BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81869_g1_i1 len=137 path=[162:0-136]

Length=137
                                                                      Score     E

gb|EYU25861.1|  hypothetical protein MIMGU_mgv1a013719mg              77.4    6e-16   
gb|EPS70693.1|  germin-like protein                                   74.7    5e-15   
gb|EYU28339.1|  hypothetical protein MIMGU_mgv1a013656mg              73.2    2e-14   
ref|XP_008228197.1|  PREDICTED: auxin-binding protein ABP19a          72.8    3e-14   
ref|XP_004287629.1|  PREDICTED: auxin-binding protein ABP19a-like     72.0    4e-14   
gb|KCW82145.1|  hypothetical protein EUGRSUZ_C03536                   71.2    7e-14   
ref|XP_004287628.1|  PREDICTED: auxin-binding protein ABP19a-like     71.2    8e-14   
gb|KDP33908.1|  hypothetical protein JCGZ_07479                       71.2    9e-14   
ref|XP_010049430.1|  PREDICTED: auxin-binding protein ABP19a-like     71.2    9e-14   
ref|XP_010049517.1|  PREDICTED: auxin-binding protein ABP19a-like     71.2    1e-13   
gb|KCW82111.1|  hypothetical protein EUGRSUZ_C03486                   69.3    2e-13   
gb|KCW82113.1|  hypothetical protein EUGRSUZ_C03488                   70.1    2e-13   
gb|AEQ39055.1|  putative germin-like protein                          70.5    2e-13   
ref|XP_011093822.1|  PREDICTED: auxin-binding protein ABP19a-like     70.5    2e-13   
gb|KCW82126.1|  hypothetical protein EUGRSUZ_C03507                   70.1    2e-13   
ref|XP_010051456.1|  PREDICTED: germin-like protein                   69.7    3e-13   
ref|XP_010049513.1|  PREDICTED: auxin-binding protein ABP19a-like     69.7    3e-13   
gb|ACA03784.1|  putative auxin-binding protein 3                      69.3    4e-13   Prunus salicina [Japanese plum]
gb|ABC86741.1|  auxin-binding protein                                 68.6    5e-13   Vitis pseudoreticulata
ref|XP_007202571.1|  hypothetical protein PRUPE_ppa011460mg           68.9    6e-13   
sp|O04011.1|ABP20_PRUPE  RecName: Full=Auxin-binding protein ABP2...  68.9    7e-13   Prunus persica
gb|KCW81975.1|  hypothetical protein EUGRSUZ_C033371                  68.6    7e-13   
emb|CAN67380.1|  hypothetical protein VITISV_017918                   68.6    8e-13   Vitis vinifera
ref|XP_010051414.1|  PREDICTED: auxin-binding protein ABP19a-like     68.6    9e-13   
ref|XP_008337871.1|  PREDICTED: auxin-binding protein ABP20           68.6    1e-12   
ref|NP_001268059.1|  germin-like protein 6 precursor                  68.2    1e-12   
ref|XP_010666273.1|  PREDICTED: auxin-binding protein ABP19a          68.2    1e-12   
gb|ACA03785.1|  putative auxin-binding protein 2                      67.8    1e-12   Prunus salicina [Japanese plum]
ref|XP_008242222.1|  PREDICTED: auxin-binding protein ABP19a          67.8    2e-12   
gb|KCW82144.1|  hypothetical protein EUGRSUZ_C03535                   67.8    2e-12   
ref|XP_010049516.1|  PREDICTED: auxin-binding protein ABP19a-like     67.4    2e-12   
gb|ABV03161.1|  germin-like protein                                   67.4    2e-12   Chimonanthus praecox [wintersweet]
ref|XP_007202573.1|  hypothetical protein PRUPE_ppa011467mg           67.4    2e-12   
ref|XP_008242223.1|  PREDICTED: auxin-binding protein ABP20           67.0    3e-12   
ref|XP_009784603.1|  PREDICTED: auxin-binding protein ABP19a-like     66.6    4e-12   
gb|KEH37574.1|  auxin-binding protein ABP19a                          66.6    4e-12   
gb|KEH37575.1|  auxin-binding protein ABP19a                          66.2    5e-12   
ref|XP_009594759.1|  PREDICTED: auxin-binding protein ABP19a-like     66.2    5e-12   
ref|XP_008337872.1|  PREDICTED: auxin-binding protein ABP19a          66.2    6e-12   
gb|AFY10819.1|  germin-like protein                                   66.2    7e-12   
ref|XP_007138665.1|  hypothetical protein PHAVU_009G227800g           65.9    9e-12   
ref|XP_004513480.1|  PREDICTED: auxin-binding protein ABP19a-like     65.5    9e-12   
ref|XP_004303688.1|  PREDICTED: auxin-binding protein ABP19a-like     65.5    1e-11   
sp|O04012.1|AB19B_PRUPE  RecName: Full=Auxin-binding protein ABP1...  65.5    1e-11   Prunus persica
ref|XP_007204735.1|  hypothetical protein PRUPE_ppa011385mg           65.5    1e-11   
ref|XP_010261910.1|  PREDICTED: auxin-binding protein ABP19a-like     65.5    1e-11   
ref|XP_010666274.1|  PREDICTED: auxin-binding protein ABP19a-like     65.5    1e-11   
ref|XP_006849665.1|  hypothetical protein AMTR_s00024p00231430        65.1    1e-11   
gb|ADD71879.1|  germin-like protein subfamily 3 member 4 precursor    65.1    1e-11   Arachis hypogaea [goober]
ref|XP_008391398.1|  PREDICTED: auxin-binding protein ABP19a-like     65.1    2e-11   
ref|XP_009760539.1|  PREDICTED: auxin-binding protein ABP19a-like     64.7    2e-11   
ref|XP_009600028.1|  PREDICTED: auxin-binding protein ABP19a          64.7    2e-11   
dbj|BAH15357.1|  germin like protein                                  64.7    2e-11   Nicotiana tabacum [American tobacco]
gb|AEN02469.1|  germin-like protein                                   64.3    2e-11   
ref|NP_001241062.1|  auxin-binding protein ABP19a-like precursor      64.3    2e-11   
ref|XP_011072583.1|  PREDICTED: auxin-binding protein ABP19a          64.3    2e-11   
emb|CAC34417.1|  Germin-like protein                                  64.3    3e-11   Pisum sativum [garden pea]
ref|XP_011045993.1|  PREDICTED: auxin-binding protein ABP20           64.3    3e-11   
ref|XP_009361697.1|  PREDICTED: auxin-binding protein ABP19a          63.9    3e-11   
emb|CDP03095.1|  unnamed protein product                              63.9    4e-11   
gb|AFK39466.1|  unknown                                               63.9    4e-11   
gb|AFK43419.1|  unknown                                               63.9    4e-11   
gb|AFK44812.1|  unknown                                               63.5    4e-11   
ref|XP_010064035.1|  PREDICTED: auxin-binding protein ABP19a          63.5    4e-11   
ref|XP_006381632.1|  hypothetical protein POPTR_0006s14510g           63.9    4e-11   
ref|XP_009375459.1|  PREDICTED: auxin-binding protein ABP19a          63.5    5e-11   
sp|L8BRS3.1|GLP1_MORAL  RecName: Full=Germin-like protein; Short=...  63.2    7e-11   
gb|ABL86677.1|  GLP3                                                  63.2    8e-11   Gossypium barbadense [Egyptian cotton]
ref|XP_006342915.1|  PREDICTED: auxin-binding protein ABP19a-like     62.8    9e-11   
ref|XP_010261909.1|  PREDICTED: auxin-binding protein ABP20-like      62.8    9e-11   
ref|XP_004235542.1|  PREDICTED: auxin-binding protein ABP19a          62.8    9e-11   
ref|XP_002274625.1|  PREDICTED: auxin-binding protein ABP19a-like     62.4    1e-10   Vitis vinifera
ref|XP_008362989.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-bindin...  62.4    1e-10   
emb|CDO97853.1|  unnamed protein product                              62.0    1e-10   
ref|XP_010666280.1|  PREDICTED: auxin-binding protein ABP19a-like     62.4    1e-10   
ref|XP_010090139.1|  Auxin-binding protein ABP19a                     62.4    1e-10   
gb|ABG76199.2|  germin-like protein                                   62.4    1e-10   Capsicum chinense [Scotch bonnet]
ref|XP_010235197.1|  PREDICTED: germin-like protein 8-14              62.4    1e-10   
ref|XP_003574592.1|  PREDICTED: germin-like protein 8-14              62.4    1e-10   
ref|XP_006361339.1|  PREDICTED: auxin-binding protein ABP19a-like     62.4    1e-10   
ref|XP_010666307.1|  PREDICTED: auxin-binding protein ABP19a-like     62.0    2e-10   
ref|XP_008450917.1|  PREDICTED: auxin-binding protein ABP19a-like     62.0    2e-10   
ref|XP_010666277.1|  PREDICTED: auxin-binding protein ABP19a-like     61.6    2e-10   
ref|XP_010086822.1|  Auxin-binding protein ABP19a                     60.8    4e-10   
ref|XP_010086820.1|  Auxin-binding protein ABP19a                     60.8    4e-10   
gb|ACU18952.1|  unknown                                               60.8    4e-10   Glycine max [soybeans]
ref|XP_003551125.1|  PREDICTED: auxin-binding protein ABP19a-like     60.8    4e-10   
ref|XP_011078075.1|  PREDICTED: auxin-binding protein ABP20-like      60.5    6e-10   
ref|XP_004243715.1|  PREDICTED: auxin-binding protein ABP19a-like     60.5    6e-10   
ref|XP_004141699.1|  PREDICTED: auxin-binding protein ABP19a-like     60.5    7e-10   
gb|AFK42476.1|  unknown                                               60.5    7e-10   
ref|XP_007154588.1|  hypothetical protein PHAVU_003G131400g           60.1    8e-10   
ref|XP_009417703.1|  PREDICTED: germin-like protein 8-14              60.1    8e-10   
ref|XP_008784308.1|  PREDICTED: germin-like protein 8-14              60.1    9e-10   
ref|XP_006426654.1|  hypothetical protein CICLE_v10026481mg           60.1    1e-09   
ref|XP_006465923.1|  PREDICTED: auxin-binding protein ABP19a-like     59.7    1e-09   
ref|XP_004144029.1|  PREDICTED: auxin-binding protein ABP20-like      59.7    1e-09   
ref|XP_010688043.1|  PREDICTED: auxin-binding protein ABP19a-like     59.7    1e-09   
ref|XP_010687789.1|  PREDICTED: auxin-binding protein ABP19a-like     59.3    2e-09   
ref|XP_010910722.1|  PREDICTED: auxin-binding protein ABP20-like      58.5    3e-09   
ref|XP_008362990.1|  PREDICTED: auxin-binding protein ABP19a-like     58.5    3e-09   
ref|XP_009126460.1|  PREDICTED: germin-like protein 1                 58.5    3e-09   
ref|XP_008462312.1|  PREDICTED: auxin-binding protein ABP19a          58.2    4e-09   
ref|XP_010688042.1|  PREDICTED: auxin-binding protein ABP19a-like     58.2    4e-09   
ref|XP_010932415.1|  PREDICTED: germin-like protein 8-14              58.2    4e-09   
ref|XP_004296080.1|  PREDICTED: auxin-binding protein ABP19b-like     58.2    5e-09   
ref|XP_004287631.1|  PREDICTED: auxin-binding protein ABP19b-like     57.4    9e-09   
ref|XP_004287630.1|  PREDICTED: auxin-binding protein ABP19a-like     57.4    1e-08   
ref|XP_004510467.1|  PREDICTED: germin-like protein subfamily 3 m...  57.4    1e-08   
gb|KFK26288.1|  hypothetical protein AALP_AA8G228400                  57.0    1e-08   
ref|XP_007012661.1|  Germin protein subfamily 3 member 3              57.8    2e-08   
gb|KDP40703.1|  hypothetical protein JCGZ_24702                       56.6    2e-08   
emb|CAC85479.1|  adenosine diphosphate glucose pyrophosphatase        56.6    2e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009120792.1|  PREDICTED: germin-like protein 1                 56.6    2e-08   
ref|NP_001061976.1|  Os08g0460000                                     56.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|AAC05682.1|  germin-like protein                                   56.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006289376.1|  hypothetical protein CARUB_v10002870mg           56.2    2e-08   
emb|CDY51841.1|  BnaA03g56080D                                        56.2    2e-08   
dbj|BAA74702.1|  germin-like protein 1                                56.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131804.1|  PREDICTED: germin-like protein subfamily 3 m...  56.2    2e-08   
ref|XP_002304136.2|  germin-like family protein                       56.2    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011036430.1|  PREDICTED: auxin-binding protein ABP19a-like     56.2    2e-08   
ref|XP_010416015.1|  PREDICTED: germin-like protein subfamily 3 m...  56.2    2e-08   
gb|ABK95684.1|  unknown                                               56.2    2e-08   Populus trichocarpa [western balsam poplar]
emb|CDX70935.1|  BnaC03g10190D                                        56.2    2e-08   
ref|XP_010666275.1|  PREDICTED: auxin-binding protein ABP19a-like     56.2    2e-08   
ref|XP_004288274.1|  PREDICTED: auxin-binding protein ABP19a-like     56.2    3e-08   
ref|XP_002299591.2|  germin-like family protein                       55.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|NP_001236394.1|  uncharacterized protein LOC100500326 precursor   55.8    3e-08   
ref|XP_010687709.1|  PREDICTED: auxin-binding protein ABP19a-like     55.8    3e-08   
gb|EYU45887.1|  hypothetical protein MIMGU_mgv1a022096mg              55.8    3e-08   
ref|XP_006342367.1|  PREDICTED: auxin-binding protein ABP19a-like     55.8    3e-08   
gb|ACG69484.1|  germin-like protein 8                                 55.8    3e-08   Glycine max [soybeans]
ref|XP_002274457.1|  PREDICTED: germin-like protein                   55.5    4e-08   Vitis vinifera
ref|XP_009389677.1|  PREDICTED: germin-like protein 8-14              55.5    4e-08   
gb|ADW66138.1|  auxin-binding protein                                 54.3    4e-08   
ref|XP_010471286.1|  PREDICTED: germin-like protein subfamily 3 m...  55.5    4e-08   
ref|XP_010495333.1|  PREDICTED: germin-like protein subfamily 3 m...  55.1    4e-08   
ref|XP_010428148.1|  PREDICTED: germin-like protein subfamily 3 m...  55.5    4e-08   
ref|XP_009126456.1|  PREDICTED: germin-like protein 1                 55.5    4e-08   
ref|XP_010471285.1|  PREDICTED: germin-like protein subfamily 3 m...  55.5    5e-08   
ref|XP_002273384.1|  PREDICTED: auxin-binding protein ABP19a-like     55.1    6e-08   Vitis vinifera
ref|XP_010420905.1|  PREDICTED: germin-like protein subfamily 3 m...  55.1    6e-08   
ref|XP_010454369.1|  PREDICTED: germin-like protein subfamily 3 m...  55.1    6e-08   
ref|XP_008786632.1|  PREDICTED: germin-like protein 8-14              55.1    6e-08   
emb|CAN67670.1|  hypothetical protein VITISV_008896                   55.1    7e-08   Vitis vinifera
ref|XP_002874007.1|  hypothetical protein ARALYDRAFT_910104           54.7    7e-08   
ref|XP_011035719.1|  PREDICTED: auxin-binding protein ABP19a-like     54.7    8e-08   
gb|AAG36666.1|  oxalate oxidase-like germin 171                       54.7    9e-08   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_006659477.1|  PREDICTED: germin-like protein 8-14-like         54.7    9e-08   
ref|XP_010670849.1|  PREDICTED: auxin-binding protein ABP19a-like     54.7    9e-08   
sp|P45854.1|GLP1_SINAL  RecName: Full=Germin-like protein 1; Flag...  54.7    1e-07   Sinapis alba [bai jie]
ref|XP_003547722.1|  PREDICTED: auxin-binding protein ABP19a-like     54.3    1e-07   
emb|CAA63014.1|  germin1                                              54.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888885.1|  hypothetical protein ARALYDRAFT_476393           54.3    1e-07   
ref|XP_006400624.1|  hypothetical protein EUTSA_v10014670mg           54.3    1e-07   
ref|NP_177405.1|  germin-like protein subfamily 3 member 1            54.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAL38307.1|  germin-like protein                                   54.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAB51750.1|  germin-like protein                                   54.3    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EMT30411.1|  Germin-like protein 8-14                              55.1    1e-07   
gb|AAB51583.1|  germin-like protein                                   53.9    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126458.1|  PREDICTED: germin-like protein subfamily 3 m...  54.3    1e-07   
ref|XP_007024622.1|  Germin-like protein 1                            54.3    1e-07   
emb|CAN74027.1|  hypothetical protein VITISV_013538                   55.5    1e-07   Vitis vinifera
emb|CAC32847.1|  adenosine diphosphate glucose pyrophosphatase        53.9    2e-07   Hordeum vulgare [barley]
gb|ABG46233.1|  germin-like protein 2a                                53.9    2e-07   Hordeum vulgare subsp. vulgare [barley]
dbj|BAK03467.1|  predicted protein                                    53.9    2e-07   
ref|XP_010672290.1|  PREDICTED: auxin-binding protein ABP19a-like     54.3    2e-07   
ref|XP_009784907.1|  PREDICTED: auxin-binding protein ABP19a-like     53.9    2e-07   
ref|NP_197563.1|  germin-like protein subfamily 3 member 3            53.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAB51566.1|  germin-like protein                                   53.9    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009596795.1|  PREDICTED: auxin-binding protein ABP19a-like     53.9    2e-07   
gb|ABL86676.1|  GLP2                                                  53.5    2e-07   Gossypium barbadense [Egyptian cotton]
dbj|BAJ98277.1|  predicted protein                                    53.5    2e-07   
ref|XP_007135440.1|  hypothetical protein PHAVU_010G129700g           53.5    2e-07   
ref|XP_007135442.1|  hypothetical protein PHAVU_010G129900g           53.5    2e-07   
ref|XP_003627289.1|  Germin-like protein                              53.5    2e-07   
ref|XP_004288978.1|  PREDICTED: auxin-binding protein ABP19a-like     53.5    3e-07   
ref|XP_006390643.1|  hypothetical protein EUTSA_v10019138mg           53.1    3e-07   
ref|XP_002521328.1|  Auxin-binding protein ABP19a precursor, puta...  53.1    3e-07   Ricinus communis
sp|P45853.1|GLP1_IPONI  RecName: Full=Germin-like protein; Flags:...  53.1    4e-07   Ipomoea nil [qian niu]
ref|XP_010672291.1|  PREDICTED: auxin-binding protein ABP19a-like     53.1    4e-07   
ref|XP_002516286.1|  Auxin-binding protein ABP19a precursor, puta...  52.8    4e-07   Ricinus communis
ref|XP_006604971.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  52.4    4e-07   
ref|XP_010666278.1|  PREDICTED: auxin-binding protein ABP19a-like     52.8    5e-07   
gb|ABK25578.1|  unknown                                               52.8    5e-07   Picea sitchensis
ref|XP_003627273.1|  Germin-like protein                              52.4    5e-07   
ref|XP_006302822.1|  hypothetical protein CARUB_v10020953mg           52.4    6e-07   
gb|KFK41682.1|  hypothetical protein AALP_AA2G159300                  52.4    6e-07   
emb|CAA75907.1|  Germin-like protein 1                                52.4    6e-07   Hordeum vulgare [barley]
ref|XP_010666313.1|  PREDICTED: auxin-binding protein ABP19b-like     52.4    7e-07   
ref|XP_010688041.1|  PREDICTED: auxin-binding protein ABP19a-like     51.6    9e-07   
gb|ACA03782.1|  putative auxin-binding protein 3                      50.1    1e-06   Prunus salicina [Japanese plum]
ref|XP_006837025.1|  hypothetical protein AMTR_s00110p00020470        51.6    1e-06   
gb|AAO92740.1|  auxin binding protein                                 51.6    1e-06   Gossypium hirsutum [American cotton]
gb|AAF21988.2|AF116537_1  fiber protein GLP1                          51.6    1e-06   Gossypium hirsutum [American cotton]
ref|XP_011078074.1|  PREDICTED: auxin-binding protein ABP19a-like     51.6    1e-06   
emb|CDX82141.1|  BnaC02g21490D                                        51.6    1e-06   
ref|XP_003632366.1|  PREDICTED: auxin-binding protein ABP19a-like     51.2    2e-06   
ref|XP_010687565.1|  PREDICTED: auxin-binding protein ABP19a-like     51.6    2e-06   
ref|XP_002264949.1|  PREDICTED: auxin-binding protein ABP19a          50.8    2e-06   Vitis vinifera
ref|XP_007135441.1|  hypothetical protein PHAVU_010G129800g           50.8    2e-06   
gb|KHN01412.1|  Auxin-binding protein ABP19a                          50.8    2e-06   
gb|KHN01409.1|  Auxin-binding protein ABP19a                          50.8    2e-06   
ref|NP_001240182.1|  auxin-binding protein ABP19a-like precursor      50.8    3e-06   
ref|NP_001236898.1|  uncharacterized protein LOC100527498 precursor   50.4    3e-06   
gb|EMS51159.1|  Germin-like protein 8-14                              50.4    3e-06   
ref|XP_010666297.1|  PREDICTED: auxin-binding protein ABP19b-like     50.4    3e-06   
ref|XP_003528531.2|  PREDICTED: auxin-binding protein ABP19a-like     50.8    3e-06   
ref|XP_003604394.1|  Germin-like protein                              50.1    4e-06   
ref|XP_004303796.1|  PREDICTED: auxin-binding protein ABP19a-like...  50.1    5e-06   
gb|ACA03783.1|  putative auxin-binding protein 2                      47.8    8e-06   Prunus salicina [Japanese plum]
ref|XP_002989518.1|  hypothetical protein SELMODRAFT_235813           49.3    8e-06   
ref|XP_002964624.1|  hypothetical protein SELMODRAFT_81894            49.3    8e-06   
ref|XP_010666281.1|  PREDICTED: auxin-binding protein ABP19b-like     49.3    9e-06   
ref|XP_002979113.1|  hypothetical protein SELMODRAFT_109813           49.3    1e-05   
ref|XP_010666282.1|  PREDICTED: auxin-binding protein ABP19b-like     49.3    1e-05   
ref|XP_006595343.1|  PREDICTED: auxin-binding protein ABP19a-like     48.5    1e-05   
gb|ABK22930.1|  unknown                                               48.9    1e-05   Picea sitchensis
ref|XP_002978994.1|  hypothetical protein SELMODRAFT_418837           48.5    1e-05   
ref|XP_010666311.1|  PREDICTED: auxin-binding protein ABP19b-like     48.9    1e-05   
ref|XP_010670843.1|  PREDICTED: auxin-binding protein ABP19a-like     48.9    1e-05   
gb|ABK23834.1|  unknown                                               48.9    1e-05   Picea sitchensis
gb|EYU42507.1|  hypothetical protein MIMGU_mgv1a019482mg              49.3    1e-05   
emb|CDY11164.1|  BnaC06g24160D                                        48.9    1e-05   
ref|XP_011028673.1|  PREDICTED: germin-like protein subfamily T m...  48.9    2e-05   
ref|XP_002322136.2|  hypothetical protein POPTR_0015s07940g           48.9    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_002986434.1|  hypothetical protein SELMODRAFT_123878           48.9    2e-05   
ref|XP_002986338.1|  hypothetical protein SELMODRAFT_123774           48.9    2e-05   
ref|XP_002986337.1|  hypothetical protein SELMODRAFT_123769           48.9    2e-05   
ref|XP_002979115.1|  hypothetical protein SELMODRAFT_109970           48.5    2e-05   
ref|XP_002986439.1|  hypothetical protein SELMODRAFT_123791           48.5    2e-05   
ref|XP_010666312.1|  PREDICTED: germin-like protein                   47.8    2e-05   
ref|XP_010666316.1|  PREDICTED: auxin-binding protein ABP19b-like     48.5    2e-05   
emb|CDX96421.1|  BnaA07g30320D                                        48.5    2e-05   
emb|CDX72929.1|  BnaC06g33770D                                        48.5    2e-05   
ref|XP_010537615.1|  PREDICTED: germin-like protein subfamily 3 m...  48.1    2e-05   
ref|XP_009105920.1|  PREDICTED: germin-like protein 1                 48.1    2e-05   
sp|P46271.1|GLP1_BRANA  RecName: Full=Germin-like protein 1; Flag...  48.1    2e-05   Brassica napus [oilseed rape]
gb|AES68967.2|  germin family 3 protein                               48.1    2e-05   
ref|XP_002981347.1|  hypothetical protein SELMODRAFT_114518           48.1    2e-05   
ref|XP_002969738.1|  hypothetical protein SELMODRAFT_92738            48.1    2e-05   
ref|XP_002986433.1|  hypothetical protein SELMODRAFT_123956           48.1    2e-05   
ref|XP_002981346.1|  hypothetical protein SELMODRAFT_114245           48.1    3e-05   
gb|EMT24696.1|  hypothetical protein F775_52705                       48.1    3e-05   
ref|XP_002962817.1|  hypothetical protein SELMODRAFT_78485            48.1    3e-05   
ref|XP_010670845.1|  PREDICTED: auxin-binding protein ABP19a-like     47.8    3e-05   
ref|XP_002979117.1|  hypothetical protein SELMODRAFT_109767           47.8    3e-05   
ref|XP_002978995.1|  hypothetical protein SELMODRAFT_109968           47.8    3e-05   
ref|XP_008786633.1|  PREDICTED: germin-like protein 8-14              47.8    3e-05   
ref|XP_002986335.1|  hypothetical protein SELMODRAFT_123975           47.8    4e-05   
gb|EYU42510.1|  hypothetical protein MIMGU_mgv1a013236mg              47.8    4e-05   
ref|NP_001140857.1|  uncharacterized protein LOC100272933 precursor   47.8    4e-05   Zea mays [maize]
gb|ADD71875.1|  germin-like protein subfamily 3 member 3 precursor    47.8    4e-05   Arachis hypogaea [goober]
gb|ABS86850.1|  oxalate oxidase                                       47.8    4e-05   Arachis hypogaea [goober]
ref|XP_010666317.1|  PREDICTED: auxin-binding protein ABP19b-like     47.4    5e-05   
ref|XP_004288296.1|  PREDICTED: auxin-binding protein ABP19a-like     47.0    6e-05   
ref|XP_003598716.1|  Germin-like protein 8-14                         48.1    6e-05   
ref|XP_002979114.1|  hypothetical protein SELMODRAFT_109995           46.6    9e-05   
gb|AHM10392.1|  GLP                                                   46.6    9e-05   
ref|XP_009104850.1|  PREDICTED: germin-like protein 1                 46.6    1e-04   
emb|CDX68260.1|  BnaA07g23000D                                        46.6    1e-04   
ref|XP_004288941.1|  PREDICTED: auxin-binding protein ABP19a-like     46.6    1e-04   
ref|XP_003627287.1|  Germin-like protein                              46.6    1e-04   
ref|XP_003627275.1|  Germin-like protein                              46.2    1e-04   
ref|XP_003595410.1|  Germin-like protein                              46.2    1e-04   
ref|XP_003627279.1|  Germin-like protein                              46.2    1e-04   
ref|XP_003598710.1|  Germin-like protein                              45.1    1e-04   
ref|XP_010917183.1|  PREDICTED: germin-like protein 8-14              46.2    1e-04   
ref|XP_002439350.1|  hypothetical protein SORBIDRAFT_09g004970        46.2    1e-04   Sorghum bicolor [broomcorn]
gb|KHN01407.1|  Auxin-binding protein ABP19a                          46.2    1e-04   
ref|XP_003528524.1|  PREDICTED: auxin-binding protein ABP19a-like     46.2    1e-04   
ref|XP_004973627.1|  PREDICTED: germin-like protein 8-14-like         45.8    2e-04   
ref|XP_003627277.1|  Germin-like protein                              45.8    2e-04   
ref|XP_002981345.1|  hypothetical protein SELMODRAFT_114208           45.8    2e-04   
ref|XP_002969737.1|  hypothetical protein SELMODRAFT_92705            45.4    2e-04   
ref|XP_004299636.1|  PREDICTED: germin-like protein subfamily T m...  45.4    2e-04   
ref|XP_004510470.1|  PREDICTED: uncharacterized protein LOC101508818  46.6    3e-04   
gb|KEH37655.1|  auxin-binding protein ABP19a                          44.3    7e-04   
ref|XP_004510468.1|  PREDICTED: germin-like protein 8-14-like         44.3    7e-04   
ref|XP_010678642.1|  PREDICTED: germin-like protein subfamily T m...  44.7    8e-04   
ref|XP_003627288.1|  Germin-like protein                              45.1    8e-04   
gb|KEH29186.1|  germin family 3 protein                               42.7    9e-04   
gb|AFK33656.1|  unknown                                               43.9    9e-04   
emb|CAI56441.1|  germin-like protein                                  43.5    0.001   
ref|XP_004510469.1|  PREDICTED: auxin-binding protein ABP19a-like     43.9    0.001   
ref|XP_010678641.1|  PREDICTED: germin-like protein subfamily T m...  43.9    0.001   
ref|XP_010675440.1|  PREDICTED: auxin-binding protein ABP19a-like     43.9    0.001   



>gb|EYU25861.1| hypothetical protein MIMGU_mgv1a013719mg [Erythranthe guttata]
Length=212

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLSLP GPAGYPCKKS+SVT  DF F GLAAAGNTTNII AAVT
Sbjct  28   ADLSLPAGPAGYPCKKSSSVTADDFAFHGLAAAGNTTNIISAAVT  72



>gb|EPS70693.1| germin-like protein, partial [Genlisea aurea]
Length=204

 Score = 74.7 bits (182),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLSLP GPAGYPCKK++ VT  DF + GLAAAGNTTNII+AAVT
Sbjct  21   ADLSLPAGPAGYPCKKTSEVTADDFAYGGLAAAGNTTNIIRAAVT  65



>gb|EYU28339.1| hypothetical protein MIMGU_mgv1a013656mg [Erythranthe guttata]
Length=214

 Score = 73.2 bits (178),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGYPCKKS+SVT +DF F GLAAAGNT NII AAVT
Sbjct  29   ADLSHPAGPAGYPCKKSSSVTENDFFFHGLAAAGNTKNIISAAVT  73



>ref|XP_008228197.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=212

 Score = 72.8 bits (177),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P GPAGYPCK  A+VTVSDFVFSGLA  GNTTNII+AAVT
Sbjct  29   ADLKGPDGPAGYPCKSPANVTVSDFVFSGLAKGGNTTNIIQAAVT  73



>ref|XP_004287629.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAGY CKK A VTV DFVFSGL  AGNTTNIIKAAVT
Sbjct  26   ADLTAPEGPAGYSCKKPAKVTVDDFVFSGLGIAGNTTNIIKAAVT  70



>gb|KCW82145.1| hypothetical protein EUGRSUZ_C03536 [Eucalyptus grandis]
Length=195

 Score = 71.2 bits (173),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>ref|XP_004287628.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=209

 Score = 71.2 bits (173),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK+A+VTV DFVFSGL  AGNTTNIIKAAVT
Sbjct  26   ADYKAPEGPAGYSCKKAATVTVDDFVFSGLGVAGNTTNIIKAAVT  70



>gb|KDP33908.1| hypothetical protein JCGZ_07479 [Jatropha curcas]
Length=208

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS P GPAG+ CKK+ASVTV DFV+SGL  AGNTTNIIKAAVT
Sbjct  26   DLSGPEGPAGFSCKKAASVTVKDFVYSGLGVAGNTTNIIKAAVT  69



>ref|XP_010049430.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW81986.1| hypothetical protein EUGRSUZ_C03354 [Eucalyptus grandis]
Length=211

 Score = 71.2 bits (173),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>ref|XP_010049517.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82146.1| hypothetical protein EUGRSUZ_C03537 [Eucalyptus grandis]
Length=211

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>gb|KCW82111.1| hypothetical protein EUGRSUZ_C03486, partial [Eucalyptus grandis]
Length=109

 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CK  ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKNVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>gb|KCW82113.1| hypothetical protein EUGRSUZ_C03488 [Eucalyptus grandis]
Length=154

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS P GPAGY CKK ++VTV+DFVFSGL+ AGNT+N+IKAAVT
Sbjct  28   DLSAPEGPAGYSCKKVSAVTVNDFVFSGLSVAGNTSNLIKAAVT  71



>gb|AEQ39055.1| putative germin-like protein [Wolffia arrhiza]
Length=211

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  P+GYPCKK A++TV DFVFSGL  AGNTTNIIKAAVT
Sbjct  28   ADLTAPLTPSGYPCKKEAALTVDDFVFSGLGKAGNTTNIIKAAVT  72



>ref|XP_011093822.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=211

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLSLP GPAGYPCKK+ASVT  DF + GLA AGNT+NII A VT
Sbjct  27   ADLSLPAGPAGYPCKKAASVTADDFAYHGLATAGNTSNIISAFVT  71



>gb|KCW82126.1| hypothetical protein EUGRSUZ_C03507 [Eucalyptus grandis]
Length=193

 Score = 70.1 bits (170),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVF+GL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFAGLGMAGNTSNLIKAAVT  71



>ref|XP_010051456.1| PREDICTED: germin-like protein [Eucalyptus grandis]
Length=182

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CK  ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKNVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>ref|XP_010049513.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
 gb|KCW82133.1| hypothetical protein EUGRSUZ_C03521 [Eucalyptus grandis]
Length=211

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+N+IKAAVT
Sbjct  28   DLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAVT  71



>gb|ACA03784.1| putative auxin-binding protein 3 [Prunus salicina]
Length=214

 Score = 69.3 bits (168),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAG+ CKK ASV V+DFVFSGL  AGNT+NIIKAAVT
Sbjct  31   ADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVT  75



>gb|ABC86741.1| auxin-binding protein [Vitis pseudoreticulata]
Length=137

 Score = 68.6 bits (166),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL+ P GPAGY CKK A VTV DFVFSGL  AGNT+N+IKAAVT
Sbjct  26   DLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVT  69



>ref|XP_007202571.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
 gb|EMJ03770.1| hypothetical protein PRUPE_ppa011460mg [Prunus persica]
Length=209

 Score = 68.9 bits (167),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAG+ CKK ASV V+DFVFSGL  AGNT+NIIKAAVT
Sbjct  26   ADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVT  70



>sp|O04011.1|ABP20_PRUPE RecName: Full=Auxin-binding protein ABP20; Flags: Precursor [Prunus 
persica]
 gb|AAB51240.1| auxin-binding protein [Prunus persica]
Length=214

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAG+ CKK ASV V+DFVFSGL  AGNT+NIIKAAVT
Sbjct  31   ADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAGNTSNIIKAAVT  75



>gb|KCW81975.1| hypothetical protein EUGRSUZ_C033371, partial [Eucalyptus grandis]
Length=199

 Score = 68.6 bits (166),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+ +IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVT  71



>emb|CAN67380.1| hypothetical protein VITISV_017918 [Vitis vinifera]
Length=193

 Score = 68.6 bits (166),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL+ P GPAGY CKK A VTV DFVFSGL  AGNT+N+IKAAVT
Sbjct  11   DLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVT  54



>ref|XP_010051414.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=231

 Score = 68.6 bits (166),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GPAGY CKK ++VTV+DFVFSGL  AGNT+ +IKAAVT
Sbjct  27   ADLSAPEGPAGYSCKKVSAVTVNDFVFSGLGVAGNTSGLIKAAVT  71



>ref|XP_008337871.1| PREDICTED: auxin-binding protein ABP20 [Malus domestica]
Length=233

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAGY CK  A+V V DFVFSGL  AGNTTNIIKAAVT
Sbjct  50   ADLTAPDGPAGYSCKSPANVKVDDFVFSGLGVAGNTTNIIKAAVT  94



>ref|NP_001268059.1| germin-like protein 6 precursor [Vitis vinifera]
 gb|ABL60875.1| germin-like protein 6 [Vitis vinifera]
Length=208

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL+ P GPAGY CKK A VTV DFVFSGL  AGNT+N+IKAAVT
Sbjct  26   DLAAPEGPAGYSCKKPAKVTVDDFVFSGLGMAGNTSNLIKAAVT  69



>ref|XP_010666273.1| PREDICTED: auxin-binding protein ABP19a [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+LP GPAGY CK  A VT  DFV+ GLAAAGNT+N+IKAAVT
Sbjct  25   ADLNLPDGPAGYSCKSPAKVTADDFVYHGLAAAGNTSNLIKAAVT  69



>gb|ACA03785.1| putative auxin-binding protein 2 [Prunus salicina]
Length=209

 Score = 67.8 bits (164),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK A VTV+DFV+SGL  AGNTTNIIKAAVT
Sbjct  26   ADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVT  70



>ref|XP_008242222.1| PREDICTED: auxin-binding protein ABP19a [Prunus mume]
Length=209

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK A VTV+DFV+SGL  AGNTTNIIKAAVT
Sbjct  26   ADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAGNTTNIIKAAVT  70



>gb|KCW82144.1| hypothetical protein EUGRSUZ_C03535 [Eucalyptus grandis]
Length=207

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GP GY CKK ++VTV+DFVFSGL  AGNT+N+IKAA T
Sbjct  27   ADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAAT  71



>ref|XP_010049516.1| PREDICTED: auxin-binding protein ABP19a-like [Eucalyptus grandis]
Length=210

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS P GP GY CKK ++VTV+DFVFSGL  AGNT+N+IKAA T
Sbjct  27   ADLSAPEGPTGYSCKKVSAVTVNDFVFSGLGVAGNTSNLIKAAAT  71



>gb|ABV03161.1| germin-like protein [Chimonanthus praecox]
Length=214

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             DL+ P GPAGY CKK A VTV DFVFSGL  AGNT+NII+AAVT
Sbjct  30   GDLTGPEGPAGYSCKKPAIVTVDDFVFSGLGKAGNTSNIIRAAVT  74



>ref|XP_007202573.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
 sp|Q9ZRA4.1|AB19A_PRUPE RecName: Full=Auxin-binding protein ABP19a; Flags: Precursor 
[Prunus persica]
 gb|AAD00295.1| auxin-binding protein ABP19 [Prunus persica]
 gb|EMJ03772.1| hypothetical protein PRUPE_ppa011467mg [Prunus persica]
Length=209

 Score = 67.4 bits (163),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK A VT++DFV+SGL  AGNTTNIIKAAVT
Sbjct  26   ADYKAPDGPAGYSCKKPAKVTINDFVYSGLGIAGNTTNIIKAAVT  70



>ref|XP_008242223.1| PREDICTED: auxin-binding protein ABP20 [Prunus mume]
Length=237

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAG+ CKK A V V+DFVFSGL  AGNT+NIIKAAVT
Sbjct  54   ADLAAPEGPAGFSCKKPAVVKVNDFVFSGLGIAGNTSNIIKAAVT  98



>ref|XP_009784603.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK +  VTV+DFVFSGL+AAGNT+NIIKA+VT
Sbjct  25   ADLKGPESPAGYSCKNATKVTVNDFVFSGLSAAGNTSNIIKASVT  69



>gb|KEH37574.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  + VTV+DFV+ GLAAAGNTTNIIKAAVT
Sbjct  27   ADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVT  71



>gb|KEH37575.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  + VTV+DFV+ GLAAAGNTTNIIKAAVT
Sbjct  27   ADYNAPNGPAGYSCKPPSKVTVNDFVYHGLAAAGNTTNIIKAAVT  71



>ref|XP_009594759.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
Length=208

 Score = 66.2 bits (160),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK +  VTV+DFVFSGL+AAGNT+NIIKA+VT
Sbjct  25   ADLKGPESPAGYSCKTATKVTVNDFVFSGLSAAGNTSNIIKASVT  69



>ref|XP_008337872.1| PREDICTED: auxin-binding protein ABP19a [Malus domestica]
Length=209

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+   P GPAGY CKK A VTV DFV+SGL  AGNTTNIIKAAVT
Sbjct  26   ANYKAPEGPAGYACKKPAKVTVDDFVYSGLGIAGNTTNIIKAAVT  70



>gb|AFY10819.1| germin-like protein [Camellia sinensis]
Length=231

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD  LP GPAGY CKK A VTV DFVF+GL  A NT+NIIKAAVT
Sbjct  27   ADPKLPQGPAGYSCKKPAKVTVDDFVFTGLGMAANTSNIIKAAVT  71



>ref|XP_007138665.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
 gb|ESW10659.1| hypothetical protein PHAVU_009G227800g [Phaseolus vulgaris]
Length=210

 Score = 65.9 bits (159),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  A VTV+DFV+SGLA AGNT+NIIKAAV+
Sbjct  27   ADYTAPNGPAGYSCKNPAKVTVNDFVYSGLATAGNTSNIIKAAVS  71



>ref|XP_004513480.1| PREDICTED: auxin-binding protein ABP19a-like [Cicer arietinum]
Length=210

 Score = 65.5 bits (158),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CKK + VT  DFV+ GL+A GNTTNIIKAAVT
Sbjct  27   ADYTFPNGPAGYSCKKPSKVTADDFVYHGLSAGGNTTNIIKAAVT  71



>ref|XP_004303688.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=223

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAGY CK  A+VTVSDFV+SGLA AGNT+NII+AAVT
Sbjct  40   ADLTGPDSPAGYFCKNPANVTVSDFVYSGLAKAGNTSNIIQAAVT  84



>sp|O04012.1|AB19B_PRUPE RecName: Full=Auxin-binding protein ABP19b; Flags: Precursor 
[Prunus persica]
 gb|AAB51241.1| auxin-binding protein [Prunus persica]
Length=209

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK A VTV+DFV+SGL  AGNTTNI KAAVT
Sbjct  26   ADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVT  70



>ref|XP_007204735.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
 gb|EMJ05934.1| hypothetical protein PRUPE_ppa011385mg [Prunus persica]
Length=212

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P GPAGY CKK A VTV+DFV+SGL  AGNTTNI KAAVT
Sbjct  26   ADYKAPDGPAGYSCKKPAIVTVNDFVYSGLGIAGNTTNIFKAAVT  70



>ref|XP_010261910.1| PREDICTED: auxin-binding protein ABP19a-like [Nelumbo nucifera]
Length=207

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAGY CKK A VTV+DFV+S L+AAGNT+NIIKAAVT
Sbjct  25   ADLTAPEGPAGYSCKKPAKVTVNDFVYS-LSAAGNTSNIIKAAVT  68



>ref|XP_010666274.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGYPC+  A++TV DFVFSGL  AGNT+NI +  VT
Sbjct  28   ADFNFPVGPAGYPCRNPANLTVDDFVFSGLGVAGNTSNIFRVGVT  72



>ref|XP_006849665.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
 gb|ERN11246.1| hypothetical protein AMTR_s00024p00231430 [Amborella trichopoda]
Length=209

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLSLPP P+G+PCK  + +T  DF F+GL  AGNT+NIIKAAVT
Sbjct  26   ADLSLPPTPSGFPCKSPSKLTSDDFYFTGLGVAGNTSNIIKAAVT  70



>gb|ADD71879.1| germin-like protein subfamily 3 member 4 precursor [Arachis hypogaea]
Length=211

 Score = 65.1 bits (157),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  A VTV DFV+SGL A GNT+NIIKAAVT
Sbjct  28   ADYTAPNGPAGYSCKSPAKVTVDDFVYSGLGAVGNTSNIIKAAVT  72



>ref|XP_008391398.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=213

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK +A VTVSDFVFSGLA  GNTTNII AAVT
Sbjct  30   ADLKGPDSPSGYTCKTAAMVTVSDFVFSGLAKGGNTTNIISAAVT  74



>ref|XP_009760539.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=208

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK  A+VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  25   ADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVT  69



>ref|XP_009600028.1| PREDICTED: auxin-binding protein ABP19a [Nicotiana tomentosiformis]
Length=208

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK  A+VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  25   ADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVT  69



>dbj|BAH15357.1| germin like protein [Nicotiana tabacum]
Length=208

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK  A+VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  25   ADLKGPESPAGYSCKSVANVTVDDFVFSGLSAAGNTASIIKAAVT  69



>gb|AEN02469.1| germin-like protein [Camellia sinensis]
Length=212

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD SLP GPAGY CKK A VTV+DFV+S L  AG+T N+IKA VT
Sbjct  28   ADFSLPDGPAGYSCKKPAKVTVNDFVYSALGIAGDTNNLIKAKVT  72



>ref|NP_001241062.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69486.1| germin-like protein 10 [Glycine max]
Length=213

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  A VTV DFV+SGL  AGNT+NIIKAAVT
Sbjct  30   ADYTGPNGPAGYSCKSPAKVTVDDFVYSGLGTAGNTSNIIKAAVT  74



>ref|XP_011072583.1| PREDICTED: auxin-binding protein ABP19a [Sesamum indicum]
Length=221

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL  P GPAGY CK  A VTV+DFVF+G  AAGNTTNII AAV+
Sbjct  39   DLKAPEGPAGYSCKSPADVTVADFVFTGFRAAGNTTNIINAAVS  82



>emb|CAC34417.1| Germin-like protein [Pisum sativum]
Length=211

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK    VTV DFVF GLA  GNTTNIIKAAVT
Sbjct  28   ADYNAPNGPAGYSCKTPKKVTVDDFVFHGLATGGNTTNIIKAAVT  72



>ref|XP_011045993.1| PREDICTED: auxin-binding protein ABP20 [Populus euphratica]
Length=209

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  P G+ CKK A+VTV DFVFSGL A GNT+NIIKAAVT
Sbjct  26   ADLTGPDTPTGFVCKKPAAVTVDDFVFSGLGAGGNTSNIIKAAVT  70



>ref|XP_009361697.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=209

 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+   P GPAGY CKK A VTV DFV+SGL   GNTTNIIKAAVT
Sbjct  26   ANYKAPEGPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIIKAAVT  70



>emb|CDP03095.1| unnamed protein product [Coffea canephora]
Length=207

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD SLP GPAGY CKK+A VTV DF+FS LAA+GNT+NII AAVT
Sbjct  24   ADPSLPVGPAGYSCKKTADVTVDDFIFS-LAASGNTSNIISAAVT  67



>gb|AFK39466.1| unknown [Medicago truncatula]
Length=210

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD +LP GPAGY CK  + VT +DF + GLAAAGNT+NIIKAAVT
Sbjct  27   ADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVT  71



>gb|AFK43419.1| unknown [Medicago truncatula]
 gb|KEH37573.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=210

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD +LP GPAGY CK  + VT +DF + GLAAAGNT+NIIKAAVT
Sbjct  27   ADYNLPNGPAGYSCKTPSKVTENDFAYHGLAAAGNTSNIIKAAVT  71



>gb|AFK44812.1| unknown [Lotus japonicus]
Length=210

 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL+ P GPAGY CKK + VT  DF +SGL  AGNT+NIIKAAVT
Sbjct  28   DLTFPNGPAGYACKKPSKVTADDFAYSGLGIAGNTSNIIKAAVT  71



>ref|XP_010064035.1| PREDICTED: auxin-binding protein ABP19a [Eucalyptus grandis]
 gb|KCW71333.1| hypothetical protein EUGRSUZ_F04417 [Eucalyptus grandis]
Length=208

 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L  P  PAGY CK  A VTV DFVFSGL  AGNTTNIIKAAVT
Sbjct  25   ANLKGPDTPAGYTCKSPAKVTVKDFVFSGLGVAGNTTNIIKAAVT  69



>ref|XP_006381632.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
 gb|ERP59429.1| hypothetical protein POPTR_0006s14510g [Populus trichocarpa]
Length=250

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  P G+ CKK A+VTV DFVFSGL A GNT+NIIKAAVT
Sbjct  67   ADLTGPDTPTGFVCKKPAAVTVDDFVFSGLGAGGNTSNIIKAAVT  111



>ref|XP_009375459.1| PREDICTED: auxin-binding protein ABP19a [Pyrus x bretschneideri]
Length=213

 Score = 63.5 bits (153),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK  A VTVSDFVFSGLA  GNTTNII AAVT
Sbjct  30   ADLKGPDSPSGYTCKIPAKVTVSDFVFSGLAKGGNTTNIISAAVT  74



>sp|L8BRS3.1|GLP1_MORAL RecName: Full=Germin-like protein; Short=Ma-Glp; Flags: Precursor 
[Morus alba]
 emb|CCH57381.3| auxin binding protein [Morus alba]
Length=209

 Score = 63.2 bits (152),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD S P GPAGY CK  A VTV +FV+SGL   GNTTN+IKAAVT
Sbjct  26   ADYSAPQGPAGYSCKNPAKVTVDNFVYSGLGITGNTTNLIKAAVT  70



>gb|ABL86677.1| GLP3 [Gossypium barbadense]
Length=205

 Score = 63.2 bits (152),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DL+ P GPAGY CKK+  VTV+DFV+SGLAA GNT+N+IKAAVT
Sbjct  24   DLNGPVGPAGYSCKKT--VTVNDFVYSGLAATGNTSNLIKAAVT  65



>ref|XP_006342915.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score = 62.8 bits (151),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  25   ADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVT  69



>ref|XP_010261909.1| PREDICTED: auxin-binding protein ABP20-like [Nelumbo nucifera]
Length=207

 Score = 62.8 bits (151),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAGY CKK A VTV DFVFS L   GNT+NIIKAAVT
Sbjct  25   ADLTAPEGPAGYSCKKPAKVTVDDFVFS-LGTVGNTSNIIKAAVT  68



>ref|XP_004235542.1| PREDICTED: auxin-binding protein ABP19a [Solanum lycopersicum]
Length=208

 Score = 62.8 bits (151),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  25   ADLKAPESPSGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVT  69



>ref|XP_002274625.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=208

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            ADL  P GPAGY CK  A VTV DFV+SGL  AGNT+N IKA++
Sbjct  25   ADLKAPQGPAGYSCKTPAKVTVDDFVYSGLGVAGNTSNFIKASI  68



>ref|XP_008362989.1| PREDICTED: LOW QUALITY PROTEIN: auxin-binding protein ABP20-like 
[Malus domestica]
Length=206

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 3/45 (7%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL++P GPAGY CK    V V DFVFSGL  AGNTTNIIKAAVT
Sbjct  26   ADLTVPDGPAGYSCK---XVKVDDFVFSGLDIAGNTTNIIKAAVT  67



>emb|CDO97853.1| unnamed protein product [Coffea canephora]
Length=125

 Score = 62.0 bits (149),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAG  CK  A+VTV DF F+GL AAGNT+NIIKAAV 
Sbjct  25   ADLNGPEGPAGCSCKSPANVTVDDFTFTGLGAAGNTSNIIKAAVN  69



>ref|XP_010666280.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGYPC+  A++TV DFVFSG   AGNT+NI   AVT
Sbjct  29   ADFNYPVGPAGYPCRNPANLTVDDFVFSGFGVAGNTSNIFGVAVT  73



>ref|XP_010090139.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB38936.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD S P GPAGY CK  A VTV  FV+SGL   GNTTN+IKAAVT
Sbjct  28   ADYSAPQGPAGYSCKNPAKVTVDSFVYSGLGITGNTTNLIKAAVT  72



>gb|ABG76199.2| germin-like protein [Capsicum chinense]
Length=203

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P GY CK   +VTV DFVFSGL+AAGNT +IIKAAVT
Sbjct  26   ADLKAPESPCGYSCKSVTNVTVDDFVFSGLSAAGNTASIIKAAVT  70



>ref|XP_010235197.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK + SV+  DF + GLAAAGNTTN+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVT  74



>ref|XP_003574592.1| PREDICTED: germin-like protein 8-14 [Brachypodium distachyon]
Length=214

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK + SV+  DF + GLAAAGNTTN+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCKAAGSVSSGDFYYHGLAAAGNTTNLIKAAVT  74



>ref|XP_006361339.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=208

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  PAGY CK    VTV+DFVFSGL+AAG+T+NIIKA+V+
Sbjct  25   ADLKGPESPAGYSCKSVTKVTVNDFVFSGLSAAGDTSNIIKASVS  69



>ref|XP_010666307.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
            ADLS P GPAGYPC+  +++TV DFVFSGL  AGNT NI  ++
Sbjct  28   ADLSFPGGPAGYPCRNPSNLTVDDFVFSGLGVAGNTENIFNSS  70



>ref|XP_008450917.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis melo]
Length=215

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+G+PCKK++ VT  DFV+SGL  AGNT+N+IKAAVT
Sbjct  32   ADLKSPDTPSGFPCKKASLVTEKDFVYSGLGVAGNTSNLIKAAVT  76



>ref|XP_010666277.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P GPAGYPCK  A++TV DFV+SGL  +GNT+N+    VT
Sbjct  29   ADLNYPVGPAGYPCKNPANLTVDDFVYSGLGVSGNTSNVFGVGVT  73



>ref|XP_010086822.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23832.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAGY CK    VT  DFV+SGLAA GNTTNII AAVT
Sbjct  28   ADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVT  72



>ref|XP_010086820.1| Auxin-binding protein ABP19a [Morus notabilis]
 gb|EXB23830.1| Auxin-binding protein ABP19a [Morus notabilis]
Length=211

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAGY CK    VT  DFV+SGLAA GNTTNII AAVT
Sbjct  28   ADLTAPDTPAGYHCKDPKKVTADDFVYSGLAAPGNTTNIISAAVT  72



>gb|ACU18952.1| unknown [Glycine max]
Length=208

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CKK + VT  DF +SGL  AGNT+NIIKAAVT
Sbjct  25   ADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVT  69



>ref|XP_003551125.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
 gb|KHN17718.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score = 60.8 bits (146),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CKK + VT  DF +SGL  AGNT+NIIKAAVT
Sbjct  25   ADYAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVT  69



>ref|XP_011078075.1| PREDICTED: auxin-binding protein ABP20-like [Sesamum indicum]
Length=212

 Score = 60.5 bits (145),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTN  22
            ADLSLP GPAGYPCKKSASVTV+DF + GL   G+T N
Sbjct  28   ADLSLPAGPAGYPCKKSASVTVNDFFYHGLTTPGSTKN  65



>ref|XP_004243715.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum lycopersicum]
Length=211

 Score = 60.5 bits (145),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CKK + VT  DFVFSGLAA G    +IKAAVT
Sbjct  28   DLSLPDGPGGYACKKPSKVTADDFVFSGLAATGKIIPLIKAAVT  71



>ref|XP_004141699.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 ref|XP_004155922.1| PREDICTED: auxin-binding protein ABP19a-like [Cucumis sativus]
 gb|KGN45492.1| hypothetical protein Csa_7G450510 [Cucumis sativus]
Length=208

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P GPAGY CK ++ VT  DFVFSGL AAGN +++IKAAVT
Sbjct  25   ADLKGPQGPAGYSCKIASVVTADDFVFSGLRAAGNISSLIKAAVT  69



>gb|AFK42476.1| unknown [Lotus japonicus]
Length=209

 Score = 60.5 bits (145),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL    GPAGYPCK  A+VT  DFVF+GL+A GN TNII AAVT
Sbjct  26   ADLKGSDGPAGYPCKTPATVTSDDFVFAGLSAPGNITNIIGAAVT  70



>ref|XP_007154588.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
 gb|ESW26582.1| hypothetical protein PHAVU_003G131400g [Phaseolus vulgaris]
Length=208

 Score = 60.1 bits (144),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CKK + VT  DF +SGL  AGNT+NIIKAAVT
Sbjct  25   ADHAGPIGPAGYSCKKPSKVTADDFAYSGLGIAGNTSNIIKAAVT  69



>ref|XP_009417703.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=209

 Score = 60.1 bits (144),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            D+S    PAGYPCK  + VT +DFVF GL  AGNT+NIIKAAVT
Sbjct  27   DISASDTPAGYPCKDVSHVTTNDFVFKGLGKAGNTSNIIKAAVT  70



>ref|XP_008784308.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=210

 Score = 60.1 bits (144),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    P+GY CKK A+VT +DFVF+GL  AGNT+N+IKAAVT
Sbjct  27   ADLTGRLTPSGYECKKEAAVTTNDFVFTGLGKAGNTSNLIKAAVT  71



>ref|XP_006426654.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
 gb|ESR39894.1| hypothetical protein CICLE_v10026481mg [Citrus clementina]
Length=211

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL L   PAGYPC   A VT  DFVFSGL  AGNTT+II AAVT
Sbjct  27   ADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVT  71



>ref|XP_006465923.1| PREDICTED: auxin-binding protein ABP19a-like [Citrus sinensis]
 gb|KDO65035.1| hypothetical protein CISIN_1g028365mg [Citrus sinensis]
Length=210

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL L   PAGYPC   A VT  DFVFSGL  AGNTT+II AAVT
Sbjct  26   ADLKLSDSPAGYPCVPPAMVTADDFVFSGLGVAGNTTSIINAAVT  70



>ref|XP_004144029.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 ref|XP_004161110.1| PREDICTED: auxin-binding protein ABP20-like [Cucumis sativus]
 gb|KGN66292.1| hypothetical protein Csa_1G596420 [Cucumis sativus]
Length=215

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     P+G+PCKK++ VT  DFVFSGL  AGNT+N+IKAAVT
Sbjct  32   ADLMSADTPSGFPCKKASLVTEKDFVFSGLGVAGNTSNLIKAAVT  76



>ref|XP_010688043.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIK  13
             DLSLP GPAGY CK  A VTV DFV+SGL  A NTTN+ K
Sbjct  27   GDLSLPSGPAGYSCKDPAKVTVDDFVYSGLRVAANTTNLFK  67



>ref|XP_010687789.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=214

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            DLSLP GP GY CK  A VTV DFV+SG+  AGNT N+ K  V
Sbjct  28   DLSLPSGPTGYSCKDPAKVTVDDFVYSGMRVAGNTANLFKFGV  70



>ref|XP_010910722.1| PREDICTED: auxin-binding protein ABP20-like [Elaeis guineensis]
Length=210

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    P+GY CK+ +SVT  DFVFSGL   GNT+NIIKAAVT
Sbjct  27   ADLTGHLTPSGYDCKEESSVTTDDFVFSGLGVPGNTSNIIKAAVT  71



>ref|XP_008362990.1| PREDICTED: auxin-binding protein ABP19a-like [Malus domestica]
Length=210

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -3

Query  114  GPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            GPAGY CKK A VTV DFV+SGL   GNTTNI K+AVT
Sbjct  33   GPAGYSCKKPAKVTVDDFVYSGLGIPGNTTNIFKSAVT  70



>ref|XP_009126460.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45077.1| BnaA02g04990D [Brassica napus]
 emb|CDY27880.1| BnaA07g04700D [Brassica napus]
Length=212

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD S P GP+G+ CK    VT +DF FSGLA AGNT+N+IKAAVT
Sbjct  29   ADPSGPQGPSGFSCKNPDQVTANDFAFSGLAKAGNTSNMIKAAVT  73



>ref|XP_008462312.1| PREDICTED: auxin-binding protein ABP19a [Cucumis melo]
Length=210

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P GPAGY CK ++ VT  DFV++GL AAGN +++IKAAVT
Sbjct  27   ADLKGPQGPAGYSCKIASVVTADDFVYTGLGAAGNISSLIKAAVT  71



>ref|XP_010688042.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=209

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIK  13
             DLSLP GPAGY CK  A VTV DFV+SGL    NTTN+ K
Sbjct  27   GDLSLPSGPAGYACKDPAKVTVDDFVYSGLRVGANTTNLFK  67



>ref|XP_010932415.1| PREDICTED: germin-like protein 8-14 [Elaeis guineensis]
Length=205

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    P+GY CK  +SVT +DFVFSGL   GNT+NIIKAAVT
Sbjct  21   ADLTGRLTPSGYECKMESSVTTNDFVFSGLGVPGNTSNIIKAAVT  65



>ref|XP_004296080.1| PREDICTED: auxin-binding protein ABP19b-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 58.2 bits (139),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CKK   VT  DFV+SGL   GNT NI KAA T
Sbjct  27   ADYTAPSGPAGYSCKKDEMVTADDFVYSGLNTTGNTVNIFKAANT  71



>ref|XP_004287631.1| PREDICTED: auxin-binding protein ABP19b-like [Fragaria vesca 
subsp. vesca]
Length=213

 Score = 57.4 bits (137),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P  P+GY CK+  +VTV DFV+SGL  AGNT+NI +  +T
Sbjct  26   ADYTAPSNPSGYSCKRPENVTVDDFVYSGLGVAGNTSNIFRGTIT  70



>ref|XP_004287630.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=211

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P GPAGY CK  A+VTV DFV+S L   GNT+N+IK  +T
Sbjct  28   ADYTAPQGPAGYSCKDPANVTVDDFVYSALGVPGNTSNMIKTGIT  72



>ref|XP_004510467.1| PREDICTED: germin-like protein subfamily 3 member 1-like [Cicer 
arietinum]
Length=226

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD+     PAGYPCK + +VT  DF +SGL  AGNTTNII AAVT
Sbjct  43   ADIKASDTPAGYPCKAATTVTSDDFAYSGLIEAGNTTNIINAAVT  87



>gb|KFK26288.1| hypothetical protein AALP_AA8G228400 [Arabis alpina]
Length=211

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKDPEQVTENDFAFSGLAKAGNTSNIIKAAVT  72



>ref|XP_007012661.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
 gb|EOY30280.1| Germin protein subfamily 3 member 3 [Theobroma cacao]
Length=275

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     PAGY CK   +VTV DFVFSGL AAGNT+N+IKAAVT
Sbjct  94   ADLKGLQSPAGYSCK--TAVTVDDFVFSGLGAAGNTSNLIKAAVT  136



>gb|KDP40703.1| hypothetical protein JCGZ_24702 [Jatropha curcas]
Length=207

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            P+GY C+  A+VT  DFVF GLAAAGNTTNII AAVT
Sbjct  32   PSGYACRSPANVTADDFVFKGLAAAGNTTNIISAAVT  68



>emb|CAC85479.1| adenosine diphosphate glucose pyrophosphatase [Triticum aestivum]
Length=212

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK  A V+  DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCK--AGVSAGDFYYHGLAAAGNTSNLIKAAVT  72



>ref|XP_009120792.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY22866.1| BnaA06g02110D [Brassica napus]
 emb|CDY16549.1| BnaC09g37240D [Brassica napus]
 emb|CDX92448.1| BnaA10g14870D [Brassica napus]
 emb|CDX85429.1| BnaA02g03840D [Brassica napus]
Length=211

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA AGNT+NIIKAAVT
Sbjct  28   ADPKGPQNPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVT  72



>ref|NP_001061976.1| Os08g0460000 [Oryza sativa Japonica Group]
 sp|Q6ZBZ2.1|GL814_ORYSJ RecName: Full=Germin-like protein 8-14; AltName: Full=Germin-like 
protein 1; AltName: Full=Germin-like protein 5; Short=OsGER5; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAC04836.1| germin-like protein 5 [Oryza sativa Japonica Group]
 dbj|BAB17848.1| germin-like protein 1 [Oryza sativa Japonica Group]
 dbj|BAD09603.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD09958.1| germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF23890.1| Os08g0460000 [Oryza sativa Japonica Group]
 gb|EAZ07240.1| hypothetical protein OsI_29484 [Oryza sativa Indica Group]
 gb|EAZ42986.1| hypothetical protein OsJ_27575 [Oryza sativa Japonica Group]
 dbj|BAG89446.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96911.1| unnamed protein product [Oryza sativa Japonica Group]
Length=213

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    PAGYPCK  ASV   DF + GLAAAGNT+N+IKAAVT
Sbjct  31   ADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVT  73



>gb|AAC05682.1| germin-like protein [Oryza sativa Japonica Group]
Length=213

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    PAGYPCK  ASV   DF + GLAAAGNT+N+IKAAVT
Sbjct  31   ADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVT  73



>ref|XP_006289376.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
 gb|EOA22274.1| hypothetical protein CARUB_v10002870mg [Capsella rubella]
Length=212

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  PAGY CK    VT +DFVFSGL   GNT+NIIKAAVT
Sbjct  29   ADPKGPQSPAGYSCKNPDQVTENDFVFSGLGKTGNTSNIIKAAVT  73



>emb|CDY51841.1| BnaA03g56080D [Brassica napus]
Length=211

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVT  72



>dbj|BAA74702.1| germin-like protein 1 [Oryza sativa]
Length=213

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    PAGYPCK  ASV   DF + GLAAAGNT+N+IKAAVT
Sbjct  31   ADLTCSDTPAGYPCK--ASVGAGDFAYHGLAAAGNTSNLIKAAVT  73



>ref|XP_009131804.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
Length=211

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNIIKAAVT  72



>ref|XP_002304136.2| germin-like family protein [Populus trichocarpa]
 gb|EEE79115.2| germin-like family protein [Populus trichocarpa]
Length=210

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGY C+  ++VTV DFVF+GL  AGNTTNII AAVT
Sbjct  34   PAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVT  70



>ref|XP_011036430.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=210

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGY C+  ++VTV DFVF+GL  AGNTTNII AAVT
Sbjct  34   PAGYACRMPSNVTVDDFVFTGLGVAGNTTNIISAAVT  70



>ref|XP_010416015.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=208

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRQIHVKASDFVFSGLGTPGNTTNIISAAVT  69



>gb|ABK95684.1| unknown [Populus trichocarpa]
Length=210

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGY C+  + VTV DFVF+GL  AGNTTNII AAVT
Sbjct  34   PAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVT  70



>emb|CDX70935.1| BnaC03g10190D [Brassica napus]
Length=211

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT  DF FSGLA AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTEKDFAFSGLAKAGNTSNIIKAAVT  72



>ref|XP_010666275.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=210

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
            AD + P GPAGY C+  A++TV DFVFSGL   GNT+NI  ++
Sbjct  28   ADFNFPVGPAGYSCRNPANLTVDDFVFSGLGVPGNTSNIFNSS  70



>ref|XP_004288274.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=212

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIK  13
            AD + P GPAGY CK  A VTV DFV+SGL  +GNT+NI K
Sbjct  28   ADYTAPQGPAGYSCKDPAKVTVDDFVYSGLRVSGNTSNIHK  68



>ref|XP_002299591.2| germin-like family protein [Populus trichocarpa]
 gb|EEE84396.2| germin-like family protein [Populus trichocarpa]
Length=207

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGY C+  + VTV DFVF+GL  AGNTTNII AAVT
Sbjct  31   PAGYACRMPSKVTVDDFVFTGLGVAGNTTNIISAAVT  67



>ref|NP_001236394.1| uncharacterized protein LOC100500326 precursor [Glycine max]
 gb|ACU15366.1| unknown [Glycine max]
Length=207

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     PAGYPCK  A+VT  DFV++GLA A N TNII AAVT
Sbjct  26   ADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAANVTNIINAAVT  70



>ref|XP_010687709.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 gb|AAO92348.1| germin-like protein Kiel 1 [Beta vulgaris]
Length=211

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
            ADL+ P GPAGYPC+  A++T  DFV+SGL AAGN +    AA
Sbjct  29   ADLTFPVGPAGYPCRNPATLTADDFVYSGLGAAGNFSTTFNAA  71



>gb|EYU45887.1| hypothetical protein MIMGU_mgv1a022096mg [Erythranthe guttata]
Length=210

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  P+GY CK  A+VT  DFVF+G    GNTTNII AAV+
Sbjct  27   ADLTGPQTPSGYTCKPPANVTAEDFVFTGFRKGGNTTNIINAAVS  71



>ref|XP_006342367.1| PREDICTED: auxin-binding protein ABP19a-like [Solanum tuberosum]
Length=211

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CKK + VT  DFVFSGLAA      +IKAAVT
Sbjct  28   DLSLPDGPGGYACKKPSKVTSDDFVFSGLAAPVKLIPLIKAAVT  71



>gb|ACG69484.1| germin-like protein 8 [Glycine max]
 gb|KHN01406.1| Auxin-binding protein ABP19a [Glycine soja]
Length=209

 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     PAGYPCK  A+VT  DFV++GLA A N TNII AAVT
Sbjct  26   ADLKGADTPAGYPCKPPANVTSDDFVYTGLAEAANVTNIINAAVT  70



>ref|XP_002274457.1| PREDICTED: germin-like protein [Vitis vinifera]
Length=209

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            ADL+ P GPAGY CK  A VT  DFV+SGL+  GNT+++  AA+
Sbjct  26   ADLTAPQGPAGYSCKTPAEVTADDFVYSGLSQPGNTSSLFNAAI  69



>ref|XP_009389677.1| PREDICTED: germin-like protein 8-14 [Musa acuminata subsp. malaccensis]
Length=215

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             +LS    PAGYPCK+ ++VT  DFVF+GL   G+T+N+IKAAVT
Sbjct  32   GELSSSDTPAGYPCKEVSTVTCDDFVFTGLGVPGDTSNLIKAAVT  76



>gb|ADW66138.1| auxin-binding protein [Solanum nigrum]
Length=96

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CKK + VT  DFVFSGLA       +IKAAVT
Sbjct  15   DLSLPDGPCGYSCKKPSKVTADDFVFSGLATPVKLNPLIKAAVT  58



>ref|XP_010471286.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFSGL   GNTTNII AAVT
Sbjct  26   ANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVT  70



>ref|XP_010495333.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=182

 Score = 55.1 bits (131),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    V  +DFVFSGL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVNENDFVFSGLGKAGNTSNIIKAAVT  72



>ref|XP_010428148.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVT  69



>ref|XP_009126456.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 emb|CDY45080.1| BnaA02g04960D [Brassica napus]
Length=211

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA AGNT+N+IKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKAGNTSNLIKAAVT  72



>ref|XP_010471285.1| PREDICTED: germin-like protein subfamily 3 member 1 [Camelina 
sativa]
Length=209

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFSGL   GNTTNII AAVT
Sbjct  26   ANLKRAETPAGYPCIRPMHVKASDFVFSGLGTPGNTTNIISAAVT  70



>ref|XP_002273384.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            ADL+ P GPAGY CK  A VT  DFV+SGL+  GNT+ +  AA+
Sbjct  26   ADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAI  69



>ref|XP_010420905.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
 ref|XP_010493167.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    V  +DFVFSGL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVNENDFVFSGLGKAGNTSNIIKAAVT  72



>ref|XP_010454369.1| PREDICTED: germin-like protein subfamily 3 member 3 [Camelina 
sativa]
Length=211

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    V  +DFVFSGL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVNENDFVFSGLGKAGNTSNIIKAAVT  72



>ref|XP_008786632.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score = 55.1 bits (131),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     P+GY CK  ++VT  DFVF+GL   GNT+NIIKAAVT
Sbjct  22   ADLMGSLTPSGYQCKVESAVTTDDFVFTGLGVVGNTSNIIKAAVT  66



>emb|CAN67670.1| hypothetical protein VITISV_008896 [Vitis vinifera]
Length=209

 Score = 55.1 bits (131),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            ADL+ P GPAGY CK  A VT  DFV+SGL+  GNT+ +  AA+
Sbjct  26   ADLTAPQGPAGYSCKTPAEVTADDFVYSGLSVPGNTSTLFNAAI  69



>ref|XP_002874007.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50266.1| hypothetical protein ARALYDRAFT_910104 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score = 54.7 bits (130),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFSGLGKAGNTSNIIKAAVT  72



>ref|XP_011035719.1| PREDICTED: auxin-binding protein ABP19a-like [Populus euphratica]
Length=208

 Score = 54.7 bits (130),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGY C+  + VTV DFV++GL  AGNTTNII AAVT
Sbjct  32   PAGYACRMPSKVTVDDFVYTGLGVAGNTTNIISAAVT  68



>gb|AAG36666.1| oxalate oxidase-like germin 171 [Beta vulgaris]
Length=208

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CK  AS+T  DFV++G      TTNI K  VT
Sbjct  28   DLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVT  71



>ref|XP_006659477.1| PREDICTED: germin-like protein 8-14-like [Oryza brachyantha]
Length=212

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+    PAGYPCK  A V   DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLTCSDTPAGYPCK--AGVGAGDFAYHGLAAAGNTSNLIKAAVT  72



>ref|XP_010670849.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CK  AS+T  DFV++G      TTNI K  VT
Sbjct  28   DLSLPRGPQGYACKDPASITTDDFVYTGFRGERTTTNIFKNNVT  71



>sp|P45854.1|GLP1_SINAL RecName: Full=Germin-like protein 1; Flags: Precursor [Sinapis 
alba]
 emb|CAA59257.1| Glp1 [Sinapis alba]
Length=211

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGL  AGNT+N+IKAAVT
Sbjct  28   ADPKGPQNPSGYSCKNPDQVTENDFAFSGLGKAGNTSNVIKAAVT  72



>ref|XP_003547722.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=209

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     P+GYPCK  A+VT  DFV++GLA A N TNII AAVT
Sbjct  26   ADLKGADTPSGYPCKPPANVTSDDFVYTGLAEAANVTNIINAAVT  70



>emb|CAA63014.1| germin1 [Arabidopsis thaliana]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  +DFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVT  69



>ref|XP_002888885.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65144.1| hypothetical protein ARALYDRAFT_476393 [Arabidopsis lyrata subsp. 
lyrata]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  +DFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVT  69



>ref|XP_006400624.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
 gb|ESQ42077.1| hypothetical protein EUTSA_v10014670mg [Eutrema salsugineum]
Length=211

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF FSGLA +GNT+N+IKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFSGLAKSGNTSNLIKAAVT  72



>ref|NP_177405.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
 sp|P94040.1|GL31_ARATH RecName: Full=Germin-like protein subfamily 3 member 1; Short=At-GERM1; 
Short=AtGER1; Short=AtGLP1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51848.1|AC010926_11 germin-like protein; 70589-71215 [Arabidopsis thaliana]
 gb|AAB51567.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51568.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51574.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51575.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51579.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51584.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51751.1| germin-like protein [Arabidopsis thaliana]
 gb|AAD05223.1| germin-like protein 1 [Arabidopsis thaliana]
 dbj|BAA77207.1| germin-like protein precursor [Arabidopsis thaliana]
 gb|AAM63161.1| germin-like protein [Arabidopsis thaliana]
 gb|AAN60267.1| unknown [Arabidopsis thaliana]
 gb|AEE35348.1| germin-like protein subfamily 3 member 1 [Arabidopsis thaliana]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  +DFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVT  69



>gb|AAL38307.1| germin-like protein [Arabidopsis thaliana]
 gb|AAM10138.1| germin-like protein [Arabidopsis thaliana]
Length=208

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  +DFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVT  69



>gb|AAB51750.1| germin-like protein [Arabidopsis thaliana]
Length=204

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  +DFVFSGL   GNTTNII AAVT
Sbjct  21   ANLKRAETPAGYPCIRPIHVKATDFVFSGLGTPGNTTNIINAAVT  65



>gb|EMT30411.1| Germin-like protein 8-14 [Aegilops tauschii]
Length=252

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK  A V   DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCK--AGVGAGDFYYHGLAAAGNTSNLIKAAVT  72



>gb|AAB51583.1| germin-like protein, partial [Arabidopsis thaliana]
Length=188

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF F+GL  AGNT+NIIKAAVT
Sbjct  5    ADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGNTSNIIKAAVT  49



>ref|XP_009126458.1| PREDICTED: germin-like protein subfamily 3 member 3 [Brassica 
rapa]
 emb|CDY45079.1| BnaA02g04970D [Brassica napus]
Length=219

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            AD S P  P+GY CK    VT  DF FSGLA +GNT+N+IKAAV
Sbjct  29   ADPSGPQSPSGYSCKNPDQVTADDFAFSGLAKSGNTSNMIKAAV  72



>ref|XP_007024622.1| Germin-like protein 1 [Theobroma cacao]
 gb|EOY27244.1| Germin-like protein 1 [Theobroma cacao]
Length=224

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            P+GY CKK+A VT  D++F+GL   GNTTNIIKAAV+
Sbjct  49   PSGYACKKAAKVTADDYMFTGLGLEGNTTNIIKAAVS  85



>emb|CAN74027.1| hypothetical protein VITISV_013538 [Vitis vinifera]
Length=345

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            ADL+ P GPAGY CK  A VT  DFV+SGL+  GNT+++  AA+
Sbjct  227  ADLTAPQGPAGYSCKTPAEVTADDFVYSGLSQPGNTSSLFNAAI  270



>emb|CAC32847.1| adenosine diphosphate glucose pyrophosphatase [Hordeum vulgare 
subsp. vulgare]
Length=212

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK    V   DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCKTG--VGAGDFYYHGLAAAGNTSNLIKAAVT  72



>gb|ABG46233.1| germin-like protein 2a [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK    V   DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCKTG--VGAGDFYYHGLAAAGNTSNLIKAAVT  72



>dbj|BAK03467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK    V   DF + GLAAAGNT+N+IKAAVT
Sbjct  30   ADLSCSDTPAGYPCKTG--VGAGDFYYHGLAAAGNTSNLIKAAVT  72



>ref|XP_010672290.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GPAGY CK   +VTV+DFV S L   GNT NI K   T
Sbjct  59   DLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPGNTANIFKFGAT  102



>ref|XP_009784907.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana sylvestris]
Length=210

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS+P GP GY CKK ++VT +DFVFSGLA       +IKAAVT
Sbjct  27   DLSVPDGPGGYACKKPSAVTANDFVFSGLATPVKLNPLIKAAVT  70



>ref|NP_197563.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
 sp|P94072.1|GL33_ARATH RecName: Full=Germin-like protein subfamily 3 member 3; Short=AtGER3; 
Short=AtGLP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB51571.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51573.1| germin-like protein [Arabidopsis thaliana]
 emb|CAA73213.1| GLP3 protein [Arabidopsis thaliana]
 dbj|BAA77208.1| germin-like protein 2 precursor [Arabidopsis thaliana]
 emb|CAB54516.1| GER3 protein [Arabidopsis thaliana]
 gb|AAK62573.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AAL06953.1| AT5g20630/T1M15_30 [Arabidopsis thaliana]
 gb|AED92868.1| germin-like protein subfamily 3 member 3 [Arabidopsis thaliana]
Length=211

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF F+GL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFTGLGTAGNTSNIIKAAVT  72



>gb|AAB51566.1| germin-like protein [Arabidopsis thaliana]
 gb|AAB51581.1| germin-like protein [Arabidopsis thaliana]
Length=211

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD   P  P+GY CK    VT +DF F+GL  AGNT+NIIKAAVT
Sbjct  28   ADPKGPQSPSGYSCKNPDQVTENDFAFTGLGKAGNTSNIIKAAVT  72



>ref|XP_009596795.1| PREDICTED: auxin-binding protein ABP19a-like [Nicotiana tomentosiformis]
 dbj|BAC77634.1| 24K germin like protein [Nicotiana tabacum]
Length=210

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS+P GP GY CKK ++VT +DFVFSGLA       +IKAAVT
Sbjct  27   DLSVPDGPGGYACKKPSAVTANDFVFSGLATPVKLNPLIKAAVT  70



>gb|ABL86676.1| GLP2 [Gossypium barbadense]
Length=205

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = -3

Query  129  LSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            L+ P GPAGY CKK+A  T  DF FSGL  AGNT+N++KAA+T
Sbjct  26   LNGPVGPAGYSCKKTA--TEDDFSFSGLRTAGNTSNLVKAAIT  66



>dbj|BAJ98277.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87478.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96386.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92946.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAGYPCK    V   DF + GLA AGNT+N+IKAAVT
Sbjct  30   ADLACPDTPAGYPCKPG--VGAGDFYYHGLATAGNTSNLIKAAVT  72



>ref|XP_007135440.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
 emb|CAB77393.1| germin-like protein [Phaseolus vulgaris]
 gb|ESW07434.1| hypothetical protein PHAVU_010G129700g [Phaseolus vulgaris]
Length=206

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK +  VTV DFVFSGL  AGNTTN   AA+T
Sbjct  25   ADLKGPDSPSGYQCKPTKEVTVDDFVFSGL-VAGNTTNTFNAALT  68



>ref|XP_007135442.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
 gb|ESW07436.1| hypothetical protein PHAVU_010G129900g [Phaseolus vulgaris]
Length=209

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL    GPAG+PC   A VT  DFVF+GL+ A N TNII AAV+
Sbjct  26   ADLKSADGPAGFPCVPPAKVTSDDFVFAGLSEAANVTNIINAAVS  70



>ref|XP_003627289.1| Germin-like protein [Medicago truncatula]
 gb|AET01765.1| auxin-binding protein ABP19a [Medicago truncatula]
Length=212

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNT-TNIIKAAVT  1
            ADLS P  P+GYPCK   +VT  DFVFSGL  A NT TN  K A T
Sbjct  29   ADLSFPDTPSGYPCKSENNVTADDFVFSGLNIAANTSTNSFKVAFT  74



>ref|XP_004288978.1| PREDICTED: auxin-binding protein ABP19a-like [Fragaria vesca 
subsp. vesca]
Length=213

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P  PAGY CK+  +VTV DFV+S L  AGNT+ I + A+T
Sbjct  26   ADYTAPSSPAGYSCKRPENVTVDDFVYSSLGVAGNTSTITRDAIT  70



>ref|XP_006390643.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
 gb|ESQ27929.1| hypothetical protein EUTSA_v10019138mg [Eutrema salsugineum]
Length=208

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V   DFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKKAETPAGYPCIRPIHVKAKDFVFSGLGTPGNTTNIINAAVT  69



>ref|XP_002521328.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF40996.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=207

 Score = 53.1 bits (126),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            P+GY C+  A VT  DFVFSGL  +GNTTNII AAVT
Sbjct  32   PSGYACRNPALVTADDFVFSGLGTSGNTTNIISAAVT  68



>sp|P45853.1|GLP1_IPONI RecName: Full=Germin-like protein; Flags: Precursor [Ipomoea 
nil]
 dbj|BAA08266.1| germin-like protein precursor [Ipomoea nil]
Length=214

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            P+G+ CK +A VT +DFV+SGLA  GNTTNII AAVT
Sbjct  39   PSGFVCKNTAKVTAADFVYSGLAKPGNTTNIINAAVT  75



>ref|XP_010672291.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=211

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GPAGY CK   +VTV+DFV S L    NT NI K++ T
Sbjct  30   DLSLPSGPAGYSCKDPTTVTVNDFVSSNLRVPRNTENIFKSSAT  73



>ref|XP_002516286.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
 gb|EEF46288.1| Auxin-binding protein ABP19a precursor, putative [Ricinus communis]
Length=208

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             DLS P GPAGY CKK+  VTV+DFV+SGLAA G    +IKA VT
Sbjct  26   GDLSGPDGPAGYGCKKT--VTVNDFVYSGLAAPGKILPLIKAGVT  68



>ref|XP_006604971.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
3 member 1-like [Glycine max]
Length=178

 Score = 52.4 bits (124),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = -3

Query  111  PAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            PAGYPCK  A+ T  DFV++GLA A N TNII AA+T
Sbjct  16   PAGYPCKPPANTTXDDFVYTGLAEAANVTNIINAAMT  52



>ref|XP_010666278.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
 emb|CAK22420.1| germin-like protein [Beta vulgaris]
Length=211

 Score = 52.8 bits (125),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTT  25
            AD + P GPAGYPCK  A++T  DFVFSGL  A N+T
Sbjct  28   ADFNFPVGPAGYPCKNPATLTADDFVFSGLGVAANST  64



>gb|ABK25578.1| unknown [Picea sitchensis]
Length=213

 Score = 52.8 bits (125),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    P+GYPCK ++S+T   FVF+GL AAGN +N I AAVT
Sbjct  30   ADLSSELTPSGYPCKAASSLTSDSFVFTGLEAAGNVSNNIGAAVT  74



>ref|XP_003627273.1| Germin-like protein [Medicago truncatula]
 gb|AET01749.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK45666.1| unknown [Medicago truncatula]
Length=208

 Score = 52.4 bits (124),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD+     P+GYPCK +++VT  DF F GL A GN TNII AAVT
Sbjct  25   ADIKGSDTPSGYPCKPASTVTSDDFAFEGLIAPGNITNIINAAVT  69



>ref|XP_006302822.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
 gb|EOA35720.1| hypothetical protein CARUB_v10020953mg [Capsella rubella]
Length=208

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGY C +   V  SDFVFSGL   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYQCIRPMHVKASDFVFSGLGTPGNTTNIISAAVT  69



>gb|KFK41682.1| hypothetical protein AALP_AA2G159300 [Arabis alpina]
Length=208

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGY C +   V   DFVFSGL  AGNTTNII AAVT
Sbjct  25   ANLKRGETPAGYQCIRPIHVKSKDFVFSGLGTAGNTTNIINAAVT  69



>emb|CAA75907.1| Germin-like protein 1 [Hordeum vulgare subsp. vulgare]
Length=212

 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    PAGYPCK    V   DF + GLAAAGNT+N+IKA VT
Sbjct  30   ADLSCSDTPAGYPCKTG--VGAGDFYYHGLAAAGNTSNLIKAVVT  72



>ref|XP_010666313.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 52.4 bits (124),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CK  A++T  DFV++G      TTNI +  VT
Sbjct  28   DLSLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVT  71



>ref|XP_010688041.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score = 51.6 bits (122),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIK  13
            DLS P GP+GY CK    VT+ DFV++GL+   NTTN+ K
Sbjct  28   DLSRPSGPSGYTCKDPVKVTIDDFVYTGLSVKPNTTNVFK  67



>gb|ACA03782.1| putative auxin-binding protein 3 [Prunus salicina]
Length=64

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAG  34
            ADL+ P GPAG+ CKK ASV V+DFVFSGL  AG
Sbjct  31   ADLAAPEGPAGFSCKKPASVKVNDFVFSGLGIAG  64



>ref|XP_006837025.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
 gb|ERM99878.1| hypothetical protein AMTR_s00110p00020470 [Amborella trichopoda]
Length=210

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD SLP   +G+PCK  +++T  DF +SGLA  GNT+N IKA VT
Sbjct  27   ADTSLPQTFSGFPCKNPSNLTADDFSYSGLANPGNTSNTIKATVT  71



>gb|AAO92740.1| auxin binding protein [Gossypium hirsutum]
Length=206

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSG-LAAAGNTTNIIKAAVT  1
             DL+ P GPAGY CKK+A  T  DF FSG L  AGNT+N++KAA+T
Sbjct  24   GDLNGPVGPAGYSCKKTA--TEDDFSFSGLLRTAGNTSNLVKAAIT  67



>gb|AAF21988.2|AF116537_1 fiber protein GLP1 [Gossypium hirsutum]
Length=206

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSG-LAAAGNTTNIIKAAVT  1
             DL+ P GPAGY CKK+A  T  DF FSG L  AGNT+N++KAA+T
Sbjct  24   GDLNGPVGPAGYSCKKTA--TEDDFSFSGLLRTAGNTSNLVKAAIT  67



>ref|XP_011078074.1| PREDICTED: auxin-binding protein ABP19a-like [Sesamum indicum]
Length=210

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLSLP GP GY CK  ASVT +DF + GLA  G+T N   A V+
Sbjct  26   ADLSLPAGPTGYSCKTPASVTENDFFYHGLATPGSTNNRAGAGVS  70



>emb|CDX82141.1| BnaC02g21490D [Brassica napus]
Length=221

 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL     PAGYPC     V   DFVFSGL   GNT NII AAVT
Sbjct  91   ADLKRAETPAGYPCICPIHVKAKDFVFSGLGTPGNTNNIISAAVT  135



>ref|XP_003632366.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
Length=209

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            AD + P GP GY C+  A VT  DFV+SGL   GNT++I  A+V
Sbjct  26   ADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASV  69



>ref|XP_010687565.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=242

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            DL+LP GP+G+ CK    VT  DFV+SG+  A NT+N+ K  +
Sbjct  55   DLNLPSGPSGFSCKDPTKVTADDFVYSGMRVASNTSNLFKFGI  97



>ref|XP_002264949.1| PREDICTED: auxin-binding protein ABP19a [Vitis vinifera]
 ref|XP_003632367.1| PREDICTED: auxin-binding protein ABP19a-like [Vitis vinifera]
 emb|CBI37285.3| unnamed protein product [Vitis vinifera]
 emb|CBI37287.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAV  4
            AD + P GP GY C+  A VT  DFV+SGL   GNT++I  A++
Sbjct  26   ADFTAPQGPTGYSCRTPAEVTADDFVYSGLRQPGNTSSIFNASI  69



>ref|XP_007135441.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
 gb|ESW07435.1| hypothetical protein PHAVU_010G129800g [Phaseolus vulgaris]
Length=208

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L+ P GP+GY CK   +VTV DFVFSG   AGNT+ I  AA+T
Sbjct  27   ANLNGPDGPSGYECKAPNTVTVDDFVFSGF-VAGNTSGIFNAAIT  70



>gb|KHN01412.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSG   AGNTTN   AA+T
Sbjct  25   ADLKGPDSPSGYQCKPPNTVTVDDFVFSGF-VAGNTTNTFNAALT  68



>gb|KHN01409.1| Auxin-binding protein ABP19a [Glycine soja]
Length=206

 Score = 50.8 bits (120),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSG   AGNTTN   AA+T
Sbjct  25   ADLKGPDSPSGYQCKPPNTVTVDDFVFSGF-VAGNTTNTFNAALT  68



>ref|NP_001240182.1| auxin-binding protein ABP19a-like precursor [Glycine max]
 gb|ACG69485.1| germin-like protein 9 [Glycine max]
 gb|KHN01408.1| Auxin-binding protein ABP19a [Glycine soja]
Length=208

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSG   AGNTTN   AA+T
Sbjct  27   ADLKGPDSPSGYQCKPPNTVTVDDFVFSGF-VAGNTTNTFNAALT  70



>ref|NP_001236898.1| uncharacterized protein LOC100527498 precursor [Glycine max]
 gb|ACU16594.1| unknown [Glycine max]
Length=208

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSG   AGNTTN   AA+T
Sbjct  27   ADLKGPDSPSGYQCKPPNTVTVDDFVFSGF-VAGNTTNTFNAALT  70



>gb|EMS51159.1| Germin-like protein 8-14 [Triticum urartu]
Length=213

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 31/45 (69%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAG PCKK   V   DF + GLA AGNT N+IKAAVT
Sbjct  31   ADLACPDTPAGDPCKKG--VGPGDFYYHGLATAGNTNNLIKAAVT  73



>ref|XP_010666297.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             DLSLP GP GY CK  A+VT  DFV++G      TTNI +  VT
Sbjct  27   GDLSLPRGPQGYACKNPATVTTDDFVYTGFRGEKATTNIFRNNVT  71



>ref|XP_003528531.2| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=225

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P  P+GY CK   +VTV DFVFSG   AGNTTN   AA+T
Sbjct  44   ADLKGPDSPSGYQCKPPNTVTVDDFVFSGF-VAGNTTNTFNAALT  87



>ref|XP_003604394.1| Germin-like protein [Medicago truncatula]
 gb|AES86591.1| auxin-binding protein ABP19a [Medicago truncatula]
 gb|AFK34763.1| unknown [Medicago truncatula]
Length=205

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL LP  P+GYPCK   +VTV+DFVFSGL   G+T N    A+T
Sbjct  25   ADLLLPNTPSGYPCKSETNVTVNDFVFSGL-VPGSTINPFNFAIT  68



>ref|XP_004303796.1| PREDICTED: auxin-binding protein ABP19a-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=208

 Score = 50.1 bits (118),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            AD + P  PAGY CK    VTV DFVFSGL  AGN ++I K  ++
Sbjct  26   ADYAAPQSPAGYACKDPVKVTVDDFVFSGLRVAGNISSINKIGLS  70



>gb|ACA03783.1| putative auxin-binding protein 2 [Prunus salicina]
Length=59

 Score = 47.8 bits (112),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAG  34
            AD   P GPAGY CKK A VTV+DFV+SGL  AG
Sbjct  26   ADYKAPDGPAGYSCKKPAKVTVNDFVYSGLGIAG  59



>ref|XP_002989518.1| hypothetical protein SELMODRAFT_235813 [Selaginella moellendorffii]
 gb|EFJ09394.1| hypothetical protein SELMODRAFT_235813 [Selaginella moellendorffii]
Length=215

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS  P   G+PC+ ++ VTV DF++SGL  + NTTNI +A  T
Sbjct  34   DLSARPSINGFPCRNASLVTVDDFIYSGLVNSSNTTNIDRAGAT  77



>ref|XP_002964624.1| hypothetical protein SELMODRAFT_81894 [Selaginella moellendorffii]
 gb|EFJ34957.1| hypothetical protein SELMODRAFT_81894 [Selaginella moellendorffii]
Length=215

 Score = 49.3 bits (116),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLS  P   G+PC+ ++ VTV DF++SGL  + NTTNI +A  T
Sbjct  34   DLSARPSINGFPCRNASLVTVDDFIYSGLVNSSNTTNIDRAGAT  77



>ref|XP_010666281.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score = 49.3 bits (116),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            D SLP GP GY CK  A++T  DFV++G      TTNI +  VT
Sbjct  38   DPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVT  81



>ref|XP_002979113.1| hypothetical protein SELMODRAFT_109813 [Selaginella moellendorffii]
 gb|EFJ20070.1| hypothetical protein SELMODRAFT_109813 [Selaginella moellendorffii]
Length=217

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_010666282.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=218

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            D SLP GP GY CK  A++T  DFV++G      TTNI +  VT
Sbjct  38   DPSLPRGPQGYACKNPATITTDDFVYTGFRGERTTTNIFRNNVT  81



>ref|XP_006595343.1| PREDICTED: auxin-binding protein ABP19a-like [Glycine max]
Length=179

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  102  YPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            + CKK A VT  DF +SGL  AGNT+NIIKAAVT
Sbjct  9    HSCKKPAKVTADDFAYSGLGIAGNTSNIIKAAVT  42



>gb|ABK22930.1| unknown [Picea sitchensis]
Length=213

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    P+GYPCK ++S+    FVF+GL  AGN +N I AAVT
Sbjct  30   ADLSSELTPSGYPCKPASSLNSDSFVFTGLETAGNVSNNIGAAVT  74



>ref|XP_002978994.1| hypothetical protein SELMODRAFT_418837 [Selaginella moellendorffii]
 gb|EFJ19951.1| hypothetical protein SELMODRAFT_418837 [Selaginella moellendorffii]
Length=184

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKA  10
            D ++ PG  G+PC+ +++VTV DF++SG+  + NTTNI ++
Sbjct  36   DFNVVPGINGFPCRNTSTVTVDDFIYSGIVNSSNTTNINRS  76



>ref|XP_010666311.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             DL+LP GP GY CK  A++T  DFV++G      TTNI +  VT
Sbjct  27   GDLTLPRGPEGYACKNPATITTDDFVYTGFRGEKATTNIFRNNVT  71



>ref|XP_010670843.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP GY CK  + +T  DFV++G      T+N+ +  VT
Sbjct  28   DLSLPRGPEGYACKDPSDITTDDFVYTGFRGERTTSNLFRNNVT  71



>gb|ABK23834.1| unknown [Picea sitchensis]
Length=208

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADLS    P+GYPCK ++S+    FVF+GL  AGN +N I AAVT
Sbjct  30   ADLSSELTPSGYPCKPASSLNSDSFVFTGLETAGNVSNNIGAAVT  74



>gb|EYU42507.1| hypothetical protein MIMGU_mgv1a019482mg [Erythranthe guttata]
Length=230

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTN  22
            ADL  PP   GYPCK + +VT  DF F GL+  GNTTN
Sbjct  38   ADLKSPPSINGYPCKPTVNVTSDDFFFDGLSKEGNTTN  75



>emb|CDY11164.1| BnaC06g24160D [Brassica napus]
Length=207

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V V DFVFS L   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKVKDFVFS-LGTPGNTTNIISAAVT  68



>ref|XP_011028673.1| PREDICTED: germin-like protein subfamily T member 2 [Populus 
euphratica]
Length=220

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P    G+PCK  A VT  DF F GL+  GNTTNI   +VT
Sbjct  37   ADLKAPLSVNGFPCKPEAKVTSDDFFFDGLSKEGNTTNIFGWSVT  81



>ref|XP_002322136.2| hypothetical protein POPTR_0015s07940g [Populus trichocarpa]
 gb|EEF06263.2| hypothetical protein POPTR_0015s07940g [Populus trichocarpa]
Length=220

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P    G+PCK  A VT  DF F GL+  GNTTNI   +VT
Sbjct  37   ADLKAPLSVNGFPCKPEAKVTSDDFFFDGLSKEGNTTNIFGWSVT  81



>ref|XP_002986434.1| hypothetical protein SELMODRAFT_123878 [Selaginella moellendorffii]
 gb|EFJ12643.1| hypothetical protein SELMODRAFT_123878 [Selaginella moellendorffii]
Length=217

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002986338.1| hypothetical protein SELMODRAFT_123774 [Selaginella moellendorffii]
 gb|EFJ12547.1| hypothetical protein SELMODRAFT_123774 [Selaginella moellendorffii]
Length=217

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002986337.1| hypothetical protein SELMODRAFT_123769 [Selaginella moellendorffii]
 gb|EFJ12546.1| hypothetical protein SELMODRAFT_123769 [Selaginella moellendorffii]
Length=217

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002979115.1| hypothetical protein SELMODRAFT_109970 [Selaginella moellendorffii]
 gb|EFJ20072.1| hypothetical protein SELMODRAFT_109970 [Selaginella moellendorffii]
Length=217

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSAVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002986439.1| hypothetical protein SELMODRAFT_123791 [Selaginella moellendorffii]
 gb|EFJ12648.1| hypothetical protein SELMODRAFT_123791 [Selaginella moellendorffii]
Length=217

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNSSAVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_010666312.1| PREDICTED: germin-like protein [Beta vulgaris subsp. vulgaris]
Length=166

 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP  Y CK  A+VT  DFV+ G      TTNI +  VT
Sbjct  28   DLSLPRGPQEYACKNPATVTTYDFVYIGFRGEKVTTNIFRNNVT  71



>ref|XP_010666316.1| PREDICTED: auxin-binding protein ABP19b-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 26/44 (59%), Gaps = 0/44 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            DLSLP GP  Y CK   ++T  DFV++G      TTNI +  VT
Sbjct  28   DLSLPRGPQAYTCKNPTTITTDDFVYTGFRGEKATTNIFRNNVT  71



>emb|CDX96421.1| BnaA07g30320D [Brassica napus]
Length=217

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFS L   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVT  68



>emb|CDX72929.1| BnaC06g33770D [Brassica napus]
Length=217

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFS L   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVT  68



>ref|XP_010537615.1| PREDICTED: germin-like protein subfamily 3 member 1 [Tarenaya 
hassleriana]
Length=208

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     P+GYPC +  +V  +DFVF+GL+  GNT++II AAVT
Sbjct  25   ANLKHADTPSGYPCIRPINVKATDFVFTGLSTPGNTSSIINAAVT  69



>ref|XP_009105920.1| PREDICTED: germin-like protein 1 [Brassica rapa]
 gb|AAX35339.1| oxalic acid oxidase [Brassica napus]
Length=207

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFS L   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVT  68



>sp|P46271.1|GLP1_BRANA RecName: Full=Germin-like protein 1; Flags: Precursor [Brassica 
napus]
 gb|AAA86365.1| germin-like protein [Brassica napus]
Length=207

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            A+L     PAGYPC +   V  SDFVFS L   GNTTNII AAVT
Sbjct  25   ANLKRAETPAGYPCIRPIHVKASDFVFS-LGTPGNTTNIISAAVT  68



>gb|AES68967.2| germin family 3 protein [Medicago truncatula]
Length=209

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 1/45 (2%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL  P   +GYPCK  AS+T  DFVF GL  AGNT+N  K  VT
Sbjct  28   ADLKAPNTNSGYPCKPVASITSDDFVFHGL-VAGNTSNSFKIGVT  71



>ref|XP_002981347.1| hypothetical protein SELMODRAFT_114518 [Selaginella moellendorffii]
 gb|EFJ17535.1| hypothetical protein SELMODRAFT_114518 [Selaginella moellendorffii]
Length=217

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKA  10
            DL+  PG  G+PC  S++VTV DF++SG+  + NTTNI ++
Sbjct  36   DLTAVPGVNGFPCTNSSTVTVDDFIYSGIVNSSNTTNINRS  76



>ref|XP_002969738.1| hypothetical protein SELMODRAFT_92738 [Selaginella moellendorffii]
 gb|EFJ28862.1| hypothetical protein SELMODRAFT_92738 [Selaginella moellendorffii]
Length=217

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  132  DLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKA  10
            DL+  PG  G+PC  S++VTV DF++SG+  + NTTNI ++
Sbjct  36   DLTAVPGVNGFPCTNSSTVTVDDFIYSGIVNSSNTTNINRS  76



>ref|XP_002986433.1| hypothetical protein SELMODRAFT_123956 [Selaginella moellendorffii]
 gb|EFJ12642.1| hypothetical protein SELMODRAFT_123956 [Selaginella moellendorffii]
Length=217

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC  S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNIVPGINGFPCTNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002981346.1| hypothetical protein SELMODRAFT_114245 [Selaginella moellendorffii]
 gb|EFJ17534.1| hypothetical protein SELMODRAFT_114245 [Selaginella moellendorffii]
Length=217

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DLS+ PG  G+PC+  ++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLSVVPGINGFPCRNPSTVTVDDFIYSGIVNSSNTTNINRSG  77



>gb|EMT24696.1| hypothetical protein F775_52705 [Aegilops tauschii]
Length=210

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 29/45 (64%), Gaps = 2/45 (4%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
            ADL+ P  PAG PCKK   V   D    GLA AGNT N+IKAAVT
Sbjct  30   ADLACPDTPAGDPCKKG--VGQGDLYHHGLATAGNTNNLIKAAVT  72



>ref|XP_002962817.1| hypothetical protein SELMODRAFT_78485 [Selaginella moellendorffii]
 gb|EFJ36280.1| hypothetical protein SELMODRAFT_78485 [Selaginella moellendorffii]
Length=217

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 19/43 (44%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC+ +++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNVVPGINGFPCRNASAVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_010670845.1| PREDICTED: auxin-binding protein ABP19a-like [Beta vulgaris subsp. 
vulgaris]
Length=208

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAAVT  1
             DLSLP GP GY CK  A++T  DFV++G      T+NI +  VT
Sbjct  27   GDLSLPRGPQGYACKDPANITTDDFVYTGFRGERTTSNIFRNNVT  71



>ref|XP_002979117.1| hypothetical protein SELMODRAFT_109767 [Selaginella moellendorffii]
 gb|EFJ20074.1| hypothetical protein SELMODRAFT_109767 [Selaginella moellendorffii]
Length=217

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC  S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNIVPGINGFPCTNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_002978995.1| hypothetical protein SELMODRAFT_109968 [Selaginella moellendorffii]
 gb|EFJ19952.1| hypothetical protein SELMODRAFT_109968 [Selaginella moellendorffii]
Length=217

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
             DL++ PG  G+PC  S++VTV DF++SG+  + NTTNI ++ 
Sbjct  35   GDLNIVPGINGFPCTNSSTVTVDDFIYSGIVNSSNTTNINRSG  77



>ref|XP_008786633.1| PREDICTED: germin-like protein 8-14 [Phoenix dactylifera]
Length=205

 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -3

Query  135  ADLSLPPGPAGYPCKKSASVTVSDFVFSGLAAAGNTTNIIKAA  7
            ADL+ P  P+GY CKK ++VT  DFV +GL   GN + + KAA
Sbjct  22   ADLTGPETPSGYQCKKESAVTADDFVITGLGVPGNFSTMFKAA  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510661775884