BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81851_g1_i1 len=906 path=[1:0-905]

Length=906
                                                                      Score     E

emb|CDP02096.1|  unnamed protein product                                269   1e-86   
gb|AGI60280.1|  transcription factor MYB305                             265   1e-84   
ref|XP_009618404.1|  PREDICTED: myb-related protein 305-like            264   2e-84   
ref|XP_011097428.1|  PREDICTED: myb-related protein 305                 264   2e-84   
dbj|BAF96932.1|  R2R3-MYB transcriptional factor                        264   3e-84   Gentiana triflora
gb|ABU97106.1|  MYB305 protein v2                                       263   5e-84   Nicotiana langsdorffii x Nicotiana sanderae
gb|ABU97107.1|  MYB305 protein v1                                       263   5e-84   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004233330.1|  PREDICTED: myb-related protein 305-like            261   2e-83   
gb|ADT82939.1|  non-opening 1                                           261   3e-83   
ref|XP_006357153.1|  PREDICTED: myb-related protein 305-like            261   3e-83   
ref|XP_009791355.1|  PREDICTED: myb-related protein 305-like            260   7e-83   
ref|XP_008341440.1|  PREDICTED: myb-related protein 305-like            258   4e-82   
emb|CAN77103.1|  hypothetical protein VITISV_018445                     257   7e-82   Vitis vinifera
emb|CAD87008.1|  MYB8 protein                                           257   7e-82   Gerbera hybrid cultivar
ref|XP_004304632.1|  PREDICTED: myb-related protein 305-like            256   2e-81   
ref|XP_009375123.1|  PREDICTED: myb-related protein 305-like            255   7e-81   
gb|AGN52062.1|  MYB-related transcription factor                        255   7e-81   
ref|XP_009334094.1|  PREDICTED: myb-related protein 305-like            254   8e-81   
gb|ACB12237.1|  MYB-like protein NON1                                   254   1e-80   
ref|XP_007217766.1|  hypothetical protein PRUPE_ppa011751mg             254   1e-80   
ref|XP_008230585.1|  PREDICTED: myb-related protein 305-like            255   1e-80   
ref|NP_001268062.1|  R2R3 Myb24 transcription factor                    254   1e-80   
gb|AGN52197.1|  MYB-related transcription factor                        254   1e-80   
gb|AGN52087.1|  MYB-related transcription factor                        253   2e-80   
gb|AGC00814.1|  EOBI                                                    253   6e-80   
sp|P81391.1|MYB05_ANTMA  RecName: Full=Myb-related protein 305          253   7e-80   Antirrhinum majus [garden snapdragon]
ref|XP_009613846.1|  PREDICTED: myb-related protein 305-like            252   7e-80   
ref|NP_001235699.1|  uncharacterized protein LOC100305972               251   2e-79   
ref|NP_001235850.1|  MYB transcription factor MYB181                    251   3e-79   
gb|AFJ21697.1|  MYB24                                                   251   5e-79   
ref|XP_007031495.1|  Myb domain protein 21                              250   5e-79   
ref|XP_007151019.1|  hypothetical protein PHAVU_004G012000g             251   7e-79   
gb|AGC00813.1|  EOBI                                                    250   8e-79   
ref|XP_010033288.1|  PREDICTED: myb-related protein 305                 249   9e-79   
ref|XP_010528247.1|  PREDICTED: transcription factor MYB21              249   1e-78   
gb|KDP46431.1|  hypothetical protein JCGZ_10271                         248   2e-78   
gb|KEH24806.1|  myb transcription factor                                249   3e-78   
ref|XP_003553814.1|  PREDICTED: myb-related protein 305                 248   3e-78   
ref|XP_004489258.1|  PREDICTED: myb-related protein 305-like            248   3e-78   
ref|XP_006338574.1|  PREDICTED: myb-related protein 340-like            247   1e-77   
ref|XP_004232307.1|  PREDICTED: myb-related protein 340                 246   2e-77   
ref|NP_001235879.1|  MYB transcription factor MYB182                    246   4e-77   
ref|XP_008443525.1|  PREDICTED: myb-related protein 305                 246   6e-77   
ref|XP_007140962.1|  hypothetical protein PHAVU_008G155700g             244   1e-76   
dbj|BAF96931.1|  R2R3-MYB transcriptional factor                        244   1e-76   Gentiana triflora
gb|KEH22251.1|  myb transcription factor                                244   2e-76   
emb|CAA71992.1|  Myb26                                                  244   4e-76   Pisum sativum [garden pea]
ref|XP_009783970.1|  PREDICTED: myb-related protein 340-like            241   1e-75   
gb|EYU44761.1|  hypothetical protein MIMGU_mgv1a013642mg                242   1e-75   
ref|XP_006292470.1|  hypothetical protein CARUB_v10018700mg             242   2e-75   
ref|XP_010425556.1|  PREDICTED: transcription factor MYB21 isofor...    242   2e-75   
sp|P81396.1|MYB40_ANTMA  RecName: Full=Myb-related protein 340          241   3e-75   Antirrhinum majus [garden snapdragon]
ref|XP_010502785.1|  PREDICTED: transcription factor MYB21-like         241   3e-75   
ref|XP_010425557.1|  PREDICTED: transcription factor MYB21 isofor...    241   4e-75   
ref|XP_004141095.1|  PREDICTED: myb-related protein 305-like            241   4e-75   
ref|XP_010514490.1|  PREDICTED: transcription factor MYB21-like         241   5e-75   
ref|XP_002875402.1|  ATMYB21                                            241   5e-75   
ref|XP_006470308.1|  PREDICTED: myb-related protein 305-like isof...    239   9e-75   
gb|KDO66125.1|  hypothetical protein CISIN_1g045384mg                   239   1e-74   
ref|XP_006446527.1|  hypothetical protein CICLE_v10016820mg             239   1e-74   
ref|XP_011005145.1|  PREDICTED: myb-related protein 305 isoform X2      238   2e-74   
ref|NP_189418.2|  transcription factor MYB21                            239   4e-74   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20022.1|  Myb-related protein                                     238   5e-74   
ref|XP_004516766.1|  PREDICTED: myb-related protein 305-like isof...    238   8e-74   
ref|NP_001235865.1|  MYB transcription factor MYB98                     237   9e-74   
gb|EPS65034.1|  hypothetical protein M569_09745                         237   9e-74   
ref|NP_001238263.1|  uncharacterized protein LOC100306400               237   1e-73   
ref|XP_009111584.1|  PREDICTED: transcription factor MYB21              237   2e-73   
ref|XP_007140964.1|  hypothetical protein PHAVU_008G155900g             236   2e-73   
gb|ABH02872.1|  MYB transcription factor MYB99                          236   2e-73   Glycine max [soybeans]
ref|XP_002298534.1|  Myb26 family protein                               236   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_004142797.1|  PREDICTED: myb-related protein 305-like            235   5e-73   
emb|CDX86471.1|  BnaA06g31880D                                          236   5e-73   
ref|XP_011013637.1|  PREDICTED: myb-related protein 305-like isof...    234   5e-73   
emb|CDY44433.1|  BnaC07g24710D                                          236   7e-73   
ref|XP_011013294.1|  PREDICTED: myb-related protein 305-like isof...    234   7e-73   
gb|AET25524.1|  MYB1                                                    235   1e-72   
ref|XP_009151925.1|  PREDICTED: transcription factor MYB21              235   1e-72   
ref|XP_008458780.1|  PREDICTED: myb-related protein 340-like            234   1e-72   
ref|XP_010108787.1|  Myb-related protein 305                            234   2e-72   
ref|XP_002323803.1|  Myb26 family protein                               233   2e-72   Populus trichocarpa [western balsam poplar]
dbj|BAA21618.1|  ATMYB3                                                 234   2e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDY20036.1|  BnaA09g02150D                                          234   2e-72   
ref|XP_006395401.1|  hypothetical protein EUTSA_v10004857mg             234   3e-72   
gb|ACL81164.1|  MYB transcription factor                                232   1e-71   Mirabilis jalapa
ref|XP_004156725.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    231   2e-71   
ref|XP_010555954.1|  PREDICTED: transcription factor MYB21-like         231   2e-71   
ref|XP_010555957.1|  PREDICTED: transcription factor MYB21-like         229   9e-71   
gb|KFK33688.1|  hypothetical protein AALP_AA5G046900                    230   1e-70   
ref|XP_010554050.1|  PREDICTED: transcription factor MYB21-like         229   2e-70   
gb|AAM63674.1|  putative transcription factor MYB24                     228   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198851.1|  myb domain protein 24                                 228   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|ACR15115.1|  MYBF1                                                   228   3e-70   
ref|XP_011005144.1|  PREDICTED: myb-related protein 305 isoform X1      228   4e-70   
ref|XP_008812482.1|  PREDICTED: myb-related protein 305-like            227   7e-70   
ref|XP_006405505.1|  hypothetical protein EUTSA_v10027930mg             227   8e-70   
ref|XP_010677862.1|  PREDICTED: myb-related protein 305-like            228   9e-70   
ref|XP_008800726.1|  PREDICTED: myb-related protein 305-like            227   1e-69   
ref|XP_010925788.1|  PREDICTED: myb-related protein 305-like            225   3e-69   
gb|AEE37094.1|  MYB transcription factor                                225   4e-69   
gb|KHN27441.1|  Myb-related protein 305                                 224   6e-69   
ref|XP_010924268.1|  PREDICTED: myb-related protein 305-like            224   9e-69   
ref|XP_010925776.1|  PREDICTED: myb-related protein 305-like            223   2e-68   
dbj|BAB40790.1|  LhMyb                                                  222   3e-68   Lilium hybrid division I
ref|XP_004516765.1|  PREDICTED: myb-related protein 305-like isof...    225   3e-68   
ref|XP_010435910.1|  PREDICTED: transcription factor MYB24-like         223   4e-68   
gb|ACB59076.2|  Myb-like transcription factor EOBI                      218   9e-68   
ref|XP_006285780.1|  hypothetical protein CARUB_v10007254mg             221   2e-67   
gb|KHN27530.1|  Myb-related protein 305                                 219   5e-67   
gb|KHN23525.1|  Transcription factor MYB21                              219   5e-67   
ref|XP_010251229.1|  PREDICTED: myb-related protein 340-like            219   6e-67   
ref|XP_011013638.1|  PREDICTED: myb-related protein 305-like isof...    218   8e-67   
ref|XP_011013295.1|  PREDICTED: myb-related protein 305-like isof...    218   9e-67   
emb|CDY49063.1|  BnaC05g48910D                                          218   3e-66   
ref|XP_009419837.1|  PREDICTED: myb-related protein 305-like            217   4e-66   
dbj|BAL41446.1|  transcription factor MYB21                             217   8e-66   
gb|AGO33165.1|  MYB transcription factor                                216   1e-65   
ref|XP_009416734.1|  PREDICTED: myb-related protein 305-like            216   1e-65   
ref|XP_010029159.1|  PREDICTED: myb-related protein 340-like            216   1e-65   
gb|KFK37619.1|  hypothetical protein AALP_AA3G006700                    215   3e-65   
ref|XP_010441167.1|  PREDICTED: transcription factor MYB24-like         214   5e-65   
ref|XP_002882176.1|  predicted protein                                  214   9e-65   
ref|XP_010450678.1|  PREDICTED: transcription factor MYB24-like         214   9e-65   
ref|XP_010496298.1|  PREDICTED: transcription factor MYB57-like         213   2e-64   
emb|CDY37512.1|  BnaA05g33770D                                          213   2e-64   
ref|XP_006841613.1|  hypothetical protein AMTR_s00003p00219710          215   2e-64   
ref|XP_010485409.1|  PREDICTED: transcription factor MYB57-like         213   2e-64   
ref|NP_186802.1|  myb domain protein 57                                 211   1e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDX91944.1|  BnaC03g32460D                                          210   3e-63   
ref|XP_009147443.1|  PREDICTED: transcription factor MYB57-like         210   3e-63   
gb|AAM67076.1|  putative transcription factor                           210   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435630.1|  PREDICTED: transcription factor MYB57              209   4e-63   
ref|XP_009406298.1|  PREDICTED: myb-related protein 305-like            209   5e-63   
ref|XP_006300020.1|  hypothetical protein CARUB_v10016245mg             208   1e-62   
ref|XP_009134610.1|  PREDICTED: transcription factor MYB57-like         209   1e-62   
gb|AAL84762.1|AF474129_1  typical P-type R2R3 Myb protein               204   1e-61   Sorghum bicolor [broomcorn]
ref|XP_006649985.1|  PREDICTED: myb-related protein MYBAS1-like         209   2e-61   
ref|XP_004984581.1|  PREDICTED: myb-related protein P-like              209   2e-61   
ref|XP_009402050.1|  PREDICTED: transcription factor MYB108-like        206   3e-61   
ref|XP_008781174.1|  PREDICTED: transcription factor MYB108             207   4e-61   
ref|XP_008793362.1|  PREDICTED: transcription factor MYB108-like        207   4e-61   
ref|NP_001049937.1|  Os03g0315400                                       208   7e-61   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89765.1|  hypothetical protein OsI_11306                          208   8e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_002465358.1|  hypothetical protein SORBIDRAFT_01g037110          208   8e-61   Sorghum bicolor [broomcorn]
ref|XP_004963430.1|  PREDICTED: transcription repressor MYB5-like       207   8e-61   
ref|NP_001140397.1|  putative MYB DNA-binding domain superfamily ...    208   1e-60   Zea mays [maize]
ref|XP_010921398.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    206   1e-60   
ref|XP_010024826.1|  PREDICTED: transcription factor MYB108-like        207   2e-60   
gb|EEE58945.1|  hypothetical protein OsJ_10621                          206   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386341.1|  PREDICTED: transcription factor MYB108-like        205   3e-60   
ref|XP_007223176.1|  hypothetical protein PRUPE_ppa009143mg             204   9e-60   
gb|EMT25040.1|  Transcription factor MYB21                              203   1e-59   
ref|XP_003561685.1|  PREDICTED: myb-related protein P-like              205   1e-59   
ref|XP_009416464.1|  PREDICTED: myb-related protein 305-like            203   1e-59   
gb|KCW61339.1|  hypothetical protein EUGRSUZ_H04082                     207   1e-59   
ref|XP_006488792.1|  PREDICTED: transcription factor MYB108-like        204   2e-59   
gb|KDO72049.1|  hypothetical protein CISIN_1g019911mg                   204   2e-59   
dbj|BAC21351.1|  putative typical P-type R2R3 Myb protein               203   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060700.1|  Os07g0688200                                       203   2e-59   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19253.1|  hypothetical protein OsJ_34790                          199   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385372.1|  PREDICTED: transcription factor MYB108-like        200   3e-59   
ref|XP_006419304.1|  hypothetical protein CICLE_v10005387mg             204   3e-59   
ref|XP_009612140.1|  PREDICTED: transcription factor MYB108-like        202   3e-59   
ref|XP_004239882.1|  PREDICTED: transcription factor MYB108-like        203   3e-59   
ref|XP_009791846.1|  PREDICTED: transcription factor MYB108-like        202   3e-59   
ref|XP_010914654.1|  PREDICTED: transcription factor MYB108-like        202   3e-59   
ref|XP_010938192.1|  PREDICTED: transcription factor MYB108-like        202   4e-59   
ref|XP_009384442.1|  PREDICTED: transcription factor MYB108-like        203   4e-59   
gb|AEV91149.1|  R2R3-MYB protein                                        203   5e-59   
gb|AFW82705.1|  putative MYB DNA-binding domain superfamily protein     204   5e-59   
ref|XP_011027944.1|  PREDICTED: transcription factor MYB108-like        202   5e-59   
gb|AIB05776.1|  MYB transcription factor                                203   6e-59   
ref|XP_009383942.1|  PREDICTED: transcription factor MYB108-like        201   6e-59   
ref|NP_001141891.1|  putative MYB DNA-binding domain superfamily ...    203   6e-59   Zea mays [maize]
gb|EAY83532.1|  hypothetical protein OsI_38744                          202   6e-59   Oryza sativa Indica Group [Indian rice]
gb|ABA98967.1|  Myb-like DNA-binding domain containing protein, e...    202   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392103.1|  PREDICTED: protein ODORANT1-like                   203   7e-59   
ref|XP_009778774.1|  PREDICTED: transcription factor MYB24-like         201   7e-59   
ref|XP_008243255.1|  PREDICTED: transcription factor MYB21              202   7e-59   
gb|ADG56766.1|  putative MYB transcription factor                       201   1e-58   
dbj|BAJ91760.1|  predicted protein                                      201   1e-58   
gb|AAO49418.1|AF485900_1  MYB9                                          196   1e-58   Dendrobium sp. XMW-2002-9
ref|XP_002311369.1|  GmMYB12 family protein                             202   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009387805.1|  PREDICTED: transcription factor MYB57-like         200   1e-58   
ref|XP_009587217.1|  PREDICTED: transcription factor MYB24-like         201   1e-58   
ref|XP_011016230.1|  PREDICTED: transcription factor MYB108-like        201   2e-58   
ref|XP_009415657.1|  PREDICTED: transcription factor MYB108-like        199   2e-58   
gb|EMT01874.1|  Myb-related protein 305                                 201   2e-58   
ref|XP_009411608.1|  PREDICTED: transcription factor MYB108             199   2e-58   
ref|XP_006658986.1|  PREDICTED: transcription factor MYB108-like        196   3e-58   
ref|NP_001068466.2|  Os11g0684000                                       199   3e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004962755.1|  PREDICTED: transcription repressor MYB5-like       200   4e-58   
gb|EAY96442.1|  hypothetical protein OsI_18339                          200   4e-58   Oryza sativa Indica Group [Indian rice]
ref|XP_009390416.1|  PREDICTED: transcription factor MYB57              199   4e-58   
gb|EEE62225.1|  hypothetical protein OsJ_17012                          200   4e-58   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003579302.1|  PREDICTED: transcription factor MYB108-like ...    199   4e-58   
ref|XP_009417759.1|  PREDICTED: transcription factor MYB108-like        199   4e-58   
ref|XP_002440534.1|  hypothetical protein SORBIDRAFT_09g002675          203   5e-58   Sorghum bicolor [broomcorn]
ref|XP_010237154.1|  PREDICTED: transcription factor MYB108-like ...    198   5e-58   
ref|XP_004299054.1|  PREDICTED: transcription factor WER-like           199   5e-58   
ref|XP_008677864.1|  PREDICTED: transcription factor MYB108-like        201   5e-58   
ref|XP_002463415.1|  hypothetical protein SORBIDRAFT_02g043420          198   6e-58   Sorghum bicolor [broomcorn]
ref|XP_002440535.1|  hypothetical protein SORBIDRAFT_09g002680          201   6e-58   Sorghum bicolor [broomcorn]
ref|XP_009392050.1|  PREDICTED: transcription factor MYB108-like        198   6e-58   
emb|CAN76459.1|  hypothetical protein VITISV_010827                     197   7e-58   Vitis vinifera
gb|AFW60134.1|  putative MYB DNA-binding domain superfamily protein     201   7e-58   
ref|XP_003592641.1|  R2R3-MYB transcription factor                      199   8e-58   
ref|XP_006664647.1|  PREDICTED: transcription factor MYB108-like        199   8e-58   
ref|XP_006654961.1|  PREDICTED: transcription factor MYB108-like        198   8e-58   
ref|XP_010941513.1|  PREDICTED: transcription factor MYB108-like        197   9e-58   
tpg|DAA47022.1|  TPA: putative MYB DNA-binding domain superfamily...    200   1e-57   
ref|XP_007044287.1|  Myb domain protein 62, putative                    199   1e-57   
ref|XP_004958743.1|  PREDICTED: myb-related protein 330-like            199   1e-57   
ref|XP_006663109.1|  PREDICTED: transcription factor MYB108-like        198   1e-57   
ref|XP_002316060.2|  hypothetical protein POPTR_0010s15970g             199   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_008662919.1|  PREDICTED: myb-like protein AA                     201   2e-57   
ref|XP_010264231.1|  PREDICTED: transcription factor MYB108-like        199   2e-57   
gb|KDP29432.1|  hypothetical protein JCGZ_18353                         198   2e-57   
gb|AGL81356.1|  R2R3 MYB transcription factor 3                         196   2e-57   
ref|XP_008389270.1|  PREDICTED: myb-related protein 305                 198   2e-57   
ref|XP_009356251.1|  PREDICTED: transcription factor MYB108-like        197   2e-57   
ref|XP_011010946.1|  PREDICTED: transcription factor MYB108-like        198   2e-57   
ref|XP_010045365.1|  PREDICTED: transcription factor MYB108             199   2e-57   
gb|ABU93236.1|  R2R3 Myb-like protein                                   198   2e-57   Triticum aestivum [Canadian hard winter wheat]
gb|KDP27970.1|  hypothetical protein JCGZ_19050                         198   3e-57   
ref|NP_001170329.1|  putative MYB DNA-binding domain superfamily ...    199   3e-57   Zea mays [maize]
ref|XP_007142925.1|  hypothetical protein PHAVU_007G028700g             198   3e-57   
ref|XP_009390937.1|  PREDICTED: myb-related protein 305-like            197   3e-57   
gb|EEC69869.1|  hypothetical protein OsI_00232                          199   3e-57   Oryza sativa Indica Group [Indian rice]
gb|ABC54967.1|  MYB-like protein                                        191   3e-57   Vitis vinifera
gb|AFR67332.1|  R2R3 MYB protein                                        198   3e-57   
ref|XP_003535723.1|  PREDICTED: transcription factor MYB108-like        197   3e-57   
ref|XP_002279433.1|  PREDICTED: transcription factor MYB24              197   3e-57   Vitis vinifera
ref|XP_004497077.1|  PREDICTED: transcription factor MYB21-like         197   4e-57   
gb|EMT04483.1|  Transcription factor MYB21                              197   4e-57   
ref|XP_009382479.1|  PREDICTED: transcription factor MYB108-like        196   4e-57   
emb|CBI27001.3|  unnamed protein product                                197   4e-57   
ref|XP_002451276.1|  hypothetical protein SORBIDRAFT_05g026820          199   5e-57   Sorghum bicolor [broomcorn]
gb|AAL84765.1|AF474132_1  typical P-type R2R3 Myb protein               193   5e-57   Sorghum bicolor [broomcorn]
dbj|BAB18296.1|  putative dehydration-induced myb-related protein...    198   6e-57   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001041908.1|  Os01g0128000                                       198   7e-57   Oryza sativa Japonica Group [Japonica rice]
gb|KHN11407.1|  Transcription factor MYB21                              197   8e-57   
ref|XP_008667098.1|  PREDICTED: putative MYB DNA-binding domain s...    197   8e-57   
ref|XP_010265100.1|  PREDICTED: myb-related protein MYBAS2-like         196   9e-57   
ref|XP_003555909.1|  PREDICTED: transcription factor MYB108-like        196   9e-57   
ref|XP_009356946.1|  PREDICTED: transcription factor MYB21-like         196   9e-57   
ref|XP_002311464.2|  hypothetical protein POPTR_0008s12130g             197   1e-56   Populus trichocarpa [western balsam poplar]
ref|NP_001182983.1|  putative MYB DNA-binding domain superfamily ...    198   1e-56   
ref|XP_006643700.1|  PREDICTED: transcription repressor MYB4-like       197   1e-56   
ref|XP_009398691.1|  PREDICTED: transcription factor MYB108-like        194   1e-56   
ref|NP_001056356.1|  Os05g0568200                                       194   2e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99070.1|  hypothetical protein OsI_21027                          194   2e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_009380293.1|  PREDICTED: myb-related protein P-like              196   2e-56   
gb|ABC54973.1|  MYB-like protein                                        188   3e-56   Vitis vinifera
ref|XP_006655601.1|  PREDICTED: transcription factor MYB21-like         193   3e-56   
gb|KDO86883.1|  hypothetical protein CISIN_1g043269mg                   191   4e-56   
ref|XP_003569075.1|  PREDICTED: protein ODORANT1-like                   195   4e-56   
ref|XP_011022276.1|  PREDICTED: transcription factor MYB108             195   5e-56   
ref|XP_002455261.1|  hypothetical protein SORBIDRAFT_03g007360          197   5e-56   Sorghum bicolor [broomcorn]
ref|XP_009797951.1|  PREDICTED: transcription factor MYB108-like        193   5e-56   
ref|XP_010470777.1|  PREDICTED: myb-related protein 340-like            194   6e-56   
ref|XP_008674336.1|  PREDICTED: myb-related protein 305                 195   6e-56   
ref|XP_010099251.1|  Transcription factor                               195   6e-56   
ref|XP_004239413.2|  PREDICTED: transcription factor MYB108             193   6e-56   
gb|ACP30364.1|  MYB protein                                             194   7e-56   Malus hybrid cultivar
ref|NP_001141174.1|  MYB transcription factor                           196   7e-56   Zea mays [maize]
gb|ABC54957.1|  MYB-like protein                                        187   8e-56   Vitis vinifera
ref|XP_002318546.1|  hypothetical protein POPTR_0012s05200g             194   9e-56   Populus trichocarpa [western balsam poplar]
gb|ABC54990.1|  MYB-like protein                                        187   9e-56   Vitis vinifera
ref|XP_002276526.3|  PREDICTED: transcription factor MYB108             194   1e-55   Vitis vinifera
ref|XP_011045847.1|  PREDICTED: myb-related protein Zm38-like           194   1e-55   
gb|ABC54969.1|  MYB-like protein                                        187   1e-55   Vitis vinifera
emb|CBI15464.3|  unnamed protein product                                194   1e-55   
ref|XP_006407939.1|  hypothetical protein EUTSA_v10021126mg             194   1e-55   
ref|XP_011070788.1|  PREDICTED: transcription factor MYB24              192   1e-55   
gb|AGN52055.1|  MYB-related transcription factor                        192   1e-55   
gb|ADF43752.1|  MYB                                                     193   1e-55   
ref|XP_011007699.1|  PREDICTED: transcription factor MYB24              194   1e-55   
ref|XP_010415449.1|  PREDICTED: myb-related protein 305                 192   2e-55   
ref|XP_002321477.2|  hypothetical protein POPTR_0015s03770g             194   2e-55   
ref|XP_007160381.1|  hypothetical protein PHAVU_002G317000g             193   2e-55   
ref|XP_009413670.1|  PREDICTED: transcription factor MYB108-like        191   2e-55   
gb|EMT33189.1|  Myb-related protein 305                                 192   2e-55   
ref|XP_011011974.1|  PREDICTED: myb-related protein Myb4-like           193   3e-55   
gb|ABC54986.1|  MYB-like protein                                        186   3e-55   
ref|XP_008675301.1|  PREDICTED: myb-related protein 305-like            191   3e-55   
gb|ABC54983.1|  MYB-like protein                                        186   3e-55   
ref|XP_009103061.1|  PREDICTED: transcription factor MYB24-like         192   3e-55   
ref|XP_010551244.1|  PREDICTED: myb-related protein 305-like            192   3e-55   
ref|XP_002887176.1|  hypothetical protein ARALYDRAFT_339072             192   3e-55   
emb|CDP00641.1|  unnamed protein product                                192   3e-55   
ref|XP_002443369.1|  hypothetical protein SORBIDRAFT_08g018370          193   4e-55   
ref|XP_008672180.1|  PREDICTED: putative MYB DNA-binding domain s...    194   4e-55   
ref|XP_004300516.1|  PREDICTED: transcription factor TT2-like           191   4e-55   
ref|XP_008807088.1|  PREDICTED: transcription factor MYB108-like        192   4e-55   
ref|XP_010681493.1|  PREDICTED: transcription factor MYB108 isofo...    192   4e-55   
gb|KFK41242.1|  hypothetical protein AALP_AA2G104300                    191   5e-55   
ref|XP_007036545.1|  Myb domain protein 62, putative                    192   5e-55   
emb|CDY03859.1|  BnaC07g10840D                                          191   5e-55   
ref|XP_010270853.1|  PREDICTED: transcription factor MYB108             192   5e-55   
ref|XP_009394051.1|  PREDICTED: transcription factor MYB108-like        192   5e-55   
ref|XP_010926024.1|  PREDICTED: myb-related protein 305-like isof...    192   5e-55   
gb|ABC54984.1|  MYB-like protein                                        185   5e-55   
ref|NP_001280981.1|  transcription factor MYB21                         192   6e-55   
ref|XP_008797802.1|  PREDICTED: transcription factor MYB108-like        192   6e-55   
ref|XP_006492457.1|  PREDICTED: transcription factor MYB108-like        191   6e-55   
ref|XP_004968076.1|  PREDICTED: myb-related protein P-like              193   6e-55   
ref|XP_006842316.1|  hypothetical protein AMTR_s00079p00140660          191   6e-55   
ref|NP_176999.1|  R2R3-MYB transcription  family                        191   6e-55   
ref|XP_003565287.1|  PREDICTED: transcription factor MYB24-like         191   6e-55   
ref|XP_006444559.1|  hypothetical protein CICLE_v10021479mg             191   7e-55   
emb|CDX84981.1|  BnaC05g20740D                                          191   7e-55   
gb|AGN52122.1|  MYB-related transcription factor                        189   7e-55   
ref|XP_004963592.1|  PREDICTED: transcription factor MYB12-like         192   8e-55   
ref|XP_006344301.1|  PREDICTED: transcription factor MYB48-like         190   8e-55   
ref|NP_564230.1|  putative transcription factor (MYB116)                191   8e-55   
gb|ABC54966.1|  MYB-like protein                                        184   8e-55   
ref|XP_008445685.1|  PREDICTED: transcription factor MYB108-like        190   9e-55   
ref|XP_006301020.1|  hypothetical protein CARUB_v10021411mg             191   9e-55   
ref|XP_009626235.1|  PREDICTED: transcription factor MYB108-like        191   9e-55   
ref|XP_010477945.1|  PREDICTED: transcription factor MYB108-like ...    191   9e-55   
ref|XP_010511820.1|  PREDICTED: transcription factor MYB21-like         191   9e-55   
ref|NP_001042810.1|  Os01g0298400                                       191   9e-55   
emb|CCC14989.1|  Myb transcription factor                               193   1e-54   
ref|NP_001235837.1|  MYB transcription factor MYB184                    190   1e-54   
ref|XP_004979993.1|  PREDICTED: myb-related protein Zm38-like           192   1e-54   
ref|XP_002455504.1|  hypothetical protein SORBIDRAFT_03g012310          191   1e-54   
ref|XP_006391151.1|  hypothetical protein EUTSA_v10018962mg             190   2e-54   
ref|XP_010276490.1|  PREDICTED: transcription factor MYB108-like        190   2e-54   
emb|CDY42115.1|  BnaA09g28450D                                          189   2e-54   
ref|XP_010544950.1|  PREDICTED: transcription factor MYB108-like        189   2e-54   
ref|XP_010094742.1|  Transcription factor                               190   2e-54   
ref|XP_010532345.1|  PREDICTED: myb-related protein 340-like            190   2e-54   
emb|CDP19695.1|  unnamed protein product                                191   2e-54   
ref|XP_006468714.1|  PREDICTED: transcription factor MYB108-like        191   2e-54   
ref|XP_006448450.1|  hypothetical protein CICLE_v10015986mg             190   3e-54   
ref|XP_004160829.1|  PREDICTED: transcription factor MYB3-like          189   3e-54   
ref|XP_007209375.1|  hypothetical protein PRUPE_ppa008877mg             190   3e-54   
gb|AAG51527.1|AC051631_7  myb-related transcription factor (cpm10...    187   3e-54   
ref|XP_008240255.1|  PREDICTED: transcription factor MYB108-like        190   3e-54   
dbj|BAJ99893.1|  predicted protein                                      191   3e-54   
ref|XP_009115302.1|  PREDICTED: transcription factor MYB57              189   3e-54   
gb|KHN16570.1|  Transcription factor MYB21                              190   5e-54   
ref|NP_564519.1|  myb domain protein 112                                187   5e-54   
ref|XP_010523903.1|  PREDICTED: transcription factor MYB108-like        188   5e-54   
gb|KFK36115.1|  hypothetical protein AALP_AA4G080100                    186   5e-54   
emb|CDX96033.1|  BnaA07g26980D                                          189   5e-54   
ref|XP_009105377.1|  PREDICTED: transcription factor MYB24-like         189   5e-54   
ref|XP_006584643.1|  PREDICTED: MYB transcription factor MYB184 i...    189   5e-54   
ref|XP_007145121.1|  hypothetical protein PHAVU_007G211800g             188   5e-54   
ref|XP_007154150.1|  hypothetical protein PHAVU_003G094600g             189   6e-54   
gb|EMT11819.1|  Transcription factor MYB21                              190   7e-54   
ref|XP_010916405.1|  PREDICTED: transcription factor MYB21-like         189   7e-54   
gb|KDP20133.1|  hypothetical protein JCGZ_05902                         188   8e-54   
gb|EPS73052.1|  hypothetical protein M569_01708                         183   8e-54   
gb|AFM77857.1|  myb domain protein                                      189   8e-54   
ref|XP_006341595.1|  PREDICTED: myb-related protein 305-like            188   8e-54   
emb|CDM80629.1|  unnamed protein product                                189   1e-53   
gb|EMS46598.1|  Transcription factor MYB21                              189   1e-53   
ref|XP_009403972.1|  PREDICTED: transcription factor MYB108-like ...    188   1e-53   
emb|CCA29096.1|  putative MYB transcription factor                      189   1e-53   
ref|XP_006393501.1|  hypothetical protein EUTSA_v10012051mg             186   1e-53   
ref|XP_004295042.1|  PREDICTED: uncharacterized protein LOC101295899    189   1e-53   
ref|XP_011076599.1|  PREDICTED: transcription factor MYB108-like        188   1e-53   
gb|ABK28415.1|  unknown                                                 187   2e-53   
ref|XP_004229031.1|  PREDICTED: transcription factor MYB108-like        187   2e-53   
ref|XP_009409973.1|  PREDICTED: transcription factor MYB108-like        187   2e-53   
ref|XP_002894088.1|  hypothetical protein ARALYDRAFT_473935             185   2e-53   
ref|XP_010477944.1|  PREDICTED: transcription factor MYB108-like ...    187   2e-53   
ref|XP_010666321.1|  PREDICTED: transcription factor MYB108-like        188   2e-53   
gb|AGN52033.1|  MYB-related transcription factor                        186   2e-53   
emb|CDY69953.1|  BnaAnng32120D                                          187   2e-53   
ref|XP_004512906.1|  PREDICTED: transcription factor MYB21-like         187   2e-53   
ref|XP_006644098.1|  PREDICTED: transcription factor MYB108-like        187   2e-53   
ref|XP_002315935.1|  hypothetical protein POPTR_0010s13290g             188   2e-53   
ref|XP_004236420.2|  PREDICTED: transcription factor MYB108-like        187   2e-53   
gb|AIU39030.1|  myb transcription factor 1                              187   2e-53   
emb|CDY69488.1|  BnaCnng63810D                                          187   2e-53   
ref|XP_008438973.1|  PREDICTED: transcription factor MYB108             187   3e-53   
ref|XP_009403971.1|  PREDICTED: transcription factor MYB108-like ...    188   3e-53   
ref|XP_003591357.1|  Myb-like transcription factor                      186   3e-53   
ref|XP_002534590.1|  DNA binding protein, putative                      186   3e-53   
ref|XP_009383607.1|  PREDICTED: transcription factor MYB108-like        187   3e-53   
ref|XP_002456023.1|  hypothetical protein SORBIDRAFT_03g029050          187   3e-53   
emb|CDX95420.1|  BnaC04g27380D                                          185   4e-53   
ref|NP_001235789.1|  MYB transcription factor MYB84                     187   4e-53   
ref|XP_003536859.1|  PREDICTED: transcription factor MYB108             185   4e-53   
ref|XP_004495882.1|  PREDICTED: protein ODORANT1-like                   186   4e-53   
ref|XP_010499121.1|  PREDICTED: myb-related protein 305-like            186   4e-53   
ref|XP_011100718.1|  PREDICTED: transcription factor MYB108-like        187   4e-53   
ref|NP_001241924.1|  uncharacterized LOC100819467                       186   4e-53   
ref|XP_003520762.1|  PREDICTED: transcription factor MYB108-like        186   4e-53   
ref|XP_007147396.1|  hypothetical protein PHAVU_006G120800g             187   4e-53   
ref|XP_006337993.1|  PREDICTED: myb-related protein 305-like            186   5e-53   
gb|KHN14149.1|  Transcription factor MYB21                              180   5e-53   
ref|XP_009105051.1|  PREDICTED: transcription factor MYB21-like         186   6e-53   
ref|XP_008390410.1|  PREDICTED: transcription factor MYB108-like        188   6e-53   
gb|ACU18510.1|  unknown                                                 187   6e-53   
ref|XP_007227100.1|  hypothetical protein PRUPE_ppa025672mg             187   6e-53   
ref|XP_004150815.1|  PREDICTED: transcription repressor MYB6-like       185   7e-53   
ref|XP_004165513.1|  PREDICTED: transcription repressor MYB6-like       185   7e-53   
emb|CDY01906.1|  BnaC06g29460D                                          186   8e-53   
ref|XP_009621085.1|  PREDICTED: transcription factor MYB108-like        186   8e-53   
ref|XP_008367580.1|  PREDICTED: transcription factor MYB108-like        186   8e-53   
ref|XP_010044254.1|  PREDICTED: transcription factor MYB24-like         186   9e-53   
ref|XP_011071358.1|  PREDICTED: transcription factor MYB108-like        186   1e-52   
gb|EYU45477.1|  hypothetical protein MIMGU_mgv1a009198mg                187   1e-52   
ref|XP_009804370.1|  PREDICTED: transcription factor MYB57-like         185   1e-52   
gb|ABR28342.1|  MYB transcription factor MYB61                          184   1e-52   
ref|XP_009372081.1|  PREDICTED: transcription factor MYB108             187   1e-52   
ref|XP_003553674.1|  PREDICTED: transcription factor MYB108-like        183   1e-52   
ref|XP_003533124.1|  PREDICTED: transcription factor MYB108-like        186   2e-52   
emb|CDP20749.1|  unnamed protein product                                185   2e-52   
gb|KGN57183.1|  hypothetical protein Csa_3G168940                       186   2e-52   
ref|XP_003594670.1|  Myb-like transcription factor                      186   2e-52   
ref|XP_009118865.1|  PREDICTED: transcription factor MYB108-like        184   2e-52   
gb|EPS64015.1|  hypothetical protein M569_10766                         184   2e-52   
ref|XP_004967585.1|  PREDICTED: myb-related protein Myb4-like           185   2e-52   
ref|XP_010102909.1|  Myb-related protein 305                            186   2e-52   
gb|AHW45787.1|  MYB transcription factor                                184   2e-52   
emb|CDY12705.1|  BnaA02g13730D                                          184   2e-52   
gb|KHN20739.1|  Myb-related protein 305                                 185   2e-52   
ref|XP_006440994.1|  hypothetical protein CICLE_v10021157mg             186   2e-52   
ref|XP_003528951.2|  PREDICTED: transcription factor RAX3-like          185   2e-52   
ref|XP_009127621.1|  PREDICTED: transcription factor MYB24-like         184   2e-52   
gb|AAM43912.1|AF510112_1  MYB transcription factor                      186   2e-52   
gb|KFK44510.1|  hypothetical protein AALP_AA1G266100                    184   2e-52   
ref|XP_010461601.1|  PREDICTED: myb-related protein 340                 184   2e-52   
ref|XP_006485803.1|  PREDICTED: transcription factor MYB108-like        186   2e-52   
gb|ABR28334.1|  MYB transcription factor MYB39                          186   3e-52   
ref|XP_011002746.1|  PREDICTED: transcription factor MYB108-like        184   3e-52   
ref|XP_003565694.1|  PREDICTED: transcription factor MYB108-like        184   3e-52   
gb|AAB58313.1|  Cpm5                                                    186   3e-52   
ref|XP_008223427.1|  PREDICTED: transcription factor MYB108             186   3e-52   
ref|XP_009784472.1|  PREDICTED: transcription factor MYB108-like        185   3e-52   
ref|XP_010314656.1|  PREDICTED: ABA-induced MYB transcription fac...    183   3e-52   
ref|XP_010314657.1|  PREDICTED: ABA-induced MYB transcription fac...    182   3e-52   
ref|NP_001267991.1|  R2R3 transcription factor MYB108-like protein 1    185   3e-52   
emb|CBI22842.3|  unnamed protein product                                185   3e-52   
ref|NP_001132469.1|  putative MYB DNA-binding domain superfamily ...    186   3e-52   
emb|CAN63179.1|  hypothetical protein VITISV_029107                     184   3e-52   
emb|CBH32532.1|  Myb-like DNA-binding domain containing protein,e...    184   3e-52   
ref|XP_010506747.1|  PREDICTED: transcription factor MYB108-like        184   4e-52   
gb|AAB58314.1|  Cpm7                                                    185   4e-52   
ref|NP_001241747.1|  uncharacterized protein LOC100856932               185   4e-52   
ref|XP_010440825.1|  PREDICTED: transcription factor MYB108-like        184   4e-52   
ref|NP_182241.1|  R2R3 MYB DNA binding domain transcription factor      183   4e-52   
ref|XP_006397911.1|  hypothetical protein EUTSA_v10001584mg             183   4e-52   
ref|XP_006355725.1|  PREDICTED: transcription factor MYB21-like         185   4e-52   
ref|XP_006294780.1|  hypothetical protein CARUB_v10023831mg             183   5e-52   
ref|XP_003591359.1|  MYB transcription factor                           183   5e-52   
ref|XP_006644414.1|  PREDICTED: transcription factor MYB21-like         181   5e-52   
ref|XP_006280880.1|  hypothetical protein CARUB_v10026871mg             184   5e-52   
ref|XP_002880286.1|  MYB transcription factor Atmyb2                    183   5e-52   
emb|CDY27504.1|  BnaC04g51450D                                          183   5e-52   
ref|XP_010507918.1|  PREDICTED: transcription factor MYB108-like        183   6e-52   
ref|XP_004486524.1|  PREDICTED: myb-related protein 330-like            184   6e-52   
ref|NP_001043670.1|  Os01g0637800                                       181   6e-52   
ref|XP_006349958.1|  PREDICTED: transcription factor MYB21-like         182   6e-52   
ref|NP_001242391.1|  MYB12 protein                                      182   6e-52   
dbj|BAH83498.1|  MYB12 transcription factor a                           182   6e-52   
gb|EEE55059.1|  hypothetical protein OsJ_02763                          181   6e-52   
gb|EYU33077.1|  hypothetical protein MIMGU_mgv1a010262mg                184   7e-52   
gb|AHY94990.1|  MYB2                                                    183   7e-52   
gb|KFK37485.1|  hypothetical protein AALP_AA4G263500                    183   7e-52   
gb|EEC71159.1|  hypothetical protein OsI_03001                          181   7e-52   
ref|XP_010442426.1|  PREDICTED: transcription factor MYB108-like        183   7e-52   
emb|CDY54094.1|  BnaC02g46060D                                          183   7e-52   
gb|ABH02913.1|  MYB transcription factor MYB72                          179   8e-52   
ref|XP_009142557.1|  PREDICTED: transcription factor MYB108             182   9e-52   
gb|EMT31736.1|  Myb-related protein 305                                 184   9e-52   
dbj|BAB62112.1|  MYB transcription factor Atmyb2                        182   1e-51   
ref|XP_010038307.1|  PREDICTED: transcription factor MYB108-like        182   1e-51   
dbj|BAB62119.1|  MYB transcription factor Atmyb2                        182   1e-51   
gb|ACU20373.1|  unknown                                                 184   1e-51   
dbj|BAB62114.1|  MYB transcription factor Atmyb2                        182   1e-51   
dbj|BAB62121.1|  MYB transcription factor Atmyb2                        182   1e-51   
ref|XP_003546301.1|  PREDICTED: transcription factor MYB108 isofo...    184   1e-51   
ref|XP_007158818.1|  hypothetical protein PHAVU_002G184600g             182   2e-51   
ref|XP_008655821.1|  PREDICTED: transcription factor MYB108-like        183   2e-51   
ref|XP_008348686.1|  PREDICTED: transcription factor MYB108-like        182   2e-51   
ref|NP_001131296.1|  putative MYB DNA-binding domain superfamily ...    184   2e-51   
dbj|BAB62110.1|  MYB transcription factor Atmyb2                        181   2e-51   
ref|XP_010518412.1|  PREDICTED: transcription factor MYB108-like        182   2e-51   
ref|XP_009360147.1|  PREDICTED: transcription factor MYB108-like        182   2e-51   
ref|XP_009591106.1|  PREDICTED: transcription factor MYB57-like         182   2e-51   
ref|XP_007163206.1|  hypothetical protein PHAVU_001G215100g             181   2e-51   
gb|ADR63291.1|  MYB146                                                  182   2e-51   
ref|XP_007035892.1|  Myb domain protein 112 isoform 1                   183   2e-51   
ref|XP_003534166.2|  PREDICTED: transcription repressor MYB6-like       182   2e-51   
ref|XP_011098762.1|  PREDICTED: myb-related protein 305                 179   3e-51   
ref|XP_003566926.2|  PREDICTED: myb-related protein 340-like            179   3e-51   
gb|KHN32052.1|  Myb-related protein 305                                 182   3e-51   
ref|NP_001239915.1|  uncharacterized protein LOC100791349               183   3e-51   
ref|XP_006395046.1|  hypothetical protein EUTSA_v10004588mg             182   3e-51   
ref|XP_004969272.1|  PREDICTED: myb-related protein 340-like            181   3e-51   
ref|XP_009347244.1|  PREDICTED: transcription factor WER-like           181   3e-51   
ref|XP_009367189.1|  PREDICTED: transcription factor MYB108-like        181   3e-51   
gb|KHG22187.1|  Myb-related protein                                     181   4e-51   
ref|XP_010500311.1|  PREDICTED: transcription factor MYB108-like        179   5e-51   



>emb|CDP02096.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 163/209 (78%), Gaps = 20/209 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ      +   +GQGS    DQ   +++   +++   + YS P  S+  NME    FQG
Sbjct  118  KQ------AETFAGQGSEHANDQA--STSQISTTVDAAETYSPP--SYSGNMET---FQG  164

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              FP+   SN+ +W M+D+ WSMQ+LNGD
Sbjct  165  -PFPTE--SNENLWSMEDL-WSMQLLNGD  189



>gb|AGI60280.1| transcription factor MYB305 [Nicotiana tabacum]
Length=192

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 161/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   SS+  N  I+T FQG
Sbjct  118  KQAENMN------GQAANSEQNDHQEGSSSHMSSAGPAETYSP--SSYSAN--IDTTFQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>ref|XP_009618404.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=192

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 161/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   +S+  N  I+T FQG
Sbjct  118  KQAENMN------GQAANSEQNDHQEGSSSHMSSAGPAETYSP--TSYSAN--IDTTFQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>ref|XP_011097428.1| PREDICTED: myb-related protein 305 [Sesamum indicum]
Length=199

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 158/209 (76%), Gaps = 10/209 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ A    S   + Q S    D  +  S S            SP +SF  NM  ET FQ 
Sbjct  118  KQ-ADHQSSFPAAAQNSEHSNDCTNHASTSSCCPTDHAVESYSPTTSFNGNM--ETTFQS  174

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              FP+   S+D +W M+D+ WS+Q+LNGD
Sbjct  175  -PFPTE--SHDNIWSMEDL-WSLQLLNGD  199



>dbj|BAF96932.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=200

 Score =   264 bits (674),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 166/211 (79%), Gaps = 15/211 (7%)
 Frame = -1

Query  882  MDKK-TCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            MDKK +  NSSS DPE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL
Sbjct  1    MDKKGSNINSSSKDPEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  60

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH
Sbjct  61   RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  120

Query  525  LKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIY---SSPQSSFVCNMEIET  355
            +KQ  A N     +GQ S ++ ++V+STS    ++    ++     SP S++  +  +  
Sbjct  121  MKQ--AEN----YAGQSSSEQNERVASTSMQTSAATAPHELMMETQSPPSNYTMD-HLPE  173

Query  354  GFQGHHFPSHEYSNDAVWGMDDISWSMQILN  262
             FQ + FP+   SND +W M+D+ WS+ +LN
Sbjct  174  AFQ-NPFPTE--SNDNLWSMEDL-WSLHLLN  200



>gb|ABU97106.1| MYB305 protein v2 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 161/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   +S+  N  I+T FQG
Sbjct  118  KQAENMN------GQAANSEQNDHQEGSSSHMSSAGPTEAYSP--TSYSAN--IDTTFQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>gb|ABU97107.1| MYB305 protein v1 [Nicotiana langsdorffii x Nicotiana sanderae]
Length=192

 Score =   263 bits (672),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 161/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   +S+  N  I+T FQG
Sbjct  118  KQAENMN------GQAANSEQNDHQEGSSSHMSSAGPTETYSP--TSYSAN--IDTTFQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>ref|XP_004233330.1| PREDICTED: myb-related protein 305-like [Solanum lycopersicum]
Length=195

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 16/210 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK   CNS   D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDK--ICNSQ--DVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  56

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGN+WSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  57   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNKWSKIAKHLPGRTDNEIKNYWRTRIQKHI  116

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGD-IYSSPQSSFVCNMEIETGFQ  346
            KQ    N      GQGS ++       S+SQ+SS+GQ D I +   +S+  N  ++T FQ
Sbjct  117  KQGENMN------GQGSSEQNIDHQEGSSSQISSVGQADNIETYSPTSY--NGNLDTNFQ  168

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              +F +   +ND +W M+DI WSMQ+LNGD
Sbjct  169  ASNFLNE--TNDNMWSMEDI-WSMQLLNGD  195



>gb|ADT82939.1| non-opening 1 [Nicotiana attenuata]
Length=192

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 160/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   +S+  N  I+  FQG
Sbjct  118  KQAENMN------GQAASHEQNDHQEGSSSHMSSAGPTETYSP--TSYSAN--IDNTFQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>ref|XP_006357153.1| PREDICTED: myb-related protein 305-like [Solanum tuberosum]
Length=195

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 165/210 (79%), Gaps = 16/210 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK   CNS   D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDK--TCNSQ--DVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  56

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGN+WSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  57   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNKWSKIAKHLPGRTDNEIKNYWRTRIQKHI  116

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGD-IYSSPQSSFVCNMEIETGFQ  346
            KQ    N      GQG+ ++       S+SQ+SS+GQ D I +   +S+  N  ++T FQ
Sbjct  117  KQGENMN------GQGTSEQNIDHQEGSSSQISSVGQADNIETYSPTSY--NGNLDTNFQ  168

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              +F S   +ND +W M+DI WSMQ+LNGD
Sbjct  169  APNFLSE--TNDNMWSMEDI-WSMQLLNGD  195



>ref|XP_009791355.1| PREDICTED: myb-related protein 305-like [Nicotiana sylvestris]
Length=192

 Score =   260 bits (664),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 160/209 (77%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N      GQ +  + +     S+S +SS G  + YS   +S+  N  I+T  QG
Sbjct  118  KQAENMN------GQVANSEQNDHQEGSSSHMSSAGPAEAYSP--TSYSAN--IDTTLQG  167

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    +ND +W M+DI WSMQ+LNGD
Sbjct  168  ---PFLTETNDNIWSMEDI-WSMQLLNGD  192



>ref|XP_008341440.1| PREDICTED: myb-related protein 305-like [Malus domestica]
Length=195

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 164/210 (78%), Gaps = 16/210 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC-NSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDI-YSSPQSSFVCNMEIETGFQ  346
            KQ        +  GQ S +  DQ S++  S  +++   DI +S+P  ++  NM+      
Sbjct  120  KQ-----AENITPGQSS-EVNDQASTSQVSISNTVDTMDISHSAP--TYQANMDAYPP--  169

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                P+ + SN++ W M+D+ WS+Q+LNG+
Sbjct  170  --PLPADQ-SNESYWSMEDL-WSLQLLNGE  195



>emb|CAN77103.1| hypothetical protein VITISV_018445 [Vitis vinifera]
 emb|CBI34905.3| unnamed protein product [Vitis vinifera]
Length=189

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 154/209 (74%), Gaps = 20/209 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDAEVRKGPWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQ LIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITDEEQQLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            K       +   + Q S    DQ +++     + +   D YS P  S+  N+E    F G
Sbjct  118  KN------AETFTAQSSDQTHDQATTSQVMGAAHV--ADSYSPP--SYPANLE---AFPG  164

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               PS   SND  W M+DI WSMQ+LNGD
Sbjct  165  ---PSSAESNDNFWTMEDI-WSMQLLNGD  189



>emb|CAD87008.1| MYB8 protein [Gerbera hybrid cultivar]
Length=190

 Score =   257 bits (657),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 153/202 (76%), Gaps = 17/202 (8%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            N+SS D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP
Sbjct  6    NNSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  65

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATN  502
            DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+KQ     
Sbjct  66   DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQVEN--  123

Query  501  ESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHE  322
                 SGQ S  + DQ + +S    + +   + YS P  +F         F G  FP+  
Sbjct  124  ----FSGQTSSGQNDQATMSSTQTCNVVNPMETYSPPYDNF-------QNFSG-PFPTE-  170

Query  321  YSNDAVWGMDDISWSMQILNGD  256
             +N+ +W M+D+ WSMQ+LN +
Sbjct  171  -TNENMWSMEDL-WSMQLLNSE  190



>ref|XP_004304632.1| PREDICTED: myb-related protein 305-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 151/209 (72%), Gaps = 21/209 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC-NSSSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ   +N      GQ S    DQ S+               S   SS      ++     
Sbjct  120  KQGDQSNS----QGQSSDGTADQAST---------------SKVGSSSTVATLVQPPAHP  160

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
            +  P  + + D  W M+D+ WSMQ+LNG+
Sbjct  161  NVLPPGDSNQDNYWSMEDL-WSMQLLNGE  188



>ref|XP_009375123.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
 ref|XP_009377203.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 164/210 (78%), Gaps = 16/210 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC-NSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDI-YSSPQSSFVCNMEIETGFQ  346
            K   A N   +  GQ S +  DQ  ++  S  +++   DI +S+P  ++  NM+      
Sbjct  120  K--PAEN---ITPGQSS-EVNDQAITSQVSISNTVDTMDISHSAP--TYQANMDAYPP--  169

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                P+ + SN++ W M+D+ WS+Q+LNG+
Sbjct  170  --PLPADQ-SNESYWSMEDL-WSLQLLNGE  195



>gb|AGN52062.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52172.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=200

 Score =   255 bits (651),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 161/211 (76%), Gaps = 13/211 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+ C   +S++PE+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRPC---NSHEPEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT +E LLI+ELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITADEHLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTV-ISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
            KQ  + N +T+ ++       T+Q  S       +I Q    +   SSF  +M+    FQ
Sbjct  118  KQ--SENFTTLPLNNMDQSTFTNQALSGCVPADYAISQSYTPNPATSSFQGSMQ---NFQ  172

Query  345  GHHFPSHEYSND-AVWGMDDISWSMQILNGD  256
            G +FP+   SND  +W MDD  WSMQ+L+GD
Sbjct  173  GSNFPTQ--SNDHNIWSMDDF-WSMQLLHGD  200



>ref|XP_009334094.1| PREDICTED: myb-related protein 305-like [Pyrus x bretschneideri]
Length=195

 Score =   254 bits (650),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 158/207 (76%), Gaps = 15/207 (7%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K  CNSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  3    KNPCNSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  62

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQE  514
            YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+KQ 
Sbjct  63   YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQ-  121

Query  513  AATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDI-YSSPQSSFVCNMEIETGFQGHH  337
                   +  GQ S +  DQ S++  S   ++   DI +S+P  +   NM+         
Sbjct  122  ----AENITPGQ-SSEVNDQASTSQVSISKTLDTMDISHSAP--THQANMDAYPP----P  170

Query  336  FPSHEYSNDAVWGMDDISWSMQILNGD  256
             P+ + SND  W M+D+ WSMQ+LNG+
Sbjct  171  LPADQ-SNDNYWSMEDL-WSMQLLNGE  195



>gb|ACB12237.1| MYB-like protein NON1 [Petunia x hybrida]
 gb|ACB59077.1| Myb-like transcription factor EOBII [Petunia x hybrida]
 gb|AEC11893.1| MYB transcription factor EOBII [Petunia axillaris]
 gb|AEC11894.1| MYB transcription factor EOBII [Petunia exserta]
Length=197

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 157/209 (75%), Gaps = 12/209 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N     S Q    +      ++    ++I Q   YS   +S+  N  ++T   G
Sbjct  118  KQAETMNGQAASSEQNDHQEACTSQMSNGPNDNTIDQ--TYSP--TSYSGN--VDTFQAG  171

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             +F +   +ND +W M+DI WSMQ+LNGD
Sbjct  172  PNFLTE--ANDNMWSMEDI-WSMQLLNGD  197



>ref|XP_007217766.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
 gb|EMJ18965.1| hypothetical protein PRUPE_ppa011751mg [Prunus persica]
Length=198

 Score =   254 bits (650),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 160/212 (75%), Gaps = 17/212 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC-NSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ     E+ +  GQ S       +S  +   +++    I  +  +++  NM+       
Sbjct  120  KQA----ENNITPGQISEVNDQASTSQVSISSAAVDTMAITHAAPANYPPNMDA------  169

Query  342  HHFPSH---EYSNDAVWGMDDISWSMQILNGD  256
              +PS    ++S++  W ++D+ WSMQ+LNG+
Sbjct  170  --YPSSLPADHSHEGYWSIEDL-WSMQLLNGE  198



>ref|XP_008230585.1| PREDICTED: myb-related protein 305-like [Prunus mume]
Length=213

 Score =   255 bits (651),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 161/213 (76%), Gaps = 17/213 (8%)
 Frame = -1

Query  885  KMDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            +MDKK C NSSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRL
Sbjct  15   EMDKKPC-NSSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRL  73

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH
Sbjct  74   RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKH  133

Query  525  LKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
            +KQ     E+ +  GQ         +S  +   +++   +I  +  +++  NM+      
Sbjct  134  IKQA----ENNITPGQNFEVNDQASTSQVSISSAAVDTMEITHAAPANYPPNMDA-----  184

Query  345  GHHFPSH---EYSNDAVWGMDDISWSMQILNGD  256
               +PS    ++S++  W ++D+ WSMQ+LNG+
Sbjct  185  ---YPSSLPADHSHENYWSIEDL-WSMQLLNGE  213



>ref|NP_001268062.1| R2R3 Myb24 transcription factor [Vitis vinifera]
 gb|ABW34394.1| R2R3 Myb24 transcription factor [Vitis vinifera]
Length=189

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 153/209 (73%), Gaps = 20/209 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWT+ EDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDAEVRKGPWTLGEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQ LIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITDEEQQLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            K       +   + Q S    DQ +++     + +   D YS P  S+  N+E    F G
Sbjct  118  KN------AETFTAQSSDQTHDQATTSQVMGAAHV--ADSYSPP--SYPANLE---AFPG  164

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               PS   SND  W M+DI WSMQ+LNGD
Sbjct  165  ---PSSAESNDNFWTMEDI-WSMQLLNGD  189



>gb|AGN52197.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 156/209 (75%), Gaps = 16/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S D E+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKPC---KSIDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ      +   +GQ + +  DQ S++  S            SP S    NME    F G
Sbjct  118  KQ------AENCTGQTAENSNDQASTSQVSSSCPADHTVESYSPPSFTGNNME---PFHG  168

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              FP+   SN+ +W M+D+ WS+Q+LNGD
Sbjct  169  -PFPTE--SNENLWSMEDL-WSLQLLNGD  193



>gb|AGN52087.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=193

 Score =   253 bits (647),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 157/209 (75%), Gaps = 16/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S D E+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKPC---KSIDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ  A N     +GQ + +  DQ S++  S            SP S    NME    F G
Sbjct  118  KQ--AEN----CTGQTAENSDDQASTSQVSSSCPADHTVESYSPPSFTGNNME---PFHG  168

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              FP+   SN+ +W M+D+ WS+Q+LNGD
Sbjct  169  -PFPTE--SNENLWSMEDL-WSLQLLNGD  193



>gb|AGC00814.1| EOBI [Petunia x hybrida]
Length=202

 Score =   253 bits (645),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 157/209 (75%), Gaps = 13/209 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+TC   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRTC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTD-QVsstsasqlsSIGQGDIYSSPQSSFVCNMEIET-GF  349
             ++A  N    +  Q  C+  D Q  STS          D YS    +   N  +E   F
Sbjct  118  NKQADQN----MKKQSKCEHNDQQAISTSQVSTGPTDTIDSYSPSSYTGNTNNNMENITF  173

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILN  262
             G +FP+   +N+ +W ++D+ WS+Q+LN
Sbjct  174  HG-NFPTE--TNENIWSIEDL-WSLQLLN  198



>sp|P81391.1|MYB05_ANTMA RecName: Full=Myb-related protein 305 [Antirrhinum majus]
Length=205

 Score =   253 bits (645),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 160/212 (75%), Gaps = 10/212 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK LPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKTLPGRTDNEIKNYWRTRIQKHM  117

Query  522  KQEAATNESTVISGQGSCDKT--DQVsstsasq-lsSIGQGDIYSSPQSSFVCNMEIETG  352
            +Q   ++ +T  +GQ + D +  DQ SS+  S     +    +  S  S    N    T 
Sbjct  118  EQGDQSSSTTFNNGQMNLDHSCNDQASSSQMSACGPVVDHTAVDQSSYSPHSFNGNDHT-  176

Query  351  FQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
            FQ   FP+ + SND +W M+D  WSMQ+LNGD
Sbjct  177  FQA-PFPTDQ-SNDNMWSMEDF-WSMQLLNGD  205



>ref|XP_009613846.1| PREDICTED: myb-related protein 305-like [Nicotiana tomentosiformis]
Length=199

 Score =   252 bits (644),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 158/207 (76%), Gaps = 12/207 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+TC   +S D E+RKGPWTMEEDLILINYIANHG+GVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRTC---NSQDVEVRKGPWTMEEDLILINYIANHGDGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGN+WSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNKWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    ++S  I    + +      ++++   +     + YS P  S+  N    T FQ 
Sbjct  118  KQ---ADQSMNIRPSSNSEHNHHQQASTSQASTGNNTIETYSPP--SYNGNNMGTTNFQA  172

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILN  262
             +FP+   +N+ +W M+D+ WSMQ+LN
Sbjct  173  -NFPAE--TNENIWSMEDL-WSMQLLN  195



>ref|NP_001235699.1| uncharacterized protein LOC100305972 [Glycine max]
 gb|ACU13920.1| unknown [Glycine max]
Length=206

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 162/218 (74%), Gaps = 21/218 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS+DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLR
Sbjct  1    MDKKPC-NSSSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  119

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ   + +       G+ +  D  +STS S++S++   +   SP  S+    E    FQ 
Sbjct  120  KQAETSQQ------HGNSENNDHQASTSTSKVSTMAHPNETFSP-PSYQGTFE---PFQP  169

Query  342  HHFP---------SHEYSNDAVWGMDDISWSMQILNGD  256
              FP         +    N+  W ++DI  SMQ+LNGD
Sbjct  170  -QFPTITDQSSCCTTTNDNNNYWSIEDIWSSMQLLNGD  206



>ref|NP_001235850.1| MYB transcription factor MYB181 [Glycine max]
 gb|ABH02847.1| MYB transcription factor MYB181 [Glycine max]
 gb|ACU14259.1| unknown [Glycine max]
Length=208

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 156/216 (72%), Gaps = 15/216 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK  CN+S  DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKQLCNTSQ-DPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  K-----QEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFVCNME  364
            K     Q+  +N S +   Q S      ++    +      QG  + +SS Q   + N +
Sbjct  120  KQAENFQQQISNNSEINDHQASTSHVSTMAEPMETYSPPFYQGMLEPFSSIQFPTI-NPD  178

Query  363  IETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              +     +  S  Y     W M+DI WSMQ+LNGD
Sbjct  179  QSSCCTNDNNNSINY-----WSMEDI-WSMQLLNGD  208



>gb|AFJ21697.1| MYB24 [Gossypium hirsutum]
Length=210

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 155/218 (71%), Gaps = 17/218 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S + E+RKGPWTMEEDLILINYIANHGEGVWNSLAR+AGLKRTGKSCRLR
Sbjct  1    MDKKPC---KSQEVEVRKGPWTMEEDLILINYIANHGEGVWNSLARAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQ LIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQFLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHM  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYS-----SPQSSF--VCNME  364
             + A        S Q  C+  DQ +S+S    +S    +  S     SP SSF    N+E
Sbjct  118  NKPA----EVCYSNQSDCELLDQQASSSQLPCNSTNTTNADSMGTSYSPLSSFDYYNNIE  173

Query  363  IETGFQGHH--FPSHEYSNDAVWGMDDISWSMQILNGD  256
              +G Q       S     D  W M+DI WSMQILNG+
Sbjct  174  AFSGQQQQQVMLESPSSQEDNYWNMEDI-WSMQILNGN  210



>ref|XP_007031495.1| Myb domain protein 21 [Theobroma cacao]
 gb|EOY02421.1| Myb domain protein 21 [Theobroma cacao]
Length=194

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 153/211 (73%), Gaps = 19/211 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC---KSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFV-CNMEIETGFQ  346
            KQ A    S + S       T QV   +           + + P SSF  CNME    F 
Sbjct  118  KQ-AEVCSSQIHSELHKQASTSQVPCNTDM---------METYPPSSFNHCNME---AFP  164

Query  345  GHHFPSHEY-SNDAVWGMDDISWSMQILNGD  256
            G    S    SN++ W ++D+ WSMQ+L GD
Sbjct  165  GQSAMSMAVESNESYWSIEDL-WSMQLLTGD  194



>ref|XP_007151019.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
 gb|ESW23013.1| hypothetical protein PHAVU_004G012000g [Phaseolus vulgaris]
Length=241

 Score =   251 bits (642),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 160/220 (73%), Gaps = 16/220 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C +SSS+DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLR
Sbjct  27   MDKKPCNSSSSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLR  86

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQLLI ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  87   WLNYLRPDVRRGNITTEEQLLIFELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHM  146

Query  522  KQEAATNESTVISGQGSCDKTD----QVsstsasqlsSIGQGDIYSSPQSSFVCNME-IE  358
            KQ  A N     +     +  D    Q SS+++   +   Q + YS+P  S+  N+E   
Sbjct  147  KQ--AENSQQQGNNSNISETNDHHHHQASSSTSLVSNMALQIETYSAP--SYQENLESFP  202

Query  357  TGF-----QGHHFPSHEY-SNDAVWGMDDISWSMQILNGD  256
            T F     Q     +H   SN   W ++D  W MQ+LNGD
Sbjct  203  TQFPTITDQSSSCTNHNINSNHNYWNIEDF-WPMQLLNGD  241



>gb|AGC00813.1| EOBI [Petunia x hybrida]
Length=201

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 158/211 (75%), Gaps = 18/211 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+TC   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRTC---NSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGD-IYSSPQSSFVCNMEIET---  355
            KQ         +     C++ DQ     ++  +S G  D I S   SS+  N        
Sbjct  118  KQADQN-----MKKPSKCEQNDQ--KAISTSQASTGPTDTIDSYSPSSYTENTNNNMENI  170

Query  354  GFQGHHFPSHEYSNDAVWGMDDISWSMQILN  262
             FQG +FP+   +N+ +W M+D+ WS+Q+LN
Sbjct  171  TFQG-NFPTE--TNENIWSMEDL-WSLQLLN  197



>ref|XP_010033288.1| PREDICTED: myb-related protein 305 [Eucalyptus grandis]
 gb|KCW52898.1| hypothetical protein EUGRSUZ_J02217 [Eucalyptus grandis]
Length=195

 Score =   249 bits (637),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 153/213 (72%), Gaps = 22/213 (10%)
 Frame = -1

Query  882  MDKKTCC-NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            MDKK    N  S D E+RKGPWTMEEDLILINYIANHGEG WNSLA++AGLKRTGKSCRL
Sbjct  1    MDKKPDDDNGKSQDVEVRKGPWTMEEDLILINYIANHGEGSWNSLAKAAGLKRTGKSCRL  60

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH
Sbjct  61   RWLNYLRPDVRRGNITTEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  120

Query  525  LKQ-EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            +KQ EA + +S+ +S Q S      +              + Y SP  SF  N  +E   
Sbjct  121  IKQAEAFSGQSSEMSDQASTSHMSSMPEPM----------ETYDSP-PSFQGNNNMEP--  167

Query  348  QGHHFPSH--EYSNDAVWGMDDISWSMQILNGD  256
                 P +    SN+A W MDD+ WSMQ+LNGD
Sbjct  168  ----LPVNLSVESNEAYWSMDDL-WSMQLLNGD  195



>ref|XP_010528247.1| PREDICTED: transcription factor MYB21 [Tarenaya hassleriana]
Length=204

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 157/215 (73%), Gaps = 15/215 (7%)
 Frame = -1

Query  888  IKMDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            + M+KK   +SSS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCR
Sbjct  1    MNMEKK--GSSSSGDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCR  58

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYLRPDV+RGNITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTR+QK
Sbjct  59   LRWLNYLRPDVKRGNITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRVQK  118

Query  528  HLKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            ++KQ   T   + +  QGS +  DQ SS  A       Q  +YS   +S+  NM ++  +
Sbjct  119  YIKQAETT---SSVGSQGS-EINDQASSNQAFGT----QEALYSPTTASYQANMGLDYNY  170

Query  348  QGHHFPSHEYSNDAV----WGMDDISWSMQILNGD  256
                    +   D      W MDD+ WSMQ+LNG+
Sbjct  171  PPSSASQMQLPIDQTGENYWTMDDL-WSMQLLNGN  204



>gb|KDP46431.1| hypothetical protein JCGZ_10271 [Jatropha curcas]
 gb|AIT52247.1| MYB family protein [Jatropha curcas]
Length=192

 Score =   248 bits (634),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 157/209 (75%), Gaps = 17/209 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            M+KK C   +S D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MEKKPC---NSQDAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITSEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ  A       +GQ +  + ++ +++S+S   S G  + YS+P  S+   ME    F G
Sbjct  118  KQAEA------FAGQNTNSEINEHATSSSSSQFSSGMMETYSAP--SYQGTME---AFTG  166

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                    S +  W M+D+ WSMQ+LN D
Sbjct  167  PTLAPE--STETYWTMEDL-WSMQLLNDD  192



>gb|KEH24806.1| myb transcription factor [Medicago truncatula]
Length=209

 Score =   249 bits (635),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 162/216 (75%), Gaps = 14/216 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  +SS DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC--NSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNME-IETGFQ  346
            KQ    +++     Q S +  D   S+S+   + +   + YS P  S+   +E     F 
Sbjct  119  KQVDHPHQNNF--QQMSLEINDHHQSSSSQVSNIVEPMESYSPP--SYQGTLEPFPAQFP  174

Query  345  --GHHFPS----HEYSNDAVWGMDDISWSMQILNGD  256
                H PS    ++ +N+  W M+DI WSMQ+LNGD
Sbjct  175  TINDHHPSSCCTNDNNNNNYWSMEDI-WSMQLLNGD  209



>ref|XP_003553814.1| PREDICTED: myb-related protein 305 [Glycine max]
Length=205

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 160/215 (74%), Gaps = 16/215 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   SS+DPE+RKGPW MEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLR
Sbjct  1    MDKKPC--DSSHDPEVRKGPWIMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ A T++    S + S +   Q S++++   +     + +S P  S+    E    FQ 
Sbjct  119  KQ-AETSQQHGNSSENS-NNDHQASNSTSKVSTMAHPNETFSPP--SYQATFE---PFQP  171

Query  342  HHFPSHE------YSNDAVWGMDDISWSMQILNGD  256
              FP+         SN+  W ++DI  SMQ+LNGD
Sbjct  172  -QFPTINDQSSCCTSNNNYWSIEDIWSSMQLLNGD  205



>ref|XP_004489258.1| PREDICTED: myb-related protein 305-like [Cicer arietinum]
Length=210

 Score =   248 bits (634),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 160/215 (74%), Gaps = 11/215 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  +SS DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC--NSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELH KWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHEKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNME-IETGF-  349
            KQ     +++      S D   Q +++ AS  + +   + Y SP S    N+E   T F 
Sbjct  119  KQVDHNQQNSQQQKSSSSDH-HQTNTSQASNSTMVEPMENY-SPTSYQATNLEPFPTQFP  176

Query  348  ----QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                      +++++ +  W M+DI WSMQ+LNGD
Sbjct  177  TINDHNSSCCTNDHNTNNYWSMEDI-WSMQLLNGD  210



>ref|XP_006338574.1| PREDICTED: myb-related protein 340-like [Solanum tuberosum]
Length=207

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 157/210 (75%), Gaps = 10/210 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+TC    S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRTC---DSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  117

Query  522  KQEAATNE-STVISGQGSCDK--TDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETG  352
            KQ    N  S+ IS   +  +  T Q S++ A  + +   G+  ++  ++   N     G
Sbjct  118  KQAENMNRISSNISEHNNIQQASTSQTSTSLADSIETYS-GNNNNNNNNNNNNNNNNNMG  176

Query  351  FQGHHFPSHEYSNDAVWGMDDISWSMQILN  262
               HH     + N+ +W M+D+ WSMQ+LN
Sbjct  177  TTFHH--QGNFPNENIWSMEDL-WSMQLLN  203



>ref|XP_004232307.1| PREDICTED: myb-related protein 340 [Solanum lycopersicum]
Length=203

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 152/208 (73%), Gaps = 10/208 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+TC    S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKRTC---DSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNLWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIET-GFQ  346
            KQ    N    +S   S +   Q +STS +  S     + YS   ++   N      G  
Sbjct  118  KQAENINR---LSSNISENNNIQQASTSQTSTSLADSMETYSGNNNNNNNNNNNNNMGTT  174

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILN  262
             HH     + N+ +W M+D+ WSMQ+LN
Sbjct  175  FHH--QGNFPNENIWSMEDL-WSMQLLN  199



>ref|NP_001235879.1| MYB transcription factor MYB182 [Glycine max]
 gb|ABH02849.1| MYB transcription factor MYB182 [Glycine max]
 gb|KHN24347.1| Myb-related protein 305 [Glycine soja]
Length=206

 Score =   246 bits (627),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 154/222 (69%), Gaps = 29/222 (13%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK  C +S  DPE+RKGPWTMEEDLIL+NYIANHGEGVWNSLA++AGLKR GKSCRLR
Sbjct  1    MDKKQQCKTSQ-DPEVRKGPWTMEEDLILMNYIANHGEGVWNSLAKAAGLKRNGKSCRLR  59

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  60   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  119

Query  522  K-----QEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQG--DIYSS------PQSS  382
            K     Q+ ++N S +   Q S      ++           QG  + +S+      P  S
Sbjct  120  KQAENFQQQSSNNSEINDHQASTSHVSTMAEPMEMYSPPCYQGMLEPFSTQFPTINPDQS  179

Query  381  FVCNMEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              C              +++ +N   W M+D SWSMQ+LNGD
Sbjct  180  SCC--------------TNDNNNINYWSMED-SWSMQLLNGD  206



>ref|XP_008443525.1| PREDICTED: myb-related protein 305 [Cucumis melo]
Length=218

 Score =   246 bits (627),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 160/226 (71%), Gaps = 25/226 (11%)
 Frame = -1

Query  882  MDKKTCCNS--SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            MDK+ C N+  S  D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR
Sbjct  1    MDKRACNNNNNSPQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCR  60

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYLRPDVRRGNITP+EQLLIMELHAKWGN+WSKIAK LPGRTDNEIKN+WRTRIQK
Sbjct  61   LRWLNYLRPDVRRGNITPDEQLLIMELHAKWGNKWSKIAKQLPGRTDNEIKNYWRTRIQK  120

Query  528  HLKQ-------EAATNESTVISGQGSCDKTDQVsstsasqls--------SIGQGDIYSS  394
            H+KQ       +++TN   ++S Q       Q+ + +    S        ++   + YS 
Sbjct  121  HIKQAHGFHTPQSSTN--ILLSSQDHHHHHHQIMNNNEQAASSSSCQVSYTMDPMETYSP  178

Query  393  PQSSFVCNMEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
            P  ++  N++    F     P+   SND  W M+D+ WSMQ+LN +
Sbjct  179  P--TYSQNID---AFSVPLPPTDNNSNDNYWSMEDL-WSMQLLNAE  218



>ref|XP_007140962.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
 gb|ESW12956.1| hypothetical protein PHAVU_008G155700g [Phaseolus vulgaris]
Length=200

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 155/212 (73%), Gaps = 15/212 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  ++S DPE+RKGPWTMEEDLILINYI+NHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKQC--NTSQDPEVRKGPWTMEEDLILINYISNHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAK LPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITAEEQLLIMELHAKWGNRWSKIAKQLPGRTDNEIKNFWRTRIQKHI  118

Query  522  K---QEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETG  352
            K   Q+ + + S +   Q S  +   ++    +  S   QG +   P S+ + N+  ++ 
Sbjct  119  KQADQQQSNSNSEINDHQASTSQVSTMAEPMETYSSPCYQGML--EPFSTQLPNIPDQSS  176

Query  351  FQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               +        N+  W M+D  WSMQ+LNGD
Sbjct  177  CCTN-------DNNNYWSMEDF-WSMQLLNGD  200



>dbj|BAF96931.1| R2R3-MYB transcriptional factor [Gentiana triflora]
Length=214

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 154/208 (74%), Gaps = 13/208 (6%)
 Frame = -1

Query  879  DKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  700
            + K  CNS   D ++RKGPWTMEED+ILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW
Sbjct  18   NSKAACNSG--DVQVRKGPWTMEEDMILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  75

Query  699  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK +K
Sbjct  76   LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQMK  135

Query  519  --QEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
              + ++  +S   S Q     T   +ST+A+  ++     + +    S+  NME    FQ
Sbjct  136  HVENSSVGQS---SEQTEAPSTSHEASTAAAATATTAHDAVEAYSPQSYTANME---SFQ  189

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILN  262
                P  + SND VW M+D+ WSM +LN
Sbjct  190  NPFPP--DQSNDNVWSMEDL-WSMNLLN  214



>gb|KEH22251.1| myb transcription factor [Medicago truncatula]
Length=208

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 154/219 (70%), Gaps = 21/219 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  SSS DP++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKKEC--SSSQDPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ     E++    QGS  + +       +    IG     S+       N+     +QG
Sbjct  119  KQA----ENSQSQEQGSDIQINDD----NNNNQLIGSTSQISNIAEPMDTNIISPPSYQG  170

Query  342  --------HHFP--SHEYSNDAVWGMDDISWSMQILNGD  256
                    H FP  S +      W M+D+  S+Q+LNGD
Sbjct  171  ILEPFPPHHQFPTISDQSGCSNYWSMEDL-LSLQLLNGD  208



>emb|CAA71992.1| Myb26 [Pisum sativum]
Length=217

 Score =   244 bits (622),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 155/230 (67%), Gaps = 34/230 (15%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  +SS DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC--NSSQDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELH+KWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHSKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEI--ETGF  349
            KQ    N+      + S +  D                   SS  S+ V  ME    T +
Sbjct  119  KQVDNPNQQN-FQQKMSLEINDHHHHHPHQPS---------SSQVSNLVEPMETYSPTSY  168

Query  348  QG--HHFPSH--EYSND---------------AVWGMDDISWSMQILNGD  256
            QG    FP+     +ND                 W M+DI WSMQ+LNGD
Sbjct  169  QGTLEPFPTQFPTINNDHHQNSNCCANDNNNNNYWSMEDI-WSMQLLNGD  217



>ref|XP_009783970.1| PREDICTED: myb-related protein 340-like [Nicotiana sylvestris]
Length=186

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 146/196 (74%), Gaps = 10/196 (5%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MD K  CNS  +D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDNKRTCNS--HDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    +E   I    + +      ++++   +     + YS   SS+  N    T FQ 
Sbjct  119  KQ---ADEGMNIRPSSNSENNHHQQASTSQVSTENNTIETYSP--SSYNGNNMGTTNFQA  173

Query  342  HHFPSHEYSNDAVWGM  295
             +FP+   +N+ +W M
Sbjct  174  -NFPAE--TNENIWSM  186



>gb|EYU44761.1| hypothetical protein MIMGU_mgv1a013642mg [Erythranthe guttata]
Length=214

 Score =   242 bits (617),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 151/202 (75%), Gaps = 14/202 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S D E+RKGPWTMEEDLIL+NYIANHGEGVWNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKPCI---SQDVEVRKGPWTMEEDLILMNYIANHGEGVWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNIT EEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITAEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ A  N ST   GQ +    DQ S++  S         + S   SSF  N+E    FQ 
Sbjct  118  KQ-ADQNCST---GQLADVSNDQASTSQLSSCCPADNHTVESYSPSSFNANIE---PFQP  170

Query  342  HHFPSHEYSNDAVWGMDDISWS  277
              FP+   SN+ +W M+D+ WS
Sbjct  171  -PFPTE--SNENLWSMEDL-WS  188



>ref|XP_006292470.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
 gb|EOA25368.1| hypothetical protein CARUB_v10018700mg [Capsella rubella]
Length=227

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 153/212 (72%), Gaps = 15/212 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ  AT  S+V 
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADATTTSSVG  135

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG-DIYSSPQSSFVCNMEIETGFQGHH---------  337
            S   S       S++S +   +  Q  + YS   +S+  +  +E  + G++         
Sbjct  136  SHHSSEINDQAASTSSHNVFCTQDQAMETYSPTPTSYQQHTNMEFNYGGNYSAAATTTTV  195

Query  336  -FPSHEYSNDAV----WGMDDISWSMQILNGD  256
             +P     +D      WGMDDI  SM +LNG+
Sbjct  196  DYPIPMTVDDQTGENYWGMDDIWSSMHLLNGN  227



>ref|XP_010425556.1| PREDICTED: transcription factor MYB21 isoform X1 [Camelina sativa]
Length=224

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 154/210 (73%), Gaps = 14/210 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ  AT  S+V 
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADATTTSSVG  135

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYS-SPQSSFVCNMEIETG-FQGHHFPSHEY  319
            S   S +  DQ +STS+  +        + YS +P S    NME   G +      + +Y
Sbjct  136  S-HHSSEINDQAASTSSHNVFCTQDQPMETYSPTPTSYQQTNMEFNYGNYSTAATATVDY  194

Query  318  ---------SNDAVWGMDDISWSMQILNGD  256
                     S +  WGMDDI  SM +LNG+
Sbjct  195  PIPMTVDDQSGENYWGMDDIWSSMHLLNGN  224



>sp|P81396.1|MYB40_ANTMA RecName: Full=Myb-related protein 340 [Antirrhinum majus]
Length=198

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 153/208 (74%), Gaps = 14/208 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C   +S+D E+RKGPWTMEEDLILIN+I+NHGEGVWN++ARSAGLKRTGKSCRLR
Sbjct  1    MDKKPC---NSHDVEVRKGPWTMEEDLILINFISNHGEGVWNTIARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFW-RTRIQKH  526
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+W RTRIQKH
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWNRTRIQKH  117

Query  525  LKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
            +KQ     E++ I         +Q S++  S            S  SSF  NM     + 
Sbjct  118  IKQA----EASFIGHINPEHSNEQASTSLLSSSCHADHA--VESYSSSFNGNMGNNVQYP  171

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILN  262
             +HFP+   SND  W M+D+ WSMQ+ N
Sbjct  172  -NHFPTE--SNDYFWSMEDL-WSMQLPN  195



>ref|XP_010502785.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score =   241 bits (616),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 154/210 (73%), Gaps = 14/210 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ  AT  S+V 
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADATTTSSVG  135

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYS-SPQSSFVCNMEIETG-FQGHHFPSHEY  319
            S   S +  DQ +STS+  +        + YS +P S    NME   G +      + +Y
Sbjct  136  S-HHSSEINDQAASTSSHNVFCTQDQPMETYSPTPTSYQQINMEFNYGNYSTAATATVDY  194

Query  318  ---------SNDAVWGMDDISWSMQILNGD  256
                     S +  WGMDDI  SM +LNG+
Sbjct  195  PIPMTVDDQSGENYWGMDDIWSSMHLLNGN  224



>ref|XP_010425557.1| PREDICTED: transcription factor MYB21 isoform X2 [Camelina sativa]
Length=224

 Score =   241 bits (616),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 154/210 (73%), Gaps = 14/210 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ  AT  S+V 
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADATTTSSVG  135

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYS-SPQSSFVCNMEIETG-FQGHHFPSHEY  319
            S   S +  DQ +STS+  +        + YS +P S    NME   G +      + +Y
Sbjct  136  S-HHSSEINDQAASTSSHNVFCTQDQPMETYSPTPTSYQQTNMEFNYGNYSTAATXTVDY  194

Query  318  ---------SNDAVWGMDDISWSMQILNGD  256
                     S +  WGMDDI  SM +LNG+
Sbjct  195  PIPMTVDDQSGENYWGMDDIWSSMHLLNGN  224



>ref|XP_004141095.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
 ref|XP_004168850.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=217

 Score =   241 bits (615),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 160/226 (71%), Gaps = 26/226 (12%)
 Frame = -1

Query  882  MDKKTCCNS--SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            MDK+ C N+  S  D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR
Sbjct  1    MDKRACNNNNNSPQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCR  60

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYLRPDVRRGNITP+EQLLIMELHAKWGN+WSKIAK LPGRTDNEIKN+WRTRIQK
Sbjct  61   LRWLNYLRPDVRRGNITPDEQLLIMELHAKWGNKWSKIAKQLPGRTDNEIKNYWRTRIQK  120

Query  528  HLKQ-------EAATNESTVISGQGS--------CDKTDQVsstsasqlsSIGQGDIYSS  394
            H+KQ       +++TN   ++S Q           +     SS+S     ++   + YS 
Sbjct  121  HIKQAHGFHTPQSSTN--ILLSSQDHHHHHHHQIMNNEQAASSSSCQVSYTMDPMETYSP  178

Query  393  PQSSFVCNMEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
            P  ++  N++  +       P  + SND  W M+D+ WSMQ+LN +
Sbjct  179  P--TYSQNIDAFSV----PLPPTDNSNDNYWSMEDL-WSMQLLNAE  217



>ref|XP_010514490.1| PREDICTED: transcription factor MYB21-like [Camelina sativa]
Length=224

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 153/209 (73%), Gaps = 14/209 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  16   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ  AT  S+V 
Sbjct  76   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADATTTSSVG  135

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYS-SPQSSFVCNMEIETG-FQGHHFPSHEY  319
            S   S +  DQ +STS+  +        + YS +P S    NME   G +      + +Y
Sbjct  136  SHH-SSEINDQAASTSSHNVFCTQDQPMETYSPTPTSYQHTNMEFNYGNYSTAATATVDY  194

Query  318  ---------SNDAVWGMDDISWSMQILNG  259
                     S +  WGMDDI  SM +LNG
Sbjct  195  PIPMTVDDQSGENYWGMDDIWSSMHLLNG  223



>ref|XP_002875402.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51661.1| ATMYB21 [Arabidopsis lyrata subsp. lyrata]
Length=226

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 150/210 (71%), Gaps = 13/210 (6%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  S+V 
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQADVTTTSSVG  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG-DIYS-SPQSSFVCNMEIETGFQGHHFPS-----  328
            S   S       S++S +   +  Q  + YS +P S    NME   G      P+     
Sbjct  137  SHHSSEINDQAASTSSHNVFCTQDQAMETYSPTPTSYQHTNMEFNYGNYSAAAPTATVDY  196

Query  327  ------HEYSNDAVWGMDDISWSMQILNGD  256
                   + + +  WGMDDI  SM +LNG+
Sbjct  197  PIPMTVDDQTGENYWGMDDIWSSMHLLNGN  226



>ref|XP_006470308.1| PREDICTED: myb-related protein 305-like isoform X1 [Citrus sinensis]
Length=194

 Score =   239 bits (610),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 150/207 (72%), Gaps = 16/207 (8%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            KT CNS   + E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  3    KTPCNSQ--EAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQE  514
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK +KQ 
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQ-  119

Query  513  AATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHF  334
                 +   SGQ S +  +Q SS+  S  +   +   YS+PQ     NM+    F   + 
Sbjct  120  -----AETFSGQ-SSEANEQASSSQMSTAAYTMED--YSAPQYPLNNNMDPHQAFPLDNM  171

Query  333  -PSHEYSNDAVWGMDDISWSMQILNGD  256
             P     N+  W M+D+ W   + NGD
Sbjct  172  APIPSEVNENYWSMEDL-W---LYNGD  194



>gb|KDO66125.1| hypothetical protein CISIN_1g045384mg [Citrus sinensis]
Length=194

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 150/207 (72%), Gaps = 16/207 (8%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            KT CNS   + E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  3    KTPCNSQ--EAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQE  514
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK +KQ 
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQ-  119

Query  513  AATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHF  334
                 +   SGQ S +  +Q SS+  S  +   +   YS+PQ     NM+    F   + 
Sbjct  120  -----AETFSGQ-SSEANEQASSSQMSTAAYTVED--YSAPQYPLNNNMDPHQAFPLDNM  171

Query  333  -PSHEYSNDAVWGMDDISWSMQILNGD  256
             P     N+  W M+D+ W   + NGD
Sbjct  172  APIPSEVNENYWSMEDL-W---LYNGD  194



>ref|XP_006446527.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
 gb|ESR59767.1| hypothetical protein CICLE_v10016820mg [Citrus clementina]
Length=194

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 150/207 (72%), Gaps = 16/207 (8%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            KT CNS   + E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLN
Sbjct  3    KTPCNSQ--EAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLN  60

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQE  514
            YLRPDV+RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK +KQ 
Sbjct  61   YLRPDVKRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKQIKQ-  119

Query  513  AATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHF  334
                 +   SGQ S +  +Q SS+  S  +   +   YS+PQ     NM+    F   + 
Sbjct  120  -----AETFSGQ-SSEANEQASSSQMSTAAYTVED--YSAPQYPLNNNMDPHQAFPLDNM  171

Query  333  -PSHEYSNDAVWGMDDISWSMQILNGD  256
             P     N+  W M+D+ W   + NGD
Sbjct  172  APIPSEVNENYWNMEDL-W---LYNGD  194



>ref|XP_011005145.1| PREDICTED: myb-related protein 305 isoform X2 [Populus euphratica]
Length=190

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 149/215 (69%), Gaps = 31/215 (14%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK  C   +S D E+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKSPC---NSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAK GNRWSKIAKHLPGRTDNEIKN+WRTRI+KH 
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKLGNRWSKIAKHLPGRTDNEIKNYWRTRIKKHT  117

Query  522  KQE---AATNESTVISGQGSC---DKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEI  361
            KQ    AA +  T   G  +C     TDQ+     +    + QGD+              
Sbjct  118  KQTEPFAAGSSETNEDGSSTCQVSSATDQM----EAYCPPLYQGDV--------------  159

Query  360  ETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               F G + P     N+  W MDD+ WSMQ+LNGD
Sbjct  160  -GAFSGGNIPQE--LNENYWSMDDL-WSMQLLNGD  190



>ref|NP_189418.2| transcription factor MYB21 [Arabidopsis thaliana]
 sp|Q9LK95.1|MYB21_ARATH RecName: Full=Transcription factor MYB21; AltName: Full=Myb homolog 
3; Short=AtMyb3; AltName: Full=Myb-related protein 21; 
Short=AtMYB21 [Arabidopsis thaliana]
 dbj|BAB02527.1| ATMYB3 [Arabidopsis thaliana]
 dbj|BAC43048.1| putative myb family transcription factor Atmyb3 [Arabidopsis 
thaliana]
 gb|AAS10059.1| MYB transcription factor [Arabidopsis thaliana]
 dbj|BAH30473.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77366.1| transcription factor MYB21 [Arabidopsis thaliana]
Length=226

 Score =   239 bits (609),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 149/210 (71%), Gaps = 13/210 (6%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  S+V 
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQSDVTTTSSVG  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG-DIYS-SPQSSFVCNMEIETGFQGH-------HF  334
            S   S       S++S +   +  Q  + YS +P S    NME   G            +
Sbjct  137  SHHSSEINDQAASTSSHNVFCTQDQAMETYSPTPTSYQHTNMEFNYGNYSAAAVTATVDY  196

Query  333  PSHEYSNDAV----WGMDDISWSMQILNGD  256
            P     +D      WGMDDI  SM +LNG+
Sbjct  197  PVPMTVDDQTGENYWGMDDIWSSMHLLNGN  226



>gb|KHG20022.1| Myb-related protein [Gossypium arboreum]
Length=213

 Score =   238 bits (607),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 155/221 (70%), Gaps = 20/221 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C    S D E+RKGPWTMEEDLILINYIA HGEGVWN+LA++AGLKRTGKSCRLR
Sbjct  1    MDKKPC---KSQDVEVRKGPWTMEEDLILINYIATHGEGVWNNLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFV-CNMEIETGFQ  346
             ++A    S  IS     D   Q S++      S    + Y SP SSF  CN+E   G Q
Sbjct  118  NKQAEM-FSFNISTPELLDH--QASTSQLPCNGSTSFMETY-SPMSSFNHCNLEPFPGQQ  173

Query  345  GHHFPSH-----------EYSNDAVWGMDDISWSMQILNGD  256
                              + +N++ W M+D  WSMQ+LNGD
Sbjct  174  QEVQQQQQQQPQQQHIVDQPNNESYWSMEDF-WSMQLLNGD  213



>ref|XP_004516766.1| PREDICTED: myb-related protein 305-like isoform X2 [Cicer arietinum]
Length=233

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 156/220 (71%), Gaps = 21/220 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK   CNSS  DP++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR R
Sbjct  24   MDKNKECNSSQ-DPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRFR  82

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIM+LHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  83   WLNYLRPDIRRGNITPEEQLLIMKLHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  142

Query  522  KQEAATNESTVISGQGSCDK----TDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIET  355
            KQ  A N     S Q +CD+     +Q++S+S     +    DI S P           +
Sbjct  143  KQ--AEN-----SQQQNCDQINDNNNQIASSSQVSNMAPEPMDI-SPPCYQGGILEPFSS  194

Query  354  GFQGHHFPSHE-------YSNDAVWGMDDISWSMQILNGD  256
                HHFP+           N+  W M+D   SMQ+LNGD
Sbjct  195  HDHHHHFPTISDQSSCCTNDNNNYWSMEDF-LSMQLLNGD  233



>ref|NP_001235865.1| MYB transcription factor MYB98 [Glycine max]
 gb|ABH02848.1| MYB transcription factor MYB98 [Glycine max]
 gb|KHN24348.1| Myb-related protein 305 [Glycine soja]
Length=204

 Score =   237 bits (604),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 157/215 (73%), Gaps = 20/215 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK    ++S+DPE+RKGPWTMEEDLILI YIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKK--LGNTSHDPEVRKGPWTMEEDLILITYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKHL
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHL  118

Query  522  KQEAATNEST-----VISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCN-MEI  361
            KQ +++ +       +I    +C  T QVS+ +          + YS P    + +   I
Sbjct  119  KQASSSFQQQSSNSEIIYHPQAC--TSQVSTMAQPI-------ETYSPPSYQGMLDPFSI  169

Query  360  ETGFQGHHFP--SHEYSNDAVWGMDDISWSMQILN  262
            +     HH    +++  N+  W M+DI WSMQ+ N
Sbjct  170  QFPTNPHHSSCCTNDDDNNNYWSMEDI-WSMQLAN  203



>gb|EPS65034.1| hypothetical protein M569_09745, partial [Genlisea aurea]
Length=207

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 147/207 (71%), Gaps = 22/207 (11%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK  C    S + E+RKGPWTMEEDLIL+NYIANHGEGVWNSLA+SAGLKRTGKSCRLR
Sbjct  1    MDKNIC---KSPEAEVRKGPWTMEEDLILMNYIANHGEGVWNSLAKSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHM  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ    N + +IS        D  +  ++S   S     + S   +SF       T    
Sbjct  118  KQTENNNGTELIS--------DNCNDRASSSNLSSSGPALESYSPTSF------NTAIDA  163

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILN  262
              F S+E+    +W MDD  WSM +LN
Sbjct  164  APFDSNEH----LWNMDDF-WSMHLLN  185



>ref|NP_001238263.1| uncharacterized protein LOC100306400 [Glycine max]
 gb|ACU14553.1| unknown [Glycine max]
Length=204

 Score =   237 bits (604),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 157/215 (73%), Gaps = 20/215 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK    ++S+DPE+RKGPWTMEEDLILI YIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKK--LGNTSHDPEVRKGPWTMEEDLILITYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKHL
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHL  118

Query  522  KQEAATNEST-----VISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCN-MEI  361
            KQ +++ +       +I    +C  T QVS+ +          + YS P    + +   I
Sbjct  119  KQASSSFQQQSSNSEIIYHPQAC--TSQVSTMAQPI-------ETYSPPSYQGMLDPYSI  169

Query  360  ETGFQGHHFP--SHEYSNDAVWGMDDISWSMQILN  262
            +     HH    +++  N+  W M+DI WSMQ+ N
Sbjct  170  QFPTNPHHSSCCTNDDDNNNYWSMEDI-WSMQLAN  203



>ref|XP_009111584.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 149/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST-V  490
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  +T  
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVTATTTSS  136

Query  489  ISGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETGFQGHHFPSHEY  319
            +    S +  DQV+STS   +        + YS   +S+   NM+   G      P+   
Sbjct  137  VGSHHSSEINDQVASTSNHNVFCTQDQAMETYSPTTTSYQHTNMDFNYGNFSAAGPTVTA  196

Query  318  SNDA---------------VWGMDDISWSMQILNGD  256
            +  A                WGMDDI  SM +LNG+
Sbjct  197  TTTADYSIPMTVDDQNGENYWGMDDIWSSMHLLNGN  232



>ref|XP_007140964.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
 gb|ESW12958.1| hypothetical protein PHAVU_008G155900g [Phaseolus vulgaris]
Length=199

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 146/211 (69%), Gaps = 17/211 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK   ++ S+DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKK--LSTMSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAK LPGRTDNEIKNFWRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKQLPGRTDNEIKNFWRTRIQKHM  118

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ  +  + +          T QV        S+I +     SP  S    M      Q 
Sbjct  119  KQTESFQQQSNSETNDHQACTSQV--------STIAEPMETYSP--SCYQGMLEPFSAQF  168

Query  342  HHFPSHEY----SNDAVWGMDDISWSMQILN  262
            H  P H       N   W M+DI  SMQ+ N
Sbjct  169  HTNPDHSSCCTNDNTNYWSMEDI-LSMQLAN  198



>gb|ABH02872.1| MYB transcription factor MYB99 [Glycine max]
Length=198

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 149/204 (73%), Gaps = 10/204 (5%)
 Frame = -1

Query  855  SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  676
            SS+DPE+RKGPWTMEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRWLNYLRPDV
Sbjct  1    SSHDPEVRKGPWTMEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYLRPDV  60

Query  675  RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNES  496
            RRG  TPEEQLLI+ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+KQ   + + 
Sbjct  61   RRGIFTPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHIKQAETSQQ-  119

Query  495  TVISGQGSCDKTD-QVsstsasqlsSIGQGDIYSSP--QSSF-VCNMEIETGFQGHHFPS  328
                  G+ +  D Q S++++   +     + +S P  Q +F     +  T        +
Sbjct  120  -----HGNSENNDHQASTSTSKVSTMAHPNETFSPPSYQGTFEPFQPQFPTITDQSSCCT  174

Query  327  HEYSNDAVWGMDDISWSMQILNGD  256
                N+  W ++DI  SMQ+LNGD
Sbjct  175  TTNDNNNYWSIEDIWSSMQLLNGD  198



>ref|XP_002298534.1| Myb26 family protein [Populus trichocarpa]
 gb|EEE83339.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 149/215 (69%), Gaps = 31/215 (14%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK  C   +S D E+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKSPC---NSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAK GNRWSKIAKHLPGRTDNEIKN+WRTRI+KH 
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKLGNRWSKIAKHLPGRTDNEIKNYWRTRIKKHT  117

Query  522  KQE---AATNESTVISGQGSC---DKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEI  361
            KQ    AA +  T   G  +C     TDQ+     +      QGD+              
Sbjct  118  KQTEPFAAGSSETNEHGSSTCQVSSATDQM----ETYCPPFYQGDV--------------  159

Query  360  ETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               F G + P  +  N+  W M+D+ WSMQ+LNGD
Sbjct  160  -GAFSGGNIP--QELNENYWSMEDL-WSMQLLNGD  190



>ref|XP_004142797.1| PREDICTED: myb-related protein 305-like [Cucumis sativus]
Length=209

 Score =   235 bits (600),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 155/217 (71%), Gaps = 18/217 (8%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+   +SS  D E+RKGPWTMEED +L+NYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKR--LSSSQDDDEVRKGPWTMEEDSMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTRIQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIMELHSKWGNRWSKIARHLPGRTDNEIKNYWRTRIQKHI  118

Query  522  K-QEAATNESTVISGQGSCDKTD---------QVsstsasqlsSIGQGDIYSSPQSSFVC  373
            K QE        +   GSC +T+         QVSS S          D + S Q     
Sbjct  119  KQQEEVERVRDQMISIGSCSETNDDCAISPWSQVSSFSNVAEPMEISHDYFPSSQG----  174

Query  372  NMEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILN  262
            +ME   G+Q   +   + +ND  W M+D+ WSMQ+L+
Sbjct  175  DMEA-MGYQQTSWDRGDGANDNYWSMEDL-WSMQLLD  209



>emb|CDX86471.1| BnaA06g31880D [Brassica napus]
Length=232

 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 148/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ      +T  
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVAATATSS  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETG------------  352
             G  S +  D  +STSA  +        D YS   +S+   NME   G            
Sbjct  137  VGSQSSEINDHAASTSAHNVFCAQDQAMDTYSPTTTSYQHTNMEFNYGNYSAPVAPVTTA  196

Query  351  FQGHHFPSHEYSNDAV----WGMDDISWSMQILNGD  256
                 +P     +D      WGMDDI  SM +LNG+
Sbjct  197  ATTADYPVPMTVDDQTGENYWGMDDIWSSMHLLNGN  232



>ref|XP_011013637.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score =   234 bits (598),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 155/211 (73%), Gaps = 22/211 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     S+S D EIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AGLKRTGKSCRLR
Sbjct  1    MDKTP---SNSQDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEA--ATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            KQ    A   S+  +  GS   + QVSST+           + S+   S+  ++E    F
Sbjct  118  KQAETFAAQVSSETNEHGS--NSSQVSSTTEL---------MVSNYLPSYQGDVE---AF  163

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             G + P  +  N+  W ++D+ WSMQ+LNGD
Sbjct  164  SGANIP--QELNENYWSIEDL-WSMQLLNGD  191



>emb|CDY44433.1| BnaC07g24710D [Brassica napus]
Length=232

 Score =   236 bits (601),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 149/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ      +T  
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVAATATSS  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETG------------  352
             G  S +  D  +STSA  +        D YS   +S+   NME   G            
Sbjct  137  VGSQSSEINDHAASTSAHNVFCAQDQAMDTYSPTTTSYQHTNMEFNYGNYSAPVAPVTTA  196

Query  351  --FQGHHFP--SHEYSNDAVWGMDDISWSMQILNGD  256
                 +  P    + + +  WGMDDI  SM +LNG+
Sbjct  197  ATTADYSVPMTVDDQTGENYWGMDDIWSSMHLLNGN  232



>ref|XP_011013294.1| PREDICTED: myb-related protein 305-like isoform X1 [Populus euphratica]
Length=191

 Score =   234 bits (597),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 155/211 (73%), Gaps = 22/211 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     S+S D EIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AGLKRTGKSCRLR
Sbjct  1    MDKTP---SNSRDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQEA--ATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            KQ    A   S+  +  GS   + QVSST+           + S+   S+  ++E    F
Sbjct  118  KQAETFAAQVSSETNEHGS--NSSQVSSTTEL---------MVSNYLPSYQGDVE---AF  163

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             G + P  +  N+  W ++D+ WSMQ+LNGD
Sbjct  164  SGANIP--QELNENYWSIEDL-WSMQLLNGD  191



>gb|AET25524.1| MYB1 [Brassica oleracea]
Length=232

 Score =   235 bits (600),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 150/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST-V  490
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  +T  
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVTATTTSS  136

Query  489  ISGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETG-----------  352
            +    S +  DQVSSTS   +        + YS   +S+   NM+   G           
Sbjct  137  VGSHHSSEINDQVSSTSNHNVFCTQDQAMETYSPTTTSYQHTNMDFNYGNYSAAAATATA  196

Query  351  --FQGHHFPS--HEYSNDAVWGMDDISWSMQILNGD  256
                 +  P    + + +  WGMDDI  SM +LNG+
Sbjct  197  TTTADYSIPMTVDDQTGENYWGMDDIWSSMHLLNGN  232



>ref|XP_009151925.1| PREDICTED: transcription factor MYB21 [Brassica rapa]
Length=232

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 147/216 (68%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   ETEVRKGPWTMEEDLILINYIANHGDGVWNTLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ      +T  
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVAATATSS  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETG------------  352
             G  S +  D  +STSA  +        D YS   +S+   NME   G            
Sbjct  137  VGSQSSEINDHAASTSAHNVFCAQDQAMDTYSPTTTSYQHTNMEFNYGNYSAPVAPVTTA  196

Query  351  FQGHHFPSHEYSNDAV----WGMDDISWSMQILNGD  256
                 +P     +D      WGMDDI  SM +LNG+
Sbjct  197  ATTADYPVPMTVDDQTGENYWGMDDIWSSMHLLNGN  232



>ref|XP_008458780.1| PREDICTED: myb-related protein 340-like [Cucumis melo]
Length=210

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 148/220 (67%), Gaps = 36/220 (16%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            +SS  D E+RKGPWTMEEDL+L+NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRP
Sbjct  7    SSSQDDDEVRKGPWTMEEDLMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRP  66

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK-QEAAT  505
            DVRRGNITPEEQLLIMELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTRIQKH+K QE   
Sbjct  67   DVRRGNITPEEQLLIMELHSKWGNRWSKIARHLPGRTDNEIKNYWRTRIQKHIKQQEEVE  126

Query  504  NESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSP--QSSFVCNMEIETGFQGHHFP  331
                 +   G+C +T+                D   SP  Q S  CN+         +FP
Sbjct  127  RVRDQMISIGNCSETND---------------DCAISPCSQVSSFCNVAEPMEISHDYFP  171

Query  330  SHE-----------------YSNDAVWGMDDISWSMQILN  262
            S +                  +ND  W M+D+ WSMQ+L+
Sbjct  172  SSQGDMEAMAYQHTTWDRGDGANDNYWSMEDL-WSMQLLD  210



>ref|XP_010108787.1| Myb-related protein 305 [Morus notabilis]
 gb|EXC20302.1| Myb-related protein 305 [Morus notabilis]
Length=225

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 159/226 (70%), Gaps = 18/226 (8%)
 Frame = -1

Query  882  MDKKTCCN-SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            MD K   N +SS D E+RKGPWTMEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRL
Sbjct  1    MDNKKASNINSSQDVEVRKGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRL  60

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH
Sbjct  61   RWLNYLRPDVRRGNITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKH  120

Query  525  LKQEAATNESTVISGQGS--CDKTDQVsstsasqlsSIGQGDIYSSPQSSFVC-----NM  367
            ++Q      + +I  Q S      +Q S++ AS  +++   +I ++    F+      N+
Sbjct  121  IRQADQHQSNNMIHRQNSEMMIINNQASTSQASACNTVDAMEISNTYSPPFISHQGSYNI  180

Query  366  EIETGFQGHHFPSH---------EYSNDAVWGMDDISWSMQILNGD  256
            + +T +     P+          ++ N     M+D+ WSMQ+ N D
Sbjct  181  DHQTNYPLALPPTTTSTTSSSNIDHQNYNWSAMEDL-WSMQLFNSD  225



>ref|XP_002323803.1| Myb26 family protein [Populus trichocarpa]
 gb|EEF03936.1| Myb26 family protein [Populus trichocarpa]
Length=190

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 152/210 (72%), Gaps = 21/210 (10%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     S+S D E+RKGPWT+EEDLIL N+IANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKTP---SNSQDVEVRKGPWTLEEDLILTNHIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  117

Query  522  KQ-EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
            KQ E    +S+  +  GS       ++             + S+   S+  ++E    F 
Sbjct  118  KQAETFAAQSSETNEHGSSSSQVSSTTEL-----------MVSNCLPSYQGDVE---AFS  163

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
            G + P  +  N+  W M+D+ WSMQ+LNGD
Sbjct  164  GGNIP--QELNENYWSMEDL-WSMQLLNGD  190



>dbj|BAA21618.1| ATMYB3 [Arabidopsis thaliana]
Length=226

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/210 (62%), Positives = 148/210 (70%), Gaps = 13/210 (6%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNF RTRIQK++KQ   T  S+V 
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFCRTRIQKYIKQSDVTTTSSVG  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG-DIYS-SPQSSFVCNMEIETGFQGH-------HF  334
            S   S       S++S +   +  Q  + YS +P S    NME   G            +
Sbjct  137  SHHSSEINDQAASTSSHNVFCTQDQAMETYSPTPTSYQHTNMEFNYGNYSAAAVTATVDY  196

Query  333  PSHEYSNDAV----WGMDDISWSMQILNGD  256
            P     +D      WGMDDI  SM +LNG+
Sbjct  197  PVPMTVDDQTGENYWGMDDIWSSMHLLNGN  226



>emb|CDY20036.1| BnaA09g02150D [Brassica napus]
Length=232

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 150/216 (69%), Gaps = 19/216 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST-V  490
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  +T  
Sbjct  77   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVTATTTSS  136

Query  489  ISGQGSCDKTDQVsstsasqlsSIGQG--DIYSSPQSSFV-CNMEIETG-----------  352
            +    S +  DQV+STS   +        + YS   +S+   NM+   G           
Sbjct  137  VGSHHSSEINDQVASTSNHNVFCTQDQAMETYSPTTTSYQHTNMDFNYGNFSAAAATVTA  196

Query  351  --FQGHHFPS--HEYSNDAVWGMDDISWSMQILNGD  256
                 +  P    + + +  WGMDDI  SM +LNG+
Sbjct  197  TTTADYSIPMTVDDQNGENYWGMDDIWSSMHLLNGN  232



>ref|XP_006395401.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
 gb|ESQ32687.1| hypothetical protein EUTSA_v10004857mg [Eutrema salsugineum]
Length=233

 Score =   234 bits (597),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 152/217 (70%), Gaps = 20/217 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ   T  +T  
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQTDVTTTTTSS  136

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG---DIYSSPQSSFV-CNMEIETG-FQGHHF----  334
             G     + +  ++++ S      Q    + YS   +S+   NME   G +   ++    
Sbjct  137  VGSHQSSEINDQAASTTSHNVFCTQDQAMETYSPTTTSYQHTNMEFNYGNYSAGNYSTAG  196

Query  333  --PSHEYS---------NDAVWGMDDISWSMQILNGD  256
               + +YS          +  WGMDDI  SM +LNG+
Sbjct  197  ATATADYSVPMTVDDQTGENYWGMDDIWSSMHLLNGN  233



>gb|ACL81164.1| MYB transcription factor [Mirabilis jalapa]
Length=209

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 144/208 (69%), Gaps = 11/208 (5%)
 Frame = -1

Query  858  SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  679
            +++ + E+RKGPWTMEEDLILINYI  HGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD
Sbjct  6    NTTQENEVRKGPWTMEEDLILINYIVTHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  65

Query  678  VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNE  499
            VRRGNI+PEE+LLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKHLK+     E
Sbjct  66   VRRGNISPEEELLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHLKRV----E  121

Query  498  STVISGQGSCDKTDQVsstsasqls----SIGQGDIYSSP--QSSFVCNMEIETGFQGHH  337
            +   SGQ S D  DQ S++     +         D    P    S   N  +E  +  +H
Sbjct  122  NNSNSGQISPDHNDQASASHMQTSALTCSYTTDNDHAYMPCMSPSSYSNQAMEVSYMMNH  181

Query  336  FPSHEYSNDAVWGMDDIS-WSMQILNGD  256
                + ++   W   D   WSMQ+ N D
Sbjct  182  HLQQDTNDQFCWTNPDQDLWSMQLFNAD  209



>ref|XP_004156725.1| PREDICTED: LOW QUALITY PROTEIN: myb-related protein 305-like 
[Cucumis sativus]
Length=210

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 150/210 (71%), Gaps = 16/210 (8%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            +SS  D E+RKGPWTMEED +L+NYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRP
Sbjct  7    SSSQDDDEVRKGPWTMEEDSMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRP  66

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK-QEAAT  505
            DVRRGNITPEEQLLIMELH+KWGNRWSKIA+H PGRTDNEIKN+WRTRIQKH+K QE   
Sbjct  67   DVRRGNITPEEQLLIMELHSKWGNRWSKIARHXPGRTDNEIKNYWRTRIQKHIKQQEEVE  126

Query  504  NESTVISGQGSCDKTD---------QVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETG  352
                 +   GSC +T+         QVSS S          D + S Q     +ME   G
Sbjct  127  RVRDQMISIGSCSETNDDCAISPWSQVSSFSNVAEPMEISHDYFPSSQG----DMEA-MG  181

Query  351  FQGHHFPSHEYSNDAVWGMDDISWSMQILN  262
            +Q   +   + +ND  W M+D+ WSMQ+L+
Sbjct  182  YQQTSWDRGDGANDNYWSMEDL-WSMQLLD  210



>ref|XP_010555954.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=207

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 147/205 (72%), Gaps = 13/205 (6%)
 Frame = -1

Query  852  SYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  673
            S + ++RKGPWTMEEDLILINYI+NHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPD+R
Sbjct  10   SGEEDVRKGPWTMEEDLILINYISNHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDLR  69

Query  672  RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST  493
            RGNIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTR+QK++KQ   T   +
Sbjct  70   RGNITSEEQLVIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRVQKYIKQAETT---S  126

Query  492  VISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHH-----FPS  328
             +  QGS +  DQ  S+             Y  P +S+  NME+              P 
Sbjct  127  SVGSQGS-EINDQAGSSQIFGTQQEATETYY--PTTSYQGNMELNYDSPMSSEWLMPMPM  183

Query  327  H-EYSNDAVWGMDDISWSMQILNGD  256
              + + +  W MDDI WSMQ+LNG+
Sbjct  184  QIDQTGENYWTMDDI-WSMQLLNGN  207



>ref|XP_010555957.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=206

 Score =   229 bits (585),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 147/205 (72%), Gaps = 14/205 (7%)
 Frame = -1

Query  852  SYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVR  673
            S + ++RKGPWTMEEDLILINYI NHG+GVWNSLA++AGLKRTGKSCRLRWLNYLRPD+R
Sbjct  10   SGEEDVRKGPWTMEEDLILINYITNHGDGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDLR  69

Query  672  RGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST  493
            RGNIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTR+QK++KQ   T   +
Sbjct  70   RGNITSEEQLVIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRVQKYIKQSETT---S  126

Query  492  VISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHH-----FPS  328
             +  QGS +  DQ SS+         +      P +S+  NME+              P 
Sbjct  127  AVGSQGS-EINDQPSSSQIFSAQEAMETYF---PTTSYQANMEVNYDSPMSSEWLMPMPM  182

Query  327  H-EYSNDAVWGMDDISWSMQILNGD  256
              + + +  W MDDI WSMQ+LNG+
Sbjct  183  QIDQTGENYWTMDDI-WSMQLLNGN  206



>gb|KFK33688.1| hypothetical protein AALP_AA5G046900 [Arabis alpina]
Length=228

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 154/214 (72%), Gaps = 19/214 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+RKGPWTMEEDLILINYIANHG+GVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   EAEVRKGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK++KQ+  T  ++  
Sbjct  77   NITPEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKYIKQDVTTTTTS--  134

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG---DIYSSPQSSFV--CNMEIETGFQ--------  346
            S    C + +  +++++S      Q    + YS   +S+    NM+   G Q        
Sbjct  135  SVGSGCSEINDQAASTSSHNVFCTQDQAMETYSPTTTSYQQHPNMDFNYGNQYSAAATTA  194

Query  345  --GHHFPSH--EYSNDAVWGMDDISWSMQILNGD  256
               +  P +  + S +  WGMDDI  SM +LNG+
Sbjct  195  TADYPIPMNVDDQSGENYWGMDDIWSSMHLLNGN  228



>ref|XP_010554050.1| PREDICTED: transcription factor MYB21-like [Tarenaya hassleriana]
Length=202

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 152/211 (72%), Gaps = 23/211 (11%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            +S S + E+RKGPWTMEEDLILINYI +HG+GVWNSLA++AGLKRTGKSCRLRWLNYLRP
Sbjct  6    SSGSEEAEVRKGPWTMEEDLILINYITHHGDGVWNSLAKAAGLKRTGKSCRLRWLNYLRP  65

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATN  502
            DVRRGNIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTR+QK++KQ   T+
Sbjct  66   DVRRGNITAEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRVQKYIKQSETTS  125

Query  501  ESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHE  322
                +  QGS +  DQ  S   S   ++   + YS+  +S+  +ME+      H +P   
Sbjct  126  S---VGSQGS-EINDQYPSHVFSARDAM---EAYST-TTSYQGDMEL-----NHSYPMSS  172

Query  321  YS---------NDAVWGMDDISWSMQILNGD  256
             S          +  W MDD+ WSMQ+L+ +
Sbjct  173  VSPMSLTVDQPGENYWTMDDL-WSMQLLDSN  202



>gb|AAM63674.1| putative transcription factor MYB24 [Arabidopsis thaliana]
Length=214

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 150/208 (72%), Gaps = 18/208 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++     + E+T +
Sbjct  74   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYI---IKSGETTTV  130

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSF--VCNMEIETGFQGHHFP------  331
              Q S +  +  ++TS     +    D+Y SP +S+    N+  +  + G++ P      
Sbjct  131  GSQ-SSEFINHHATTSHVMNDTQETMDMY-SPTTSYQHASNINQQLNY-GNYVPESSSIM  187

Query  330  ---SHEYSNDAVWGMDDISWSMQILNGD  256
               S + S    W +DD+ W M I NG+
Sbjct  188  MPLSVDQSEQNYWSVDDL-WPMNIYNGN  214



>ref|NP_198851.1| myb domain protein 24 [Arabidopsis thaliana]
 sp|Q9SPG9.1|MYB24_ARATH RecName: Full=Transcription factor MYB24; AltName: Full=Myb-related 
protein 24; Short=AtMYB24 [Arabidopsis thaliana]
 gb|AAD53092.1|AF175987_1 putative transcription factor [Arabidopsis thaliana]
 dbj|BAB11590.1| transcription factor [Arabidopsis thaliana]
 gb|AAS10102.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED94536.1| myb domain protein 24 [Arabidopsis thaliana]
Length=214

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 150/208 (72%), Gaps = 18/208 (9%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NITPEEQL IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++     + E+T +
Sbjct  74   NITPEEQLTIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYI---IKSGETTTV  130

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSF--VCNMEIETGFQGHHFP------  331
              Q S +  +  ++TS     +    D+Y SP +S+    N+  +  + G++ P      
Sbjct  131  GSQ-SSEFINHHATTSHVMNDTQETMDMY-SPTTSYQHASNINQQLNY-GNYVPESGSIM  187

Query  330  ---SHEYSNDAVWGMDDISWSMQILNGD  256
               S + S    W +DD+ W M I NG+
Sbjct  188  MPLSVDQSEQNYWSVDDL-WPMNIYNGN  214



>gb|ACR15115.1| MYBF1 [Populus x canadensis]
Length=190

 Score =   228 bits (580),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 147/215 (68%), Gaps = 31/215 (14%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK  C   +S D E+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKSPC---NSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD++RGNITP+ QLLIMELHAK GNRWSKIAKHLPGRTDNEIKN+WRTRI+KH 
Sbjct  58   WLNYLRPDLKRGNITPDGQLLIMELHAKLGNRWSKIAKHLPGRTDNEIKNYWRTRIKKHT  117

Query  522  KQE---AATNESTVISGQGSC---DKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEI  361
            KQ    AA +  T   G  +C     TDQ+     +      QGD+              
Sbjct  118  KQSEPFAAGSSETNEHGSSTCQVSSATDQM----ETYCPPFYQGDV--------------  159

Query  360  ETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               F G + P  +  N+  W M+D+ WSMQ+ NGD
Sbjct  160  -GAFSGGNIP--QELNENYWSMEDL-WSMQLRNGD  190



>ref|XP_011005144.1| PREDICTED: myb-related protein 305 isoform X1 [Populus euphratica]
Length=201

 Score =   228 bits (580),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 148/226 (65%), Gaps = 42/226 (19%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK  C   +S D E+RKGPWT+EEDLIL NYIANHGEGVWNSLA++AGLKRTGKSCRLR
Sbjct  1    MDKSPC---NSQDVEVRKGPWTLEEDLILTNYIANHGEGVWNSLAKAAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNR-----------WSKIAKHLPGRTDNEIK  556
            WLNYLRPD+RRGNITPEEQLLIMELHAK GN            WSKIAKHLPGRTDNEIK
Sbjct  58   WLNYLRPDLRRGNITPEEQLLIMELHAKLGNSIKKYIHIYIYVWSKIAKHLPGRTDNEIK  117

Query  555  NFWRTRIQKHLKQE---AATNESTVISGQGSC---DKTDQVsstsasqlsSIGQGDIYSS  394
            N+WRTRI+KH KQ    AA +  T   G  +C     TDQ+     +    + QGD+   
Sbjct  118  NYWRTRIKKHTKQTEPFAAGSSETNEDGSSTCQVSSATDQM----EAYCPPLYQGDV---  170

Query  393  PQSSFVCNMEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                          F G + P     N+  W MDD+ WSMQ+LNGD
Sbjct  171  ------------GAFSGGNIPQE--LNENYWSMDDL-WSMQLLNGD  201



>ref|XP_008812482.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=201

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 150/211 (71%), Gaps = 17/211 (8%)
 Frame = -1

Query  885  KMDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            +MDK     +SS + E+RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRL
Sbjct  7    RMDKSI---NSSQETEVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRL  63

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK LPGRTDNEIKN+WRTRIQK 
Sbjct  64   RWLNYLRPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQLPGRTDNEIKNYWRTRIQKK  123

Query  525  LKQ-EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            +KQ E+   +  +++ + S   +        + +  +G    Y+  Q   V N +     
Sbjct  124  VKQGESFDYQQAMVTDETSTSNSTSQ----TNSVEDVGLQPSYAQTQ---VTNPDALPP-  175

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               HF S E S+D  W ++D  WSMQ  NGD
Sbjct  176  ---HFSSTE-SSDNFWSVEDF-WSMQQFNGD  201



>ref|XP_006405505.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
 gb|ESQ46958.1| hypothetical protein EUTSA_v10027930mg [Eutrema salsugineum]
Length=214

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 149/207 (72%), Gaps = 16/207 (8%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  14   DAEVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  73

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++ ++    E+T +
Sbjct  74   NITAEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYIIKQG---ETTNV  130

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ-GHHFPSH-----  325
              Q S    D+ +STS    +     DIY SP +S+      +  F  G++ PS      
Sbjct  131  GSQSSEMINDRATSTSHVLNAQETM-DIY-SPLTSYQQTNNTDHQFNYGNYVPSSDSIMM  188

Query  324  ----EYSNDAVWGMDDISWSMQILNGD  256
                + S +  W +DD+ W M +  G+
Sbjct  189  PLAVDQSEENCWSVDDL-WPMHLFGGN  214



>ref|XP_010677862.1| PREDICTED: myb-related protein 305-like [Beta vulgaris subsp. 
vulgaris]
Length=231

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/114 (93%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -1

Query  858  SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  679
            ++S D E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD
Sbjct  6    NNSQDNEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  65

Query  678  VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            VRRGNIT EE+LLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKHLKQ
Sbjct  66   VRRGNITAEEELLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHLKQ  119



>ref|XP_008800726.1| PREDICTED: myb-related protein 305-like [Phoenix dactylifera]
Length=215

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 146/218 (67%), Gaps = 22/218 (10%)
 Frame = -1

Query  897  SPLIK----MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLK  730
            SP+++    MDK+    +SS + E+RKGPWTMEEDLILINYIANHGEGVWN++ARSAGL 
Sbjct  16   SPMVEEANSMDKRI---NSSQEAEVRKGPWTMEEDLILINYIANHGEGVWNNIARSAGLN  72

Query  729  RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNF  550
            RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHA+WGNRWSKIA+ LPGRTDNEIKN+
Sbjct  73   RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHARWGNRWSKIARQLPGRTDNEIKNY  132

Query  549  WRTRIQKHLKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCN  370
            WRTRIQK +K   + +   V+    +   T Q +S                  Q S+   
Sbjct  133  WRTRIQKKVKHGESFDYQHVMLTDEASTSTSQTNSVED------------GGSQPSYTEQ  180

Query  369  MEIETGFQGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             E         F +   S+D  W ++D  W MQ LNGD
Sbjct  181  HETNPDALAPQFSTE--SSDNFWSVEDF-WLMQSLNGD  215



>ref|XP_010925788.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=201

 Score =   225 bits (574),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 148/211 (70%), Gaps = 19/211 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+    +SS + E+RKGPWT EEDLILINYIANHGEG WN+LARSAGL RTGKSCRLR
Sbjct  8    MDKRI---NSSQEAEVRKGPWTKEEDLILINYIANHGEGAWNNLARSAGLNRTGKSCRLR  64

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK LPGRTD+EIKN+WRTRIQK +
Sbjct  65   WLNYLRPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQLPGRTDHEIKNYWRTRIQKRV  124

Query  522  KQEAATN--ESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            +   + +  ++ VI    +   T Q +S            DI   PQ S++         
Sbjct  125  EHGESFDYHQAMVIDEASASTITSQTNSVE----------DI--GPQPSYIERQAPNPDA  172

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               HF S E SN+  W ++D+ WSMQ L+GD
Sbjct  173  FAPHFSSTECSNN-FWSVEDL-WSMQSLSGD  201



>gb|AEE37094.1| MYB transcription factor [Crocus sativus]
Length=196

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/204 (57%), Positives = 142/204 (70%), Gaps = 16/204 (8%)
 Frame = -1

Query  858  SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  679
            +S  D E+RKGPWTMEEDLILINYIANHGEGVWN+LA+SAGLKRTGKSCRLRWLNYLRPD
Sbjct  6    NSGEDTEVRKGPWTMEEDLILINYIANHGEGVWNTLAKSAGLKRTGKSCRLRWLNYLRPD  65

Query  678  VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEA---A  508
            VRRGNITPEEQLLIMELH++WGNRWSKIA+ LPGRTDNEIKN+WRTRIQK  K E     
Sbjct  66   VRRGNITPEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKTKSEPLDYQ  125

Query  507  TNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPS  328
              +  ++    +    + +   +A Q   +   +I S+   +F   M          F +
Sbjct  126  NQQMMMVDDASTSHSNNGIDEGNAQQSYQMDMSNISSTSTDAFAVPM----------FST  175

Query  327  HEYSNDAVWGMDDISWSMQILNGD  256
               S++  W ++D  W+MQ LNGD
Sbjct  176  E--SSENFWTVEDF-WTMQPLNGD  196



>gb|KHN27441.1| Myb-related protein 305 [Glycine soja]
Length=201

 Score =   224 bits (572),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 152/218 (70%), Gaps = 26/218 (12%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C NSSS+DPE+RKGPWTMEEDLILINYIANHGEG      +  G  RTGKSCRLR
Sbjct  1    MDKKPC-NSSSHDPEVRKGPWTMEEDLILINYIANHGEG-----PKLLGDIRTGKSCRLR  54

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+
Sbjct  55   WLNYLRPDVRRGNITPEEQLLIIELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHI  114

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            KQ   + +       G+ +  D  +STS S++S++   +   SP  S+    E    FQ 
Sbjct  115  KQAETSQQ------HGNSENNDHQASTSTSKVSTMAHPNETFSP-PSYQGTFE---PFQP  164

Query  342  HHFP---------SHEYSNDAVWGMDDISWSMQILNGD  256
              FP         +    N+  W ++DI  SMQ+LNGD
Sbjct  165  -QFPTITDQSSCCTTTNDNNNYWSIEDIWSSMQLLNGD  201



>ref|XP_010924268.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=198

 Score =   224 bits (570),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 139/209 (67%), Gaps = 18/209 (9%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK   C   S + E+RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRLR
Sbjct  8    MDKGINC---SEEAEVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRLR  64

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELHA+WGNRWSKIA+ LPGRTDNEIKN+WRTRIQK +
Sbjct  65   WLNYLRPDVRRGNITPEEQLLIMELHARWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKV  124

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            K   +++    +    +   T Q +S                  Q S+    + ET    
Sbjct  125  KHGESSDYQHAMLIDEASTTTSQTNSVED------------GGAQPSYT--QQRETNPVA  170

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
               P    S D  W ++D  WSMQ  NGD
Sbjct  171  LAPPFSTESCDNFWSVEDF-WSMQSFNGD  198



>ref|XP_010925776.1| PREDICTED: myb-related protein 305-like [Elaeis guineensis]
Length=195

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 148/209 (71%), Gaps = 14/209 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     +SS +  +RKGPWTMEEDLILINYIANHGEGVWN+LARSAGL RTGKSCRLR
Sbjct  1    MDKTI---NSSQEAAVRKGPWTMEEDLILINYIANHGEGVWNNLARSAGLNRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYL+PDVRRGNITPEEQLLIM+LHA+WGNRWSKIAK LPGRTDNEIKN+WRTRIQK +
Sbjct  58   WLNYLKPDVRRGNITPEEQLLIMDLHARWGNRWSKIAKQLPGRTDNEIKNYWRTRIQKKV  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            K   + +    +        TD+ S+++ S   +    D+  +PQ S+  +   +     
Sbjct  118  KHGESFDYQHAMV-------TDEASTSTTSTSQTNSVEDV--APQPSYTEHQATDPHALA  168

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
              F S E S+D  W ++D  WSM  LNGD
Sbjct  169  PPFSSTE-SSDNFWTVEDF-WSMHSLNGD  195



>dbj|BAB40790.1| LhMyb [Lilium hybrid division I]
Length=184

 Score =   222 bits (566),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 4/145 (3%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MD+K   N    D E+RKGPWTMEEDLILINYIANHG+GVWN+LARSAGLKRTGKSCRLR
Sbjct  1    MDRKVGTNE---DVEVRKGPWTMEEDLILINYIANHGDGVWNTLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLIMELH +WGNRWSKIAK LPGRTDNEIKNFWRTR+QK  
Sbjct  58   WLNYLRPDVRRGNITPEEQLLIMELHDRWGNRWSKIAKELPGRTDNEIKNFWRTRVQKKS  117

Query  522  KQ-EAATNESTVISGQGSCDKTDQV  451
            K  E++  + +++S + S  + + V
Sbjct  118  KNGESSEGQISMLSDETSAMQMEDV  142



>ref|XP_004516765.1| PREDICTED: myb-related protein 305-like isoform X1 [Cicer arietinum]
Length=257

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 156/244 (64%), Gaps = 45/244 (18%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK   CNSS  DP++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR R
Sbjct  24   MDKNKECNSSQ-DPDVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRFR  82

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGN------------------------RWSKI  595
            WLNYLRPD+RRGNITPEEQLLIM+LHAKWGN                        RWSKI
Sbjct  83   WLNYLRPDIRRGNITPEEQLLIMKLHAKWGNRGFKIIVFHSLDTRTGVLFSFKGYRWSKI  142

Query  594  AKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQGSCDK----TDQVsstsasql  427
            AKHLPGRTDNEIKN+WRTRIQKH+KQ  A N     S Q +CD+     +Q++S+S    
Sbjct  143  AKHLPGRTDNEIKNYWRTRIQKHIKQ--AEN-----SQQQNCDQINDNNNQIASSSQVSN  195

Query  426  sSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHE-------YSNDAVWGMDDISWSMQI  268
             +    DI S P           +    HHFP+           N+  W M+D   SMQ+
Sbjct  196  MAPEPMDI-SPPCYQGGILEPFSSHDHHHHFPTISDQSSCCTNDNNNYWSMEDF-LSMQL  253

Query  267  LNGD  256
            LNGD
Sbjct  254  LNGD  257



>ref|XP_010435910.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   223 bits (567),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 147/215 (68%), Gaps = 10/215 (5%)
 Frame = -1

Query  882  MDKKTCCN--SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            M+K+   N  S S D ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCR
Sbjct  1    MEKRVKGNGGSGSGDADVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCR  60

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYLRPDVRRGNIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK
Sbjct  61   LRWLNYLRPDVRRGNITAEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQK  120

Query  528  HLKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            ++ +     E+T    Q S       +ST      +    D+YS   ++    +  +T  
Sbjct  121  YIIKNG---ETTTAGSQSSEIINHHATSTGQVLTDTQEPMDMYSQHANNIDHQLSYDTYV  177

Query  348  ---QGHHFP-SHEYSNDAVWGMDDISWSMQILNGD  256
                    P S + S    W +DD+ W M + NG+
Sbjct  178  PESDSIMMPLSVDQSEQNYWSVDDL-WPMHLYNGN  211



>gb|ACB59076.2| Myb-like transcription factor EOBI [Petunia x hybrida]
Length=105

 Score =   218 bits (555),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 105/105 (100%), Gaps = 0/105 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  1    EVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  60

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH
Sbjct  61   TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKH  105



>ref|XP_006285780.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
 gb|EOA18678.1| hypothetical protein CARUB_v10007254mg [Capsella rubella]
Length=221

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 145/208 (70%), Gaps = 14/208 (7%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++RKGPWTMEEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  17   DADVRKGPWTMEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  76

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++ +   T  +T  
Sbjct  77   NITAEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYIIKNGET--TTTA  134

Query  486  SGQGSCDKTDQVsstsasqlsSIGQG-DIYSSPQS-SFVCNMEIETGFQGHHFP------  331
              Q S      V+STS     ++ +  D+YS   S  +  N++      G + P      
Sbjct  135  GLQSSEIMNHHVTSTSKVLNDTLEEPMDLYSPTTSYQYANNIDHLQLSYGTYVPESDSIM  194

Query  330  ---SHEYSNDAVWGMDDISWSMQILNGD  256
               S +      W +DD+ W M + NG+
Sbjct  195  MPLSIDQDVQNYWSVDDL-WPMHLYNGN  221



>gb|KHN27530.1| Myb-related protein 305 [Glycine soja]
Length=187

 Score =   219 bits (558),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 138/194 (71%), Gaps = 14/194 (7%)
 Frame = -1

Query  816  MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  637
            MEEDLILINYIANHGEGVWNSLA++AGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  636  MELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK-----QEAATNESTVISGQGS  472
            MELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+K     Q+  +N S +   Q S
Sbjct  61   MELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHIKQAENFQQQISNNSEINDHQAS  120

Query  471  CDKTDQVsstsasqlsSIGQG--DIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
                  ++    +      QG  + +SS Q   + N +  +     +  S  Y     W 
Sbjct  121  TSHVSTMAEPMETYSPPFYQGMLEPFSSIQFPTI-NPDQSSCCTNDNNNSINY-----WS  174

Query  297  MDDISWSMQILNGD  256
            M+DI WSMQ+LNGD
Sbjct  175  MEDI-WSMQLLNGD  187



>gb|KHN23525.1| Transcription factor MYB21 [Glycine soja]
Length=185

 Score =   219 bits (557),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 143/193 (74%), Gaps = 14/193 (7%)
 Frame = -1

Query  816  MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  637
            MEEDLILINYIANHGEGVWNSLA+++GLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDLILINYIANHGEGVWNSLAKASGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  636  MELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQGSCDKTD  457
            +ELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH+KQ A T++    S + S +   
Sbjct  61   IELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHIKQ-AETSQQHGNSSENS-NNDH  118

Query  456  QVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFP------SHEYSNDAVWGM  295
            Q S++++   +     + +S P  S+    E    FQ   FP      S   SN+  W +
Sbjct  119  QASNSTSKVSTMAHPNETFSPP--SYQATFE---PFQP-QFPTINDQSSCCTSNNNYWSI  172

Query  294  DDISWSMQILNGD  256
            +DI  SMQ+LNGD
Sbjct  173  EDIWSSMQLLNGD  185



>ref|XP_010251229.1| PREDICTED: myb-related protein 340-like [Nelumbo nucifera]
Length=184

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 118/146 (81%), Gaps = 10/146 (7%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK      S +PE+RKGPWTMEEDLIL+NYI NHGEG WNSLARSAGLKRTGKSCRLR
Sbjct  1    MDKKP---GRSQEPEVRKGPWTMEEDLILMNYIGNHGEGEWNSLARSAGLKRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYL+PDVRRGNIT EEQLLIMELHA+WGNRWSKIAKHLPGRTDNEIKN+WRT+I+KH+
Sbjct  58   WLNYLKPDVRRGNITAEEQLLIMELHARWGNRWSKIAKHLPGRTDNEIKNYWRTKIRKHI  117

Query  522  K-------QEAATNESTVISGQGSCD  466
            K       Q +  N     S Q S D
Sbjct  118  KEAENNPSQSSEINPEQTTSSQVSSD  143



>ref|XP_011013638.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score =   218 bits (556),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 150/211 (71%), Gaps = 27/211 (13%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     S+S D EIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AG     KSCRLR
Sbjct  1    MDKTP---SNSQDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAG-----KSCRLR  52

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  53   WLNYLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  112

Query  522  KQEA--ATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            KQ    A   S+  +  GS   + QVSST+           + S+   S+  ++E    F
Sbjct  113  KQAETFAAQVSSETNEHGS--NSSQVSSTTEL---------MVSNYLPSYQGDVE---AF  158

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             G + P  +  N+  W ++D+ WSMQ+LNGD
Sbjct  159  SGANIP--QELNENYWSIEDL-WSMQLLNGD  186



>ref|XP_011013295.1| PREDICTED: myb-related protein 305-like isoform X2 [Populus euphratica]
Length=186

 Score =   218 bits (556),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 150/211 (71%), Gaps = 27/211 (13%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK     S+S D EIRKGPWT+EEDLIL N+IANHGEGVWNSLA+ AG     KSCRLR
Sbjct  1    MDKTP---SNSRDVEIRKGPWTLEEDLILTNHIANHGEGVWNSLAKDAG-----KSCRLR  52

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPD+RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKH+
Sbjct  53   WLNYLRPDLRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHI  112

Query  522  KQEA--ATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF  349
            KQ    A   S+  +  GS   + QVSST+           + S+   S+  ++E    F
Sbjct  113  KQAETFAAQVSSETNEHGS--NSSQVSSTTEL---------MVSNYLPSYQGDVE---AF  158

Query  348  QGHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             G + P  +  N+  W ++D+ WSMQ+LNGD
Sbjct  159  SGANIP--QELNENYWSIEDL-WSMQLLNGD  186



>emb|CDY49063.1| BnaC05g48910D [Brassica napus]
Length=207

 Score =   218 bits (555),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 137/194 (71%), Gaps = 13/194 (7%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQ  478
             EEQLLI++LHAK GNRWSKIAK+LPGRTDNEIKNFWRT+IQ+H+K  ++ N  T+ +  
Sbjct  83   AEEQLLIIQLHAKLGNRWSKIAKYLPGRTDNEIKNFWRTKIQRHVKFSSSVN--TINTRH  140

Query  477  GSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
             S +    V          I   D  SS +   +    I        F   E SND+ W 
Sbjct  141  CSGNSQSSV----------ITATDQGSSSKGFDMAESLISPATTTTSFHMMEQSNDSYWN  190

Query  297  MDDISWSMQILNGD  256
            ++D+ W +Q+LNGD
Sbjct  191  VEDL-WPLQLLNGD  203



>ref|XP_009419837.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   217 bits (552),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 142/209 (68%), Gaps = 13/209 (6%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDK+    S+S + E+RKGPWTMEEDLILINYI NHGEGVWN++ARSAGL RTGKSCRLR
Sbjct  1    MDKRI---SNSQEAEVRKGPWTMEEDLILINYITNHGEGVWNNVARSAGLNRTGKSCRLR  57

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQ LIMELHA+WGNRWSKIA+ LPGRTDNEIKNFWRTRIQK L
Sbjct  58   WLNYLRPDVRRGNITPEEQHLIMELHARWGNRWSKIARQLPGRTDNEIKNFWRTRIQKKL  117

Query  522  KQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQG  343
            K         V+    +   T QV++T+           ++   Q++    M  E   + 
Sbjct  118  KHGEPFGVQNVMLTDEASTSTTQVNTTTDEGAQPGAYTHMHDEQQTANPDGMISEFSTE-  176

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                    S+D  W +DD  WSM  LNGD
Sbjct  177  --------SSDNFWTVDDF-WSMPSLNGD  196



>dbj|BAL41446.1| transcription factor MYB21 [Linum grandiflorum]
Length=224

 Score =   217 bits (553),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 105/107 (98%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            IRKGPWTMEEDLILINYIANHGEGVWNSLA SAGLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  24   IRKGPWTMEEDLILINYIANHGEGVWNSLALSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  83

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             +EQ+LIM+LH+KWGNRWSKIAKHLPGRTDNEIKN+WRTRIQKHLKQ
Sbjct  84   LDEQILIMDLHSKWGNRWSKIAKHLPGRTDNEIKNYWRTRIQKHLKQ  130



>gb|AGO33165.1| MYB transcription factor [Narcissus tazetta var. chinensis]
Length=210

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 139/206 (67%), Gaps = 17/206 (8%)
 Frame = -1

Query  858  SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  679
            +SS D ++RKGPWT+EEDLIL+NYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPD
Sbjct  13   NSSQDADVRKGPWTLEEDLILVNYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPD  72

Query  678  VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNE  499
            VRRGNIT EEQLLIMELH++WGNRWSKIA+ LPGRTDNEIKNFWRTRIQK  KQ    ++
Sbjct  73   VRRGNITLEEQLLIMELHSRWGNRWSKIARQLPGRTDNEIKNFWRTRIQKKTKQGEPFDQ  132

Query  498  STVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSS----FVCNMEIETGFQGHHFP  331
                 GQ      +Q+ +       S G    Y  P        + +   ++    +  P
Sbjct  133  ----CGQ------NQMVTDEGGTSHSYGMDQDYGRPDQQQNYPMMDDGNTDSADASYSAP  182

Query  330  SHEY--SNDAVWGMDDISWSMQILNG  259
            S     S +  W M+D  WSMQ  NG
Sbjct  183  SLSTPDSTENFWTMEDF-WSMQPPNG  207



>ref|XP_009416734.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/217 (55%), Positives = 144/217 (66%), Gaps = 24/217 (11%)
 Frame = -1

Query  882  MDKKTCCN------SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTG  721
            MD+K   N       SS + E+RKGPWTMEEDLIL+NYIA+HGEGVWN+LARSAGL RTG
Sbjct  1    MDRKGSSNMNDKRVDSSQETEVRKGPWTMEEDLILVNYIAHHGEGVWNNLARSAGLNRTG  60

Query  720  KSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT  541
            KSCRLRWLNYLRPD+RRGNITP+EQLLIMELHA+WGNRWSKIA+ LPGRTDNEIKN+WRT
Sbjct  61   KSCRLRWLNYLRPDLRRGNITPQEQLLIMELHARWGNRWSKIARQLPGRTDNEIKNYWRT  120

Query  540  RIQKHLKQEAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEI  361
            RIQK +K+  + +    +    S   T Q +S++  +       D  S P        + 
Sbjct  121  RIQKRVKRSESDDFQNAMLTDESGAGTSQTNSSNDGR-------DQPSHPDE------QT  167

Query  360  ETGFQG--HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
             T   G    FP+    N   W  +D  WSMQ+ + D
Sbjct  168  ATAADGVDPQFPAESSYN--FWTFEDF-WSMQLPDDD  201



>ref|XP_010029159.1| PREDICTED: myb-related protein 340-like [Eucalyptus grandis]
 gb|KCW56012.1| hypothetical protein EUGRSUZ_I01782 [Eucalyptus grandis]
Length=208

 Score =   216 bits (550),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 147/214 (69%), Gaps = 27/214 (13%)
 Frame = -1

Query  882  MDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            MDKK C  +   DP++RKGPWT+EEDLIL++YIANHGEGVWNSLA++AGL+RTGKSCRLR
Sbjct  1    MDKKPCYRTQ--DPQVRKGPWTLEEDLILMDYIANHGEGVWNSLAKAAGLQRTGKSCRLR  58

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ L + WGNRWS+IAKHLPGRTDNEIKN+WRT+IQKH+
Sbjct  59   WLNYLRPDVRRGNITPEEQLLIIHLQSMWGNRWSEIAKHLPGRTDNEIKNYWRTKIQKHI  118

Query  522  KQEAAT--NESTV-ISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETG  352
             +++ T  N+ T+  S   +C  TD                 + ++      C+   + G
Sbjct  119  IKQSETEINDLTIPPSSANAC--TD--------------HRGVSAANTIEIACSPPSDQG  162

Query  351  FQGHHF-----PSHEYSNDAVWGMDDISWSMQIL  265
              G        P+ E ++ A W ++D+ W +Q L
Sbjct  163  GSGETMLSALPPAQELNDSACWSVEDL-WPIQSL  195



>gb|KFK37619.1| hypothetical protein AALP_AA3G006700 [Arabis alpina]
Length=204

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 141/194 (73%), Gaps = 16/194 (8%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+S+GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  22   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKSSGLKRTGKSCRLRWLNYLRPDVRRGNIT  81

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQ  478
             EEQLLI++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K   +++E+  I   
Sbjct  82   SEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMK--VSSSENMKIHHC  139

Query  477  GSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
             +  +T ++++T     S         SP ++   N+              E SN+  W 
Sbjct  140  SANSQTSEMTTTDQGSSSKPFDMAESFSPATTTSFNL-------------MEQSNENYWN  186

Query  297  MDDISWSMQILNGD  256
            ++D+ WS+Q+LNG+
Sbjct  187  VEDL-WSVQLLNGE  199



>ref|XP_010441167.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 137/201 (68%), Gaps = 8/201 (4%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++RKGPWTMEEDLILIN IANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  15   DADVRKGPWTMEEDLILINCIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  74

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NIT EEQL IMELH+KWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++ +     E+T  
Sbjct  75   NITAEEQLTIMELHSKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYIIKNG---ETTTA  131

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF---QGHHFP-SHEY  319
              Q S       +ST      +    D+YS   ++    +   T          P S + 
Sbjct  132  GSQSSEIINHHATSTGQVLNDTQEPMDMYSQHANNIDHQLSYNTYVPESDSTMIPLSVDQ  191

Query  318  SNDAVWGMDDISWSMQILNGD  256
            S    W +DD+ W M + NG+
Sbjct  192  SEQNYWSVDDL-WPMHLYNGN  211



>ref|XP_002882176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=202

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/210 (53%), Positives = 140/210 (67%), Gaps = 26/210 (12%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  12   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  71

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  72   NYLRPDVRRGNITAEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMK-  130

Query  516  EAATNESTVISGQGSCD---KTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
               ++E  + SG         TDQ      S   +I   + +S  +++F           
Sbjct  131  -VMSSEHMICSGNSQSSGMTTTDQ-----GSSGKAIDMAESFSQAKTTFNVV--------  176

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                   E SN+  W ++D+ W + +LNGD
Sbjct  177  -------EQSNENYWNVEDL-WPVHLLNGD  198



>ref|XP_010450678.1| PREDICTED: transcription factor MYB24-like [Camelina sativa]
Length=211

 Score =   214 bits (545),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 136/201 (68%), Gaps = 8/201 (4%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++RKGP TMEEDLILINYI NHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  15   DADVRKGPRTMEEDLILINYITNHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRG  74

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            NIT EEQL+IMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRT+IQK++ +     E+T  
Sbjct  75   NITAEEQLIIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTKIQKYIIKNG---ETTTA  131

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGF---QGHHFP-SHEY  319
              Q S       +ST      +    D YS   +S    +   T          P S + 
Sbjct  132  GSQSSEIINHHATSTGQVLNDTQEPIDTYSQHANSIDHQLSYNTYVPESDSIMMPLSVDQ  191

Query  318  SNDAVWGMDDISWSMQILNGD  256
            S    W +DD+ W M + NG+
Sbjct  192  SEQNYWSVDDL-WPMHLYNGN  211



>ref|XP_010496298.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 138/207 (67%), Gaps = 16/207 (8%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  11   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  70

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  71   NYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKV  130

Query  516  EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHH  337
            + ++         G+   +   ++   S   +I   + +S   ++F              
Sbjct  131  KVSSENMMNHHRSGNSQSSGMTTTDQGSSGKAIDMAESFSPATTTFNVV-----------  179

Query  336  FPSHEYSNDAVWGMDDISWSMQILNGD  256
                E SN+  W ++D+ W + +LNGD
Sbjct  180  ----EQSNENYWNVEDL-WPVHLLNGD  201



>emb|CDY37512.1| BnaA05g33770D [Brassica napus]
Length=201

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/194 (55%), Positives = 131/194 (68%), Gaps = 19/194 (10%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQ  478
             EE LLI++LHAK GNRWSKIAK+LPGRTDNEIKNFWRT+IQ+H+K  ++ N + +    
Sbjct  83   AEEHLLIIQLHAKLGNRWSKIAKYLPGRTDNEIKNFWRTKIQRHVKMSSSKNTNNIRHCL  142

Query  477  GSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
            G+                   Q  + ++          I        F   E SND+ W 
Sbjct  143  GNS------------------QSSVITATDQGSSSKGLISPATTTTSFHVMEQSNDSYWN  184

Query  297  MDDISWSMQILNGD  256
            ++DI W +Q+LN D
Sbjct  185  VEDI-WPLQLLNDD  197



>ref|XP_006841613.1| hypothetical protein AMTR_s00003p00219710 [Amborella trichopoda]
 gb|ERN03288.1| hypothetical protein AMTR_s00003p00219710 [Amborella trichopoda]
Length=272

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 111/119 (93%), Gaps = 3/119 (3%)
 Frame = -1

Query  864  CNSSSY---DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            CNSS +   D E+R+GPWT+EED+IL+NYIANHGEG WNSLAR AGLKRTGKSCRLRWLN
Sbjct  8    CNSSPHIDEDSELRRGPWTVEEDMILVNYIANHGEGRWNSLARCAGLKRTGKSCRLRWLN  67

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YLRPDVRRGNITPEEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  68   YLRPDVRRGNITPEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_010485409.1| PREDICTED: transcription factor MYB57-like [Camelina sativa]
Length=205

 Score =   213 bits (542),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/207 (51%), Positives = 138/207 (67%), Gaps = 16/207 (8%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  11   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  70

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  71   NYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKV  130

Query  516  EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHH  337
            + ++         G+   +   ++   S   +I   + +S   ++F              
Sbjct  131  KVSSENMMNHHCSGNSQSSGMTTTNQDSSGKAIDMAESFSPATTTFNVV-----------  179

Query  336  FPSHEYSNDAVWGMDDISWSMQILNGD  256
                E SN+  W ++D+ W + +LNGD
Sbjct  180  ----EQSNENYWNVEDL-WPVHLLNGD  201



>ref|NP_186802.1| myb domain protein 57 [Arabidopsis thaliana]
 sp|Q9SSA1.1|MYB57_ARATH RecName: Full=Transcription factor MYB57; AltName: Full=Myb-related 
protein 57; Short=AtMYB57 [Arabidopsis thaliana]
 gb|AAF01538.1|AC009325_8 putative transcription factor [Arabidopsis thaliana]
 dbj|BAC42719.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO63994.1| putative myb family transcription factor [Arabidopsis thaliana]
 gb|AAS10052.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE73682.1| myb domain protein 57 [Arabidopsis thaliana]
Length=206

 Score =   211 bits (537),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 141/209 (67%), Gaps = 20/209 (10%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  12   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  71

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  72   NYLRPDVRRGNITEEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMK-  130

Query  516  EAATNESTVISGQGSCDKTDQVsstsasqls--SIGQGDIYSSPQSSFVCNMEIETGFQG  343
                +   +++ Q  C    Q S  +    S  +I   + +S  +++    +E       
Sbjct  131  ---VSSENMMNHQHHCSGNSQSSGMTTQGSSGKAIDTAESFSQAKTTTFNVVE-------  180

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                  + SN+  W ++D+ W + +LNGD
Sbjct  181  ------QQSNENYWNVEDL-WPVHLLNGD  202



>emb|CDX91944.1| BnaC03g32460D [Brassica napus]
Length=207

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 134/197 (68%), Gaps = 20/197 (10%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYIFNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  82

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNEST---VI  487
             EEQLLI++L AK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K  ++   +T   + 
Sbjct  83   AEEQLLIIQLQAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKLSSSETMNTRHCLG  142

Query  486  SGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDA  307
            S Q S   T                 D  SS ++  +      T      +   E SND+
Sbjct  143  SSQSSVMTTT----------------DQGSSSKAFHMAESLKSTETVTTSYNVMEQSNDS  186

Query  306  VWGMDDISWSMQILNGD  256
             W ++D+ W +Q+ N D
Sbjct  187  YWSVEDL-WPVQLFNDD  202



>ref|XP_009147443.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
Length=205

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 130/194 (67%), Gaps = 19/194 (10%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRT KSCRLRWLNYLRPDVRRGNIT
Sbjct  23   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTEKSCRLRWLNYLRPDVRRGNIT  82

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQ  478
             EE LLI++LHAK GNRWSKIAK+LPGRTDNEIKNFWRT+IQ+H+K  ++ N + +    
Sbjct  83   AEEHLLIIQLHAKLGNRWSKIAKYLPGRTDNEIKNFWRTKIQRHVKMSSSKNTNNIRHCL  142

Query  477  GSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
            G+                   Q  + ++          I        F   E SND+ W 
Sbjct  143  GN------------------SQSSVITATDQGSSSKGLISPATTTTSFHVMEQSNDSYWN  184

Query  297  MDDISWSMQILNGD  256
            ++DI W +Q+LN D
Sbjct  185  VEDI-WPLQLLNDD  197



>gb|AAM67076.1| putative transcription factor [Arabidopsis thaliana]
Length=206

 Score =   210 bits (534),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 140/209 (67%), Gaps = 20/209 (10%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  12   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  71

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  72   NYLRPDVRRGNITTEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMK-  130

Query  516  EAATNESTVISGQGSCDKTDQVsstsasqls--SIGQGDIYSSPQSSFVCNMEIETGFQG  343
                +   +++ Q  C    Q S  +    S  +I   + +S  +++    +E       
Sbjct  131  ---VSSENMMNHQHHCSGNSQSSGMTTQGSSGKAIDTAESFSQAKTTTFNVVE-------  180

Query  342  HHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                  + SN+  W + D+ W + +LNGD
Sbjct  181  ------QQSNENYWNVGDL-WPVHLLNGD  202



>ref|XP_010435630.1| PREDICTED: transcription factor MYB57 [Camelina sativa]
Length=202

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 136/207 (66%), Gaps = 19/207 (9%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  11   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  70

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  71   NYLRPDVRRGNITAEEQLVIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKV  130

Query  516  EAATNESTVISGQGSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHH  337
            + ++         G+   +   ++   S   +I   + +S   ++F              
Sbjct  131  KVSSENMMNHHCSGNSQSSGMTTTEQGSSGKAIDMAESFSPATTTF--------------  176

Query  336  FPSHEYSNDAVWGMDDISWSMQILNGD  256
                   N+  W ++D+ W + +LNGD
Sbjct  177  ----NVVNENYWNVEDL-WPVHLLNGD  198



>ref|XP_009406298.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   209 bits (532),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -1

Query  858  SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  679
            +S  + ++RKGPWTMEEDLIL+NYI NHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD
Sbjct  15   NSGEEADVRKGPWTMEEDLILVNYIGNHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPD  74

Query  678  VRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            +RRGNIT +EQLLIMEL A+WGNRWSKIA+ +PGRTDNEIKN+WRTRIQK +KQ
Sbjct  75   LRRGNITAQEQLLIMELQARWGNRWSKIARQMPGRTDNEIKNYWRTRIQKRVKQ  128



>ref|XP_006300020.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
 gb|EOA32918.1| hypothetical protein CARUB_v10016245mg [Capsella rubella]
Length=203

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/210 (53%), Positives = 135/210 (64%), Gaps = 24/210 (11%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K T  +    +  +RKGPWTMEED IL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWL
Sbjct  11   KATITSQKEEEGTVRKGPWTMEEDFILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWL  70

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQLLI++LHAK GNRWSKIAKHLPGRTDNEIKNFWRT+IQ+H+K 
Sbjct  71   NYLRPDVRRGNITAEEQLLIIQLHAKLGNRWSKIAKHLPGRTDNEIKNFWRTKIQRHMKV  130

Query  516  EAATNESTVISGQGSCD---KTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQ  346
                      SG         TDQ      S   +I   + +S   ++F           
Sbjct  131  PPKNMMHQHCSGNSQSSGMTTTDQ-----GSSGKAIDMAESFSPATTTFNVV--------  177

Query  345  GHHFPSHEYSNDAVWGMDDISWSMQILNGD  256
                   E SN+  W ++D+ W + +LNGD
Sbjct  178  -------EQSNENYWNVEDL-WPVHLLNGD  199



>ref|XP_009134610.1| PREDICTED: transcription factor MYB57-like [Brassica rapa]
 emb|CDX74303.1| BnaA03g27440D [Brassica napus]
Length=208

 Score =   209 bits (531),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/194 (55%), Positives = 138/194 (71%), Gaps = 14/194 (7%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWTMEEDLIL NYI NHGEG+WNS+A+++GLKRTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  22   VRKGPWTMEEDLILFNYILNHGEGLWNSVAKASGLKRTGKSCRLRWLNYLRPDVRRGNIT  81

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQ  478
             EEQLLI++L AK GN+WSKIAKHLPGRTDNEIKNFWRT+IQ+H+K          +S  
Sbjct  82   AEEQLLIIQLQAKLGNKWSKIAKHLPGRTDNEIKNFWRTKIQRHMK----------LSSS  131

Query  477  GSCDKTDQVsstsasqlsSIGQGDIYSSPQSSFVCNMEIETGFQGHHFPSHEYSNDAVWG  298
             + +    + S+ +S +++  QG   SS ++S +      T      +   E  ND+ W 
Sbjct  132  KTMNSRHCLGSSQSSVMTTTDQG---SSSKASHMAESLKSTETMTTSYNVMEQCNDSYWS  188

Query  297  MDDISWSMQILNGD  256
            ++D+ W +Q+ N D
Sbjct  189  VEDL-WPVQLFNDD  201



>gb|AAL84762.1|AF474129_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=165

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  4    ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  63

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  64   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  111



>ref|XP_006649985.1| PREDICTED: myb-related protein MYBAS1-like [Oryza brachyantha]
Length=328

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_004984581.1| PREDICTED: myb-related protein P-like [Setaria italica]
Length=318

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 106/108 (98%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NY+A+HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   ELRRGPWTVEEDLLLVNYVASHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_009402050.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 2/124 (2%)
 Frame = -1

Query  888  IKMDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            ++   K+C      D  +R+GPWT++EDLIL+NYIA HGEG WNSLAR AGLKRTGKSCR
Sbjct  1    MEFHGKSCGGEEELD--LRRGPWTVDEDLILVNYIAVHGEGRWNSLARCAGLKRTGKSCR  58

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYLRPDVRRGNITPEEQLLI+ELH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QK
Sbjct  59   LRWLNYLRPDVRRGNITPEEQLLILELHCRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQK  118

Query  528  HLKQ  517
            H KQ
Sbjct  119  HAKQ  122



>ref|XP_008781174.1| PREDICTED: transcription factor MYB108 [Phoenix dactylifera]
Length=292

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -1

Query  855  SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  676
            S  D ++R+GPWT EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDV
Sbjct  23   SEEDMDLRRGPWTAEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDV  82

Query  675  RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            RRGNITPEEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  83   RRGNITPEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  135



>ref|XP_008793362.1| PREDICTED: transcription factor MYB108-like [Phoenix dactylifera]
Length=291

 Score =   207 bits (527),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/113 (84%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -1

Query  855  SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  676
            S  D ++R+GPWT+EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDV
Sbjct  23   SEEDMDLRRGPWTVEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDV  82

Query  675  RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            RRGNITPEEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  83   RRGNITPEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  135



>ref|NP_001049937.1| Os03g0315400 [Oryza sativa Japonica Group]
 gb|ABF95617.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11851.1| Os03g0315400 [Oryza sativa Japonica Group]
 dbj|BAH00067.1| unnamed protein product [Oryza sativa Japonica Group]
Length=329

 Score =   208 bits (529),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>gb|EAY89765.1| hypothetical protein OsI_11306 [Oryza sativa Indica Group]
Length=329

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_002465358.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
 gb|EER92356.1| hypothetical protein SORBIDRAFT_01g037110 [Sorghum bicolor]
Length=334

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  17   ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  76

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  77   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  124



>ref|XP_004963430.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=326

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  22   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  81

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  82   TAEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  129



>ref|NP_001140397.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF83741.1| unknown [Zea mays]
 gb|AFW88522.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=349

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NY+A HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   ELRRGPWTVEEDLLLVNYVAAHGEGRWNSLARSAGLRRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_010921398.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB108 [Elaeis 
guineensis]
Length=292

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 110/122 (90%), Gaps = 3/122 (2%)
 Frame = -1

Query  873  KTCCNS---SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLR  703
            +TC ++   S  D ++R+GPWT EEDLIL+NYIA HGEG WNSLAR AGLKRTGKSCRLR
Sbjct  14   RTCSSATPPSEEDMDLRRGPWTAEEDLILMNYIAAHGEGRWNSLARCAGLKRTGKSCRLR  73

Query  702  WLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHL  523
            WLNYLRPDVRRGNITPEEQLLI+ELH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH 
Sbjct  74   WLNYLRPDVRRGNITPEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHA  133

Query  522  KQ  517
            KQ
Sbjct  134  KQ  135



>ref|XP_010024826.1| PREDICTED: transcription factor MYB108-like [Eucalyptus grandis]
Length=343

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL L+NYIANHGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  32   DLRRGPWTVEEDLTLVNYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  91

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  92   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  139



>gb|EEE58945.1| hypothetical protein OsJ_10621 [Oryza sativa Japonica Group]
Length=310

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  19   DLRRGPWTVEEDLLLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_009386341.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=281

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT++EDLILINYIA HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  15   DLRRGPWTVDEDLILINYIAAHGEGQWNSLARSAGLRRTGKSCRLRWLNYLRPDVRRGNI  74

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  75   TPEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ  122



>ref|XP_007223176.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
 gb|EMJ24375.1| hypothetical protein PRUPE_ppa009143mg [Prunus persica]
Length=305

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K+ CN +  + E+R+GPWT+EED +LI+YIA+HGEG WNSLA+ AGLKRTGKSCRLRWLN
Sbjct  6    KSACNPNEEEIELRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLN  65

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YL+PD++RGN+TP+EQL+I+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  66   YLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  124



>gb|EMT25040.1| Transcription factor MYB21 [Aegilops tauschii]
Length=267

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 107/124 (86%), Gaps = 0/124 (0%)
 Frame = -1

Query  864  CNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLR  685
            C+      EIR+GPWT+EEDL L+NYIA+HG+G WNSLAR+AGLKRTGKSCRLRWLNYLR
Sbjct  19   CSVEEAAEEIRRGPWTVEEDLTLVNYIADHGDGRWNSLARAAGLKRTGKSCRLRWLNYLR  78

Query  684  PDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAAT  505
            PDV+RGN T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ    
Sbjct  79   PDVKRGNFTADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLNCD  138

Query  504  NEST  493
              ST
Sbjct  139  ANST  142



>ref|XP_003561685.1| PREDICTED: myb-related protein P-like [Brachypodium distachyon]
Length=327

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 105/108 (97%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_009416464.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=270

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+RKG WT+EEDL+L+NY+A HGEG W+SLAR AGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  14   ELRKGSWTVEEDLLLVNYVAEHGEGRWDSLAREAGLKRTGKSCRLRWLNYLRPDLRRGNI  73

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH++WGNRWSKIA+H+PGRTDNEIKN+WRTR+QKH KQ
Sbjct  74   TPEEQLLILELHSRWGNRWSKIAQHMPGRTDNEIKNYWRTRVQKHAKQ  121



>gb|KCW61339.1| hypothetical protein EUGRSUZ_H04082 [Eucalyptus grandis]
Length=401

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL L+NYIANHGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  3    DLRRGPWTVEEDLTLVNYIANHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  62

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  63   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  110



>ref|XP_006488792.1| PREDICTED: transcription factor MYB108-like [Citrus sinensis]
Length=334

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K +    S  D ++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  134



>gb|KDO72049.1| hypothetical protein CISIN_1g019911mg [Citrus sinensis]
Length=334

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K +    S  D ++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  134



>dbj|BAC21351.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 dbj|BAD30303.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica 
Group]
 gb|EAZ05206.1| hypothetical protein OsI_27405 [Oryza sativa Indica Group]
 gb|EAZ41155.1| hypothetical protein OsJ_25652 [Oryza sativa Japonica Group]
Length=298

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGN+
Sbjct  16   ELRRGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNM  75

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            T EEQLLI+ELH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH K
Sbjct  76   TAEEQLLILELHGRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAK  122



>ref|NP_001060700.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAF22614.1| Os07g0688200 [Oryza sativa Japonica Group]
 dbj|BAG96090.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADX60233.1| MYB transcription factor [Oryza sativa Japonica Group]
Length=300

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGN+
Sbjct  18   ELRRGPWTVEEDLLLVNYIAAHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNM  77

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            T EEQLLI+ELH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH K
Sbjct  78   TAEEQLLILELHGRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAK  124



>gb|EAZ19253.1| hypothetical protein OsJ_34790 [Oryza sativa Japonica Group]
Length=184

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  28   ELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  87

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  88   TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  135



>ref|XP_009385372.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=221

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+RKG WT+EEDL+L+NYIA+HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  2    EVRKGAWTVEEDLLLMNYIASHGEGQWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  61

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH++WGNRWSKIA+ LPGRTDNEIKN+WRTR++K  KQ
Sbjct  62   TPEEQLLILELHSRWGNRWSKIAQCLPGRTDNEIKNYWRTRVEKQAKQ  109



>ref|XP_006419304.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
 gb|ESR32544.1| hypothetical protein CICLE_v10005387mg [Citrus clementina]
Length=334

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            K +    S  D ++R+GPWT+EED  LINYI+NHGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  15   KSSSTTISEEDLDLRRGPWTVEEDFKLINYISNHGEGRWNCLARCAGLKRTGKSCRLRWL  74

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNIT EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  75   NYLRPDVRRGNITLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  134



>ref|XP_009612140.1| PREDICTED: transcription factor MYB108-like [Nicotiana tomentosiformis]
Length=295

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++R+GPWT+EED  LINYIA+HGEG WN LARSAGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  29   DMDLRQGPWTVEEDFTLINYIAHHGEGRWNFLARSAGLKRTGKSCRLRWLNYLRPDVRRG  88

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NIT EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  89   NITLEEQLVILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  138



>ref|XP_004239882.1| PREDICTED: transcription factor MYB108-like [Solanum lycopersicum]
Length=318

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LIN+IA+HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  35   DLRRGPWTVEEDFTLINFIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  94

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  95   TVEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  142



>ref|XP_009791846.1| PREDICTED: transcription factor MYB108-like [Nicotiana sylvestris]
Length=282

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++R+GPWT EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  29   DMDLRRGPWTAEEDFTLINYIAKHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRG  88

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NIT EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  89   NITLEEQLVILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  138



>ref|XP_010914654.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=275

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL LINYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  19   DLRRGPWTVEEDLKLINYIAVHGEGRWNTLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  KQ
Sbjct  79   TPEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQAKQ  126



>ref|XP_010938192.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=292

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D ++R+GPWT++EDL+L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDVRRG
Sbjct  26   DMDLRRGPWTVDEDLVLMNYIAAHGEGRWNCLARCAGLKRTGKSCRLRWLNYLRPDVRRG  85

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NITPEEQLLI+ELH++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   NITPEEQLLILELHSRWGNRWSKIAQQLPGRTDNEIKNYWRTRVQKHAKQ  135



>ref|XP_009384442.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=330

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 110/123 (89%), Gaps = 4/123 (3%)
 Frame = -1

Query  873  KTCCNS----SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRL  706
            +T C S    S  + ++R+GPWT+EED++L++YIA HGEG WNSLAR AGL+RTGKSCRL
Sbjct  5    ETTCGSAIPPSEEEMDLRRGPWTVEEDVVLVDYIAVHGEGRWNSLARCAGLRRTGKSCRL  64

Query  705  RWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKH  526
            RWLNYLRPDVRRGNITPEEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH
Sbjct  65   RWLNYLRPDVRRGNITPEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKH  124

Query  525  LKQ  517
             KQ
Sbjct  125  AKQ  127



>gb|AEV91149.1| R2R3-MYB protein [Triticum aestivum]
Length=319

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L+NYIA H EG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHSEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  126



>gb|AFW82705.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=357

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++ED++L+NYIA HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  51   ELRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLRRTGKSCRLRWLNYLRPDVRRGNI  110

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH ++
Sbjct  111  TVEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARR  158



>ref|XP_011027944.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=312

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  133



>gb|AIB05776.1| MYB transcription factor, partial [Zea mays]
Length=336

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL L+NY+  HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  20   ELRRGPWTVEEDLQLVNYVDAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  79

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  80   TPQEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  127



>ref|XP_009383942.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L+NYIA HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  16   DLRRGPWTVEEDLLLMNYIAAHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  75

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  76   TPEEQLLILELHSRWGNRWSKIAQFLPGRTDNEIKNYWRTRVQKHAKQ  123



>ref|NP_001141891.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACF87244.1| unknown [Zea mays]
 tpg|DAA45085.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=336

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL L+NY+  HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  20   ELRRGPWTVEEDLQLVNYVDAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNI  79

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  80   TPQEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  127



>gb|EAY83532.1| hypothetical protein OsI_38744 [Oryza sativa Indica Group]
Length=300

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  56   ELRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  115

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  116  TADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  163



>gb|ABA98967.1| Myb-like DNA-binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EAZ20885.1| hypothetical protein OsJ_36524 [Oryza sativa Japonica Group]
Length=300

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  56   ELRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  115

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  116  TADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  163



>ref|XP_009392103.1| PREDICTED: protein ODORANT1-like [Musa acuminata subsp. malaccensis]
Length=348

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            EIR+GPWT EEDL+LI Y+A HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  88   EIRRGPWTTEEDLVLIKYVAQHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  147

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            TPEEQLLI++LH++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH KQ      ST  
Sbjct  148  TPEEQLLILDLHSRWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKHAKQLHCDVNSTTF  205



>ref|XP_009778774.1| PREDICTED: transcription factor MYB24-like [Nicotiana sylvestris]
Length=262

 Score =   201 bits (510),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = -1

Query  885  KMDKKTCCNSSSYDP-EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            ++ K T  NSSS D  E+RKGPWT+EED +LI+++ +HGEG WN+LA+S+GLKRTGKSCR
Sbjct  5    RLAKSTSTNSSSEDAFELRKGPWTIEEDNLLIHHVTSHGEGRWNALAKSSGLKRTGKSCR  64

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYL+PDV+RGN++P+EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QK
Sbjct  65   LRWLNYLKPDVKRGNLSPQEQLLILELHSRWGNRWSKIAEHLPGRTDNEIKNYWRTRVQK  124

Query  528  HLKQEAATNEST  493
              +Q    + ST
Sbjct  125  QARQLKVDSNST  136



>ref|XP_008243255.1| PREDICTED: transcription factor MYB21 [Prunus mume]
Length=305

 Score =   202 bits (513),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 86/119 (72%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K  CN +  + ++R+GPWT+EED +LI+YIA+HGEG WNSLA+ AGLKRTGKSCRLRWLN
Sbjct  6    KRACNPNEEEIDLRRGPWTLEEDTLLIHYIASHGEGHWNSLAKCAGLKRTGKSCRLRWLN  65

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YL+PD++RGN+TP+EQL+I+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  66   YLKPDIKRGNLTPQEQLMILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  124



>gb|ADG56766.1| putative MYB transcription factor [Rosa rugosa]
Length=299

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+RKGPWT++ED +LI+YIANHGEG WN+LA+ AGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  18   EMRKGPWTLDEDTLLIHYIANHGEGHWNALAKCAGLKRTGKSCRLRWLNYLKPDIKRGNL  77

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELHAKWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  78   TPQEQLLILELHAKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  125



>dbj|BAJ91760.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=282

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -1

Query  891  LIKMDKKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSC  712
            ++K D     +      EIR+GPWT+EEDL L+NYIA+HG+G WNSLAR AGLKRTGKSC
Sbjct  25   VMKFDDDLLRHEEEAAEEIRRGPWTVEEDLTLVNYIADHGDGRWNSLARGAGLKRTGKSC  84

Query  711  RLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQ  532
            RLRWLNYLRPDV+RGN T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+Q
Sbjct  85   RLRWLNYLRPDVKRGNFTADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQ  144

Query  531  KHLKQ  517
            KH KQ
Sbjct  145  KHAKQ  149



>gb|AAO49418.1|AF485900_1 MYB9 [Dendrobium sp. XMW-2002-9]
Length=151

 Score =   196 bits (498),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/116 (80%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  816  MEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  637
            MEED ILINYIANHGEGVWN+LA+SAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI
Sbjct  1    MEEDGILINYIANHGEGVWNNLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITPEEQLLI  60

Query  636  MELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISGQGSC  469
            MELHA+WGNRWSKIA+ LPGRTDNEIKN+WRTRIQK +K   A + S+ +    +C
Sbjct  61   MELHARWGNRWSKIARQLPGRTDNEIKNYWRTRIQKKVKNGDAVDYSSQMIIDEAC  116



>ref|XP_002311369.1| GmMYB12 family protein [Populus trichocarpa]
 gb|EEE88736.1| GmMYB12 family protein [Populus trichocarpa]
Length=321

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  133



>ref|XP_009387805.1| PREDICTED: transcription factor MYB57-like [Musa acuminata subsp. 
malaccensis]
Length=267

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/107 (83%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWT+EEDL+L+NYIA HGEG WNS+AR +GLKRTGKSCRLRWLNYLRPDVR GNIT
Sbjct  20   LRKGPWTVEEDLLLMNYIAVHGEGRWNSVARCSGLKRTGKSCRLRWLNYLRPDVRHGNIT  79

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            PEEQLLI+ELH+ WGNRWSKIA+HLPGRTDNEIKN+WRT++QKH KQ
Sbjct  80   PEEQLLILELHSSWGNRWSKIAQHLPGRTDNEIKNYWRTKVQKHAKQ  126



>ref|XP_009587217.1| PREDICTED: transcription factor MYB24-like [Nicotiana tomentosiformis]
Length=303

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = -1

Query  885  KMDKKTCCNSSSYDP-EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCR  709
            ++ K T  NSS+ D  E+RKGPWT EED +LIN++ +HGEG WN+LA+S+GLKRTGKSCR
Sbjct  5    RLVKSTSSNSSNEDAFELRKGPWTTEEDNLLINHVTSHGEGRWNALAKSSGLKRTGKSCR  64

Query  708  LRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK  529
            LRWLNYL+PDV+RGN++P+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK
Sbjct  65   LRWLNYLKPDVKRGNLSPQEQLLILELHSKWGNRWSKIAEHLPGRTDNEIKNYWRTRVQK  124

Query  528  HLKQEAATNEST  493
              +Q    + ST
Sbjct  125  QARQLKVDSNST  136



>ref|XP_011016230.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=321

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LINYIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  133



>ref|XP_009415657.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=251

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++RKGPWT+EEDL+L+NYI +HGEG WNSLAR AGL+RTGKSCRLRW+NYLRPDVRRGNI
Sbjct  2    DLRKGPWTVEEDLVLMNYIGSHGEGKWNSLARCAGLRRTGKSCRLRWMNYLRPDVRRGNI  61

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            TPEEQLLI+ELH++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH +
Sbjct  62   TPEEQLLILELHSRWGNRWSKIAQRLPGRTDNEIKNYWRTRVQKHAR  108



>gb|EMT01874.1| Myb-related protein 305 [Aegilops tauschii]
Length=319

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPD+RRG+I
Sbjct  19   DLRRGPWTVEEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGSI  78

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH++W NRWSKIA+ LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  79   TPQEQLLILELHSRWANRWSKIAQPLPGRTDNEIKNYWRTRVQKHAKQ  126



>ref|XP_009411608.1| PREDICTED: transcription factor MYB108 [Musa acuminata subsp. 
malaccensis]
Length=256

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = -1

Query  888  IKMDKKTCCN---SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGK  718
            ++   +TC +    S  + ++R+GPWT EEDL+L+NY+A HGEG WNSLAR +GL+RTGK
Sbjct  1    MEFHGRTCGSFMAQSEEEVDLRRGPWTAEEDLVLMNYVAAHGEGRWNSLARCSGLRRTGK  60

Query  717  SCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTR  538
            SCRLRWLNYLRPDVRRGNITPEEQLLI++LH +WGNRWSKIA++LPGRTDNEIKN+WRTR
Sbjct  61   SCRLRWLNYLRPDVRRGNITPEEQLLILQLHTRWGNRWSKIAQYLPGRTDNEIKNYWRTR  120

Query  537  IQKHLKQ  517
            +QKH KQ
Sbjct  121  VQKHAKQ  127



>ref|XP_006658986.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=187

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EEDL+L NYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDVRRGN+
Sbjct  14   DLRRGPWTVEEDLLLANYIALHGEGRWNALARCAGLKRTGKSCRLRWLNYLRPDVRRGNM  73

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            T EEQLLI+ELH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH K
Sbjct  74   TAEEQLLILELHGRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAK  120



>ref|NP_001068466.2| Os11g0684000 [Oryza sativa Japonica Group]
 gb|AAK08983.1| Myb transcription factor JAMyb [Oryza sativa Japonica Group]
 gb|ABA95299.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF28829.2| Os11g0684000 [Oryza sativa Japonica Group]
Length=285

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  28   ELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  87

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  88   TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  135



>ref|XP_004962755.1| PREDICTED: transcription repressor MYB5-like [Setaria italica]
Length=294

 Score =   200 bits (508),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  33   QLRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  92

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  93   TADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  140



>gb|EAY96442.1| hypothetical protein OsI_18339 [Oryza sativa Indica Group]
Length=311

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L++YIANHGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TADEQLLILDLHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ  133



>ref|XP_009390416.1| PREDICTED: transcription factor MYB57 [Musa acuminata subsp. 
malaccensis]
Length=292

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 111/136 (82%), Gaps = 5/136 (4%)
 Frame = -1

Query  861  NSSSYD-----PEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            +SSSYD      E+R+GPWT+EED +LI+YIA HGEG WN LAR +GL+RTGKSCRLRWL
Sbjct  7    SSSSYDRIELGMELRRGPWTLEEDTLLIHYIACHGEGRWNLLARCSGLRRTGKSCRLRWL  66

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYL+PD++RGN++PEEQLLI+ELHAKWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  67   NYLKPDIKRGNLSPEEQLLIIELHAKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQ  126

Query  516  EAATNESTVISGQGSC  469
                 +ST       C
Sbjct  127  LKIDADSTTFRDAVRC  142



>gb|EEE62225.1| hypothetical protein OsJ_17012 [Oryza sativa Japonica Group]
Length=310

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 104/108 (96%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L++YIANHGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDMLLVDYIANHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TADEQLLILDLHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ  133



>ref|XP_003579302.1| PREDICTED: transcription factor MYB108-like isoform X1 [Brachypodium 
distachyon]
Length=275

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+R+GPWT++EDL L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  16   EAEVRRGPWTVDEDLTLVNYIAEHGEGRWNCLARGAGLKRTGKSCRLRWLNYLRPDVKRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            N T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  76   NFTADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  125



>ref|XP_009417759.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=260

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 4/120 (3%)
 Frame = -1

Query  864  CNSSSYDPE----IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            C+S++   E    +R+GPWT++EDLIL+NY+  HGEG WNSLAR AGL+RTGKSCRLRWL
Sbjct  8    CSSATRQSEEGMDLRRGPWTVDEDLILMNYVTTHGEGRWNSLARCAGLRRTGKSCRLRWL  67

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYLRPDVRRGNITPEEQLLI+ELH++ GNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  68   NYLRPDVRRGNITPEEQLLILELHSRLGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  127



>ref|XP_002440534.1| hypothetical protein SORBIDRAFT_09g002675 [Sorghum bicolor]
 gb|EES18964.1| hypothetical protein SORBIDRAFT_09g002675 [Sorghum bicolor]
Length=428

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT++ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  85   DLRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  144

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +
Sbjct  145  TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAR  191



>ref|XP_010237154.1| PREDICTED: transcription factor MYB108-like isoform X2 [Brachypodium 
distachyon]
Length=261

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            + E+R+GPWT++EDL L+NYIA HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  16   EAEVRRGPWTVDEDLTLVNYIAEHGEGRWNCLARGAGLKRTGKSCRLRWLNYLRPDVKRG  75

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            N T +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  76   NFTADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  125



>ref|XP_004299054.1| PREDICTED: transcription factor WER-like [Fragaria vesca subsp. 
vesca]
Length=283

 Score =   199 bits (506),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 107/121 (88%), Gaps = 5/121 (4%)
 Frame = -1

Query  864  CNSSSYDP-----EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRW  700
             NS+S  P     E+RKGPWT++ED +LI+YI NHGEG WN+LA+ AGLKRTGKSCRLRW
Sbjct  5    ANSASISPNEEENELRKGPWTLDEDTLLIHYIENHGEGHWNALAKCAGLKRTGKSCRLRW  64

Query  699  LNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            LNYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +
Sbjct  65   LNYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQAR  124

Query  519  Q  517
            Q
Sbjct  125  Q  125



>ref|XP_008677864.1| PREDICTED: transcription factor MYB108-like [Zea mays]
 ref|XP_008677865.1| PREDICTED: transcription factor MYB108-like [Zea mays]
 gb|AFW60135.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05905.1| MYB transcription factor, partial [Zea mays]
Length=352

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+R+GPWT++EDL LINYIA+HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  55   DEELRRGPWTVDEDLTLINYIADHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRG  114

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            + T +EQLLI++LH++WGNRWSKIA HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  115  DFTADEQLLILDLHSRWGNRWSKIAAHLPGRTDNEIKNYWRTRVQKHAKQ  164



>ref|XP_002463415.1| hypothetical protein SORBIDRAFT_02g043420 [Sorghum bicolor]
 gb|EER99936.1| hypothetical protein SORBIDRAFT_02g043420 [Sorghum bicolor]
Length=255

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L+NY+A HGEG WN+LAR AGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  22   DLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGLRRTGKSCRLRWLNYLRPDLRRGNI  81

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +Q
Sbjct  82   TAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQ  129



>ref|XP_002440535.1| hypothetical protein SORBIDRAFT_09g002680 [Sorghum bicolor]
 gb|EES18965.1| hypothetical protein SORBIDRAFT_09g002680 [Sorghum bicolor]
Length=341

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT +ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  56   DLRRGPWTADEDILLVNYIAVHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  115

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +
Sbjct  116  TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAR  162



>ref|XP_009392050.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=262

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT +EDLIL+NY+  HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  20   ELRRGPWTADEDLILMNYVTAHGEGRWNSLARRAGLRRTGKSCRLRWLNYLRPDVRRGNI  79

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI+ELH + GNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  80   TPEEQLLILELHFRLGNRWSKIARHLPGRTDNEIKNYWRTRVQKHAKQ  127



>emb|CAN76459.1| hypothetical protein VITISV_010827 [Vitis vinifera]
Length=249

 Score =   197 bits (502),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            N+SS + E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+P
Sbjct  9    NNSSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKP  68

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            D++RGN+TP+EQLLI+ELH+KWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  69   DIKRGNLTPQEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQ  123



>gb|AFW60134.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=347

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+R+GPWT++EDL LINYIA+HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RG
Sbjct  50   DEELRRGPWTVDEDLTLINYIADHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRG  109

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            + T +EQLLI++LH++WGNRWSKIA HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  110  DFTADEQLLILDLHSRWGNRWSKIAAHLPGRTDNEIKNYWRTRVQKHAKQ  159



>ref|XP_003592641.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES62892.1| myb transcription factor [Medicago truncatula]
Length=311

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  25   ELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPDIKRGNL  84

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  85   TPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  132



>ref|XP_006664647.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=307

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +R+GPWT++EDL L+NYIA+HGEG WNSLAR+AGLKRTGKSCRLRWLNYLRPDV+RGN T
Sbjct  56   LRRGPWTVDEDLTLVNYIADHGEGRWNSLARAAGLKRTGKSCRLRWLNYLRPDVKRGNFT  115

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  116  ADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  162



>ref|XP_006654961.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=277

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED +L++YIA HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  30   DLRRGPWTVEEDALLVDYIATHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  89

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI++LH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  90   TAEEQLLILDLHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ  137



>ref|XP_010941513.1| PREDICTED: transcription factor MYB108-like [Elaeis guineensis]
Length=258

 Score =   197 bits (502),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/113 (80%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -1

Query  855  SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  676
            S+ + ++R+GPWT+EEDL LINYIA HGEG WN+LAR AGLKRTGKSCRLRWLNYLRPDV
Sbjct  15   SAEEMDLRRGPWTVEEDLKLINYIAIHGEGRWNTLARGAGLKRTGKSCRLRWLNYLRPDV  74

Query  675  RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            RRGNI+PEEQLLI+ELH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QK  KQ
Sbjct  75   RRGNISPEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQAKQ  127



>tpg|DAA47022.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=336

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -1

Query  843  PEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  664
            PE+R+GPWT++EDL L+NYIA++GEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN
Sbjct  38   PELRRGPWTVDEDLTLVNYIADNGEGRWNNLARAAGLKRTGKSCRLRWLNYLRPDVKRGN  97

Query  663  ITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             + +EQLLI++LH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  98   FSADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  146



>ref|XP_007044287.1| Myb domain protein 62, putative [Theobroma cacao]
 gb|EOY00119.1| Myb domain protein 62, putative [Theobroma cacao]
Length=317

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K  C  S  D E+R+GPWT+EED +L +YIA HGEG WN LA+ AGLKRTGKSCRLRWLN
Sbjct  10   KGMCTPSEDDSELRRGPWTLEEDTLLTHYIARHGEGRWNMLAKCAGLKRTGKSCRLRWLN  69

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  70   YLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  128



>ref|XP_004958743.1| PREDICTED: myb-related protein 330-like [Setaria italica]
Length=314

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -1

Query  855  SSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDV  676
            S+   ++R+GPWT+EEDL+L+NYIA HGEG WN+LAR AGL+RTGKSCRLRWLNYLRPD+
Sbjct  15   SAASGDLRRGPWTVEEDLLLVNYIAVHGEGRWNALARCAGLRRTGKSCRLRWLNYLRPDL  74

Query  675  RRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            RRGNIT +EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +Q
Sbjct  75   RRGNITAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQ  127



>ref|XP_006663109.1| PREDICTED: transcription factor MYB108-like [Oryza brachyantha]
Length=296

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL LINYI++HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN 
Sbjct  31   ELRRGPWTVDEDLTLINYISDHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGNF  90

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  91   TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  138



>ref|XP_002316060.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
 gb|EEF02231.2| hypothetical protein POPTR_0010s15970g [Populus trichocarpa]
Length=317

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LI+YIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  24   DLRRGPWTVEEDFKLIDYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  83

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  84   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  131



>ref|XP_008662919.1| PREDICTED: myb-like protein AA [Zea mays]
 gb|AFW57482.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05202.1| MYB transcription factor, partial [Zea mays]
Length=406

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT EED++L+NYIA HGEG WNSLA SAGLKRTGKSCRLRWLNYLRP+VRRGNI
Sbjct  61   DLRRGPWTAEEDILLVNYIAAHGEGRWNSLALSAGLKRTGKSCRLRWLNYLRPNVRRGNI  120

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  121  TAEEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  168



>ref|XP_010264231.1| PREDICTED: transcription factor MYB108-like [Nelumbo nucifera]
Length=320

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 106/115 (92%), Gaps = 3/115 (3%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+R+GPWT+EED +LI+YIA HGEG WN LA+S+GLKRTGKSCRLRWLNYL+PDV+RG
Sbjct  15   DAELRRGPWTVEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYLKPDVKRG  74

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK---HLKQEA  511
            N+TPEEQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK   HLK +A
Sbjct  75   NLTPEEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARHLKIDA  129



>gb|KDP29432.1| hypothetical protein JCGZ_18353 [Jatropha curcas]
 gb|AIT52318.1| MYB family protein [Jatropha curcas]
Length=311

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 111/131 (85%), Gaps = 4/131 (3%)
 Frame = -1

Query  897  SPLIKMDKKTCCN----SSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLK  730
            +P+  + K+ C N    SS  + E+R+GPWT+EED +L +YIA HGEG WN LA+ AGLK
Sbjct  6    APMSSVTKRMCNNITNNSSEEESELRRGPWTLEEDTLLTHYIARHGEGRWNMLAKYAGLK  65

Query  729  RTGKSCRLRWLNYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNF  550
            RTGKSCRLRWLNYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+
Sbjct  66   RTGKSCRLRWLNYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNY  125

Query  549  WRTRIQKHLKQ  517
            WRTR+Q+  +Q
Sbjct  126  WRTRVQRQARQ  136



>gb|AGL81356.1| R2R3 MYB transcription factor 3, partial [Pyrus communis]
Length=227

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E R+GPWT+EED +LI+YI NHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  12   EFRRGPWTLEEDNLLIHYIMNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIKRGNL  71

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQL+I+ELHAKWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  72   TPQEQLVILELHAKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  119



>ref|XP_008389270.1| PREDICTED: myb-related protein 305 [Malus domestica]
Length=296

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+RKGPWT+EED +LI+YIANHGEG WN LA+ AGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  12   ELRKGPWTLEEDNLLIHYIANHGEGHWNYLAKFAGLKRTGKSCRLRWLNYLKPDIKRGNL  71

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  72   TPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  119



>ref|XP_009356251.1| PREDICTED: transcription factor MYB108-like [Pyrus x bretschneideri]
Length=296

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +RKGPWT+EED +LI+YIANHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++RGN+T
Sbjct  13   LRKGPWTLEEDNLLIHYIANHGEGHWNSLAKFAGLKRTGKSCRLRWLNYLKPDIKRGNLT  72

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            P+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  73   PQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  119



>ref|XP_011010946.1| PREDICTED: transcription factor MYB108-like [Populus euphratica]
Length=315

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LI+YIA HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  26   DLRRGPWTVEEDFKLIDYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  86   TLEEQLMILELHSRWGNRWSKIAHHLPGRTDNEIKNYWRTRVQKHAKQ  133



>ref|XP_010045365.1| PREDICTED: transcription factor MYB108 [Eucalyptus grandis]
 gb|KCW87539.1| hypothetical protein EUGRSUZ_B03985 [Eucalyptus grandis]
Length=343

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 103/107 (96%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +++GPWT+EEDL L+NY+A+HGEG WNSLARSAGL+RTGKSCRLRWLNYLRPDVRRGNIT
Sbjct  22   LKRGPWTVEEDLSLMNYVASHGEGRWNSLARSAGLRRTGKSCRLRWLNYLRPDVRRGNIT  81

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             EEQLLI++LH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  82   LEEQLLILDLHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQ  128



>gb|ABU93236.1| R2R3 Myb-like protein [Triticum aestivum]
Length=323

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++++GPWT EED++L++YI+ HGEG WNSLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  44   DLKRGPWTAEEDMLLVDYISKHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRPDVRRGNI  103

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TPEEQLLI++LH++WGNRWSKIA+ LPGRTDNE+KN+WRTR+QKH KQ
Sbjct  104  TPEEQLLILDLHSRWGNRWSKIAQRLPGRTDNEVKNYWRTRVQKHAKQ  151



>gb|KDP27970.1| hypothetical protein JCGZ_19050 [Jatropha curcas]
 gb|AIT52243.1| MYB family protein [Jatropha curcas]
Length=323

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED  LINYI  HGEG WNSLAR AGLKRTGKSCRLRWLNYLRPDVRRGNI
Sbjct  32   DLRRGPWTVEEDFKLINYITTHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI  91

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T EEQL+I+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  92   TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  139



>ref|NP_001170329.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACN36641.1| unknown [Zea mays]
 tpg|DAA47021.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB05129.1| MYB transcription factor, partial [Zea mays]
Length=351

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 103/109 (94%), Gaps = 0/109 (0%)
 Frame = -1

Query  843  PEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGN  664
            PE+R+GPWT++EDL L+NYIA++GEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RGN
Sbjct  53   PELRRGPWTVDEDLTLVNYIADNGEGRWNNLARAAGLKRTGKSCRLRWLNYLRPDVKRGN  112

Query  663  ITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             + +EQLLI++LH +WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  113  FSADEQLLILDLHTRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  161



>ref|XP_007142925.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
 gb|ESW14919.1| hypothetical protein PHAVU_007G028700g [Phaseolus vulgaris]
Length=305

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K   +S+  + E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLN
Sbjct  6    KRDLSSNEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLN  65

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  66   YLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  124



>ref|XP_009390937.1| PREDICTED: myb-related protein 305-like [Musa acuminata subsp. 
malaccensis]
Length=279

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+R+GPWT+EED +LI+YIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PDV+RG
Sbjct  5    DMELRRGPWTLEEDKLLIHYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDVKRG  64

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVI  487
            N++PEEQLLI+ELHAKWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q      S   
Sbjct  65   NLSPEEQLLILELHAKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKVDANSATF  124

Query  486  SGQGSC  469
                 C
Sbjct  125  RDAVRC  130



>gb|EEC69869.1| hypothetical protein OsI_00232 [Oryza sativa Indica Group]
Length=350

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +L+NYIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  27   ELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNL  86

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISG  481
            TPEEQLLI+ELH+KWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q      STV   
Sbjct  87   TPEEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKVDANSTVFRD  146

Query  480  QGSC  469
               C
Sbjct  147  AVRC  150



>gb|ABC54967.1| MYB-like protein [Vitis vinifera]
Length=97

 Score =   191 bits (484),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -1

Query  834  RKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNITP  655
            RKG WT+EEDLILINYIANHGEGVWNSLA+SAGLKRTGKSCRLRWLNYLRPDVRRGNIT 
Sbjct  1    RKGGWTLEEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYLRPDVRRGNITD  60

Query  654  EEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFW  547
            EEQ LIMELHAKWGNRWSKIAKHLPGRTDNEIKNFW
Sbjct  61   EEQQLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFW  96



>gb|AFR67332.1| R2R3 MYB protein [Thinopyrum intermedium]
 gb|AGO03572.1| R2R3 MYB transcription factor [Thinopyrum intermedium]
 gb|AGO03573.1| R2R3 MYB transcription factor [Thinopyrum intermedium]
Length=323

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
             +S  + ++R GPWT EED++L++YI+ HGEG WNSLAR AGL+RTGKSCRLRWLNYLRP
Sbjct  37   TASEDEGDLRGGPWTAEEDMLLVDYISKHGEGRWNSLARCAGLRRTGKSCRLRWLNYLRP  96

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            DVRRGNITPEEQLLI++LH++WGNRWSKIA+ LPGRTDNE+KN+WRTR+QKH KQ
Sbjct  97   DVRRGNITPEEQLLILDLHSRWGNRWSKIAQRLPGRTDNEVKNYWRTRVQKHAKQ  151



>ref|XP_003535723.1| PREDICTED: transcription factor MYB108-like [Glycine max]
 gb|KHN05558.1| Transcription factor MYB21 [Glycine soja]
Length=308

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 107/119 (90%), Gaps = 0/119 (0%)
 Frame = -1

Query  873  KTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLN  694
            K   +S+  + E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWLN
Sbjct  6    KRDLSSNEEESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWLN  65

Query  693  YLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            YL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTRIQK  +Q
Sbjct  66   YLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRIQKQARQ  124



>ref|XP_002279433.1| PREDICTED: transcription factor MYB24 [Vitis vinifera]
Length=288

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            N+SS + E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+P
Sbjct  9    NNSSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKP  68

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            D++RGN+TP+EQLLI+ELH+KWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  69   DIKRGNLTPQEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQ  123



>ref|XP_004497077.1| PREDICTED: transcription factor MYB21-like [Cicer arietinum]
Length=314

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +LI+YIA+HGEG WN LA+SAGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  26   ELRRGPWTLEEDSLLIHYIAHHGEGRWNMLAKSAGLKRTGKSCRLRWLNYLKPDIKRGNL  85

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  86   TPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  133



>gb|EMT04483.1| Transcription factor MYB21 [Aegilops tauschii]
Length=281

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 102/107 (95%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +R+GPWT++EDL LINYIA+HGEG WN+LAR+AGL+RTGKSCRLRWLNYLRPDV+RGN T
Sbjct  11   LRRGPWTVDEDLTLINYIADHGEGRWNALARAAGLRRTGKSCRLRWLNYLRPDVKRGNFT  70

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             +EQLLI++LH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  71   ADEQLLILDLHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQ  117



>ref|XP_009382479.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=264

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+G WT EEDL+L+NYIA HGEG W+SLAR AGL+RTGKSCRLRWLNYLRPDVRRGNI
Sbjct  12   ELRRGAWTAEEDLVLMNYIALHGEGRWSSLARRAGLRRTGKSCRLRWLNYLRPDVRRGNI  71

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLK  520
            TPEEQLLI+ELH++WGNRWSKIA++LPGRTDNEIKN+WRTR+QKH K
Sbjct  72   TPEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAK  118



>emb|CBI27001.3| unnamed protein product [Vitis vinifera]
Length=295

 Score =   197 bits (501),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  861  NSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRP  682
            N+SS + E+R+GPWT+EED +LI+YIA HGEG WN LA+ AGLKRTGKSCRLRWLNYL+P
Sbjct  9    NNSSEEIELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKCAGLKRTGKSCRLRWLNYLKP  68

Query  681  DVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATN  502
            D++RGN+TP+EQLLI+ELH+KWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q    +
Sbjct  69   DIKRGNLTPQEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKIES  128

Query  501  ES  496
            +S
Sbjct  129  DS  130



>ref|XP_002451276.1| hypothetical protein SORBIDRAFT_05g026820 [Sorghum bicolor]
 gb|EES10264.1| hypothetical protein SORBIDRAFT_05g026820 [Sorghum bicolor]
Length=362

 Score =   199 bits (505),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT++EDL LINYIA+HGEG WN+LAR+AGLKRTGKSCRLRWLNYLRPDV+RG+ 
Sbjct  64   ELRRGPWTVDEDLTLINYIADHGEGRWNALARAAGLKRTGKSCRLRWLNYLRPDVKRGDF  123

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI++LH++WGNRWSKIA HLPGRTDNEIKN+WRTR+QKH KQ
Sbjct  124  TADEQLLILDLHSRWGNRWSKIAAHLPGRTDNEIKNYWRTRVQKHAKQ  171



>gb|AAL84765.1|AF474132_1 typical P-type R2R3 Myb protein [Sorghum bicolor]
Length=183

 Score =   193 bits (491),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++ +GPW++EED++L+NY+A HGEG WN+LAR AGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  22   DLHRGPWSVEEDMLLVNYVAAHGEGRWNALARCAGLRRTGKSCRLRWLNYLRPDLRRGNI  81

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +Q
Sbjct  82   TAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQ  129



>dbj|BAB18296.1| putative dehydration-induced myb-related protein Cpm7 [Oryza 
sativa Japonica Group]
Length=341

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +L+NYIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  18   ELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNL  77

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISG  481
            TPEEQLLI+ELH++WGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q      STV   
Sbjct  78   TPEEQLLILELHSRWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKVDANSTVFRD  137

Query  480  QGSC  469
               C
Sbjct  138  AVRC  141



>ref|NP_001041908.1| Os01g0128000 [Oryza sativa Japonica Group]
 dbj|BAF03822.1| Os01g0128000 [Oryza sativa Japonica Group]
 gb|EEE53799.1| hypothetical protein OsJ_00224 [Oryza sativa Japonica Group]
Length=350

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +L+NYIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  27   ELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNL  86

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISG  481
            TPEEQLLI+ELH++WGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q      STV   
Sbjct  87   TPEEQLLILELHSRWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKVDANSTVFRD  146

Query  480  QGSC  469
               C
Sbjct  147  AVRC  150



>gb|KHN11407.1| Transcription factor MYB21 [Glycine soja]
Length=307

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            +   CN    + E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWL
Sbjct  7    RDLSCNEE--ESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWL  64

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  65   NYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  124



>ref|XP_008667098.1| PREDICTED: putative MYB DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
Length=321

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            ++R+GPWT+EED++L+NY+A HGEG WN+LAR AGL+RTGKSCRLRWLNYLRPD+RRGNI
Sbjct  21   DLRRGPWTVEEDMLLVNYVAAHGEGRWNALARCAGLRRTGKSCRLRWLNYLRPDLRRGNI  80

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            T +EQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QKH +Q
Sbjct  81   TAQEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHARQ  128



>ref|XP_010265100.1| PREDICTED: myb-related protein MYBAS2-like [Nelumbo nucifera]
Length=303

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 106/115 (92%), Gaps = 3/115 (3%)
 Frame = -1

Query  846  DPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRG  667
            D E+R+GPWT+EED +LI+YIA HGEG WN LA+S+GLKRTGKSCRLRWLNYL+PDV+RG
Sbjct  14   DVELRRGPWTLEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYLKPDVKRG  73

Query  666  NITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQK---HLKQEA  511
            N+TPEEQLLI+ELH++WGNRWSKIA+HLPGRTDNEIKN+WRTR+QK   HLK +A
Sbjct  74   NLTPEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARHLKIDA  128



>ref|XP_003555909.1| PREDICTED: transcription factor MYB108-like [Glycine max]
Length=307

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 106/120 (88%), Gaps = 2/120 (2%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            +   CN    + E+R+GPWT+EED +LI+YIA HGEG WN LA+SAGLKRTGKSCRLRWL
Sbjct  7    RDLSCNEE--ESELRRGPWTLEEDSLLIHYIARHGEGRWNMLAKSAGLKRTGKSCRLRWL  64

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  65   NYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  124



>ref|XP_009356946.1| PREDICTED: transcription factor MYB21-like [Pyrus x bretschneideri]
Length=298

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E R+GPWT+EED +LI+YI NHGEG WNSLA+ AGLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  12   EFRRGPWTLEEDNLLIHYIMNHGEGHWNSLAKLAGLKRTGKSCRLRWLNYLKPDIKRGNL  71

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQL+I+ELHAKWGNRWSKIA+HLPGRTDNEIKN+WRTR+QK  +Q
Sbjct  72   TPQEQLVILELHAKWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKQARQ  119



>ref|XP_002311464.2| hypothetical protein POPTR_0008s12130g [Populus trichocarpa]
 gb|EEE88831.2| hypothetical protein POPTR_0008s12130g [Populus trichocarpa]
Length=319

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  876  KKTCCNSSSYDPEIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL  697
            +K  CN    + E+R+GPWT+EED +L +YI  HGEG WN LAR AGLKRTGKSCRLRWL
Sbjct  5    RKRICNPREEESELRRGPWTLEEDTLLTHYITRHGEGRWNMLARGAGLKRTGKSCRLRWL  64

Query  696  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            NYL+PD++RGN+TP+EQLLI+ELH+KWGNRWSKIA+HLPGRTDNEIKN+WRT++QK  +Q
Sbjct  65   NYLKPDIKRGNLTPQEQLLILELHSKWGNRWSKIAQHLPGRTDNEIKNYWRTKVQKEARQ  124



>ref|NP_001182983.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR35333.1| unknown [Zea mays]
 gb|AFW57483.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB04393.1| MYB transcription factor, partial [Zea mays]
Length=359

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = -1

Query  837  IRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNIT  658
            +R+GPWT++ED++L+NYIA HGEG WNSLARSAGLKRTGKSCRLRWLNYLRP+VRRGNIT
Sbjct  63   LRRGPWTVDEDILLVNYIAAHGEGRWNSLARSAGLKRTGKSCRLRWLNYLRPNVRRGNIT  122

Query  657  PEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
             EEQLLI++LH++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH + 
Sbjct  123  AEEQLLILDLHSRWGNRWSKIAQQLPGRTDNEIKNYWRTRVQKHARH  169



>ref|XP_006643700.1| PREDICTED: transcription repressor MYB4-like [Oryza brachyantha]
Length=358

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EED +L+NYIA HGEG WN LAR +GLKRTGKSCRLRWLNYL+PD++RGN+
Sbjct  28   ELRRGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYLKPDIKRGNL  87

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQEAATNESTVISG  481
            TPEEQLLI+ELH+KWGNRWS+IA+HLPGRTDNEIKN+WRTR+QK  +Q      STV   
Sbjct  88   TPEEQLLILELHSKWGNRWSRIAQHLPGRTDNEIKNYWRTRVQKQARQLKVDANSTVFRD  147

Query  480  QGSC  469
               C
Sbjct  148  AVRC  151



>ref|XP_009398691.1| PREDICTED: transcription factor MYB108-like [Musa acuminata subsp. 
malaccensis]
Length=250

 Score =   194 bits (494),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -1

Query  840  EIRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRRGNI  661
            E+R+GPWT+EEDL+LI Y+  HG+G WN+LAR AGLKRTGKSCRLRWLNYLRPD+RRGNI
Sbjct  3    ELRRGPWTVEEDLVLIKYVTEHGDGQWNALARLAGLKRTGKSCRLRWLNYLRPDIRRGNI  62

Query  660  TPEEQLLIMELHAKWGNRWSKIAKHLPGRTDNEIKNFWRTRIQKHLKQ  517
            TP+EQLLI+EL ++WGNRWSKIA+ LPGRTDNEIKN+WRTR+QKH KQ
Sbjct  63   TPDEQLLILELQSRWGNRWSKIARCLPGRTDNEIKNYWRTRVQKHAKQ  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1875420020936