + S         +   KSVL +   +AR +   D EN    +++ 
Sbjct  544  RLITNRKDARRVLLQEESIVA-----PSGLGKSVLSEGCRLARHLQLLDTENGWNSEEK-  597

Query  521  QEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHS  348
               WK +++VW  LL YA+S C        L++GG+  T + LLMAH GL E L   K S
Sbjct  598  ---WKMITQVWVELLCYAASECGWEHHAQQLRRGGELLTHICLLMAHLGLSEQLPPGKPS  654



>ref|XP_007217388.1| hypothetical protein PRUPE_ppa025953mg, partial [Prunus persica]
 gb|EMJ18587.1| hypothetical protein PRUPE_ppa025953mg, partial [Prunus persica]
Length=137

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 64/124 (52%), Gaps = 9/124 (7%)
 Frame = -3

Query  698  QISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQ  519
            ++  +K C +LL  D  +     +++    KSVL  A  +A+ + + + +   T  ++  
Sbjct  16   KLGERKACTKLL--DVCTYILPSKVKGDRSKSVLFDACRLAKALQSLESDRGWTNGRK--  71

Query  518  EFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEKHS  348
              W+ +S VW  +L YA++ CR       L++GG+  T V LLMAH GL E  +  E H+
Sbjct  72   --WQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHLGLTEQFQISEGHA  129

Query  347  FPEL  336
              +L
Sbjct  130  RAKL  133



>gb|KFK28578.1| hypothetical protein AALP_AA7G015200 [Arabis alpina]
Length=1019

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 57/108 (53%), Gaps = 10/108 (9%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYK-KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            K  CQ++L+  Y     + +    YK KS+L +A  +A+E+       +          W
Sbjct  895  KMACQKILDS-YKEVEQRNKNAKGYKSKSILFQANMLAKELQRIQNREDGVGM------W  947

Query  509  KGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S+VW  +L YA++HC  ++    L +GG+   FV LLMAH+GL E
Sbjct  948  EVVSKVWVEMLCYAATHCDSKQHAAQLNRGGELINFVWLLMAHFGLGE  995



>ref|XP_008371249.1| PREDICTED: uncharacterized protein LOC103434679 [Malus domestica]
Length=760

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 38/62 (61%), Gaps = 3/62 (5%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFP  342
            W  +S+VW  LL Y + HCR +  V  L KGG+  TFV LLMAH+G+ E  +  E H+  
Sbjct  695  WDLMSQVWVELLSYTAGHCRANDHVQLLSKGGELVTFVWLLMAHFGIGEQFQINEGHARA  754

Query  341  EL  336
            +L
Sbjct  755  KL  756



>ref|XP_011040393.1| PREDICTED: uncharacterized protein LOC105136666 [Populus euphratica]
Length=649

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 14/98 (14%)
 Frame = -3

Query  617  KYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDV  444
            K KKSVL     +AR+++  +PE            W  ++EVW  ++ YA++ C  +E  
Sbjct  546  KTKKSVLIGVAVLARQLLLLEPEKR----------WGTINEVWIEMVAYAAAQCPWKEHT  595

Query  443  YYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPELSF  330
            + L++GG+  T V LLM H GL    + E +++ ++SF
Sbjct  596  HQLRRGGELLTHVSLLMLHLGLSA--QYEYNTYEDVSF  631



>ref|XP_009101588.1| PREDICTED: uncharacterized protein LOC103827791 [Brassica rapa]
Length=779

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 10/86 (12%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL     +A+E+M          Q+  +  W+ +S+VW  LL +A++HC  
Sbjct  683  DVKGDRSKSVLFDGSVLAQELMKL--------QKGRENMWEVVSKVWVELLCFAATHCDS  734

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGL  378
            +E    L KGG+   FV LLMAH+GL
Sbjct  735  QEHASQLSKGGELINFVWLLMAHFGL  760



>ref|XP_009128802.1| PREDICTED: uncharacterized protein LOC103853644 isoform X1 [Brassica 
rapa]
Length=822

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 35/97 (36%), Positives = 49/97 (51%), Gaps = 9/97 (9%)
 Frame = -3

Query  656  DYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            D SS  D   ++    KSVL  A  +A+++   +      K       W+ LS+VW  LL
Sbjct  716  DVSSDIDPMGVKGDRSKSVLFDASRLAKDLRQLEERYGKDK-------WEILSKVWVELL  768

Query  476  VYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQE  372
             YA+ HC     V  L +GG+   FV LLMAH+GL +
Sbjct  769  CYAACHCDSTAHVEQLSRGGELINFVWLLMAHFGLTD  805



>ref|XP_006414011.1| hypothetical protein EUTSA_v10025163mg [Eutrema salsugineum]
 gb|ESQ55464.1| hypothetical protein EUTSA_v10025163mg [Eutrema salsugineum]
Length=457

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 9/87 (10%)
 Frame = -3

Query  632  KELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR  453
            ++++  + KSVL +A  +A+E+   + +    K       WK LS+VW   L +A+SHC 
Sbjct  376  RDVKGNHSKSVLFEASSLAKELQRLERDFGQDK-------WKTLSKVWLEFLFHAASHCD  428

Query  452  ED--VYYLKKGGQFYTFVRLLMAHYGL  378
                +  L KGG+F  FV L M+H+GL
Sbjct  429  ATTRMELLSKGGEFINFVWLQMSHFGL  455



>ref|XP_010441723.1| PREDICTED: uncharacterized protein LOC104724861 [Camelina sativa]
Length=209

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 14/99 (14%)
 Frame = -3

Query  662  NGDYSSCNDKKELENKY--KKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVW  489
            NG  SS  + +E + +   +++VL  A  +A          N  KQ      W  +S VW
Sbjct  102  NGILSSLGESRERKGRRHQRRNVLADASRLA----------NALKQISGSTKWMIVSNVW  151

Query  488  AGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
              ++ Y +++C  ++ V  L KGG+F +FV LLMAH+GL
Sbjct  152  VEMICYGATYCDPKQHVAQLSKGGEFISFVWLLMAHFGL  190



>emb|CDX90102.1| BnaA08g18820D [Brassica napus]
Length=740

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 47/86 (55%), Gaps = 10/86 (12%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL     +A+E+M          Q   +  W+ +S+VW  LL +A++HC  
Sbjct  644  DVKGDRSKSVLFDGSVLAQELMKL--------QNGRESMWEVVSKVWVELLCFAATHCDS  695

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGL  378
            +E    L KGG+   FV LLMAH+GL
Sbjct  696  QEHASQLSKGGELINFVWLLMAHFGL  721



>ref|XP_010251958.1| PREDICTED: uncharacterized protein LOC104593691 [Nelumbo nucifera]
Length=308

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 14/104 (13%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C+RL+  D  +     +++    KSVL   V++A+ +   D E            WK +S
Sbjct  198  CKRLV--DVETDVAPMDVKGDRSKSVLFDGVKLAKALRKLDDEQR----------WKTMS  245

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             VW  +L YA+SHCR + +   L  GG+  T V LLMAH G+ +
Sbjct  246  LVWMEMLYYAASHCRGNYHAQRLSTGGELLTLVWLLMAHLGIGD  289



>ref|XP_006282059.1| hypothetical protein CARUB_v10028304mg [Capsella rubella]
 gb|EOA14957.1| hypothetical protein CARUB_v10028304mg [Capsella rubella]
Length=780

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 9/97 (9%)
 Frame = -3

Query  656  DYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            + +S  D  E++    KSVL  A  +A+++M+ +   +  K       W+ LS+VW  LL
Sbjct  682  NVNSDTDPMEVKGDGSKSVLFDASRLAKDLMHLELRYSINK-------WEILSKVWVELL  734

Query  476  VYASSHCRE--DVYYLKKGGQFYTFVRLLMAHYGLQE  372
             YA+ +C     V  L +GG+   FV LLMAH+GL +
Sbjct  735  CYAACYCDSMAHVEQLSRGGELINFVWLLMAHFGLTD  771



>ref|XP_010494655.1| PREDICTED: uncharacterized protein LOC104771779, partial [Camelina 
sativa]
Length=557

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 57/109 (52%), Gaps = 11/109 (10%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            S K   + +LN   +S  D   ++    KSVL  A  +A+++  T+ E  + K +     
Sbjct  441  SVKIATENILN--VNSETDPMSVKGDRSKSVLFDASRLAKDL--TEMEKTHKKDK-----  491

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W+ LS+VW  LL YA+ HC    +   L +G +   FV LLMAH+GL +
Sbjct  492  WEILSKVWVELLCYAACHCDATAHVEQLSRGAELINFVWLLMAHFGLTD  540



>ref|XP_010650602.1| PREDICTED: uncharacterized protein LOC104879460 [Vitis vinifera]
 ref|XP_010650603.1| PREDICTED: uncharacterized protein LOC104879460 [Vitis vinifera]
Length=618

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL  A  +A+ + + + E  N +++     W+ +S VW  +L YA+ HC   E    L
Sbjct  538  KSVLLDACRLAKSLQSLESEKWNNEKK-----WEMMSHVWVEMLCYAACHCPRNEHAKEL  592

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+  T V LLMAH+G+ E
Sbjct  593  TQGGELLTHVWLLMAHFGITE  613



>emb|CDY26372.1| BnaA02g23980D [Brassica napus]
Length=1347

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 9/103 (9%)
 Frame = -3

Query  656   DYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
             D SS  D   ++    KSVL  A  +A+++   +      K       W+ LS+VW  LL
Sbjct  1241  DVSSDIDPMGVKGDRSKSVLFDASRLAKDLRQLEERYGKDK-------WEILSKVWVELL  1293

Query  476   VYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
              YA+ HC     V  L +GG+   FV LLMAH+GL +  +  K
Sbjct  1294  CYAACHCDSTAHVEQLSRGGELINFVWLLMAHFGLTDQFQINK  1336



>emb|CDX87778.1| BnaC02g31710D [Brassica napus]
Length=135

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 6/90 (7%)
 Frame = -3

Query  623  ENKYKKSVLPKAVEVAREI--MNTDPENNNTKQQQPQE--FWKGLSEVWAGLLVYASSHC  456
            E K  KSVL +   +A+E+  +   PE  +  ++   E   W+ +S+VWA LL YA++ C
Sbjct  29   EAKRSKSVLFEGSMLAKELKGLKELPELKDGLKKAKGEAYMWEVVSKVWAELLCYAATKC  88

Query  455  R--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
               E    L KGG+  +FV LLM H+GL +
Sbjct  89   GAIEHTAQLSKGGEPISFVGLLMTHFGLGD  118



>ref|XP_007221914.1| hypothetical protein PRUPE_ppa026837mg [Prunus persica]
 gb|EMJ23113.1| hypothetical protein PRUPE_ppa026837mg [Prunus persica]
Length=735

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 15/111 (14%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            + + C+ LL    S+     +++    KSVL  A  +A  +       NN K+++    W
Sbjct  625  KTEACEMLLR--VSTEVKPAKVKGDRSKSVLFDACSLASSL-------NNQKEKK----W  671

Query  509  KGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQEILE  363
            + LS+VW  +L YA+SHCR + +   L++GG+  T V LLMAH G+ E L+
Sbjct  672  EILSQVWIEILGYAASHCRGNFHAQQLRRGGELLTHVWLLMAHLGITEQLQ  722



>ref|XP_006342534.1| PREDICTED: uncharacterized protein LOC102605257 isoform X1 [Solanum 
tuberosum]
 ref|XP_006342535.1| PREDICTED: uncharacterized protein LOC102605257 isoform X2 [Solanum 
tuberosum]
Length=696

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 47/81 (58%), Gaps = 12/81 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+ +          K++  Q  W+ +SEVW  +L YA++HCR + +   L
Sbjct  610  KSVLFDACILAKSL----------KEKGTQRKWEIISEVWVEMLAYAATHCRGNHHAQQL  659

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            +KGG+  T V LLMAH G+ E
Sbjct  660  RKGGELLTHVWLLMAHLGITE  680



>gb|KFK25862.1| hypothetical protein AALP_AA8G171900 [Arabis alpina]
Length=763

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 32/86 (37%), Positives = 48/86 (56%), Gaps = 8/86 (9%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL     +A+E+     ++NNT        W+ +S+VW  LL YA++ C  
Sbjct  665  DVKGDRSKSVLFDGGMLAKELKGLKKDDNNTY------MWEVVSKVWVELLSYAATKCSA  718

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGL  378
            +E    L KGG+  +FV LLMAH GL
Sbjct  719  KEHAAQLSKGGELISFVWLLMAHLGL  744



>ref|XP_006368456.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
 gb|ERP65025.1| hypothetical protein POPTR_0001s02970g [Populus trichocarpa]
Length=729

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W+ LS+VW  LL YA+ HCR   +   + KGG+  TFV LLMAH+GL +
Sbjct  664  WELLSKVWVELLSYAAGHCRATAHAQQVSKGGELITFVWLLMAHFGLAD  712



>ref|XP_008225847.1| PREDICTED: uncharacterized protein LOC103325459 [Prunus mume]
Length=686

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +K C +LL+     C D    +++    KSVL  A  +A+ + + + +   + +++    
Sbjct  570  RKACTKLLD----VCTDILPSKVKGDRSKSVLFDACRLAKALQSLESDRGWSNERK----  621

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            WK +S VW  +L YA++ CR   +   L++GG+  T V LLMAH GL E
Sbjct  622  WKFVSHVWVEMLSYAANQCRWSGHAQQLRRGGELLTHVWLLMAHLGLTE  670



>ref|XP_006280006.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
 gb|EOA12904.1| hypothetical protein CARUB_v10025879mg [Capsella rubella]
Length=838

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 60/116 (52%), Gaps = 15/116 (13%)
 Frame = -3

Query  701  RQISRKKPC----QRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTK  534
            R I  KK      + +LN   +S  D   ++    KSVL  A  +++++  T+ E  + K
Sbjct  715  RHIEDKKSVKIATENILN--VNSKTDPMSVKGDRSKSVLFDASRLSKDL--TEMERTHGK  770

Query  533  QQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +     W+ LS+VW  LL YA+ HC     V  L +GG+   FV LLMAH+GL +
Sbjct  771  DK-----WEILSKVWVELLCYAACHCDATAHVEQLSRGGELINFVWLLMAHFGLTD  821



>ref|XP_010654879.1| PREDICTED: uncharacterized protein LOC100246334 [Vitis vinifera]
Length=734

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 13/97 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL +A  +A+++ + + E          E WK +SEVW  +L YA+SHC   +    L
Sbjct  592  KSVLFEACGLAKKLKSLEMEMG--------EKWKMVSEVWVEMLCYAASHCGWIQHGQQL  643

Query  434  KKGGQFYTFVRLLMAHYGLQE---ILEGEKHSFPELS  333
            ++GG+  T V LLM+H GL E   ILEGE      LS
Sbjct  644  RRGGELLTHVCLLMSHLGLSEQFQILEGENEIRSRLS  680



>ref|XP_006484676.1| PREDICTED: uncharacterized protein LOC102625373 [Citrus sinensis]
Length=831

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 56/107 (52%), Gaps = 14/107 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K+ C+++LN    +      ++    KSVL     + +E+          K+ + ++ W+
Sbjct  720  KEACEKILN--VQTYVKPSAVKGDRSKSVLFDGSILTKEL----------KKLEKRDRWE  767

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +S+VW  LL YA++HC  R     +  GG+  TFV LLMAH+GL E
Sbjct  768  LMSKVWLELLSYAATHCDPRAHAQLVSSGGELITFVWLLMAHFGLGE  814



>ref|XP_002863477.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39736.1| hypothetical protein ARALYDRAFT_494436 [Arabidopsis lyrata subsp. 
lyrata]
Length=870

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 33/88 (38%), Positives = 50/88 (57%), Gaps = 11/88 (13%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREI--MNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC  456
            +++    KSVL     +A+E+  ++ + ENN        E W+ +S+VW  LL YA++ C
Sbjct  771  DVKGDRSKSVLFDGAMLAKELKGLSKNKENNT-------EMWEIVSKVWVELLSYAATKC  823

Query  455  R--EDVYYLKKGGQFYTFVRLLMAHYGL  378
               E    L KGG+  +FV LLMAH+GL
Sbjct  824  GAIEHAAQLSKGGELISFVWLLMAHFGL  851



>ref|XP_010650601.1| PREDICTED: uncharacterized protein LOC104879459 [Vitis vinifera]
Length=582

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+ + + + E  N +++     W+ +S VW  +L YA+ HC  + +   L
Sbjct  502  KSVLLDACRLAKSLQSLESEKWNNEKK-----WEMMSHVWVEMLCYAACHCPRNKHAKEL  556

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+  T V LLMAH+G+ E
Sbjct  557  TQGGELLTHVWLLMAHFGITE  577



>emb|CBI36698.3| unnamed protein product [Vitis vinifera]
Length=638

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+ + + + E  N +++     W+ +S VW  +L YA+ HC  + +   L
Sbjct  448  KSVLLDACRLAKSLQSLESEKWNNEKK-----WEMMSHVWVEMLCYAACHCPRNKHAKEL  502

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+  T V LLMAH+G+ E
Sbjct  503  TQGGELLTHVWLLMAHFGITE  523



>ref|XP_006282044.1| hypothetical protein CARUB_v10028286mg [Capsella rubella]
 gb|EOA14942.1| hypothetical protein CARUB_v10028286mg [Capsella rubella]
Length=834

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL  A  +A+++  T+ E  + K +     W+ LS+VW  LL YA+ HC  
Sbjct  737  DVKGDRSKSVLFDASRLAKDL--TEMEKTHEKDK-----WEILSKVWVELLCYAACHCDA  789

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
               V  L +GG+   FV LLMAH+GL +  +  K
Sbjct  790  TAHVEQLSRGGELINFVWLLMAHFGLTDQFQINK  823



>ref|XP_010481582.1| PREDICTED: uncharacterized protein LOC104760366 [Camelina sativa]
Length=801

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 14/103 (14%)
 Frame = -3

Query  674  QRLLNGDYSSCNDKKELENK--YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGL  501
            + + NG  SS  + +E + +   +++VL  A  +A          N  KQ      W  +
Sbjct  690  ENVCNGILSSLGESRERKGRRHQRRNVLADASRLA----------NALKQISGNTKWMIV  739

Query  500  SEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            S VW  +L Y +++C  ++ V  L KGG+F +FV LLMAH+GL
Sbjct  740  SNVWVEMLCYGATYCDPKQHVAQLSKGGEFISFVWLLMAHFGL  782



>emb|CAN83022.1| hypothetical protein VITISV_036395 [Vitis vinifera]
Length=557

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = -3

Query  608  KSVLPKAVEVAREI--MNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVY  441
            KSVL  A  +A+ +  + ++ E NN K+      W+ +S VW  +L YA+ HC   E   
Sbjct  476  KSVLLDACRLAKSLQSLESEKEWNNEKK------WEMMSHVWVEMLCYAACHCPRNEHAK  529

Query  440  YLKKGGQFYTFVRLLMAHYGLQE  372
             L +GG+  T V LLMAH+G+ E
Sbjct  530  ELTQGGELLTHVWLLMAHFGITE  552



>ref|XP_010494649.1| PREDICTED: uncharacterized protein LOC104771771 [Camelina sativa]
Length=800

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 14/103 (14%)
 Frame = -3

Query  674  QRLLNGDYSSCNDKKELENK--YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGL  501
            + + NG  SS  + +E + +   +++VL  A  +A          N  KQ      W  +
Sbjct  689  ENVCNGILSSLGESRERKGRRHQRRNVLADASRLA----------NALKQISGSTKWMIV  738

Query  500  SEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            S VW  +L Y +++C  ++ V  L KGG+F +FV LLMAH+GL
Sbjct  739  SNVWVEMLCYGATYCDPKQHVAQLSKGGEFISFVWLLMAHFGL  781



>ref|XP_010648157.1| PREDICTED: uncharacterized protein LOC100255511 [Vitis vinifera]
Length=759

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL  A  +A+E+          K+   ++ WK +SEVW  LL YA+S C  
Sbjct  665  EVKGDRSKSVLFDACILAKEL----------KKMDERKRWKVMSEVWVELLSYAASRCGA  714

Query  449  D--VYYLKKGGQFYTFVRLLMAHYGLQEILEGEK-HSFPEL  336
            +  V  L KGG+  TFV LLM   GL +    E  H+ P++
Sbjct  715  NTHVQQLSKGGELVTFVWLLMTQLGLGDQFRVETGHARPKM  755



>ref|XP_006428002.1| hypothetical protein CICLE_v10025090mg [Citrus clementina]
 gb|ESR41242.1| hypothetical protein CICLE_v10025090mg [Citrus clementina]
 gb|KDO59887.1| hypothetical protein CISIN_1g048240mg [Citrus sinensis]
Length=664

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 14/105 (13%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C  +L+   ++  +  E++    KS+L +A  +A+++   D ++           WK
Sbjct  553  KDACDEILS--VNTFAEPAEVKGDRSKSLLFEATMLAKQLKKLDQKSK----------WK  600

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
             +S++W  L  YA+SHC  R     L KGG+  TFV LLM+H+GL
Sbjct  601  LISKMWVELSSYAASHCDARSHAQQLSKGGELITFVWLLMSHFGL  645



>gb|KEH43307.1| DUF594 family protein [Medicago truncatula]
Length=717

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 51/88 (58%), Gaps = 6/88 (7%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            E++    KSVL  A  +A+ + + + E N +K+++    W+ +S VW  +L +A+S CR 
Sbjct  614  EVKGDRSKSVLFDACRLAKSLQSLETEENWSKERK----WEMISHVWVEMLCHAASQCRG  669

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             +    L +GG+  T V LLMAH G+ E
Sbjct  670  LQHAKQLTQGGELLTHVWLLMAHLGITE  697



>ref|XP_006388862.1| hypothetical protein POPTR_0088s00260g [Populus trichocarpa]
 gb|ERP47776.1| hypothetical protein POPTR_0088s00260g [Populus trichocarpa]
Length=655

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 5/74 (7%)
 Frame = -3

Query  539  TKQQQP---QEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQ  375
             KQ QP   +E W+ + EVW  +L YA++HC  +E  + L++GG+  T V LLM H GL 
Sbjct  567  AKQLQPLESKERWEMIKEVWIEMLAYAAAHCPWKEHTHQLRRGGELLTHVSLLMLHLGLS  626

Query  374  EILEGEKHSFPELS  333
            E  E  +    E+S
Sbjct  627  EQYEFTRFDGDEVS  640



>ref|XP_010034349.1| PREDICTED: uncharacterized protein LOC104423580 [Eucalyptus grandis]
Length=464

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W  +SEVW  LL YA+ HCR D++   L  GG+  T V LLM H+GL E
Sbjct  409  WVIVSEVWVELLAYAAIHCRPDMHAQQLSTGGELITLVWLLMVHFGLSE  457



>ref|XP_010449415.1| PREDICTED: uncharacterized protein LOC104731663 [Camelina sativa]
Length=810

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/105 (31%), Positives = 55/105 (52%), Gaps = 8/105 (8%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            K  C  +L+   +     +  +    KSVL +A  +A+E+   + + +N K       W+
Sbjct  686  KTACNAILDYYKADGQGNENPQGYRSKSVLFQASMLAQELQRIEIQISNKK------MWE  739

Query  506  GLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
             +S+VW  +L YA+ HC  ++    L  GG+  +FV LLMAH+GL
Sbjct  740  VVSKVWVEMLSYAAKHCDPKQHAAQLNIGGELISFVWLLMAHFGL  784



>ref|XP_010032441.1| PREDICTED: uncharacterized protein LOC104421953 isoform X2 [Eucalyptus 
grandis]
Length=488

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W  +SEVW  LL YA+ HCR D++   L  GG+  T V LLM H+GL E
Sbjct  438  WVIVSEVWVELLAYAAIHCRPDMHAQQLSTGGELVTLVWLLMVHFGLSE  486



>emb|CDY39432.1| BnaAnng05630D [Brassica napus]
Length=709

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (57%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL     +A+E+M          Q+  +  W+ +S+VW  LL +A++HC  +E    L
Sbjct  620  KSVLFDGSVLAQELMKL--------QKGRENMWEVVSKVWVELLCFAATHCDSQEHASQL  671

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLMAH+GL
Sbjct  672  SKGGELINFVWLLMAHFGL  690



>ref|XP_007217306.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
 gb|EMJ18505.1| hypothetical protein PRUPE_ppa015371mg [Prunus persica]
Length=690

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            +K C  LL    S+     E++    KSVL  A  +A+ + + + E +    ++    W+
Sbjct  573  EKACTMLLK--VSTDISPSEVKGDRSKSVLFDACRLAKALQSMEVEGHWGTNEKK---WE  627

Query  506  GLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGEKHS  348
             +S+VW  +L YA++ CR  +    L++GG+  T V LLMAH GL E   I EG K +
Sbjct  628  LVSQVWVEMLSYAANRCRWSDHAQQLRRGGELLTHVWLLMAHLGLTEQFQISEGHKRA  685



>ref|XP_010441710.1| PREDICTED: uncharacterized protein LOC104724853 isoform X1 [Camelina 
sativa]
 ref|XP_010441711.1| PREDICTED: uncharacterized protein LOC104724853 isoform X2 [Camelina 
sativa]
 ref|XP_010441712.1| PREDICTED: uncharacterized protein LOC104724853 isoform X3 [Camelina 
sativa]
Length=876

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A E+        +  ++   E WK +S+VW  LL YA++ C  
Sbjct  777  DVKGDRSKSVLFDGAMLAEELKGI-----SKNKEDDTEMWKIMSQVWVELLCYAATKCGA  831

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  +FV LLMAH+GL
Sbjct  832  VEHAAQLSKGGELISFVWLLMAHFGL  857



>emb|CDY38969.1| BnaC07g18510D [Brassica napus]
Length=663

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 44/79 (56%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL     +A+E+M          Q   +  W+ +S+VW  LL +A++HC  +E    L
Sbjct  574  KSVLFDGSVLAQELMKL--------QNGRESMWEVVSKVWVELLCFAATHCDSQEHASQL  625

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLMAH+GL
Sbjct  626  SKGGELINFVWLLMAHFGL  644



>ref|XP_009372850.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
 ref|XP_009372923.1| PREDICTED: uncharacterized protein LOC103961896 [Pyrus x bretschneideri]
Length=756

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEKHSFP  342
            W  +S VW  LL YA+ HCR  +    L KGG+  TFV LLMAH+G+ E  +  E H+  
Sbjct  691  WDLMSRVWVELLSYAACHCRAKDHAQLLSKGGELVTFVWLLMAHFGIGEQFQINEGHARA  750

Query  341  EL  336
            +L
Sbjct  751  KL  752



>ref|NP_199361.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB09176.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95257.1| uncharacterized protein AT5G45480 [Arabidopsis thaliana]
Length=877

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A+E+           ++   E WK +S+VW  LL YA++ C  
Sbjct  778  DVKGDRSKSVLFDGAMLAKELKGL-----RKNKEDDSEMWKIMSQVWVELLSYAATKCGA  832

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  +FV LLMAH+GL
Sbjct  833  IEHAAQLSKGGELISFVWLLMAHFGL  858



>ref|XP_008228196.1| PREDICTED: uncharacterized protein LOC103327633 [Prunus mume]
Length=540

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 62/118 (53%), Gaps = 10/118 (8%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWK  507
            +K C  LL    S+     E++    KSVL  A  +A+ + + + E +    ++    W+
Sbjct  423  EKACTMLLK--VSTDISPSEVKGDRSKSVLFDACRLAKALQSMEVEGHWGTNEKK---WE  477

Query  506  GLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE---ILEGEKHS  348
             +S+VW  +L YA++ CR  +    L++GG+  T V LLMAH GL E   I EG K +
Sbjct  478  LVSQVWVEMLSYAANRCRWSDHAQQLRRGGELLTHVWLLMAHLGLTEQFQISEGHKRA  535



>ref|XP_010032440.1| PREDICTED: uncharacterized protein LOC104421953 isoform X1 [Eucalyptus 
grandis]
Length=678

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W  +SEVW  LL YA+ HCR D++   L  GG+  T V LLM H+GL E
Sbjct  628  WVIVSEVWVELLAYAAIHCRPDMHAQQLSTGGELVTLVWLLMVHFGLSE  676



>ref|XP_011040249.1| PREDICTED: uncharacterized protein LOC105136553 [Populus euphratica]
Length=684

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 56/94 (60%), Gaps = 13/94 (14%)
 Frame = -3

Query  632  KELENKYKK-----SVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYA  468
            +E  N+ KK     S+L  A ++A+E+ +   ENN T +++    W+ +S++W  +L YA
Sbjct  581  EEFLNEIKKNGNNVSMLHDACKLAKELQSL--ENNWTNEKK----WRMISQIWVEMLAYA  634

Query  467  SSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            +S+C  +E    L +GG+  T V LLMAH GL E
Sbjct  635  ASNCGWKEHAQALTRGGELLTRVCLLMAHLGLSE  668



>ref|XP_010441713.1| PREDICTED: uncharacterized protein LOC104724853 isoform X4 [Camelina 
sativa]
Length=882

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A E+        +  ++   E WK +S+VW  LL YA++ C  
Sbjct  783  DVKGDRSKSVLFDGAMLAEELKGI-----SKNKEDDTEMWKIMSQVWVELLCYAATKCGA  837

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  +FV LLMAH+GL
Sbjct  838  VEHAAQLSKGGELISFVWLLMAHFGL  863



>ref|XP_010650636.1| PREDICTED: uncharacterized protein LOC104879474 [Vitis vinifera]
Length=649

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 10/83 (12%)
 Frame = -3

Query  608  KSVLPKAVEVAREI--MNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVY  441
            KSVL +A  +A+ +  + T+ E N  K+      W+ +S VW  +L YA+ HC   E   
Sbjct  557  KSVLSEACRLAKSLQSLETEEEWNCEKK------WEMMSHVWVEMLCYAACHCPRNEHAK  610

Query  440  YLKKGGQFYTFVRLLMAHYGLQE  372
             L +GG+  T V LLMAH+G+ E
Sbjct  611  ELTQGGELLTHVWLLMAHFGITE  633



>ref|XP_006374420.1| hypothetical protein POPTR_0015s07020g [Populus trichocarpa]
 gb|ERP52217.1| hypothetical protein POPTR_0015s07020g [Populus trichocarpa]
Length=688

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = -3

Query  617  KYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDV  444
            K  KSV+    ++AR++          +  + ++ W+ ++EVW  +L YA++HC  +E  
Sbjct  564  KIAKSVVIGGEKLARQL----------RSLESKKRWEMINEVWIEMLAYAAAHCPWKEHT  613

Query  443  YYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPELS  333
            + L++GG+  T V LLM H+GL E  E  +    E+S
Sbjct  614  HQLRRGGELLTHVFLLMLHFGLSEQYEFTRFDGDEVS  650



>emb|CBI34045.3| unnamed protein product [Vitis vinifera]
Length=446

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL  A  +A+E+          K+   ++ WK +SEVW  LL YA+S C  
Sbjct  352  EVKGDRSKSVLFDACILAKEL----------KKMDERKRWKVMSEVWVELLSYAASRCGA  401

Query  449  DVYY--LKKGGQFYTFVRLLMAHYGLQEILEGEK-HSFPEL  336
            + +   L KGG+  TFV LLM   GL +    E  H+ P++
Sbjct  402  NTHVQQLSKGGELVTFVWLLMTQLGLGDQFRVETGHARPKM  442



>emb|CDP19717.1| unnamed protein product [Coffea canephora]
Length=549

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S+VW  LL YA+ HCR   +   L KGG+  TFV LLMAH+GL +
Sbjct  484  WEIMSKVWVELLSYAAIHCRASAHAQQLSKGGELITFVWLLMAHFGLGD  532



>ref|XP_006374419.1| hypothetical protein POPTR_0015s07020g [Populus trichocarpa]
 gb|ERP52216.1| hypothetical protein POPTR_0015s07020g [Populus trichocarpa]
Length=687

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = -3

Query  617  KYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDV  444
            K  KSV+    ++AR++          +  + ++ W+ ++EVW  +L YA++HC  +E  
Sbjct  564  KIAKSVVIGGEKLARQL----------RSLESKKRWEMINEVWIEMLAYAAAHCPWKEHT  613

Query  443  YYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPELS  333
            + L++GG+  T V LLM H+GL E  E  +    E+S
Sbjct  614  HQLRRGGELLTHVFLLMLHFGLSEQYEFTRFDGDEVS  650



>ref|XP_004253121.1| PREDICTED: uncharacterized protein LOC101249163 [Solanum lycopersicum]
Length=695

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 12/81 (15%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A+ +          K +  Q  W+ +SEVW  +L YA++HCR + +   L
Sbjct  609  KSVLFDACILAKSL----------KAKGNQRKWEIISEVWVEMLAYAATHCRGNHHAQQL  658

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            +KGG+  T V LLMAH G+ E
Sbjct  659  RKGGELLTHVWLLMAHLGITE  679



>ref|XP_004496124.1| PREDICTED: uncharacterized protein LOC101496417 [Cicer arietinum]
Length=677

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 58/108 (54%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R K C+ +L  +  +     E++    KSVL  A  +A+ + + + E N +K+++    W
Sbjct  560  RSKVCKMILRVN--TKISPSEVKGDRSKSVLFDACRLAKSLESLETEENWSKERK----W  613

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S +W  +L +A+S CR       L +GG+  T V LLMAH G+ E
Sbjct  614  EMISNIWVEMLCHAASQCRGFHHAKQLSQGGELLTHVWLLMAHLGITE  661



>gb|KHN00959.1| hypothetical protein glysoja_000627 [Glycine soja]
Length=595

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 10/95 (11%)
 Frame = -3

Query  638  DKKELENKYK----KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVY  471
            D+K L +K K    KSVL  A  +A+ I + + E   +K+Q+    W+ +S VW  +L +
Sbjct  489  DEKFLPSKVKGDRSKSVLFDACRLAKSIKSLEEEKKWSKEQK----WEMISRVWVEMLCH  544

Query  470  ASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            A+S CR       L +GG+  T V  LMAH G+ E
Sbjct  545  AASQCRGFHHAKQLSRGGELLTHVWFLMAHLGITE  579



>ref|XP_006388860.1| hypothetical protein POPTR_0088s00240g, partial [Populus trichocarpa]
 gb|ERP47774.1| hypothetical protein POPTR_0088s00240g, partial [Populus trichocarpa]
Length=701

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 14/126 (11%)
 Frame = -3

Query  671  RLLNGDYSSCNDKKELENKYK--KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            R L+   S   D +  ++ +K  KSVL     +AR+++  + E             + ++
Sbjct  556  RELHNSVSRVYDDRGFQSVWKTEKSVLRGVERLARQLLRLESEARR----------RMIN  605

Query  497  EVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPELSFFL  324
            EVW  ++ YA++HC  +E  + L++GG+  T V LLM H GL    +      P + F L
Sbjct  606  EVWVEMVAYAAAHCPWKEHTHQLRRGGELLTHVSLLMLHLGLSAQYDINGFDGPPVIFEL  665

Query  323  NAKIGK  306
              KI K
Sbjct  666  TKKIEK  671



>ref|XP_011012477.1| PREDICTED: uncharacterized protein LOC105116722 [Populus euphratica]
Length=718

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 5/61 (8%)
 Frame = -3

Query  539  TKQQQPQEF---WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQ  375
            TKQ +  EF   WK +SEVW  +L YA++HC  +E    L++GG+  T V  LM H GL 
Sbjct  560  TKQLRSLEFEKRWKMISEVWIEMLAYAAAHCPWKEHAQELRRGGELLTHVCFLMLHLGLS  619

Query  374  E  372
            E
Sbjct  620  E  620



>ref|XP_003555479.1| PREDICTED: uncharacterized protein LOC100799916 [Glycine max]
Length=674

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 52/95 (55%), Gaps = 10/95 (11%)
 Frame = -3

Query  638  DKKELENKYK----KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVY  471
            D+K L +K K    KSVL  A  +A+ I + + E   +K+Q+    W+ +S VW  +L +
Sbjct  568  DEKFLPSKVKGDRSKSVLFDACRLAKSIKSLEEEKKWSKEQK----WEMISRVWVEMLCH  623

Query  470  ASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            A+S CR       L +GG+  T V  LMAH G+ E
Sbjct  624  AASQCRGFHHAKQLSRGGELLTHVWFLMAHLGITE  658



>ref|XP_002321761.2| hypothetical protein POPTR_0015s11930g [Populus trichocarpa]
 gb|EEF05888.2| hypothetical protein POPTR_0015s11930g [Populus trichocarpa]
Length=655

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = -3

Query  539  TKQQQPQEF---WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQ  375
             KQ QP E    W+ + EVW  +L YA++HC  +E  + L++GG+  T V LLM H GL 
Sbjct  544  AKQLQPLESKKRWEMIKEVWIEMLAYAAAHCPWKEHTHQLRRGGELLTHVSLLMLHLGLS  603

Query  374  EILEGEKHSFPELS  333
            E  E  +    E+S
Sbjct  604  EQYEFTRFDGDEVS  617



>ref|XP_006374609.1| hypothetical protein POPTR_0015s12660g, partial [Populus trichocarpa]
 gb|ERP52406.1| hypothetical protein POPTR_0015s12660g, partial [Populus trichocarpa]
Length=357

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 6/81 (7%)
 Frame = -3

Query  524  PQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQ-EILEGEK  354
            P++ W+ + EVW  ++ YA++HC  +E    L++GG+  T V LLM H GL  +  E E 
Sbjct  275  PEKRWEMIHEVWVEMVAYAAAHCPWKEHTKELRRGGELLTHVSLLMLHLGLSAQYEENES  334

Query  353  HSFPELS---FFLNAKIGKPN  300
              + EL     F++A + K N
Sbjct  335  EYYLELRGIFAFIDALVSKKN  355



>ref|XP_011043924.1| PREDICTED: uncharacterized protein LOC105139246 [Populus euphratica]
Length=313

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -3

Query  611  KKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYY  438
            K SVL    ++A+ + + + ++    +++    W+ +S VW  +L YA+SHC  +E    
Sbjct  231  KVSVLCAGFKLAKSLQSLETQDGWENKRK----WEMISTVWVEMLTYAASHCGWKEHAQA  286

Query  437  LKKGGQFYTFVRLLMAHYGLQE  372
            L +GG+  T V LLMAH GL E
Sbjct  287  LTRGGELLTHVCLLMAHLGLSE  308



>ref|XP_007214073.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
 gb|EMJ15272.1| hypothetical protein PRUPE_ppa017743mg [Prunus persica]
Length=686

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 12/109 (11%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +K C +LL+     C D    +++    KSVL  A  +A+ + + + +   + +++    
Sbjct  570  RKACTKLLD----VCTDILPSKVKGDRSKSVLFDACRLAKALQSLESDRGWSNERK----  621

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S VW  +L YA++ CR   +   L++GG+  T V LLMAH GL E
Sbjct  622  WEFVSHVWVEMLSYAANQCRWSGHAQQLRRGGELLTHVWLLMAHLGLTE  670



>ref|XP_007227431.1| hypothetical protein PRUPE_ppb023961mg, partial [Prunus persica]
 gb|EMJ28630.1| hypothetical protein PRUPE_ppb023961mg, partial [Prunus persica]
Length=199

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 65/126 (52%), Gaps = 17/126 (13%)
 Frame = -3

Query  698  QISRKKPCQRLLNGDYSSCND--KKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQ  525
            ++  +K C +LL+     C D    +++    KSVL  A  +A+ + +   E+N  ++  
Sbjct  69   KLGERKACTKLLD----VCTDILPSKVKGDRSKSVLFDACRLAKALQSL--ESNRGRK--  120

Query  524  PQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE-GEK  354
                W+ +S VW  +L YA++ CR       L++GG+  T V LLMAH GL E  +  E 
Sbjct  121  ----WQFVSHVWVEMLPYAANQCRWSGQAQQLRRGGELLTHVWLLMAHMGLTEQFQISEG  176

Query  353  HSFPEL  336
            H+  +L
Sbjct  177  HARAKL  182



>ref|XP_007015633.1| Uncharacterized protein TCM_041206 [Theobroma cacao]
 gb|EOY33252.1| Uncharacterized protein TCM_041206 [Theobroma cacao]
Length=680

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 8/103 (8%)
 Frame = -3

Query  680  PCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGL  501
             C++LL  D  +  +   ++    KSVL  A  +A+E+ + + E    ++   +E W+ +
Sbjct  566  ACEKLLQVD--TRIEPAIVKGDRSKSVLFDACRLAKELHSLEQE----RKWHTKEKWELV  619

Query  500  SEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGL  378
            S VW  +L YA+S CR  +    L++GG+  T V LLMAH GL
Sbjct  620  SHVWLEMLSYAASQCRWNQHAQQLRRGGELLTHVWLLMAHLGL  662



>ref|XP_006374598.1| hypothetical protein POPTR_0015s12510g [Populus trichocarpa]
 gb|ERP52395.1| hypothetical protein POPTR_0015s12510g [Populus trichocarpa]
Length=645

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 51/97 (53%), Gaps = 14/97 (14%)
 Frame = -3

Query  650  SSCNDKKELENKYK--KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            S   D +E +  +K  KSVL     +AR++++  PE            W  ++EVW  ++
Sbjct  527  SRVYDDEEFQALWKIEKSVLRGVYALARQLLSLGPEKR----------WWMINEVWVEMV  576

Query  476  VYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             YA++HC  +E    L++GG+  T V LL+ H GL E
Sbjct  577  AYAAAHCPWKEHTQQLRRGGELLTHVSLLVLHLGLSE  613



>ref|XP_010034767.1| PREDICTED: uncharacterized protein LOC104424081 [Eucalyptus grandis]
Length=450

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 2/47 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            W  +SEVW  +L+YA++ C  R+   Y++ GG+  T V LLMAHYGL
Sbjct  383  WSAISEVWVEMLIYAANKCKARDHAQYMRGGGELITHVWLLMAHYGL  429



>ref|XP_006380760.1| hypothetical protein POPTR_0007s12830g, partial [Populus trichocarpa]
 gb|ERP58557.1| hypothetical protein POPTR_0007s12830g, partial [Populus trichocarpa]
Length=557

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 57/114 (50%), Gaps = 14/114 (12%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYK--KSVLPKAVEVAREIMNTDPENNNTKQQ  528
            + +S+K     +L G  S    + +  + ++  KSVL     +AR++ +   E       
Sbjct  434  QALSKKDVVDTILLGIESYTTAESDFLSDWRTTKSVLDGGYWLARQLRSWGLEKR-----  488

Query  527  QPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
                 WK ++EVW  +L YA++HC  +E    L++GG+  T V  LM H+GL E
Sbjct  489  -----WKMINEVWIEMLAYAAAHCPRKEHAQQLRRGGELLTHVSFLMLHFGLSE  537



>ref|XP_006398229.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
 gb|ESQ39682.1| hypothetical protein EUTSA_v10000780mg [Eutrema salsugineum]
Length=812

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/86 (35%), Positives = 47/86 (55%), Gaps = 13/86 (15%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL  A  +A+E+           ++     W+ +S+VW  LL +A++HC  
Sbjct  719  DVKGDRSKSVLFDASVLAKEL-----------EKGGDNMWEVVSKVWVELLCFAATHCDS  767

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGL  378
            +E    L KGG+   FV LLMAH+GL
Sbjct  768  KEHASQLSKGGELINFVWLLMAHFGL  793



>ref|XP_002863480.1| hypothetical protein ARALYDRAFT_916927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39739.1| hypothetical protein ARALYDRAFT_916927 [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 9/80 (11%)
 Frame = -3

Query  611  KKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYY  438
            +K+VL  A ++A  +     E+   K       W+ +S+VW  +L Y +++C  ++ V  
Sbjct  718  RKNVLADASKLANALNQLSKEDEEVK-------WEIVSKVWVEMLCYGATYCDPKQHVAQ  770

Query  437  LKKGGQFYTFVRLLMAHYGL  378
            L  GG+F +FV LLMAH+GL
Sbjct  771  LSNGGEFISFVWLLMAHFGL  790



>ref|XP_010529242.1| PREDICTED: uncharacterized protein LOC104806182 [Tarenaya hassleriana]
Length=832

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 49/88 (56%), Gaps = 9/88 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL  A  +A+E+        +   ++ +  W+ + +VW  LL YA++HC  
Sbjct  735  DVKGDRSKSVLFDASMLAKEL-------QHLHSKREENMWEVIGKVWVELLCYAAAHCDS  787

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            +E    L KGG+  +FV LLMA +G+ E
Sbjct  788  KEHAAQLSKGGELISFVWLLMAQFGIGE  815



>ref|XP_010441715.1| PREDICTED: uncharacterized protein LOC104724856 [Camelina sativa]
Length=834

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 9/87 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQ-EFWKGLSEVWAGLLVYASSHCR  453
            +++    KSVL    ++A+E+      N  +K +  Q   WK +S+VW  LL YA++ C 
Sbjct  735  DVKGDRSKSVLFDGAKLAKEL------NGLSKNEGDQANMWKVVSQVWVELLCYAATKCG  788

Query  452  --EDVYYLKKGGQFYTFVRLLMAHYGL  378
              E    L KGG+  +FV LLMAH GL
Sbjct  789  AIEHAAQLSKGGELISFVWLLMAHLGL  815



>ref|XP_009758086.1| PREDICTED: uncharacterized protein LOC104210813 [Nicotiana sylvestris]
Length=720

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = -3

Query  632  KELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC-  456
             E++    KSVL  A  +A+ + + + EN   +  +    W+ +  VW  LL +++++C 
Sbjct  619  SEVKGDRSKSVLFDACRLAKSLQSEEDENPGAENGEK---WEKIFHVWVDLLSFSAANCD  675

Query  455  -REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             ++    L++GG+F T V LLMAH+GL +
Sbjct  676  WKDHAEQLRRGGEFLTHVWLLMAHFGLTD  704



>ref|XP_007201599.1| hypothetical protein PRUPE_ppa019270mg [Prunus persica]
 gb|EMJ02798.1| hypothetical protein PRUPE_ppa019270mg [Prunus persica]
Length=723

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (55%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            +KK C  LL    S+  +  E++    KSVL  A  + +++ + + E    K  + Q+ W
Sbjct  606  QKKACTALLG--VSTEVNPAEVKGDRSKSVLFDACRLTKDLQSLETE----KHWENQKKW  659

Query  509  KGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            + +S VW  +L YA+  C+ + +   L++GG+  T V LLMAH G+ E
Sbjct  660  ELISHVWVEMLSYAACQCQWNHHARQLRRGGELLTHVWLLMAHLGITE  707



>ref|XP_010481570.1| PREDICTED: uncharacterized protein LOC104760359 isoform X1 [Camelina 
sativa]
Length=866

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A E+        +  ++   E WK +S+VW  LL YA++ C  
Sbjct  767  DVKGDRSKSVLFDGAMLADELKGL-----SKSKEDYTEMWKIMSQVWVELLCYAATKCGA  821

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  +FV LLMAH+GL
Sbjct  822  IEHAAQLSKGGELISFVWLLMAHFGL  847



>ref|XP_010481571.1| PREDICTED: uncharacterized protein LOC104760359 isoform X2 [Camelina 
sativa]
Length=869

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/86 (36%), Positives = 46/86 (53%), Gaps = 7/86 (8%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            +++    KSVL     +A E+        +  ++   E WK +S+VW  LL YA++ C  
Sbjct  770  DVKGDRSKSVLFDGAMLADELKGL-----SKSKEDYTEMWKIMSQVWVELLCYAATKCGA  824

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGL  378
             E    L KGG+  +FV LLMAH+GL
Sbjct  825  IEHAAQLSKGGELISFVWLLMAHFGL  850



>ref|XP_009595825.1| PREDICTED: uncharacterized protein LOC104092041 [Nicotiana tomentosiformis]
Length=722

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 59/109 (54%), Gaps = 7/109 (6%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +++  C +LL  +        E++    KSVL  A  +A+ + + + EN   +  +    
Sbjct  603  TKELACDKLLQINTEIA--PSEVKGDRSKSVLFDACRLAKSLQSEEDENPGAENGEK---  657

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +  VW  LL +++++C  ++    L++GG+F T V LLMAH+GL +
Sbjct  658  WEKIFHVWVDLLSFSAANCDWKDHAEQLRRGGEFLTHVWLLMAHFGLTD  706



>ref|XP_010441702.1| PREDICTED: uncharacterized protein LOC104724847 [Camelina sativa]
Length=791

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSV   A  +A+E+     E  N         W+ +S+VW  +L YA+ HC  +E    L
Sbjct  702  KSVFFDASVLAKELRRLKDEGEN--------MWEVVSKVWVEMLCYAAIHCSSQEHASQL  753

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLM H+GL
Sbjct  754  SKGGELIDFVWLLMTHFGL  772



>ref|XP_010494665.1| PREDICTED: uncharacterized protein LOC104771784 [Camelina sativa]
Length=792

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSV   A  +A+E+     E  N         W+ +S+VW  +L YA+ HC  +E    L
Sbjct  703  KSVFFDASMLAKELRRLKDEGEN--------MWEVVSKVWVEMLCYAAIHCSSQEHASQL  754

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLM H+GL
Sbjct  755  SKGGELIDFVWLLMTHFGL  773



>gb|KCW80598.1| hypothetical protein EUGRSUZ_C01961 [Eucalyptus grandis]
Length=106

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = -3

Query  536  KQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            K+ + ++ W+ +++ W  +L+YA+S CR D +   L++GG+  T V L+MAH+GL +
Sbjct  34   KETEVRKKWETIAKFWTKILMYAASQCRGDGHARQLRRGGELLTHVWLMMAHFGLTD  90



>ref|XP_010481573.1| PREDICTED: uncharacterized protein LOC104760360 [Camelina sativa]
Length=849

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 9/81 (11%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSVL  A  +A+++  T+ E  + K +     W+ LS+VW  LL YA+ HC     V  L
Sbjct  759  KSVLFDASRLAKDL--TEMEKTHKKDK-----WEILSKVWVELLCYAACHCDATSHVEQL  811

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +G +   FV LLMAH+GL +
Sbjct  812  SRGAELINFVWLLMAHFGLTD  832



>ref|XP_006374605.1| hypothetical protein POPTR_0015s12610g [Populus trichocarpa]
 gb|ERP52402.1| hypothetical protein POPTR_0015s12610g [Populus trichocarpa]
Length=569

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  524  PQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            P++ W+ ++EVW  ++ YA++HC  RE  + L++GG+  T V LLM H GL E
Sbjct  495  PKKRWEMINEVWVEMVAYAAAHCPWREHTHELRRGGELLTHVFLLMLHLGLSE  547



>ref|XP_006573316.1| PREDICTED: uncharacterized protein LOC102662220 isoform X2 [Glycine 
max]
Length=685

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 12/112 (11%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            RQ +  + C  LL  D ++  D K        SV+  A  VA+E++           +  
Sbjct  564  RQDNLPETCTILLQHDIATTGDDKA-SKMQSASVMFHACNVAKELI---------AAENG  613

Query  521  QEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             + WK + E+W  +L YA + CR D++   L++G +F + V LL AH GL +
Sbjct  614  IQMWKFVEELWVEILCYAGAQCRVDMHAQQLRRGPEFLSNVWLLQAHLGLLD  665



>ref|XP_010481562.1| PREDICTED: uncharacterized protein LOC104760352 [Camelina sativa]
Length=790

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSV   A  +A+E+     E  N         W+ +S+VW  +L YA+ HC  +E    L
Sbjct  701  KSVFFDASVLAKELRRLKDEGEN--------MWEVVSKVWVEMLCYAAIHCSSQEHASQL  752

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLM H+GL
Sbjct  753  SKGGELIDFVWLLMTHFGL  771



>ref|XP_006573315.1| PREDICTED: uncharacterized protein LOC102662220 isoform X1 [Glycine 
max]
Length=693

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 12/112 (11%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            RQ +  + C  LL  D ++  D K  + +   SV+  A  VA+E++           +  
Sbjct  572  RQDNLPETCTILLQHDIATTGDDKASKMQ-SASVMFHACNVAKELI---------AAENG  621

Query  521  QEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             + WK + E+W  +L YA + CR D++   L++G +F + V LL AH GL +
Sbjct  622  IQMWKFVEELWVEILCYAGAQCRVDMHAQQLRRGPEFLSNVWLLQAHLGLLD  673



>gb|KHN00961.1| hypothetical protein glysoja_000629 [Glycine soja]
Length=728

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+ I + + E   +K+++    W+ +S VW  +L +A+S CR       L
Sbjct  636  KSVLFDAQRLAKSIKSLEQEMKWSKEEK----WRMISRVWVEMLCHAASQCRGFHHAKQL  691

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +GG+  T V LLMAH G+ E L+  K
Sbjct  692  SRGGELLTHVWLLMAHLGITEQLQISK  718



>emb|CDY52752.1| BnaA07g37670D [Brassica napus]
Length=76

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 2/47 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
            W  +S VW  LL YA++HC  ++   +L KGG+  +FV LLMAH GL
Sbjct  24   WGVVSRVWVELLYYAANHCESKQHAAHLSKGGEIVSFVWLLMAHMGL  70



>gb|KHN43840.1| hypothetical protein glysoja_039087 [Glycine soja]
Length=667

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (51%), Gaps = 12/112 (11%)
 Frame = -3

Query  701  RQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP  522
            RQ +  + C  LL  D ++  D K  + +   SV+  A  VA+E++           +  
Sbjct  546  RQDNLPETCTILLQHDIATTGDDKASKMQ-SASVMFHACNVAKELI---------AAENG  595

Query  521  QEFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             + WK + E+W  +L YA + CR D++   L++G +F + V LL AH GL +
Sbjct  596  IQMWKFVEELWVEILCYAGAQCRVDMHAQQLRRGPEFLSNVWLLQAHLGLLD  647



>ref|XP_002863478.1| hypothetical protein ARALYDRAFT_494437 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39737.1| hypothetical protein ARALYDRAFT_494437 [Arabidopsis lyrata subsp. 
lyrata]
Length=838

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 50/94 (53%), Gaps = 9/94 (10%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--  456
            +++    KSVL  A ++A+++   +  +   K       W+ LS+VW  LL +A+ HC  
Sbjct  741  DVKGDRSKSVLFDASKLAKDLAEMEKTHKKDK-------WEILSKVWVELLCHAACHCDA  793

Query  455  REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
               V  L +GG+   FV LLMAH+GL +  +  K
Sbjct  794  TAHVEQLSRGGELINFVWLLMAHFGLTDQFQINK  827



>ref|XP_006280036.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
 gb|EOA12934.1| hypothetical protein CARUB_v10025913mg [Capsella rubella]
Length=787

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 41/79 (52%), Gaps = 10/79 (13%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYL  435
            KSV   A  +A+E+     E  N         W+ +S+VW  +L YA+ HC  +E    L
Sbjct  698  KSVFFDASVLAKEMRRLKDEGEN--------MWEVVSKVWVEMLCYAAIHCSSQEHASQL  749

Query  434  KKGGQFYTFVRLLMAHYGL  378
             KGG+   FV LLM H+GL
Sbjct  750  SKGGELINFVWLLMTHFGL  768



>ref|XP_006606311.1| PREDICTED: uncharacterized protein LOC102661509 isoform X1 [Glycine 
max]
 ref|XP_006606312.1| PREDICTED: uncharacterized protein LOC102661509 isoform X2 [Glycine 
max]
Length=752

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+ I + + E   +K+++    W+ +S VW  +L +A+S CR       L
Sbjct  660  KSVLFDAQRLAKSIKSLEQEMKWSKEEK----WRMISRVWVEMLCHAASQCRGFHHAKQL  715

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +GG+  T V LLMAH G+ E L+  K
Sbjct  716  SRGGELLTHVWLLMAHLGITEQLQISK  742



>ref|XP_006446040.1| hypothetical protein CICLE_v10018365mg, partial [Citrus clementina]
 gb|ESR59280.1| hypothetical protein CICLE_v10018365mg, partial [Citrus clementina]
Length=285

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPE  339
            W+ +SEVW  +L YA+SH    E   +L KGG+  T VRLLMAH GL       ++ +  
Sbjct  226  WEMISEVWVEILAYAASHSTWNEHSQHLGKGGELLTHVRLLMAHLGL-----SSQYLYAN  280

Query  338  LSFFL  324
              FFL
Sbjct  281  APFFL  285



>ref|XP_007041677.1| Uncharacterized protein TCM_006509 [Theobroma cacao]
 gb|EOX97508.1| Uncharacterized protein TCM_006509 [Theobroma cacao]
Length=654

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = -3

Query  533  QQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEG  360
            ++  +E WK +S+VW  ++ YA+SHC  +E    L+ GG+  T V LLMAH GL   +  
Sbjct  579  RRDHEEKWKMISKVWVEMMTYAASHCSWKEHAQQLRHGGELLTHVALLMAHLGLTTQIRR  638

Query  359  EK  354
            EK
Sbjct  639  EK  640



>emb|CAN83020.1| hypothetical protein VITISV_036393 [Vitis vinifera]
Length=760

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL +A  +A+ + + + E    ++   ++ W+ +S VW  +L YA+ HC  + +   L
Sbjct  679  KSVLSEACRLAKSLQSLETE----EEWNCEKKWELMSHVWVEMLCYAACHCPRNHHAEKL  734

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            + GG+  T V LLMAH+G+ E
Sbjct  735  RLGGELLTHVWLLMAHFGITE  755



>gb|KDO64837.1| hypothetical protein CISIN_1g047649mg [Citrus sinensis]
Length=284

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFPE  339
            W+ +SEVW  +L YA+SH    E   +L KGG+  T VRLLMAH GL       ++ +  
Sbjct  225  WEMISEVWVEILAYAASHSTWNEHSQHLGKGGELLTHVRLLMAHLGL-----SSQYLYAN  279

Query  338  LSFFL  324
              FFL
Sbjct  280  APFFL  284



>ref|XP_010042029.1| PREDICTED: uncharacterized protein LOC104431034 [Eucalyptus grandis]
Length=666

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFP  342
            W+ +S VW  +L YA+SH R +  V  L KGG+  TFV LLMAH+G   I E   H  P
Sbjct  598  WRVMSGVWVEMLSYAASHIRGEAHVKVLSKGGELLTFVWLLMAHFGCLYIPEWGTHYEP  656



>ref|XP_010905306.1| PREDICTED: uncharacterized protein LOC105032542 [Elaeis guineensis]
Length=629

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 12/88 (14%)
 Frame = -3

Query  620  NKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVY  441
            +++ KS L  A  +AR++          K  +  E WK +SEVW  +L YA++ C  + +
Sbjct  510  HRFAKSALFHACSLARQL----------KLMEISEKWKMVSEVWIEMLAYAANQCEGNAH  559

Query  440  Y--LKKGGQFYTFVRLLMAHYGLQEILE  363
               L +GG+  T V LLMAH GL +  E
Sbjct  560  AQQLGRGGELLTHVSLLMAHLGLSKQFE  587



>ref|XP_011001065.1| PREDICTED: uncharacterized protein LOC105108443 [Populus euphratica]
Length=626

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 51/80 (64%), Gaps = 8/80 (10%)
 Frame = -3

Query  605  SVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLK  432
            S+L  A ++A+++ +   ENN T +++    W+ +S++W  +L YA+S+C  +E    L 
Sbjct  539  SMLRDACKLAKKLQSL--ENNWTNEKK----WRMISQIWVEMLAYAASNCGWKEHAQALA  592

Query  431  KGGQFYTFVRLLMAHYGLQE  372
            +GG+  T V LLMAH GL+E
Sbjct  593  RGGELLTRVCLLMAHLGLRE  612



>gb|EYU27017.1| hypothetical protein MIMGU_mgv1a019065mg [Erythranthe guttata]
Length=696

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S+VW  LL YA+SHCR  E    L +GG+   FV L MAH+GL E
Sbjct  625  WEMMSKVWVELLAYAASHCRANEHARQLSEGGELIVFVWLQMAHFGLGE  673



>ref|XP_010650638.1| PREDICTED: uncharacterized protein LOC104879477 [Vitis vinifera]
Length=737

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 6/81 (7%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL +A  +A+ + + + E    ++   ++ W+ +S VW  +L YA+ HC  + +   L
Sbjct  656  KSVLSEACRLAKSLQSLETE----EEWNCEKKWELMSHVWVEMLCYAACHCPRNHHAEKL  711

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            + GG+  T V LLMAH+G+ E
Sbjct  712  RLGGELLTHVWLLMAHFGITE  732



>ref|XP_004496121.1| PREDICTED: uncharacterized protein LOC101495219 isoform X1 [Cicer 
arietinum]
Length=712

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (52%), Gaps = 8/108 (7%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R + C+ +L  +      K  ++    KSVL  A  +A+ + + + E N +K ++    W
Sbjct  595  RSQVCEMILRVNTEILPSK--VKGDRSKSVLFDACRLAKSLESLETEQNWSKDRK----W  648

Query  509  KGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + +S VW  +L +A+S CR       L +GG+  T V LLMAH G+ E
Sbjct  649  EMISHVWVEMLCHAASQCRGIHHAKQLSQGGELLTHVWLLMAHLGITE  696



>ref|XP_010040125.1| PREDICTED: uncharacterized protein LOC104428901 [Eucalyptus grandis]
Length=476

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 35/59 (59%), Gaps = 2/59 (3%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFP  342
            W+ +S VW  +L YA+SH R +  V  L KGG+  TFV LLMAH+G   I E   H  P
Sbjct  408  WRVMSGVWVEMLSYAASHIRGEAHVKVLSKGGELLTFVWLLMAHFGCLYIPEWGMHYEP  466



>ref|XP_002322521.2| hypothetical protein POPTR_0016s01380g [Populus trichocarpa]
 gb|EEF04282.2| hypothetical protein POPTR_0016s01380g [Populus trichocarpa]
Length=675

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -3

Query  605  SVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLK  432
            S+L  A ++A+E+ + +        +Q    W+ +S++W  +L YA+S+C  +E    L 
Sbjct  583  SMLHDACKLAKELQSLETSEKKLTNEQK---WRMISKIWVEMLTYAASNCGWKEHAQALT  639

Query  431  KGGQFYTFVRLLMAHYGLQE  372
            +GG+  T V LLMAH GL E
Sbjct  640  RGGELLTRVCLLMAHLGLSE  659



>ref|XP_006398219.1| hypothetical protein EUTSA_v10000775mg [Eutrema salsugineum]
 gb|ESQ39672.1| hypothetical protein EUTSA_v10000775mg [Eutrema salsugineum]
Length=856

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 9/103 (9%)
 Frame = -3

Query  656  DYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLL  477
            D SS  D   ++    KSVL  A  +A+++M  +      K       W+ LS+VW  LL
Sbjct  750  DISSDVDPMGVKGDRSKSVLFDASRLAKDLMKLEEHFEIDK-------WEILSKVWVELL  802

Query  476  VYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +A+ HC     V  L +G +   FV LLMAH+GL +  +  K
Sbjct  803  CHAACHCDATAHVEQLTRGAELINFVWLLMAHFGLTDQFQINK  845



>emb|CBI36708.3| unnamed protein product [Vitis vinifera]
Length=917

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = -3

Query  647  SCNDKKE-LENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVY  471
            SC + K+ LE+K  K V     E  ++++  + E+  + +   +E W+ + +VW  +L Y
Sbjct  809  SCAEAKQFLEDK--KLVGEGGTEACQKLLAVNTESLQSLKIAEKEKWEMICDVWVEMLCY  866

Query  470  ASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            A+S C   +    L++GG+  T V LLMAH+G+ E
Sbjct  867  AASQCGWNQHAQQLRRGGELLTHVWLLMAHFGISE  901



>ref|XP_002510230.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52417.1| conserved hypothetical protein [Ricinus communis]
Length=647

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 14/81 (17%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY--L  435
            KSVL  A  +A ++ N            P + W+ +  VW  +L YA+SHCR   +   L
Sbjct  563  KSVLFDACRLASQLQNI-----------PNK-WEVMGNVWVEMLAYAASHCRGTYHAQQL  610

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
             +GG+  T V LLMAH+GL E
Sbjct  611  GRGGELLTHVWLLMAHFGLTE  631



>ref|XP_002322346.2| hypothetical protein POPTR_0015s12520g [Populus trichocarpa]
 gb|EEF06473.2| hypothetical protein POPTR_0015s12520g [Populus trichocarpa]
Length=597

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 47/82 (57%), Gaps = 6/82 (7%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYL-KKGGQFYTFVRLLMAHYGLQEILEGEKHSFP  342
            W+ ++EVW  +L YA++HC  +E  + L ++GG+  T V LLM H GL E  E  +    
Sbjct  510  WEMINEVWVEMLAYAAAHCSWKEHTHQLIRRGGELLTHVSLLMLHLGLSEQYEFTRFDGD  569

Query  341  ELS---FFLNAKIGKPN*NGVS  285
            E+S   FF +  I K + N +S
Sbjct  570  EVSVLEFFSSVSIPKSSLNCIS  591



>ref|XP_010034372.1| PREDICTED: uncharacterized protein LOC104423603 [Eucalyptus grandis]
Length=698

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 50/104 (48%), Gaps = 17/104 (16%)
 Frame = -3

Query  650  SSCNDKKELE-----NKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWA  486
            S+C    E E      K   SVL  A  +ARE+ + + ++           WK +SEVW 
Sbjct  575  SACGTLLEAEPPLGGRKNISSVLFNACVLARELQSIEKKDR----------WKIMSEVWV  624

Query  485  GLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQEILEG  360
             LL YA+ HC+   +   L KGG+  T V LLMA  G  + L G
Sbjct  625  ELLGYAAVHCQPSAHAQQLSKGGELVTLVWLLMAQLGFYQHLRG  668



>emb|CAN77530.1| hypothetical protein VITISV_041426 [Vitis vinifera]
Length=653

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 62/115 (54%), Gaps = 17/115 (15%)
 Frame = -3

Query  692  SRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            +R + C+ LL  D +    +   E+K  KSVL +A  +A+ + + + +    K       
Sbjct  548  NRNEACKLLLEVD-TEVEPRDAKEDK-SKSVLFEACRLAKMLESLEKDAAGEK-------  598

Query  512  WKGLSEVWAGLLVYASSHC-----REDVYY---LKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S VW  +L YA+SHC     R+ +++   L++GG+  T V LLM+H GL E
Sbjct  599  WEMISSVWGEMLCYAASHCGWIQHRQLLHHRQQLRRGGELLTHVCLLMSHLGLTE  653



>ref|XP_004496298.1| PREDICTED: uncharacterized protein LOC101495324 [Cicer arietinum]
Length=728

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (56%), Gaps = 6/88 (7%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            E++    KSVL  A  +A+ + + + E N +K+++    W+ +  VW  +L +A+S CR 
Sbjct  629  EVKGDRSKSVLFDACRLAKSLESLETEENWSKEKK----WEMICHVWVEILCHAASQCRG  684

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
                  L +GG+  T V LLMAH G+ E
Sbjct  685  LHHAKQLSQGGELLTHVWLLMAHLGITE  712



>emb|CDY07584.1| BnaC06g14800D [Brassica napus]
Length=82

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 42/81 (52%), Gaps = 8/81 (10%)
 Frame = -3

Query  614  YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVY  441
            +  + +  A ++A+E+   +  +           W  +S VW  L+ YA++HC  ++   
Sbjct  2    FDTTTMEDARQLAKELKKLERGSGGG------SIWGVVSRVWVELICYAANHCESKQHAA  55

Query  440  YLKKGGQFYTFVRLLMAHYGL  378
            +L KGG   +FV LLMAH GL
Sbjct  56   HLSKGGDIVSFVWLLMAHMGL  76



>ref|XP_009128804.1| PREDICTED: uncharacterized protein LOC103853646 [Brassica rapa]
Length=859

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 44/81 (54%), Gaps = 2/81 (2%)
 Frame = -3

Query  614  YKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVY  441
            +  S+L K ++  +E+      N   K +     W+ +S+VW  LL YA++ C   E   
Sbjct  760  FDGSMLAKELKGLKELPEPKELNGLKKVKGEAYMWEVVSKVWVELLSYAATKCGAIEHAA  819

Query  440  YLKKGGQFYTFVRLLMAHYGL  378
             L KGG+  +FV LLMAH+GL
Sbjct  820  QLSKGGELISFVWLLMAHFGL  840



>gb|EAY81637.1| hypothetical protein OsI_36806 [Oryza sativa Indica Group]
Length=725

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 59/111 (53%), Gaps = 9/111 (8%)
 Frame = -3

Query  698  QISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQ  519
            +I  ++ C + L    +S  + ++++    KSVL +A ++AR++       N  +    +
Sbjct  600  EIGDEERCAKRLTKVDTSIAEPRDVKGDRSKSVLFQACKLARQL-------NELEGITEE  652

Query  518  EFWKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
              W+ ++ VW  +L YA+  C  + +   L +GG+  T V LLMAH+G+ +
Sbjct  653  RRWRLIAGVWVEMLCYAAGKCSGNAHARQLSQGGEMLTVVWLLMAHFGMGD  703



>emb|CDX83934.1| BnaC08g17110D [Brassica napus]
Length=725

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 51/102 (50%), Gaps = 21/102 (21%)
 Frame = -3

Query  668  LLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQP-QEFWKGLSEV  492
            L+NG  S      EL N+   S+L  A  + RE+          KQ Q  +  WK LS V
Sbjct  642  LVNGGVSG-----ELGNE---SILEGASSIVREL----------KQMQGCRNKWKILSRV  683

Query  491  WAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQE  372
            W  L+ +AS HC     +  L KGG+ + F  LLMAH+GL +
Sbjct  684  WVELICFASLHCDATARLELLSKGGELFAFAWLLMAHFGLVD  725



>ref|XP_006374593.1| hypothetical protein POPTR_0015s12370g, partial [Populus trichocarpa]
 gb|ERP52390.1| hypothetical protein POPTR_0015s12370g, partial [Populus trichocarpa]
Length=94

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = -3

Query  569  IMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLL  396
            ++  D         +P++ W+ ++EVW  +L +A++HC  +E  + L++ G+  T V LL
Sbjct  4    LIGVDRLARQLLLLRPEKRWEMINEVWVEMLAHAAAHCPWKEHTHQLRRDGELLTHVSLL  63

Query  395  MAHYGLQE  372
            M + GL E
Sbjct  64   MLYLGLNE  71



>emb|CBI36717.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            E++    KSVL  A  +A  + + + E    +Q Q ++ W  +S VW  +L +A++ CR 
Sbjct  114  EVKGDRSKSVLFDACRLANSLQSLERE----EQWQCEKKWGMISLVWVEMLCHAANQCRW  169

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGLQE  372
                  L++GG+  T V LLM H+G+ E
Sbjct  170  NHHATQLRRGGELLTHVWLLMGHFGITE  197



>ref|XP_006426735.1| hypothetical protein CICLE_v10025020mg [Citrus clementina]
 gb|ESR39975.1| hypothetical protein CICLE_v10025020mg [Citrus clementina]
Length=712

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 54/129 (42%), Gaps = 20/129 (16%)
 Frame = -3

Query  725  QKQGILCWRQISRKKPCQRLLNGDYSSCNDKKELENKY---------KKSVLPKAVEVAR  573
            ++  I C  Q    K C R       +C    +++ +           KSVL  A  VA 
Sbjct  577  ERMSIFCTSQTHATKACDRRKERRIQACKMLLKVKTQVLPIKVKGDRSKSVLFDACRVAS  636

Query  572  EIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRL  399
             +       N          WK + +VW  +L YA+S  R  E    LK+GG+  T V L
Sbjct  637  ALNEISDSKNR---------WKMVRDVWLEMLTYAASQSRGSEHARQLKRGGELLTHVWL  687

Query  398  LMAHYGLQE  372
            LMAH+G+ +
Sbjct  688  LMAHFGMTD  696



>ref|XP_003561517.1| PREDICTED: uncharacterized protein LOC100832608 [Brachypodium 
distachyon]
Length=786

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 32/91 (35%), Positives = 46/91 (51%), Gaps = 12/91 (13%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR-  453
            E++    KSVL  AV +A+ +   D           Q  WK ++ VWA +L YA+  CR 
Sbjct  691  EVKGDRCKSVLFDAVILAKVLRELDA----------QLMWKVVANVWAEMLTYAAGKCRG  740

Query  452  -EDVYYLKKGGQFYTFVRLLMAHYGLQEILE  363
               V  L +GG+  T V  LMAH GL ++ +
Sbjct  741  STHVRQLSRGGELITLVWFLMAHMGLGDMYQ  771



>ref|XP_007041672.1| Uncharacterized protein TCM_006503 [Theobroma cacao]
 gb|EOX97503.1| Uncharacterized protein TCM_006503 [Theobroma cacao]
Length=1388

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = -3

Query  521   QEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGL  378
             +E WK +++VW  +LVYA+S C   E    L+ GG+  T V LLMAH+GL
Sbjct  1315  EEKWKMINDVWMEMLVYAASRCTWEEHAQQLRHGGELLTHVSLLMAHHGL  1364



>ref|XP_006387337.1| hypothetical protein POPTR_1227s00200g [Populus trichocarpa]
 gb|ERP46251.1| hypothetical protein POPTR_1227s00200g [Populus trichocarpa]
Length=267

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 53/114 (46%), Gaps = 16/114 (14%)
 Frame = -3

Query  641  NDKKELENKYKKSVLPKAVEVAREIMNTDPENNN-------------TKQQQPQEF-WKG  504
            N   EL   + K +LP    +  +I  TD    +             T    P E  W+ 
Sbjct  148  NTLDELHALFLKELLPDPPAMLNKIKLTDAGGMSALLDGCVLAMSLQTLDGCPNEKKWEM  207

Query  503  LSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHS  348
            +SEVW  +L+YA+SHC  ++    L +GG+  T V LLM+H GL +    E+ S
Sbjct  208  ISEVWVEMLMYAASHCGWKQHADALARGGELLTHVCLLMSHLGLSKPCRPERRS  261



>gb|EMT19134.1| hypothetical protein F775_22189 [Aegilops tauschii]
Length=654

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 7/102 (7%)
 Frame = -3

Query  662  NGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAG  483
            +G  S     + LE ++  + L + +    +    +P    T+ Q  +     L E W G
Sbjct  540  SGSESIAQLNETLEGRHVDAPLHRTILFLTKNEIPEPPAECTEAQLSE-----LREAWVG  594

Query  482  LLVYASSHCR--EDVYYLKKGGQFYTFVRLLMAHYGLQEILE  363
            LL++A+S  R  E    L +GG+  TF+ LLMAHYGL ++++
Sbjct  595  LLLHAASKSRPEEHAAQLARGGELLTFIWLLMAHYGLGDVMD  636



>ref|XP_004983450.1| PREDICTED: uncharacterized protein LOC101760534 [Setaria italica]
Length=686

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 53/104 (51%), Gaps = 9/104 (9%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLS  498
            C   L    +S  + ++++    KSVL +A ++AR+++  +      +       W+ ++
Sbjct  573  CAERLRAVDTSIAEPRDVKGDRSKSVLFQACKLARQLLELEGATEAKR-------WRLVT  625

Query  497  EVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
             VW  +L YA+  C    +   L +GG+  T V LLMAH+G+ +
Sbjct  626  SVWVEMLCYAAGKCAGSAHARQLSQGGELLTVVWLLMAHFGVGD  669



>ref|XP_006421701.1| hypothetical protein CICLE_v10006737mg, partial [Citrus clementina]
 gb|ESR34941.1| hypothetical protein CICLE_v10006737mg, partial [Citrus clementina]
Length=375

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 27/124 (22%)
 Frame = -3

Query  677  CQRLLNGDYSSCNDKKELENKYKKSVLPKA--VEVAREIMNTD----PENNNTK------  534
            CQ + N DY +      LE   +++++PK+  +E  R ++ T+    P++ + +      
Sbjct  232  CQEI-NDDYRAWPLISRLE---ERTLVPKSKSIEARRHLLRTEGGEKPQSASKRGRQLGK  287

Query  533  --QQQPQEF-------WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAH  387
              Q+Q  E        W+ +SEVW  +L YA+SH    E   +L+ GG+  T VRLLMAH
Sbjct  288  RLQEQESEVDWSNGRKWEMISEVWVEMLAYAASHGTWNEHGQHLRNGGELPTHVRLLMAH  347

Query  386  YGLQ  375
             GL 
Sbjct  348  LGLS  351



>gb|KDO39751.1| hypothetical protein CISIN_1g005146mg [Citrus sinensis]
Length=712

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (46%), Gaps = 20/129 (16%)
 Frame = -3

Query  725  QKQGILCWRQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVARE--------  570
            ++  I C  Q    K C R       +C    ++  K K  VLP  V+  R         
Sbjct  577  ERMSIFCTSQTHATKACDRRKERRIQAC----KMLLKVKTQVLPIKVKGDRSKSVLFDAC  632

Query  569  -IMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRL  399
             + +   E +++K +     WK + +VW  +L YA+S  R  E    LK+GG+  T V L
Sbjct  633  RVASALNEISDSKSR-----WKMVRDVWLEMLTYAASQSRGSEHARQLKRGGELLTHVWL  687

Query  398  LMAHYGLQE  372
            LMAH+G+ +
Sbjct  688  LMAHFGMTD  696



>ref|XP_006465849.1| PREDICTED: uncharacterized protein LOC102607771 isoform X1 [Citrus 
sinensis]
 ref|XP_006465850.1| PREDICTED: uncharacterized protein LOC102607771 isoform X2 [Citrus 
sinensis]
Length=712

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (46%), Gaps = 20/129 (16%)
 Frame = -3

Query  725  QKQGILCWRQISRKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVARE--------  570
            ++  I C  Q    K C R       +C    ++  K K  VLP  V+  R         
Sbjct  577  ERMSIFCTSQTHATKACDRRKERRIQAC----KMLLKVKTQVLPIKVKGDRSKSVLFDAC  632

Query  569  -IMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYLKKGGQFYTFVRL  399
             + +   E +++K +     WK + +VW  +L YA+S  R  E    LK+GG+  T V L
Sbjct  633  RVASALNEISDSKSR-----WKMVRDVWLEMLTYAASQSRGSEHARQLKRGGELLTHVWL  687

Query  398  LMAHYGLQE  372
            LMAH+G+ +
Sbjct  688  LMAHFGMTD  696



>ref|XP_002459209.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
 gb|EER95730.1| hypothetical protein SORBIDRAFT_02g000570 [Sorghum bicolor]
Length=768

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 12/91 (13%)
 Frame = -3

Query  629  ELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRE  450
            E++    KSVL  AV +A+E+          ++ + +  WK ++ VW  +L YA+  CR 
Sbjct  673  EVKGDRSKSVLFDAVILAKEL----------RKLEEELMWKVITGVWGEMLTYAAGKCRG  722

Query  449  DVYY--LKKGGQFYTFVRLLMAHYGLQEILE  363
             ++   L +GG+  T V  LMAH GL ++ +
Sbjct  723  SMHVRQLSRGGELITLVWFLMAHMGLGDMYQ  753



>ref|XP_008228365.1| PREDICTED: uncharacterized protein LOC103327776 [Prunus mume]
Length=713

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCR--EDVYYL  435
            KSVL  A  +A+++   +  +N  K       W+ +S VW  +L YA++ CR  +    L
Sbjct  624  KSVLFDACRLAKDLQAKENWDNKKK-------WELISHVWVEMLSYAANQCRWRDHTQQL  676

Query  434  KKGGQFYTFVRLLMAHYGLQE  372
            ++GG+  T V LLMAH GL E
Sbjct  677  RRGGELLTHVWLLMAHLGLTE  697



>ref|XP_006380891.1| hypothetical protein POPTR_0006s01430g [Populus trichocarpa]
 gb|ERP58688.1| hypothetical protein POPTR_0006s01430g [Populus trichocarpa]
Length=508

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = -3

Query  521  QEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
             E W+ +S VW  +++YA+SHC  ++ ++ L +GG+  T V LLMAH GL +
Sbjct  420  DEKWEMISRVWVDMVMYAASHCGWKQHIHALARGGELLTHVCLLMAHLGLSK  471



>gb|KCW53510.1| hypothetical protein EUGRSUZ_J02785 [Eucalyptus grandis]
Length=698

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 32/49 (65%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W  +SEVW  +L+Y ++ C  R+   Y++ GG+  T V LLMAHYGL +
Sbjct  633  WSAISEVWVEMLMYGANKCKARDHARYMRGGGELITHVWLLMAHYGLTD  681



>ref|XP_006388856.1| hypothetical protein POPTR_0088s00200g [Populus trichocarpa]
 gb|ERP47770.1| hypothetical protein POPTR_0088s00200g [Populus trichocarpa]
Length=641

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 18/119 (15%)
 Frame = -3

Query  686  KKPCQRLLNGDYSSCNDKKELENKYK--KSVLPKAVEVAREIMNTDPENNNTKQQQPQEF  513
            K P    L    S   D    + ++K  KSVL     +AR++++ + +            
Sbjct  533  KGPYDLELRNSESRGYDDASFQRRWKTEKSVLIGVDVLARQLLSLELKKR----------  582

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQEILEGEKHSFP  342
            W  ++EVW  ++ YA++HC  +E    L++GG+  T V LLM H GL E      + FP
Sbjct  583  WGTINEVWVEMVAYAAAHCPWKEHTQQLRRGGELLTHVSLLMLHLGLSE----HNYMFP  637



>ref|XP_011043926.1| PREDICTED: uncharacterized protein LOC105139249 [Populus euphratica]
Length=656

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -3

Query  527  QPQEFWKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            Q  E W+ +SEVW  +L+YA+ HC  +E    L +GG+  T V LLMAH GL +
Sbjct  573  QSLEKWEMISEVWVEMLMYAAGHCGWKEHADALARGGELLTHVCLLMAHLGLSK  626



>ref|XP_011008994.1| PREDICTED: uncharacterized protein LOC105114208 [Populus euphratica]
Length=702

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S VW  +L+YA+SHC  ++  + L +GG+  T V LLMAH GL +
Sbjct  617  WEMISHVWVDMLMYAASHCGWKQHTHALARGGELLTHVCLLMAHLGLSK  665



>ref|XP_011043925.1| PREDICTED: uncharacterized protein LOC105139248 [Populus euphratica]
Length=702

 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S VW  +L+YA+SHC  ++  + L +GG+  T V LLMAH GL +
Sbjct  617  WEMISHVWVDMLMYAASHCGWKQHTHALARGGELLTHVCLLMAHLGLSK  665



>emb|CDX87780.1| BnaC02g31690D [Brassica napus]
Length=1332

 Score = 50.4 bits (119),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/49 (49%), Positives = 31/49 (63%), Gaps = 2/49 (4%)
 Frame = -3

Query  512   WKGLSEVWAGLLVYASSHCRED--VYYLKKGGQFYTFVRLLMAHYGLQE  372
             W+ LS+VW  LL YA+ HC     V  L +GG+   FV LLMAH+GL +
Sbjct  1267  WEILSKVWVELLCYAACHCDSTAHVEQLSRGGELINFVWLLMAHFGLTD  1315



>emb|CDP16262.1| unnamed protein product [Coffea canephora]
Length=719

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  512  WKGLSEVWAGLLVYASSHCREDVYY--LKKGGQFYTFVRLLMAHYGLQE  372
            W+ +S+VW  LL YA+  CR  V+   L KGG+ +T V LLMAH+GL +
Sbjct  653  WEIMSKVWVELLSYAAIRCRAYVHAQQLSKGGELFTIVWLLMAHFGLGD  701



>emb|CAN83215.1| hypothetical protein VITISV_018465 [Vitis vinifera]
Length=511

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 10/83 (12%)
 Frame = -3

Query  608  KSVLPKAVEVAREI--MNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCREDVYY-  438
            KSVL  A  +A+ +  + T+ E N  K+      W+ +S VW  +L YA+ HC  + +  
Sbjct  430  KSVLLDACRLAKSLQSLETEEEWNCEKK------WEMMSHVWVEMLCYAACHCPWNGHAK  483

Query  437  -LKKGGQFYTFVRLLMAHYGLQE  372
             L  GG+  T V LLMAH+G+ E
Sbjct  484  ELTNGGELLTHVCLLMAHFGITE  506



>ref|XP_010650649.1| PREDICTED: uncharacterized protein LOC100852780 [Vitis vinifera]
Length=721

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 59/108 (55%), Gaps = 12/108 (11%)
 Frame = -3

Query  689  RKKPCQRLLNGDYSSCNDKKELENKYKKSVLPKAVEVAREIMNTDPENNNTKQQQPQEFW  510
            R + CQ+LL  + ++     ++E    KS+L +A  +A+ + + +           +E W
Sbjct  608  RTEACQKLL--EVNTEVPPLQVEGDKSKSMLFEACRLAKSLQSLEITE--------KEKW  657

Query  509  KGLSEVWAGLLVYASSHC--REDVYYLKKGGQFYTFVRLLMAHYGLQE  372
            + + +VW  +L YA+S C   +    L++GG+  T V LLMAH+G++E
Sbjct  658  EMMCDVWVEMLCYAASQCGWNQHAKQLRRGGELLTHVWLLMAHFGIRE  705



>gb|KFK31560.1| hypothetical protein AALP_AA6G127700 [Arabis alpina]
Length=861

 Score = 50.1 bits (118),  Expect = 0.001, Method: Composition-based stats.
 Identities = 32/87 (37%), Positives = 46/87 (53%), Gaps = 9/87 (10%)
 Frame = -3

Query  608  KSVLPKAVEVAREIMNTDPENNNTKQQQPQEFWKGLSEVWAGLLVYASSHCRED--VYYL  435
            KSVL  A  +A+++   + EN    +      WK LS+VW  LL +A+ HC     V  L
Sbjct  771  KSVLFDASRLAKDLKEME-ENYEVDK------WKILSKVWVELLCHAACHCDSTAHVEQL  823

Query  434  KKGGQFYTFVRLLMAHYGLQEILEGEK  354
             +G +   FV LLMAH+GL +  +  K
Sbjct  824  SRGAELINFVWLLMAHFGLTDQFQINK  850



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1247512128634