BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81732_g1_i1 len=1193 path=[1171:0-1192]

Length=1193
                                                                      Score     E

ref|XP_009761637.1|  PREDICTED: uncharacterized protein LOC104213789    338   1e-110   
ref|XP_006339714.1|  PREDICTED: uncharacterized protein LOC102583131    333   7e-109   
ref|XP_004229983.1|  PREDICTED: uncharacterized protein LOC101252...    332   1e-108   
ref|XP_004229984.1|  PREDICTED: uncharacterized protein LOC101252...    332   2e-108   
ref|XP_009607476.1|  PREDICTED: uncharacterized protein LOC104101689    332   2e-108   
ref|XP_011093032.1|  PREDICTED: uncharacterized protein LOC105173080    308   3e-99    
ref|XP_002523346.1|  conserved hypothetical protein                     291   2e-92    Ricinus communis
ref|XP_007051546.1|  Acid phosphatase/vanadium-dependent halopero...    291   2e-92    
gb|EYU32246.1|  hypothetical protein MIMGU_mgv1a011772mg                290   3e-92    
emb|CDP08674.1|  unnamed protein product                                283   4e-89    
ref|XP_010534432.1|  PREDICTED: uncharacterized protein LOC104809...    282   4e-89    
ref|XP_010267623.1|  PREDICTED: uncharacterized protein LOC104604...    282   1e-88    
ref|XP_006491277.1|  PREDICTED: uncharacterized protein LOC102622...    281   4e-88    
ref|XP_006491278.1|  PREDICTED: uncharacterized protein LOC102622...    281   4e-88    
gb|KDO86484.1|  hypothetical protein CISIN_1g022192mg                   280   7e-88    
ref|XP_006444837.1|  hypothetical protein CICLE_v10021359mg             280   8e-88    
ref|XP_011023177.1|  PREDICTED: uncharacterized protein LOC105124761    279   1e-87    
ref|XP_006402444.1|  hypothetical protein EUTSA_v10006136mg             276   2e-86    
ref|XP_010666525.1|  PREDICTED: uncharacterized protein LOC104883650    275   6e-86    
ref|XP_002876638.1|  hypothetical protein ARALYDRAFT_907735             274   9e-86    
ref|NP_567117.1|  Acid phosphatase/vanadium-dependent haloperoxid...    273   2e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512550.1|  PREDICTED: uncharacterized protein LOC104788482    273   2e-85    
ref|XP_010469022.1|  PREDICTED: uncharacterized protein LOC104749139    273   3e-85    
ref|XP_004306672.1|  PREDICTED: uncharacterized membrane protein ...    270   2e-84    
ref|XP_010413348.1|  PREDICTED: uncharacterized protein LOC104699706    271   2e-84    
ref|XP_010055015.1|  PREDICTED: uncharacterized protein LOC104443360    271   2e-84    
ref|XP_006291605.1|  hypothetical protein CARUB_v10017759mg             270   4e-84    
ref|XP_002263519.1|  PREDICTED: uncharacterized protein LOC100260453    268   5e-84    Vitis vinifera
emb|CAB71107.1|  putative protein                                       266   8e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004133813.1|  PREDICTED: uncharacterized protein LOC101209825    269   1e-83    
ref|XP_008437892.1|  PREDICTED: uncharacterized protein LOC103483...    268   1e-83    
ref|XP_008233149.1|  PREDICTED: uncharacterized protein LOC103332206    269   2e-83    
emb|CAN71954.1|  hypothetical protein VITISV_024312                     264   3e-83    Vitis vinifera
gb|KDP28486.1|  hypothetical protein JCGZ_14257                         263   6e-83    
ref|XP_004155165.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    266   1e-82    
ref|XP_002301410.2|  hypothetical protein POPTR_0002s17230g             265   4e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009336782.1|  PREDICTED: uncharacterized protein LOC103929322    265   4e-82    
ref|XP_010266541.1|  PREDICTED: uncharacterized protein LOC104604...    265   4e-82    
ref|XP_006852638.1|  hypothetical protein AMTR_s00021p00238190          264   5e-82    
ref|XP_004494823.1|  PREDICTED: uncharacterized membrane protein ...    262   9e-82    
ref|XP_008376095.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    263   2e-81    
emb|CDY11380.1|  BnaA09g39460D                                          262   3e-81    
ref|XP_010266542.1|  PREDICTED: uncharacterized protein LOC104604...    262   5e-81    
ref|XP_003554767.1|  PREDICTED: uncharacterized protein LOC100793...    259   5e-81    
gb|KFK35365.1|  hypothetical protein AALP_AA5G275800                    258   8e-81    
gb|KHG26804.1|  putative membrane yuiD                                  263   8e-81    
ref|XP_009116844.1|  PREDICTED: uncharacterized protein LOC103841999    258   8e-80    
ref|XP_010053826.1|  PREDICTED: uncharacterized protein LOC104442179    259   1e-79    
emb|CDX71706.1|  BnaC08g31680D                                          256   3e-79    
gb|KEH24632.1|  acid phosphatase/vanadium-dependent haloperoxidase      256   3e-79    
ref|XP_007147313.1|  hypothetical protein PHAVU_006G113300g             254   6e-79    
emb|CDX67863.1|  BnaA07g19030D                                          255   1e-78    
ref|XP_009104347.1|  PREDICTED: uncharacterized protein LOC103830326    255   2e-78    
emb|CDY25075.1|  BnaC06g18170D                                          253   8e-78    
ref|XP_008799605.1|  PREDICTED: uncharacterized protein LOC103714204    243   6e-74    
ref|XP_010924505.1|  PREDICTED: uncharacterized protein LOC105047322    243   1e-73    
ref|XP_010918287.1|  PREDICTED: uncharacterized protein LOC105042688    243   2e-73    
ref|XP_009395045.1|  PREDICTED: uncharacterized protein LOC103980...    235   1e-70    
ref|XP_009395047.1|  PREDICTED: uncharacterized protein LOC103980...    235   1e-70    
ref|XP_001764463.1|  predicted protein                                  232   2e-70    
ref|XP_001764571.1|  predicted protein                                  229   9e-70    
ref|XP_006491279.1|  PREDICTED: uncharacterized protein LOC102622...    231   2e-69    
ref|XP_010534433.1|  PREDICTED: uncharacterized protein LOC104809...    229   4e-69    
gb|EAY98815.1|  hypothetical protein OsI_20760                          227   9e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_010267624.1|  PREDICTED: uncharacterized protein LOC104604...    227   9e-68    
ref|XP_008437893.1|  PREDICTED: uncharacterized protein LOC103483...    218   2e-64    
ref|XP_008649891.1|  PREDICTED: uncharacterized protein LOC103630623    214   4e-63    
ref|XP_008437894.1|  PREDICTED: uncharacterized protein LOC103483...    213   6e-63    
ref|XP_002960492.1|  hypothetical protein SELMODRAFT_74719              210   8e-63    
ref|XP_010266543.1|  PREDICTED: uncharacterized protein LOC104604...    211   8e-62    
ref|XP_002440134.1|  hypothetical protein SORBIDRAFT_09g026640          211   1e-61    Sorghum bicolor [broomcorn]
ref|XP_006604907.1|  PREDICTED: uncharacterized protein LOC100793...    207   3e-61    
ref|XP_002967232.1|  hypothetical protein SELMODRAFT_86540              205   6e-61    
ref|XP_004961400.1|  PREDICTED: uncharacterized protein LOC101779439    208   2e-60    
ref|XP_008656483.1|  PREDICTED: uncharacterized protein LOC103635879    206   7e-60    
ref|NP_001056147.2|  Os05g0534100                                       176   2e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010095753.1|  hypothetical protein L484_017559                   171   5e-46    
gb|EMT33339.1|  hypothetical protein F775_20499                         157   4e-43    
gb|EMS52991.1|  hypothetical protein TRIUR3_19548                       159   1e-41    
gb|AFW82568.1|  hypothetical protein ZEAMMB73_734869                    154   5e-40    
ref|XP_001416200.1|  Phosphatidic acid Phosphatase-related protein      154   1e-39    Ostreococcus lucimarinus CCE9901
ref|XP_003056035.1|  predicted protein                                  149   2e-39    
ref|XP_002507531.1|  phosphatidic acid phosphatase-related protein      150   4e-38    Micromonas commoda
ref|XP_010231118.1|  PREDICTED: uncharacterized protein LOC100840609    146   2e-37    
ref|XP_006655523.1|  PREDICTED: uncharacterized protein LOC102710880    142   2e-37    
ref|XP_003074907.1|  Pap2 Phosphatidic acid Phosphatase-related p...    147   2e-37    
ref|XP_005650276.1|  DUF212-domain-containing protein                   148   2e-36    
ref|XP_007509127.1|  Phosphatidic acid Phosphatase-related protein      142   4e-36    
ref|XP_001692930.1|  predicted protein                                  139   1e-34    Chlamydomonas reinhardtii
ref|XP_002953421.1|  hypothetical protein VOLCADRAFT_94209              136   2e-34    
ref|XP_010248889.1|  PREDICTED: uncharacterized protein LOC104591652    131   2e-32    
ref|XP_010930079.1|  PREDICTED: uncharacterized protein LOC105051...    129   5e-32    
ref|XP_008446081.1|  PREDICTED: uncharacterized protein LOC103488...    129   7e-32    
ref|XP_008801866.1|  PREDICTED: uncharacterized protein LOC103715868    129   8e-32    
ref|XP_002514991.1|  conserved hypothetical protein                     129   1e-31    Ricinus communis
ref|XP_004135303.1|  PREDICTED: uncharacterized membrane protein ...    129   1e-31    
gb|AFK35217.1|  unknown                                                 128   1e-31    
ref|XP_009359319.1|  PREDICTED: uncharacterized protein LOC103949904    127   2e-31    
ref|XP_005850480.1|  hypothetical protein CHLNCDRAFT_13680              126   3e-31    
ref|XP_006584600.1|  PREDICTED: uncharacterized protein LOC100812...    125   1e-30    
ref|XP_008446080.1|  PREDICTED: uncharacterized protein LOC103488...    126   1e-30    
ref|XP_004972960.1|  PREDICTED: uncharacterized protein LOC101763832    125   1e-30    
ref|XP_002888611.1|  hypothetical protein ARALYDRAFT_315776             125   2e-30    
ref|NP_176927.1|  acid phosphatase/vanadium-dependent haloperoxid...    125   2e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002443801.1|  hypothetical protein SORBIDRAFT_07g002280          125   3e-30    Sorghum bicolor [broomcorn]
ref|XP_009109836.1|  PREDICTED: uncharacterized protein LOC103835422    124   3e-30    
gb|KFK44497.1|  hypothetical protein AALP_AA1G264800                    124   4e-30    
ref|WP_021621025.1|  divergent PAP2 family protein                      124   4e-30    
emb|CDY36142.1|  BnaA08g19060D                                          124   4e-30    
ref|XP_008389817.1|  PREDICTED: uncharacterized protein LOC103452109    124   5e-30    
gb|AAG52298.1|AC011020_5  unknown protein                               123   6e-30    Arabidopsis thaliana [mouse-ear cress]
emb|CDY54828.1|  BnaC03g75800D                                          124   6e-30    
ref|XP_009393775.1|  PREDICTED: uncharacterized protein LOC103979...    123   8e-30    
ref|XP_003580012.1|  PREDICTED: uncharacterized protein LOC100829864    122   9e-30    
ref|XP_006415796.1|  hypothetical protein EUTSA_v10008942mg             123   9e-30    
ref|WP_039767780.1|  membrane protein                                   122   1e-29    
ref|XP_009392613.1|  PREDICTED: uncharacterized protein LOC103978515    123   1e-29    
ref|NP_001150731.1|  acid phosphatase/vanadium-dependent halopero...    123   1e-29    Zea mays [maize]
ref|XP_009393774.1|  PREDICTED: uncharacterized protein LOC103979...    123   1e-29    
ref|XP_006304265.1|  hypothetical protein CARUB_v10010495mg             122   2e-29    
ref|XP_010926594.1|  PREDICTED: uncharacterized protein LOC105048...    122   2e-29    
ref|XP_011071195.1|  PREDICTED: uncharacterized protein LOC105156684    123   2e-29    
emb|CEF97148.1|  Acid phosphatase/vanadium-dependent haloperoxida...    122   2e-29    
ref|WP_025746508.1|  hypothetical protein                               122   2e-29    
ref|XP_003078206.1|  unnamed protein product                            124   2e-29    
ref|XP_004976017.1|  PREDICTED: uncharacterized protein LOC101774394    122   2e-29    
ref|XP_006367507.1|  PREDICTED: uncharacterized protein LOC102588354    122   2e-29    
ref|XP_004310049.1|  PREDICTED: uncharacterized membrane protein ...    122   2e-29    
ref|XP_007158710.1|  hypothetical protein PHAVU_002G175900g             121   2e-29    
emb|CDY12658.1|  BnaA02g13260D                                          122   3e-29    
ref|WP_013403329.1|  acid phosphatase                                   121   3e-29    
ref|XP_002269103.1|  PREDICTED: uncharacterized protein LOC100252740    122   3e-29    Vitis vinifera
emb|CBI27561.3|  unnamed protein product                                122   3e-29    
ref|WP_024049226.1|  Acid phosphatase/vanadium-dependent halopero...    121   3e-29    
ref|WP_011917370.1|  acid phosphatase                                   121   3e-29    
dbj|BAJ96572.1|  predicted protein                                      122   3e-29    
ref|XP_009783343.1|  PREDICTED: uncharacterized protein LOC104231958    122   3e-29    
ref|WP_034436167.1|  hypothetical protein                               121   3e-29    
ref|XP_002947271.1|  hypothetical protein VOLCADRAFT_79562              124   3e-29    
ref|XP_006584599.1|  PREDICTED: uncharacterized protein LOC100812...    121   3e-29    
ref|XP_010531343.1|  PREDICTED: uncharacterized protein LOC104807...    121   3e-29    
ref|XP_011041553.1|  PREDICTED: uncharacterized protein LOC105137493    122   3e-29    
ref|XP_010478026.1|  PREDICTED: uncharacterized protein LOC104757034    121   3e-29    
gb|EYU25931.1|  hypothetical protein MIMGU_mgv1a019225mg                122   3e-29    
ref|XP_001699970.1|  vanadium-dependent haloperoxidase-like protein     122   4e-29    Chlamydomonas reinhardtii
dbj|BAK00335.1|  predicted protein                                      122   4e-29    
ref|XP_009778706.1|  PREDICTED: uncharacterized protein LOC104228020    122   4e-29    
ref|XP_006302908.1|  hypothetical protein CARUB_v10021043mg             121   4e-29    
ref|XP_001416961.1|  predicted protein                                  121   5e-29    Ostreococcus lucimarinus CCE9901
ref|XP_003573329.1|  PREDICTED: uncharacterized protein LOC100821322    121   6e-29    
ref|XP_002315626.2|  hypothetical protein POPTR_0010s06670g             121   7e-29    Populus trichocarpa [western balsam poplar]
ref|XP_004237231.1|  PREDICTED: uncharacterized protein LOC101251275    120   7e-29    
ref|XP_002501241.1|  predicted protein                                  120   7e-29    Micromonas commoda
ref|WP_013290562.1|  acid phosphatase                                   120   8e-29    
dbj|BAJ99829.1|  predicted protein                                      120   9e-29    
ref|XP_010499183.1|  PREDICTED: uncharacterized protein LOC104776764    120   9e-29    
ref|XP_003601814.1|  Acid phosphatase/vanadium-dependent halopero...    120   9e-29    
ref|XP_006304264.1|  hypothetical protein CARUB_v10010495mg             120   9e-29    
ref|WP_026731738.1|  acid phosphatase                                   120   1e-28    
ref|XP_011086745.1|  PREDICTED: uncharacterized protein LOC105168382    120   1e-28    
gb|KDD75107.1|  PAP2 family protein                                     120   1e-28    
ref|WP_015907768.1|  acid phosphatase                                   120   1e-28    
gb|EYU22570.1|  hypothetical protein MIMGU_mgv1a014481mg                120   1e-28    
ref|XP_002890712.1|  hypothetical protein ARALYDRAFT_890238             120   1e-28    
ref|NP_564215.1|  Acid phosphatase/vanadium-dependent haloperoxid...    120   1e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006341745.1|  PREDICTED: uncharacterized protein LOC102585439    120   1e-28    
ref|XP_010415338.1|  PREDICTED: uncharacterized protein LOC104701365    120   1e-28    
gb|AAM63820.1|  unknown                                                 120   1e-28    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589503.1|  PREDICTED: uncharacterized protein LOC104086864    120   1e-28    
emb|CDX96079.1|  BnaA07g26520D                                          120   1e-28    
gb|KHG05528.1|  putative membrane yuiD                                  119   2e-28    
gb|EMT32031.1|  hypothetical protein F775_28345                         120   2e-28    
ref|WP_015171402.1|  acid phosphatase/vanadium-dependent halopero...    119   2e-28    
ref|XP_010103187.1|  hypothetical protein L484_006738                   120   2e-28    
ref|XP_010470671.1|  PREDICTED: uncharacterized protein LOC104750559    119   2e-28    
ref|WP_027414736.1|  membrane protein                                   119   2e-28    
ref|WP_013361557.1|  acid phosphatase [                                 119   2e-28    
emb|CDY03160.1|  BnaC06g08130D                                          117   2e-28    
ref|NP_001185084.1|  Acid phosphatase/vanadium-dependent halopero...    120   2e-28    
ref|NP_001148150.1|  LOC100281758                                       119   3e-28    Zea mays [maize]
gb|KFM23351.1|  putative membrane protein YuiD                          119   3e-28    
gb|EMS47761.1|  hypothetical protein TRIUR3_14304                       119   3e-28    
ref|XP_010926593.1|  PREDICTED: uncharacterized protein LOC105048...    120   3e-28    
dbj|BAJ91156.1|  predicted protein                                      119   3e-28    
ref|WP_035985451.1|  acid phosphatase                                   119   3e-28    
ref|XP_006391250.1|  hypothetical protein EUTSA_v10019219mg             119   3e-28    
ref|XP_010511708.1|  PREDICTED: uncharacterized protein LOC104787774    119   3e-28    
ref|XP_009604572.1|  PREDICTED: uncharacterized protein LOC104099328    119   3e-28    
ref|WP_017323616.1|  membrane protein                                   119   3e-28    
ref|WP_022849418.1|  membrane protein                                   118   3e-28    
ref|WP_034639986.1|  membrane protein                                   118   3e-28    
ref|WP_006638925.1|  transmembrane protein YuiD                         118   4e-28    
ref|WP_013430378.1|  acid phosphatase                                   118   4e-28    
gb|AAF97982.1|AC000103_32  F21J9.1                                      118   4e-28    Arabidopsis thaliana [mouse-ear cress]
ref|WP_013412020.1|  acid phosphatase                                   118   4e-28    
ref|WP_014794704.1|  MULTISPECIES: membrane protein                     118   4e-28    
ref|WP_038268005.1|  membrane protein [                                 118   4e-28    
ref|WP_015262814.1|  membrane protein                                   118   4e-28    
ref|WP_016875704.1|  membrane protein                                   118   4e-28    
ref|WP_034131658.1|  acid phosphatase                                   118   5e-28    
ref|WP_012063634.1|  acid phosphatase                                   118   5e-28    
ref|NP_001077594.1|  Acid phosphatase/vanadium-dependent halopero...    117   5e-28    Arabidopsis thaliana [mouse-ear cress]
gb|EMS45766.1|  hypothetical protein TRIUR3_17926                       118   5e-28    
emb|CDY15731.1|  BnaA07g09020D                                          118   6e-28    
ref|WP_012626455.1|  membrane protein                                   117   7e-28    
ref|WP_012159463.1|  acid phosphatase                                   117   7e-28    
ref|XP_006645184.1|  PREDICTED: uncharacterized protein LOC102713420    118   7e-28    
ref|XP_010556163.1|  PREDICTED: uncharacterized protein LOC104825518    117   7e-28    
ref|XP_010531349.1|  PREDICTED: uncharacterized protein LOC104807...    117   8e-28    
emb|CDP13311.1|  unnamed protein product                                119   8e-28    
ref|WP_013432570.1|  MULTISPECIES: acid phosphatase                     117   8e-28    
ref|XP_009105303.1|  PREDICTED: uncharacterized protein LOC103831184    118   9e-28    
ref|XP_006438103.1|  hypothetical protein CICLE_v10032910mg             118   9e-28    
ref|XP_006484048.1|  PREDICTED: uncharacterized protein LOC102619129    118   9e-28    
gb|EWH21263.1|  membrane protein                                        117   9e-28    
ref|WP_012410127.1|  membrane protein                                   117   1e-27    
ref|WP_029227570.1|  membrane protein                                   117   1e-27    
ref|NP_001141241.1|  acid phosphatase/vanadium-dependent halopero...    117   1e-27    Zea mays [maize]
gb|EPS65473.1|  hypothetical protein M569_09304                         117   1e-27    
ref|WP_003184918.1|  MULTISPECIES: membrane protein                     117   1e-27    
gb|EMT20290.1|  hypothetical protein F775_07250                         117   1e-27    
ref|WP_034145672.1|  membrane protein                                   116   1e-27    
ref|WP_026588609.1|  membrane protein                                   117   1e-27    
ref|WP_015150995.1|  hypothetical protein                               117   1e-27    
ref|XP_002458933.1|  hypothetical protein SORBIDRAFT_03g042940          117   1e-27    Sorghum bicolor [broomcorn]
emb|CDY32544.1|  BnaC02g17370D                                          117   1e-27    
emb|CDM84900.1|  unnamed protein product                                117   1e-27    
ref|WP_003134379.1|  acid phosphatase                                   116   2e-27    
emb|CDY01824.1|  BnaC06g28640D                                          117   2e-27    
ref|XP_004239189.1|  PREDICTED: uncharacterized protein LOC101261814    117   2e-27    
ref|XP_010025345.1|  PREDICTED: uncharacterized protein LOC104415704    117   2e-27    
emb|CDP13798.1|  unnamed protein product                                117   2e-27    
ref|XP_003596939.1|  Membrane protein, putative                         117   2e-27    
ref|WP_037224641.1|  acid phosphatase                                   116   2e-27    
ref|WP_014183540.1|  membrane protein                                   116   2e-27    
gb|AAC00597.1|  Hypothetical protein                                    117   2e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803556.1|  PREDICTED: uncharacterized protein LOC103717088    117   2e-27    
ref|NP_001045113.1|  Os01g0901800                                       116   3e-27    Oryza sativa Japonica Group [Japonica rice]
ref|WP_013190731.1|  membrane protein                                   115   3e-27    
gb|KFK41167.1|  hypothetical protein AALP_AA2G094500                    116   3e-27    
emb|CDY03897.1|  BnaC07g11220D                                          116   3e-27    
ref|WP_034597146.1|  membrane protein                                   115   3e-27    
ref|XP_004970952.1|  PREDICTED: uncharacterized protein LOC101784...    116   3e-27    
ref|WP_009460306.1|  MULTISPECIES: membrane protein                     115   3e-27    
ref|WP_014901978.1|  membrane protein                                   115   3e-27    
ref|WP_016859662.1|  MULTISPECIES: membrane protein                     115   3e-27    
ref|WP_017302090.1|  membrane protein                                   115   4e-27    
ref|WP_017313375.1|  membrane protein                                   115   4e-27    
ref|WP_020491638.1|  membrane protein                                   115   5e-27    
ref|WP_038027283.1|  acid phosphatase                                   115   5e-27    
ref|XP_008229990.1|  PREDICTED: uncharacterized protein LOC103329316    115   5e-27    
ref|WP_015042532.1|  MULTISPECIES: membrane protein                     115   6e-27    
ref|XP_007163732.1|  hypothetical protein PHAVU_001G259700g             115   6e-27    
ref|WP_005810945.1|  membrane protein                                   114   6e-27    
ref|XP_010682858.1|  PREDICTED: uncharacterized protein LOC104897628    116   6e-27    
ref|WP_015187540.1|  acid phosphatase/vanadium-dependent halopero...    115   6e-27    
ref|XP_007020732.1|  Acid phosphatase/vanadium-dependent halopero...    115   7e-27    
ref|WP_017745413.1|  MULTISPECIES: membrane protein                     115   7e-27    
dbj|BAD82772.1|  unknown protein                                        115   7e-27    Oryza sativa Japonica Group [Japonica rice]
ref|WP_039729447.1|  acid phosphatase                                   115   7e-27    
ref|WP_003133825.1|  acid phosphatase                                   114   7e-27    
ref|WP_019715587.1|  membrane protein                                   115   7e-27    
ref|WP_015215281.1|  acid phosphatase/vanadium-dependent halopero...    114   8e-27    
ref|WP_026699406.1|  membrane protein                                   114   8e-27    
gb|EMS45078.1|  hypothetical protein TRIUR3_17955                       116   9e-27    
ref|WP_007910796.1|  membrane protein                                   114   9e-27    
ref|WP_012094675.1|  membrane protein                                   114   9e-27    
gb|KDP26759.1|  hypothetical protein JCGZ_17917                         115   1e-26    
ref|WP_008909827.1|  acid phosphatase                                   114   1e-26    
ref|WP_010994391.1|  membrane protein                                   114   1e-26    
ref|XP_003551646.1|  PREDICTED: uncharacterized protein LOC100815344    114   1e-26    
ref|WP_023071726.1|  membrane protein                                   114   1e-26    
ref|WP_026104370.1|  acid phosphatase                                   114   1e-26    
ref|XP_008455920.1|  PREDICTED: uncharacterized protein LOC103495...    114   1e-26    
ref|WP_012165103.1|  membrane protein                                   114   1e-26    
ref|XP_003538561.1|  PREDICTED: uncharacterized protein LOC100804874    114   1e-26    
ref|WP_029200568.1|  membrane protein                                   114   1e-26    
ref|XP_009760523.1|  PREDICTED: uncharacterized protein LOC104212861    114   1e-26    
ref|WP_011319461.1|  membrane protein                                   114   1e-26    
ref|WP_015226613.1|  acid phosphatase/vanadium-dependent halopero...    114   1e-26    
ref|WP_039715736.1|  acid phosphatase                                   114   1e-26    
ref|WP_026475878.1|  membrane protein                                   114   2e-26    
ref|WP_015153461.1|  acid phosphatase/vanadium-dependent halopero...    114   2e-26    
ref|WP_014024213.1|  acid phosphatase                                   113   2e-26    
ref|WP_010470823.1|  membrane protein                                   114   2e-26    
ref|WP_006194372.1|  membrane protein                                   114   2e-26    
ref|WP_013561005.1|  hypothetical protein                               113   2e-26    
gb|ETD05330.1|  acid phosphatase                                        113   2e-26    
ref|XP_009418448.1|  PREDICTED: uncharacterized protein LOC103998646    114   2e-26    
ref|WP_026063883.1|  membrane protein                                   113   2e-26    
ref|WP_015944620.1|  membrane protein                                   113   2e-26    
ref|WP_039753058.1|  acid phosphatase                                   113   2e-26    
ref|XP_003564859.1|  PREDICTED: uncharacterized protein LOC100821590    114   2e-26    
ref|WP_015207140.1|  hypothetical protein                               113   2e-26    
ref|XP_002317329.1|  hypothetical protein POPTR_0011s08930g             114   2e-26    
ref|WP_006516936.1|  hypothetical protein                               113   2e-26    
gb|ACN26503.1|  unknown                                                 113   2e-26    
ref|WP_015111578.1|  acid phosphatase/vanadium-dependent halopero...    113   2e-26    
ref|WP_029345132.1|  membrane protein                                   113   2e-26    
ref|WP_031549520.1|  membrane protein                                   113   3e-26    
ref|XP_004970951.1|  PREDICTED: uncharacterized protein LOC101784...    114   3e-26    
ref|XP_004151900.1|  PREDICTED: uncharacterized membrane protein ...    113   3e-26    
ref|WP_006097891.1|  membrane protein                                   113   3e-26    
ref|WP_015128908.1|  acid phosphatase/vanadium-dependent halopero...    113   3e-26    
ref|XP_008455921.1|  PREDICTED: uncharacterized protein LOC103495...    113   3e-26    
gb|KHG28740.1|  putative membrane yuiD                                  113   4e-26    
ref|NP_001146954.1|  acid phosphatase/vanadium-dependent halopero...    112   4e-26    
ref|WP_008230484.1|  hypothetical protein                               112   5e-26    
ref|WP_006619999.1|  MULTISPECIES: membrane protein                     112   5e-26    
ref|WP_008232427.1|  hypothetical protein                               112   5e-26    
ref|WP_029636153.1|  acid phosphatase [                                 112   5e-26    
ref|XP_006659083.1|  PREDICTED: uncharacterized protein LOC102701286    112   5e-26    
ref|WP_023066786.1|  divergent PAP2 family protein                      112   6e-26    
ref|XP_010251340.1|  PREDICTED: uncharacterized protein LOC104593280    113   6e-26    
ref|XP_009608970.1|  PREDICTED: uncharacterized protein LOC104102835    112   6e-26    
ref|WP_015120449.1|  hypothetical protein                               112   7e-26    
ref|XP_007216413.1|  hypothetical protein PRUPE_ppa022761mg             112   7e-26    
ref|WP_007709487.1|  acid phosphatase [                                 112   8e-26    
ref|WP_013625052.1|  membrane protein                                   112   8e-26    
ref|WP_009785596.1|  membrane protein                                   112   8e-26    
ref|WP_007780041.1|  membrane protein                                   111   9e-26    
ref|WP_009624082.1|  membrane protein                                   111   9e-26    
ref|WP_006511522.1|  hypothetical protein                               111   9e-26    
gb|KFM25509.1|  putative membrane protein YuiD                          111   9e-26    
emb|CDY44323.1|  BnaC05g30700D                                          112   1e-25    
ref|XP_009135760.1|  PREDICTED: uncharacterized protein LOC103859915    112   1e-25    
ref|WP_027401933.1|  acid phosphatase                                   111   1e-25    
gb|AFW58653.1|  acid phosphatase/vanadium-dependent haloperoxidas...    111   1e-25    
gb|ABK26930.1|  unknown                                                 112   1e-25    
ref|WP_022090258.1|  putative uncharacterized protein                   111   1e-25    
ref|XP_009403648.1|  PREDICTED: uncharacterized protein LOC103987...    112   1e-25    
ref|WP_015573245.1|  MULTISPECIES: hypothetical protein                 111   1e-25    
ref|WP_017151500.1|  membrane protein                                   111   1e-25    
ref|WP_026315315.1|  hypothetical protein                               111   1e-25    
ref|XP_002961023.1|  hypothetical protein SELMODRAFT_164029             112   1e-25    
ref|WP_009632206.1|  hypothetical protein                               111   1e-25    
emb|CDY48897.1|  BnaA03g36360D                                          112   1e-25    
ref|XP_002966987.1|  hypothetical protein SELMODRAFT_168838             112   1e-25    
ref|XP_011097849.1|  PREDICTED: uncharacterized protein LOC105176...    111   1e-25    
ref|NP_001151640.1|  acid phosphatase/vanadium-dependent halopero...    111   1e-25    
ref|WP_031309465.1|  hypothetical protein                               111   1e-25    
emb|CDY32437.1|  BnaC03g42210D                                          111   1e-25    
ref|XP_002446696.1|  hypothetical protein SORBIDRAFT_06g020710          111   2e-25    
ref|WP_003198996.1|  membrane protein                                   110   2e-25    
ref|XP_004502318.1|  PREDICTED: uncharacterized membrane protein ...    111   2e-25    
ref|XP_009403649.1|  PREDICTED: uncharacterized protein LOC103987...    110   2e-25    
ref|WP_013458277.1|  membrane protein                                   110   2e-25    
ref|XP_002270664.1|  PREDICTED: uncharacterized protein LOC100246493    111   2e-25    
ref|XP_007223611.1|  hypothetical protein PRUPE_ppa012552mg             111   2e-25    
ref|WP_014828218.1|  membrane protein                                   110   2e-25    
gb|EYU33661.1|  hypothetical protein MIMGU_mgv1a015396mg                111   2e-25    
gb|AHF07375.1|  membrane protein                                        110   2e-25    
ref|WP_034421464.1|  hypothetical protein                               110   2e-25    
ref|WP_017653229.1|  membrane protein                                   110   2e-25    
ref|XP_002885453.1|  hypothetical protein ARALYDRAFT_898610             111   2e-25    
ref|WP_015139948.1|  hypothetical protein                               110   2e-25    
ref|XP_008222047.1|  PREDICTED: uncharacterized protein LOC103321975    111   2e-25    
ref|WP_022253662.1|  acid phosphatase/vanadium-dependent halopero...    110   2e-25    
ref|XP_010924085.1|  PREDICTED: uncharacterized protein LOC105047011    111   2e-25    
ref|WP_021170067.1|  acid phosphatase/vanadium-dependent halopero...    110   3e-25    
ref|WP_035157790.1|  acid phosphatase                                   110   3e-25    
ref|XP_010466409.1|  PREDICTED: uncharacterized protein LOC104746...    110   3e-25    
ref|WP_018765361.1|  MULTISPECIES: membrane protein                     110   3e-25    
ref|NP_001060903.1|  Os08g0127500                                       111   3e-25    
ref|XP_010488174.1|  PREDICTED: uncharacterized protein LOC104766057    110   3e-25    
ref|XP_010466410.1|  PREDICTED: uncharacterized protein LOC104746...    110   3e-25    
gb|AAT08699.1|  unknown                                                 110   3e-25    
dbj|BAL53081.1|  hypothetical conserved protein                         110   3e-25    
gb|KFK39481.1|  hypothetical protein AALP_AA3G249700                    110   3e-25    
ref|WP_015134957.1|  acid phosphatase/vanadium-dependent halopero...    110   3e-25    
ref|WP_015203056.1|  acid phosphatase/vanadium-dependent halopero...    110   3e-25    
ref|XP_011002588.1|  PREDICTED: uncharacterized protein LOC105109544    110   4e-25    
ref|XP_010556244.1|  PREDICTED: uncharacterized protein LOC104825584    109   4e-25    
ref|XP_006406251.1|  hypothetical protein EUTSA_v10021637mg             110   4e-25    
gb|EAZ41384.1|  hypothetical protein OsJ_25902                          111   4e-25    
ref|WP_035430830.1|  membrane protein                                   109   4e-25    
ref|WP_038482374.1|  membrane protein                                   110   4e-25    
ref|XP_001777913.1|  predicted protein                                  110   4e-25    
ref|WP_006530496.1|  hypothetical protein                               109   5e-25    
ref|WP_035397603.1|  membrane protein                                   109   5e-25    
ref|NP_001053141.1|  Os04g0486900                                       109   5e-25    
ref|XP_006298676.1|  hypothetical protein CARUB_v10014767mg             110   5e-25    
ref|XP_004287967.1|  PREDICTED: uncharacterized membrane protein ...    110   5e-25    
ref|WP_022794132.1|  membrane protein                                   109   5e-25    
ref|WP_020062118.1|  membrane protein                                   109   5e-25    
ref|WP_011613510.1|  membrane protein                                   109   5e-25    
ref|XP_006406252.1|  hypothetical protein EUTSA_v10021637mg             110   5e-25    
ref|WP_019504325.1|  hypothetical protein                               109   5e-25    
ref|WP_017317432.1|  membrane protein                                   109   6e-25    
ref|XP_008799229.1|  PREDICTED: uncharacterized protein LOC103713947    110   6e-25    
emb|CAD79703.2|  H0302E05.6                                             109   6e-25    
ref|WP_021850281.1|  putative uncharacterized protein                   109   6e-25    
ref|WP_011055874.1|  membrane protein                                   109   6e-25    
ref|WP_018589763.1|  hypothetical protein                               108   6e-25    
ref|WP_008412259.1|  Acid phosphatase/vanadium-dependent halopero...    109   6e-25    
ref|WP_025027962.1|  membrane protein                                   109   7e-25    
ref|WP_029738761.1|  hypothetical protein                               109   7e-25    
ref|WP_027321082.1|  membrane protein                                   109   7e-25    
gb|AFK40201.1|  unknown                                                 109   7e-25    
dbj|BAB02356.1|  unnamed protein product                                109   7e-25    
ref|XP_010524493.1|  PREDICTED: uncharacterized protein LOC104802...    109   8e-25    
ref|WP_026092973.1|  acid phosphatase                                   108   8e-25    
gb|EKE02233.1|  hypothetical protein ACD_20C00410G0019                  108   8e-25    
ref|WP_026685158.1|  membrane protein                                   108   8e-25    
ref|WP_036045932.1|  acid phosphatase                                   108   9e-25    
ref|WP_015230256.1|  hypothetical protein                               108   9e-25    
ref|XP_010510399.1|  PREDICTED: uncharacterized protein LOC104786648    109   9e-25    
ref|XP_010675740.1|  PREDICTED: uncharacterized protein LOC104891704    109   9e-25    
ref|WP_039200967.1|  acid phosphatase                                   108   9e-25    
ref|WP_014097584.1|  membrane protein                                   108   9e-25    
ref|XP_007149995.1|  hypothetical protein PHAVU_005G117000g             109   1e-24    
ref|WP_026559017.1|  membrane protein                                   108   1e-24    
ref|XP_007212170.1|  hypothetical protein PRUPE_ppa012498mg             109   1e-24    
ref|WP_038960486.1|  membrane protein                                   108   1e-24    
ref|XP_005646721.1|  DUF212-domain-containing protein                   108   1e-24    
ref|WP_013388155.1|  membrane protein                                   108   1e-24    
ref|XP_008364606.1|  PREDICTED: uncharacterized protein LOC103428283    108   1e-24    
ref|WP_008308051.1|  hypothetical protein                               108   1e-24    
gb|AFK33902.1|  unknown                                                 108   1e-24    
ref|WP_017551378.1|  membrane protein                                   108   1e-24    
ref|WP_015359887.1|  MULTISPECIES: acid phosphatase/vanadium-depe...    108   1e-24    
ref|WP_021642594.1|  divergent PAP2 family protein [                    108   1e-24    
ref|WP_011429286.1|  membrane protein                                   109   1e-24    
gb|AHM56497.1|  hypothetical protein EAL2_c12020                        108   1e-24    
ref|WP_022230387.1|  uncharacterized protein                            108   1e-24    
ref|XP_006447604.1|  hypothetical protein CICLE_v10016908mg             108   1e-24    
ref|WP_038601857.1|  membrane protein                                   108   1e-24    
ref|WP_035411095.1|  membrane protein                                   108   1e-24    
ref|WP_015079166.1|  hypothetical protein                               108   1e-24    
gb|ETP71875.1|  hypothetical protein UYO_2191                           108   1e-24    
ref|NP_188798.2|  Acid phosphatase/vanadium-dependent haloperoxid...    108   1e-24    
ref|WP_036006073.1|  acid phosphatase                                   108   2e-24    
gb|ABK25120.1|  unknown                                                 108   2e-24    
ref|XP_002529338.1|  conserved hypothetical protein                     108   2e-24    
ref|XP_010519266.1|  PREDICTED: uncharacterized protein LOC104798...    108   2e-24    
ref|XP_007049120.1|  Acid phosphatase/vanadium-dependent halopero...    108   2e-24    
ref|WP_015194597.1|  acid phosphatase/vanadium-dependent halopero...    108   2e-24    
ref|WP_034780824.1|  membrane protein                                   107   2e-24    
ref|XP_009404060.1|  PREDICTED: uncharacterized protein LOC103987467    108   2e-24    
ref|WP_003501162.1|  MULTISPECIES: acid phosphatase                     108   2e-24    
ref|XP_010644490.1|  PREDICTED: uncharacterized protein LOC100243...    108   2e-24    
ref|WP_031471891.1|  membrane protein [                                 107   2e-24    
ref|WP_021945795.1|  uncharacterized protein                            107   2e-24    
ref|WP_028085284.1|  acid phosphatase                                   107   2e-24    
gb|KDO39719.1|  hypothetical protein CISIN_1g030450mg                   108   2e-24    
ref|XP_002278573.1|  PREDICTED: uncharacterized protein LOC100243...    107   3e-24    
ref|WP_022604402.1|  hypothetical protein                               107   3e-24    
ref|XP_006352524.1|  PREDICTED: uncharacterized protein LOC102597233    107   3e-24    
ref|XP_004248365.1|  PREDICTED: uncharacterized protein LOC101246767    107   3e-24    
ref|WP_022022089.1|  tll0019 protein                                    107   3e-24    
ref|WP_016509891.1|  divergent PAP2 family protein                      107   3e-24    
ref|WP_017554802.1|  membrane protein                                   107   3e-24    
ref|WP_007934061.1|  MULTISPECIES: acid phosphatase                     107   3e-24    
ref|XP_009361033.1|  PREDICTED: uncharacterized protein LOC103951400    107   3e-24    
ref|WP_024125522.1|  protein of unknown function DUF212                 107   4e-24    
ref|WP_029716423.1|  membrane protein                                   107   4e-24    
ref|WP_021841840.1|  divergent PAP2 family protein                      107   4e-24    
gb|KDP30778.1|  hypothetical protein JCGZ_13721                         107   5e-24    
ref|XP_006438102.1|  hypothetical protein CICLE_v10032910mg             106   5e-24    
ref|XP_010519267.1|  PREDICTED: uncharacterized protein LOC104798...    107   5e-24    
ref|XP_010035542.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    107   5e-24    
ref|WP_008179962.1|  membrane protein                                   106   5e-24    
gb|EHL13956.1|  hypothetical protein HMPREF9624_01732                   107   5e-24    
ref|WP_036606393.1|  membrane protein                                   106   5e-24    
ref|WP_000256363.1|  membrane protein                                   106   6e-24    
ref|WP_022807232.1|  acid phosphatase                                   106   6e-24    
gb|KHG26468.1|  putative membrane yuiD                                  107   6e-24    
ref|WP_022481787.1|  uncharacterized protein                            106   6e-24    
ref|WP_002172856.1|  membrane protein                                   106   6e-24    
ref|XP_003540286.1|  PREDICTED: uncharacterized protein LOC100786344    107   7e-24    
ref|WP_007545726.1|  membrane protein                                   106   7e-24    
ref|WP_015144481.1|  hypothetical protein                               106   7e-24    
ref|WP_014629517.1|  membrane protein                                   106   8e-24    
ref|WP_025148102.1|  membrane protein                                   105   9e-24    
ref|XP_008787710.1|  PREDICTED: uncharacterized protein LOC103705...    106   9e-24    
ref|WP_018112238.1|  membrane protein                                   105   9e-24    
ref|WP_007358056.1|  MULTISPECIES: membrane protein                     105   1e-23    
ref|WP_007475031.1|  hypothetical protein                               106   1e-23    
ref|WP_036595048.1|  MULTISPECIES: membrane protein                     105   1e-23    
ref|WP_006556757.1|  hypothetical protein                               105   1e-23    
ref|WP_038312532.1|  hypothetical protein                               105   1e-23    
ref|WP_034626575.1|  membrane protein                                   105   1e-23    
ref|WP_017292476.1|  hypothetical protein                               105   1e-23    
ref|WP_000447820.1|  MULTISPECIES: membrane protein                     105   1e-23    
ref|WP_013322784.1|  membrane protein                                   105   1e-23    
ref|WP_015880512.1|  MULTISPECIES: membrane protein                     105   1e-23    
ref|WP_009534908.1|  acid phosphatase                                   105   1e-23    
ref|WP_002192732.1|  membrane protein                                   105   1e-23    
ref|NP_001238099.1|  uncharacterized protein LOC100306390               105   2e-23    
gb|KGN63221.1|  hypothetical protein Csa_2G416120                       105   2e-23    
ref|WP_000447819.1|  MULTISPECIES: membrane protein                     105   2e-23    
ref|WP_018206692.1|  hypothetical protein                               105   2e-23    
ref|WP_030006209.1|  acid phosphatase                                   105   2e-23    
ref|WP_012598017.1|  membrane protein                                   105   2e-23    
ref|WP_022345343.1|  uncharacterized protein conserved in bacteria      105   2e-23    
ref|WP_035422200.1|  MULTISPECIES: membrane protein                     105   2e-23    
ref|WP_022446062.1|  acid phosphatase/vanadium-dependent halopero...    105   2e-23    
ref|XP_011007188.1|  PREDICTED: uncharacterized protein LOC105112...    105   2e-23    
gb|ERG65951.1|  membrane protein                                        104   2e-23    
ref|WP_021864946.1|  acid phosphatase/vanadium-dependent halopero...    105   2e-23    



>ref|XP_009761637.1| PREDICTED: uncharacterized protein LOC104213789 [Nicotiana sylvestris]
Length=288

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 199/266 (75%), Gaps = 19/266 (7%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFNLPNS-----------FLRVHKPKTFGVSPITASQLNHQNPYLQC  891
             MDS VI+        NLPNS           F R  KPK    S +T S LN QNP  Q 
Sbjct  1     MDSFVISSAYRALPLNLPNSNITSFNLSSFCFFRFEKPKKLKTSSVTVSSLNPQNPNSQW  60

Query  890   GNHTSNRKPFLLLVPILKNLEDFASK---NNWISPVLQTPG-----EEFGGELLQSGGFG  735
              N +S  KPF LL+PI K ++DFA+K   N W+S +    G     E+  G LLQ+G FG
Sbjct  61    QNQSSYLKPFSLLLPIFKKVKDFAAKASMNKWVSFLRGGSGPENVPEKLSGNLLQNGSFG  120

Query  734   MALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
             MALLSIT+TA VKISPFVATLAANPTFVSG +AWLVAQS KVFL F VERKWDFR+M AS
Sbjct  121   MALLSITSTAKVKISPFVATLAANPTFVSGFIAWLVAQSMKVFLNFYVERKWDFRIMFAS  180

Query  554   GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLI  375
             GGMPSSH+ALCTALT SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI
Sbjct  181   GGMPSSHTALCTALTTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLI  240

Query  374   VEDLFKWHPMSQRKLKELLGHTPSQV  297
             VEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  241   VEDLFQGHPISQRKLKELLGHTPSQV  266



>ref|XP_006339714.1| PREDICTED: uncharacterized protein LOC102583131 [Solanum tuberosum]
Length=286

 Score =   333 bits (855),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 176/264 (67%), Positives = 198/264 (75%), Gaps = 17/264 (6%)
 Frame = -1

Query  1037  MDSVVINLPPPP-----------SRFNLPN-SFLRVHKPKTFGVSPITASQLNHQNPYLQ  894
             MDS++IN P              + FNL +  F R  +PK    S +T S LN QNP  +
Sbjct  1     MDSLLINSPYTALGSSNILNSNITSFNLSSFWFFRFKRPKILKTSSVTVSYLNPQNPNSE  60

Query  893   CGNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPG-----EEFGGELLQSGGFGMA  729
               N +S  KPF LL+PI K +++FA+KN W S      G     EE  G+LLQ+G FGMA
Sbjct  61    WQNQSSYLKPFSLLLPIFKKVKNFAAKNKWGSVFKGCSGTENVPEELRGDLLQNGSFGMA  120

Query  728   LLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGG  549
             LLSITATA VKISP VATLAANPTFVSG +AW VAQS KVFL F VERKWDFR+M ASGG
Sbjct  121   LLSITATAKVKISPIVATLAANPTFVSGFIAWFVAQSMKVFLNFFVERKWDFRIMFASGG  180

Query  548   MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
             MPSSHSALCTALT SVA+CHGVADSLFPVCLGF+LIVMYDAIGVRRHAGMQA+VLNLIVE
Sbjct  181   MPSSHSALCTALTTSVAICHGVADSLFPVCLGFTLIVMYDAIGVRRHAGMQAEVLNLIVE  240

Query  368   DLFKWHPMSQRKLKELLGHTPSQV  297
             DLF+ HP+SQRKLKELLGHTPSQV
Sbjct  241   DLFQGHPISQRKLKELLGHTPSQV  264



>ref|XP_004229983.1| PREDICTED: uncharacterized protein LOC101252225 isoform X1 [Solanum 
lycopersicum]
Length=286

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 196/264 (74%), Gaps = 17/264 (6%)
 Frame = -1

Query  1037  MDSVVINLPPPP-----------SRFNLPN-SFLRVHKPKTFGVSPITASQLNHQNPYLQ  894
             MDS++IN P              + FNL +  F R  +P     S +T S LN QNP  +
Sbjct  1     MDSLLINSPYTALASSKILNSNITSFNLSSFCFFRFKRPNKLKTSSVTVSYLNPQNPNSE  60

Query  893   CGNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPG-----EEFGGELLQSGGFGMA  729
               NH+S  KPF LL+PI K +++FA  N W S      G     EE  G+LLQ+G FGMA
Sbjct  61    WQNHSSYLKPFSLLLPIFKKVKNFAENNRWGSVFKGCSGTENVPEELRGDLLQNGSFGMA  120

Query  728   LLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGG  549
             LLSITATA VKISP VATLAANPTFVSG +AW +AQS KVFL FCVERKWDFR+M ASGG
Sbjct  121   LLSITATAKVKISPIVATLAANPTFVSGFIAWFMAQSMKVFLNFCVERKWDFRIMFASGG  180

Query  548   MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
             MPSSHSALCTALT SVA+CHGVADSLFPVCLGF+LIVMYDAIGVRRHAGMQA+VLNLIVE
Sbjct  181   MPSSHSALCTALTTSVAICHGVADSLFPVCLGFTLIVMYDAIGVRRHAGMQAEVLNLIVE  240

Query  368   DLFKWHPMSQRKLKELLGHTPSQV  297
             DLF+ HP+SQRKLKELLGHTP QV
Sbjct  241   DLFQGHPISQRKLKELLGHTPLQV  264



>ref|XP_004229984.1| PREDICTED: uncharacterized protein LOC101252225 isoform X2 [Solanum 
lycopersicum]
Length=278

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/264 (66%), Positives = 196/264 (74%), Gaps = 17/264 (6%)
 Frame = -1

Query  1037  MDSVVINLPPPP-----------SRFNLPN-SFLRVHKPKTFGVSPITASQLNHQNPYLQ  894
             MDS++IN P              + FNL +  F R  +P     S +T S LN QNP  +
Sbjct  1     MDSLLINSPYTALASSKILNSNITSFNLSSFCFFRFKRPNKLKTSSVTVSYLNPQNPNSE  60

Query  893   CGNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPG-----EEFGGELLQSGGFGMA  729
               NH+S  KPF LL+PI K +++FA  N W S      G     EE  G+LLQ+G FGMA
Sbjct  61    WQNHSSYLKPFSLLLPIFKKVKNFAENNRWGSVFKGCSGTENVPEELRGDLLQNGSFGMA  120

Query  728   LLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGG  549
             LLSITATA VKISP VATLAANPTFVSG +AW +AQS KVFL FCVERKWDFR+M ASGG
Sbjct  121   LLSITATAKVKISPIVATLAANPTFVSGFIAWFMAQSMKVFLNFCVERKWDFRIMFASGG  180

Query  548   MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
             MPSSHSALCTALT SVA+CHGVADSLFPVCLGF+LIVMYDAIGVRRHAGMQA+VLNLIVE
Sbjct  181   MPSSHSALCTALTTSVAICHGVADSLFPVCLGFTLIVMYDAIGVRRHAGMQAEVLNLIVE  240

Query  368   DLFKWHPMSQRKLKELLGHTPSQV  297
             DLF+ HP+SQRKLKELLGHTP QV
Sbjct  241   DLFQGHPISQRKLKELLGHTPLQV  264



>ref|XP_009607476.1| PREDICTED: uncharacterized protein LOC104101689 [Nicotiana tomentosiformis]
Length=286

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/264 (67%), Positives = 196/264 (74%), Gaps = 17/264 (6%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFNLPNS-----------FLRVHKPKTFGVSPITASQLNHQNPYLQC  891
             MDS+VIN        NLPNS           F R  KPK    SP+T S LN  NP  Q 
Sbjct  1     MDSLVINSAYRALPLNLPNSNITSFNLSSFCFFRFKKPKKLKASPVTVSSLNPPNPNSQW  60

Query  890   GNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPG------EEFGGELLQSGGFGMA  729
              N +S  KPF LL+PI K ++DFA+K +      +         E+  G LLQ+G FGMA
Sbjct  61    QNQSSYLKPFSLLLPIFKKVKDFAAKASKNKSFFKGGSGPENVPEKLSGNLLQNGSFGMA  120

Query  728   LLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGG  549
             LLSIT+TA VKISPFVATLAANPTFVSG +AWLVAQS KVFL F VERKWDFR+M ASGG
Sbjct  121   LLSITSTAKVKISPFVATLAANPTFVSGFIAWLVAQSMKVFLNFYVERKWDFRIMFASGG  180

Query  548   MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
             MPSSH+ALCTALT SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLIVE
Sbjct  181   MPSSHTALCTALTTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIVE  240

Query  368   DLFKWHPMSQRKLKELLGHTPSQV  297
             DLF+ HP+SQRKLKELLGHTPSQV
Sbjct  241   DLFQGHPISQRKLKELLGHTPSQV  264



>ref|XP_011093032.1| PREDICTED: uncharacterized protein LOC105173080 [Sesamum indicum]
Length=281

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 180/229 (79%), Gaps = 5/229 (2%)
 Frame = -1

Query  974  LRVHKPKTFGVSPITASQLNHQNPYLQCGNHTSNRKPFLLLVPILKNLEDFA---SKNNW  804
             R +K K F  S +T + L+ QNP    G ++S  KPF  L+P  + + DFA   SK  W
Sbjct  33   FRYNKSKRFRKSSLTVNSLSPQNPNSTWGAYSSPVKPFSYLLPFFQKVRDFAIKSSKRKW  92

Query  803  ISPVLQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVA  624
             S       +E   +L+Q+G FG AL+S+TATA VKISPFVATLAANPTFVS L AW +A
Sbjct  93   ASVFQDFSVQE--TKLMQNGAFGTALMSVTATAKVKISPFVATLAANPTFVSALCAWAIA  150

Query  623  QSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSL  444
            QS+KVFL FCVERKWDFR+M ASGGMPSSHSALCTALT SVA+CHGVADSLFPVCLGFSL
Sbjct  151  QSTKVFLNFCVERKWDFRIMFASGGMPSSHSALCTALTTSVAICHGVADSLFPVCLGFSL  210

Query  443  IVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            IVMYDAIGVRRHAGMQA+VLNLIVEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  211  IVMYDAIGVRRHAGMQAEVLNLIVEDLFQGHPISQRKLKELLGHTPSQV  259



>ref|XP_002523346.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39062.1| conserved hypothetical protein [Ricinus communis]
Length=288

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 171/217 (79%), Gaps = 10/217 (5%)
 Frame = -1

Query  917  NHQNPYLQCGNHTSNRKPFLLLVPILKNLE--DFASKNNWISPVLQTPGEE-------FG  765
            N QNP L   N   +  P  +LVP+L+ ++   F+    W+S  LQ   EE       + 
Sbjct  56   NAQNPRLTRKNDAFSFNPLWVLVPVLQRVKFIAFSQTKRWVSR-LQAYSEESEKAMNDYD  114

Query  764  GELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVER  585
            G  LQ+G FG+ALLSIT+ A VKISPFV+TLAANPTF+SGLLAW VAQS+KV L F VER
Sbjct  115  GNYLQNGAFGVALLSITSNAKVKISPFVSTLAANPTFISGLLAWFVAQSTKVILNFFVER  174

Query  584  KWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHA  405
            KWD R++ ASGGMPSSHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHA
Sbjct  175  KWDLRLLFASGGMPSSHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHA  234

Query  404  GMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            GMQA+VLN+IVEDLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  235  GMQAEVLNMIVEDLFQGHPISQRKLKELLGHTPSQVL  271



>ref|XP_007051546.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Theobroma cacao]
 gb|EOX95703.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Theobroma cacao]
Length=287

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 170/215 (79%), Gaps = 8/215 (4%)
 Frame = -1

Query  917  NHQNPYLQCGNHTSNRKPFLLLVPILKNLED--FASKNNWISPVLQTPGE------EFGG  762
            N  NP     N   +  P L+LVP+LK+++   F+    W S +     E      +F G
Sbjct  51   NPINPTPNSQNRCFSVNPLLVLVPVLKSIKGLAFSHTQKWASCLHAYTAESDKILDQFSG  110

Query  761  ELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERK  582
              LQSGGFG+ALLS+TA+A V+ISPFVATLAANPTFVSGLLAW +AQS KVFL F VERK
Sbjct  111  NYLQSGGFGVALLSVTASAKVRISPFVATLAANPTFVSGLLAWFIAQSMKVFLNFFVERK  170

Query  581  WDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAG  402
            WDFR++ ASGGMPSSHSALCTALT SVA+CHG+ADSLFPVCLGFSLIVMYDAIGVRRHAG
Sbjct  171  WDFRILFASGGMPSSHSALCTALTTSVAICHGIADSLFPVCLGFSLIVMYDAIGVRRHAG  230

Query  401  MQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            MQA VLN+IVEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  231  MQAAVLNMIVEDLFQGHPISQRKLKELLGHTPSQV  265



>gb|EYU32246.1| hypothetical protein MIMGU_mgv1a011772mg [Erythranthe guttata]
Length=271

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 184/259 (71%), Gaps = 24/259 (9%)
 Frame = -1

Query  1037  MDSVV-INLP--PPPSRFNLPN---------SFLRVHKPKTFGVSPITASQLNHQNPYLQ  894
             M+S+V IN P   P + F  P          S  + +  K F  S IT + LNHQNP   
Sbjct  1     MESLVTINHPQFKPSTIFTFPTFTSVNYSSFSLFKFNGRKKFNKSLITVNCLNHQNPI--  58

Query  893   CGNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPGEEFGGELLQSGGFGMALLSIT  714
                     K F  L+   ++    ++KN W +       EE G   LQ+G FG AL+S+T
Sbjct  59    --------KSFPYLIEKARDFAAKSAKNKWAAAFRDYCAEESG--YLQNGAFGTALMSVT  108

Query  713   ATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSH  534
             ATA VKISP ++TLAANPTFVSGL AW VAQS+K+FL F VERKWDFR++ ASGGMPSSH
Sbjct  109   ATAKVKISPILSTLAANPTFVSGLCAWAVAQSTKIFLNFYVERKWDFRVIFASGGMPSSH  168

Query  533   SALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW  354
             SALCTALT SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLIVEDLF+ 
Sbjct  169   SALCTALTTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIVEDLFQG  228

Query  353   HPMSQRKLKELLGHTPSQV  297
             HP+S+RKLKELLGHTPSQV
Sbjct  229   HPISKRKLKELLGHTPSQV  247



>emb|CDP08674.1| unnamed protein product [Coffea canephora]
Length=291

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 155/270 (57%), Positives = 185/270 (69%), Gaps = 22/270 (8%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFNLPNSFLR------------VHKPKTFGVSPITASQLNHQNPYLQ  894
             MDS++IN       F+L  S L+                K      +     N +NP   
Sbjct  1     MDSLLINSRFDAFAFHLSKSNLKSLESLHSLSGFNFQNSKKLKSRSVLTDTNNPRNPNSS  60

Query  893   CGNHTS--NRKPFLLLVPILKNLEDFA---SKNNWISPV-----LQTPGEEFGGELLQSG  744
              G + S   ++PF   +PI++ ++D A   SK  W S       L+    EF G+  Q+G
Sbjct  61    WGIYRSPLRKRPFSAFLPIIRKIKDIALKASKIKWASSFQGCSSLEALPCEFEGKFSQNG  120

Query  743   GFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMM  564
               G+ALLS+T+TA VKISPFVATLAANPTFVSGL AW +AQS KVFL F VERKWD R+M
Sbjct  121   AIGIALLSVTSTAKVKISPFVATLAANPTFVSGLFAWAIAQSIKVFLNFWVERKWDLRIM  180

Query  563   CASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVL  384
              ASGGMPSSHSALCTALT SVA+CHGVADSLFPVCL FSLIVMYDAIGVRRHAGMQA+VL
Sbjct  181   FASGGMPSSHSALCTALTTSVAICHGVADSLFPVCLWFSLIVMYDAIGVRRHAGMQAEVL  240

Query  383   NLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
             N+I++DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  241   NVIIQDLFQGHPISQRKLKELLGHTPSQVV  270



>ref|XP_010534432.1| PREDICTED: uncharacterized protein LOC104809981 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523808.1| PREDICTED: uncharacterized protein LOC104802074 isoform X1 [Tarenaya 
hassleriana]
Length=276

 Score =   282 bits (722),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 169/219 (77%), Gaps = 12/219 (5%)
 Frame = -1

Query  914  HQNPYLQCGNHTSNR----KPFLLLVPILKNLEDFASKNN--WIS------PVLQTPGEE  771
            H NP     ++ +NR     P+L+L  I + ++  AS  +  W+S             E+
Sbjct  38   HSNPICPQPDYGTNRILRINPYLILRSIFRRIKGLASSQSQRWVSRSQAYRDDTAAFSEQ  97

Query  770  FGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCV  591
            F G+  + GGFG ALLS+TA+A VKISPFVATLAANPTFVSGL+AW VAQS KVFL F V
Sbjct  98   FAGDWEKHGGFGTALLSVTASAKVKISPFVATLAANPTFVSGLVAWFVAQSIKVFLNFFV  157

Query  590  ERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRR  411
            ERKWDFR++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRR
Sbjct  158  ERKWDFRILFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRR  217

Query  410  HAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            HAGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  218  HAGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  256



>ref|XP_010267623.1| PREDICTED: uncharacterized protein LOC104604791 isoform X1 [Nelumbo 
nucifera]
Length=297

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 177/233 (76%), Gaps = 19/233 (8%)
 Frame = -1

Query  941  SPITASQLNHQNPYL---QCGNHTSNRKPFLLLVPILKNLEDFAS--------KNNWISP  795
            S IT S      P L   +C  H     PF +L+P+L+++ DFA            W+S 
Sbjct  46   SAITVSYRAPSGPDLSRNRC-THCLPTNPFCVLIPVLQSIRDFAGLAASGTRRGYKWLS-  103

Query  794  VLQTPGE------EFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAW  633
             L+  G+      E+GG+   +GG G+ALLS+T+TA V+ISP VATLAANPTFVSGLLAW
Sbjct  104  CLRGCGDSGGVSNEWGGDYFHNGGIGVALLSVTSTAKVRISPVVATLAANPTFVSGLLAW  163

Query  632  LVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLG  453
            + AQS KVFL F VERKWDFR++ ASGGMPSSHSALCTALT SVALCHGVADSLFPVCLG
Sbjct  164  VAAQSIKVFLNFFVERKWDFRILFASGGMPSSHSALCTALTTSVALCHGVADSLFPVCLG  223

Query  452  FSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            F+LIVMYDAIGVRRHAGMQA+VLN+I++DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  224  FTLIVMYDAIGVRRHAGMQAEVLNMIIQDLFQGHPISQRKLKELLGHTPSQVL  276



>ref|XP_006491277.1| PREDICTED: uncharacterized protein LOC102622631 isoform X1 [Citrus 
sinensis]
Length=324

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 162/200 (81%), Gaps = 10/200 (5%)
 Frame = -1

Query  866  PFLLLVPILKNLEDFASKNN--WISPVLQTPG--------EEFGGELLQSGGFGMALLSI  717
            PF +L PIL++++  AS     W S +             ++   + LQ+G FG ALLS+
Sbjct  80   PFCVLFPILQSIKGLASSQTKKWASRLQAHSSQLENINVIDQNSNDYLQTGAFGAALLSV  139

Query  716  TATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSS  537
            T+TA VKISPFVATLAANPTFVSGL AW++AQS+KVFL F VERKWD R++ ASGGMPSS
Sbjct  140  TSTAKVKISPFVATLAANPTFVSGLFAWMIAQSTKVFLNFFVERKWDLRLLFASGGMPSS  199

Query  536  HSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFK  357
            HSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF+
Sbjct  200  HSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLFQ  259

Query  356  WHPMSQRKLKELLGHTPSQV  297
             HP+SQRKLKELLGHTPSQV
Sbjct  260  GHPISQRKLKELLGHTPSQV  279



>ref|XP_006491278.1| PREDICTED: uncharacterized protein LOC102622631 isoform X2 [Citrus 
sinensis]
Length=323

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 162/200 (81%), Gaps = 10/200 (5%)
 Frame = -1

Query  866  PFLLLVPILKNLEDFASKN--NWISPVLQTPG--------EEFGGELLQSGGFGMALLSI  717
            PF +L PIL++++  AS     W S +             ++   + LQ+G FG ALLS+
Sbjct  80   PFCVLFPILQSIKGLASSQTKKWASRLQAHSSQLENINVIDQNSNDYLQTGAFGAALLSV  139

Query  716  TATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSS  537
            T+TA VKISPFVATLAANPTFVSGL AW++AQS+KVFL F VERKWD R++ ASGGMPSS
Sbjct  140  TSTAKVKISPFVATLAANPTFVSGLFAWMIAQSTKVFLNFFVERKWDLRLLFASGGMPSS  199

Query  536  HSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFK  357
            HSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF+
Sbjct  200  HSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLFQ  259

Query  356  WHPMSQRKLKELLGHTPSQV  297
             HP+SQRKLKELLGHTPSQV
Sbjct  260  GHPISQRKLKELLGHTPSQV  279



>gb|KDO86484.1| hypothetical protein CISIN_1g022192mg [Citrus sinensis]
Length=301

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 10/201 (5%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFASKNN--WISPVLQTPG--------EEFGGELLQSGGFGMALLS  720
             PF +L PIL++++  AS     W S +             ++   + LQ+G FG ALLS
Sbjct  79   NPFCVLFPILQSIKGLASSQTKKWASRLQAHSSQLENINVIDQNSNDYLQTGAFGAALLS  138

Query  719  ITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPS  540
            +T+TA VKISPFVATLAANPTFVSGL AW++AQS+KVFL F VERKWD R++ ASGGMPS
Sbjct  139  VTSTAKVKISPFVATLAANPTFVSGLFAWMIAQSTKVFLNFFVERKWDLRLLFASGGMPS  198

Query  539  SHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF  360
            SHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF
Sbjct  199  SHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLF  258

Query  359  KWHPMSQRKLKELLGHTPSQV  297
            + HP+SQRKLKELLGHTPSQV
Sbjct  259  QGHPISQRKLKELLGHTPSQV  279



>ref|XP_006444837.1| hypothetical protein CICLE_v10021359mg [Citrus clementina]
 gb|ESR58077.1| hypothetical protein CICLE_v10021359mg [Citrus clementina]
Length=301

 Score =   280 bits (716),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 10/201 (5%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFASKNN--WISPVLQTPG--------EEFGGELLQSGGFGMALLS  720
             PF +L PIL++++  AS     W S +             ++   + LQ+G FG ALLS
Sbjct  79   NPFCVLFPILQSIKGLASSQTKKWASRLQAHSSQLENINVIDQNSNDYLQTGAFGAALLS  138

Query  719  ITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPS  540
            +T+TA VKISPFVATLAANPTFVSGL AW++AQS+KVFL F VERKWD R++ ASGGMPS
Sbjct  139  VTSTAKVKISPFVATLAANPTFVSGLFAWMIAQSTKVFLNFFVERKWDLRLLFASGGMPS  198

Query  539  SHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF  360
            SHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF
Sbjct  199  SHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLF  258

Query  359  KWHPMSQRKLKELLGHTPSQV  297
            + HP+SQRKLKELLGHTPSQV
Sbjct  259  QGHPISQRKLKELLGHTPSQV  279



>ref|XP_011023177.1| PREDICTED: uncharacterized protein LOC105124761 [Populus euphratica]
Length=293

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 172/241 (71%), Gaps = 12/241 (5%)
 Frame = -1

Query  980  SFLRVHKPKTFGVSPITASQLN---HQNPY-LQCGNHTSNRKPFLLLVPILKNLEDFASK  813
            SF +      F  SPI  S  N   HQNP      N T    P   LVPI+++++  AS 
Sbjct  32   SFFKSTHLTKFKNSPICFSYKNPSNHQNPKPRNKNNRTFLSNPLRALVPIIEHIKALASS  91

Query  812  --NNWISPVLQTPGE------EFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPT  657
                W S +     +      E  G+ + +G FG+ALLSIT+ A VKISPFVATLAANPT
Sbjct  92   RTKKWASQLQAYSDDSEKVVSEHNGDFMLNGAFGLALLSITSHAKVKISPFVATLAANPT  151

Query  656  FVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVAD  477
            F+SGL AW +AQS KVFL F VERKWD R+  ASGGMPSSHSALCTALT SVA CHGVAD
Sbjct  152  FISGLFAWFIAQSMKVFLNFFVERKWDLRIFFASGGMPSSHSALCTALTTSVAFCHGVAD  211

Query  476  SLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            SLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF+ HP+SQRKLKELLGH PSQV
Sbjct  212  SLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLFQGHPISQRKLKELLGHNPSQV  271

Query  296  I  294
            +
Sbjct  272  L  272



>ref|XP_006402444.1| hypothetical protein EUTSA_v10006136mg [Eutrema salsugineum]
 gb|ESQ43897.1| hypothetical protein EUTSA_v10006136mg [Eutrema salsugineum]
Length=289

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 179/251 (71%), Gaps = 17/251 (7%)
 Frame = -1

Query  1004  PSRFNLP--NSFLRVHKPKTFGVSPITASQLNHQNPYLQCGNHTSNRK----PFLLLVPI  843
             PSR +     S  ++  P T  +    +S L   NP   C  + SNR+    PF +L PI
Sbjct  21    PSRLSFVKLTSIHKLEAPNTISLC-CKSSPLGSSNPKPDC--NASNRRIQLNPFCVLRPI  77

Query  842   LKNLEDFASKNN--WISPV------LQTPGEEFGGELLQSGGFGMALLSITATAGVKISP  687
             ++ ++   S  +  W+S             E F G+L  +GG G+ALLS+TA+A VKISP
Sbjct  78    IRTIKGLVSSQSRLWMSRFRAYRDDTAAFSENFAGDLKHNGGLGIALLSVTASAKVKISP  137

Query  686   FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
             FVATL+ANPTFVS + AW  AQSSK+ + F +ERKWDFR++ ASGGMPSSHSALC ALT 
Sbjct  138   FVATLSANPTFVSAVFAWFFAQSSKMVINFFIERKWDFRLLYASGGMPSSHSALCMALTT  197

Query  506   SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLK  327
             SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI+ DLF+ HP+SQRKLK
Sbjct  198   SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIIRDLFEGHPISQRKLK  257

Query  326   ELLGHTPSQVI  294
             ELLGHTPSQV+
Sbjct  258   ELLGHTPSQVL  268



>ref|XP_010666525.1| PREDICTED: uncharacterized protein LOC104883650 [Beta vulgaris 
subsp. vulgaris]
Length=296

 Score =   275 bits (703),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 173/241 (72%), Gaps = 14/241 (6%)
 Frame = -1

Query  974  LRVHKPKTFGVSPITASQLNHQNPY--LQCGNHTSNRKPFLLLVPILKNLEDFASKN---  810
            L + KPK    S   + +L   +P+      NH+    PF LL PIL+NL +F +K    
Sbjct  35   LSIFKPKPRKKSLYISCKLPINSPHNNFNTFNHSLPLNPFSLLAPILQNLRNFTAKTAKF  94

Query  809  NWISPVLQTPGEEFGG---------ELLQSGGFGMALLSITATAGVKISPFVATLAANPT  657
             W+S +     +E  G         + L +GG GMALL++ +TA  + SP +ATLAANPT
Sbjct  95   RWVSYLKDPAIDEIIGCNNNNNKKIQFLHNGGLGMALLTVQSTARDRFSPVMATLAANPT  154

Query  656  FVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVAD  477
            FVSGLLAW +AQS+KV L F VERKWD R  CASGGMPSSHSALCTA+T SVALCHGVAD
Sbjct  155  FVSGLLAWFLAQSTKVLLNFYVERKWDLRFFCASGGMPSSHSALCTAMTTSVALCHGVAD  214

Query  476  SLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            +LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN I+EDLF+ HP+S+RKLKELLGHTPSQV
Sbjct  215  ALFPVCLGFSLIVMYDATGVRRHAGMQAKVLNKIIEDLFQGHPISERKLKELLGHTPSQV  274

Query  296  I  294
            I
Sbjct  275  I  275



>ref|XP_002876638.1| hypothetical protein ARALYDRAFT_907735 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52897.1| hypothetical protein ARALYDRAFT_907735 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 166/216 (77%), Gaps = 9/216 (4%)
 Frame = -1

Query  917  NHQNPYLQCGNHTSNRKPFLLLVPILKNLEDFASKNN--WISPV------LQTPGEEFGG  762
            +  NP   C N      PF +L PI++ ++   S  +  W+S +           E+F G
Sbjct  50   SSSNPKPDC-NRRIKLNPFCVLRPIIRTIKGLVSSQSRLWMSRLRAYRDDTAAFSEDFAG  108

Query  761  ELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERK  582
            +L  +GG G+ALLS+TA+A +KISPFVATL+ANPTFVS ++AW  AQSSK+ + F +ERK
Sbjct  109  DLKHNGGLGIALLSVTASAKIKISPFVATLSANPTFVSAVVAWFFAQSSKMVINFFIERK  168

Query  581  WDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAG  402
            WDFR++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAG
Sbjct  169  WDFRLLYASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAG  228

Query  401  MQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            MQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  229  MQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  264



>ref|NP_567117.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
 gb|AAL86337.1| unknown protein [Arabidopsis thaliana]
 gb|AAM63948.1| unknown [Arabidopsis thaliana]
 gb|AAM67572.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80255.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
Length=284

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 177/248 (71%), Gaps = 16/248 (6%)
 Frame = -1

Query  1004  PSRFNLPNSFLRVHKPKTFGVSPITASQL---NHQNPYLQCGNHTSNRKPFLLLVPILKN  834
             PSRF    SF+++   +    S  T S     +  NP   C N      P  +L PI++ 
Sbjct  21    PSRF----SFVKLTSIQKLEASNNTLSLFCCKSSSNPKPDC-NRRIKLNPLCVLRPIIRT  75

Query  833   LEDFASKNN--WISPV------LQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVA  678
             ++   S  +  W+S             E+F G+L  +GG G+ALLS+TA+A +KISPFVA
Sbjct  76    IKGLVSSQSRQWMSRFRAYRDDTAAFSEDFAGDLKHNGGLGIALLSVTASAKIKISPFVA  135

Query  677   TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
             TL+ANPTFVS ++AW  AQSSK+ + F +ERKWDFR++ ASGGMPSSHSALC ALT SVA
Sbjct  136   TLSANPTFVSAVVAWFFAQSSKMVINFFIERKWDFRLLYASGGMPSSHSALCMALTTSVA  195

Query  497   LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELL  318
             LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI+ DLF+ HP+SQRKLKELL
Sbjct  196   LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIIRDLFEGHPISQRKLKELL  255

Query  317   GHTPSQVI  294
             GHTPSQV+
Sbjct  256   GHTPSQVL  263



>ref|XP_010512550.1| PREDICTED: uncharacterized protein LOC104788482 [Camelina sativa]
Length=290

 Score =   273 bits (699),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 162/215 (75%), Gaps = 9/215 (4%)
 Frame = -1

Query  911  QNPYLQCGNHTSNRKPFLLLVPILKNLEDFASKNN--WIS-------PVLQTPGEEFGGE  759
             NP   C        PF +L PI++ ++   S  +  W+S              E+F G+
Sbjct  55   SNPKPDCNRRIKKLNPFCVLRPIVRTIKGLVSSQSRLWMSRFRAYRDETAAFSSEDFVGD  114

Query  758  LLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKW  579
            L  +GG G+ALLS+TA+A +KISPFVATL++NPTFVS + AW  AQSSK+ + F +ERKW
Sbjct  115  LKHNGGLGIALLSVTASAKIKISPFVATLSSNPTFVSAVFAWFFAQSSKMVINFFIERKW  174

Query  578  DFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM  399
            D+R++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM
Sbjct  175  DYRLLYASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM  234

Query  398  QAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            QA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  235  QAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  269



>ref|XP_010469022.1| PREDICTED: uncharacterized protein LOC104749139 [Camelina sativa]
Length=283

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 162/215 (75%), Gaps = 9/215 (4%)
 Frame = -1

Query  911  QNPYLQCGNHTSNRKPFLLLVPILKNLEDFASKNN--WIS-------PVLQTPGEEFGGE  759
             NP   C        PF +L PI++ ++   S  +  W+S              E+F G+
Sbjct  48   SNPKPDCNRRIKKLNPFCVLRPIVRTIKGLVSSQSRLWMSRFRAYRDETAAFSSEDFVGD  107

Query  758  LLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKW  579
            L  +GG G+ALLS+TA+A +KISPFVATL++NPTFVS + AW  AQSSK+ + F +ERKW
Sbjct  108  LKHNGGLGIALLSVTASAKIKISPFVATLSSNPTFVSAVFAWFFAQSSKMVINFFIERKW  167

Query  578  DFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM  399
            D+R++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM
Sbjct  168  DYRLLYASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM  227

Query  398  QAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            QA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  228  QAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  262



>ref|XP_004306672.1| PREDICTED: uncharacterized membrane protein YuiD-like [Fragaria 
vesca subsp. vesca]
Length=270

 Score =   270 bits (691),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 176/258 (68%), Gaps = 19/258 (7%)
 Frame = -1

Query  1037  MDSVVINLP----------PPPSRFNLPNSFLRVHKPKTFGVSPITASQLNHQNPYLQCG  888
             MDS++ N P          P P  F   +S L+  K K+F V      + N +NP     
Sbjct  1     MDSIITNHPFTSFIPSPLNPHPKPFTATSSHLKKLK-KSF-VCFSQRPRSNSRNPRWPEP  58

Query  887   NHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPGEEFGGELLQSGGFGMALLSITAT  708
                    P  +LVP+L+++   AS   W+S       E  G   LQ+ G G+AL+S+T  
Sbjct  59    LSFRKLNPIWVLVPVLQSIRVLASSGKWVS-------EHHGFGFLQNSGIGIALMSVTTN  111

Query  707   AGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSA  528
             A VKISPFV  LAANPTFVSG+ AW VAQS KV L F VE+KWD R++CASGGMPSSHSA
Sbjct  112   AKVKISPFVTQLAANPTFVSGMFAWFVAQSMKVVLNFFVEKKWDLRILCASGGMPSSHSA  171

Query  527   LCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP  348
             LCTALT SVALCHGVADSLFPVCLGFSLIVMYDA GVRRHAGMQA+VLN++VE LF+ HP
Sbjct  172   LCTALTTSVALCHGVADSLFPVCLGFSLIVMYDATGVRRHAGMQAEVLNIVVEYLFQGHP  231

Query  347   MSQRKLKELLGHTPSQVI  294
             +SQ KLKELLGHTPSQV+
Sbjct  232   ISQNKLKELLGHTPSQVL  249



>ref|XP_010413348.1| PREDICTED: uncharacterized protein LOC104699706 [Camelina sativa]
Length=285

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 172/247 (70%), Gaps = 15/247 (6%)
 Frame = -1

Query  1004  PSRFNLPNSFLRVHKPKTFGVSPITASQLNHQNPYLQCGNHTSNRKPFLLLVPILKNLED  825
             PSR      F   +   T  +    +S     NP   C N      PF +L PI++ ++ 
Sbjct  23    PSRLTCIQKFEASNNNNTLSLLCCKSSS----NPKPDC-NRRIKLNPFCVLRPIVRTIKG  77

Query  824   FASKNN--WIS--------PVLQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVAT  675
               S  +  W+S               E+F G+L  +GG G+ALLS+TA+A +KISPFVAT
Sbjct  78    LVSSQSRLWMSRFRAYRDDTAAAFSSEDFAGDLKHNGGLGIALLSVTASAKIKISPFVAT  137

Query  674   LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
             L++NPTFVS + AW  AQSSK+ + F +ERKWD+R++ ASGGMPSSHSALC ALT SVAL
Sbjct  138   LSSNPTFVSAVFAWFFAQSSKMVINFFIERKWDYRLLYASGGMPSSHSALCMALTTSVAL  197

Query  494   CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLG  315
             CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI+ DLF+ HP+SQRKLKELLG
Sbjct  198   CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLG  257

Query  314   HTPSQVI  294
             HTPSQV+
Sbjct  258   HTPSQVL  264



>ref|XP_010055015.1| PREDICTED: uncharacterized protein LOC104443360 [Eucalyptus grandis]
 gb|KCW71498.1| hypothetical protein EUGRSUZ_E00052 [Eucalyptus grandis]
Length=287

 Score =   271 bits (692),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 170/235 (72%), Gaps = 10/235 (4%)
 Frame = -1

Query  980  SFLRVHKPKTFGVSPITASQLNHQNPYLQCGNHTSNRKPFLLLVPILKNLED--FASKNN  807
            SFL+    +    SP +AS     N      NH +N   FL LV IL+N++   F+    
Sbjct  33   SFLKFSDFRKLRSSPTSASFRPPSNARSSLPNHNNN---FLGLVKILRNIKGSIFSRTQR  89

Query  806  WISPV-----LQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGL  642
            W S +      Q   +      LQ+GG G+ALLS+T+ A VKISPFVATLA+NPTFVSGL
Sbjct  90   WASGIPDCGDSQEVLDSHNDNYLQNGGIGVALLSVTSNAKVKISPFVATLASNPTFVSGL  149

Query  641  LAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPV  462
             AW VAQS KV L F VE+KWD R+  ASGGMPSSHSALCTA+T SVALCHG++DSLFPV
Sbjct  150  FAWFVAQSIKVILNFFVEKKWDLRIFFASGGMPSSHSALCTAMTTSVALCHGISDSLFPV  209

Query  461  CLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            CLGFS IVMYDAIGVRRHAGMQA+VLN+IVEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  210  CLGFSSIVMYDAIGVRRHAGMQAEVLNMIVEDLFQGHPISQRKLKELLGHTPSQV  264



>ref|XP_006291605.1| hypothetical protein CARUB_v10017759mg [Capsella rubella]
 gb|EOA24503.1| hypothetical protein CARUB_v10017759mg [Capsella rubella]
Length=289

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 160/207 (77%), Gaps = 8/207 (4%)
 Frame = -1

Query  890  GNHTSNRKPFLLLVPILKNLEDFASKNN--WISPV------LQTPGEEFGGELLQSGGFG  735
            GN      PF +L PI++ ++   S  +  W+S             E+  G+L  +GG G
Sbjct  62   GNRHIKLNPFCVLRPIIRTIKGLVSSQSRLWMSRFRAYRDDTAAFSEDMAGDLKHNGGLG  121

Query  734  MALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
            +ALLS+TA+A +KISPFVATL+ANPTFVS + AW  AQSSK+ + F +ERKWD+R++ AS
Sbjct  122  IALLSVTASAKIKISPFVATLSANPTFVSAVFAWFFAQSSKMVINFFIERKWDYRLLYAS  181

Query  554  GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLI  375
            GGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI
Sbjct  182  GGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLI  241

Query  374  VEDLFKWHPMSQRKLKELLGHTPSQVI  294
            + DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  242  IRDLFEGHPISQRKLKELLGHTPSQVL  268



>ref|XP_002263519.1| PREDICTED: uncharacterized protein LOC100260453 [Vitis vinifera]
 emb|CBI40550.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   268 bits (686),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 159/208 (76%), Gaps = 11/208 (5%)
 Frame = -1

Query  917  NHQNPYLQCGNHTSNRKPFLLLVPILKNLEDFASKNNWISPVLQTPGEEFGGELLQSGGF  738
            N +NP  +  N++S   PF+    +   +   AS+            EEF GE  Q+G F
Sbjct  35   NPKNPSPKRSNNSSVINPFV----VFHTIRGLASRGFGFR-------EEFNGEYYQNGAF  83

Query  737  GMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCA  558
            G+ALLS+T  A V+ SPF+ATLAAN TFVSG+ AW+VAQS KV L F VERKWD R+M A
Sbjct  84   GVALLSLTTNAKVRFSPFLATLAANSTFVSGVFAWVVAQSVKVVLNFFVERKWDLRIMFA  143

Query  557  SGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNL  378
            SGGMPSSH+ALCTALT SVALCHGVADSLFPVCLGFSLIVMYDA GVRRHAGMQA+VLN+
Sbjct  144  SGGMPSSHTALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDATGVRRHAGMQAEVLNM  203

Query  377  IVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            IVEDLFK HP+SQRKLKE+LGHTPSQV+
Sbjct  204  IVEDLFKGHPISQRKLKEILGHTPSQVL  231



>emb|CAB71107.1| putative protein [Arabidopsis thaliana]
Length=197

 Score =   266 bits (680),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  776  EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKF  597
            E+F G+L  +GG G+ALLS+TA+A +KISPFVATL+ANPTFVS ++AW  AQSSK+ + F
Sbjct  16   EDFAGDLKHNGGLGIALLSVTASAKIKISPFVATLSANPTFVSAVVAWFFAQSSKMVINF  75

Query  596  CVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGV  417
             +ERKWDFR++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGV
Sbjct  76   FIERKWDFRLLYASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGV  135

Query  416  RRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            RRHAGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  136  RRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  176



>ref|XP_004133813.1| PREDICTED: uncharacterized protein LOC101209825 [Cucumis sativus]
 gb|KGN56424.1| hypothetical protein Csa_3G119570 [Cucumis sativus]
Length=284

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 181/268 (68%), Gaps = 25/268 (9%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFN-------------LPNSFLRVHKPKTFGVSPITASQLNH---QN  906
             M++V + L   P  FN             L + FL+  K + F   P   S +N    +N
Sbjct  1     METVSVGLISIPFIFNGSPQRTRPCSTNFLSSGFLQSKKLRRF---PHNFSCINRPTTRN  57

Query  905   PYLQCGNHTSNRKPFLLLVPILKNLEDF----ASKNNWISPVLQTPGEEFGGELLQSGGF  738
                + G+ + +   F +LVP+L++++        K   +S      G    G  LQSG  
Sbjct  58    QKYEGGDRSFSSNLFWVLVPVLQSIKGVILSKTHKAQSVSEGFVNGG--LNGNYLQSGSV  115

Query  737   GMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCA  558
             G ALLSITATA  +ISPFVATLA NPTFVSGL AW  AQS+KV L F VERKWD ++M A
Sbjct  116   GTALLSITATAKHRISPFVATLATNPTFVSGLFAWFFAQSTKVLLNFFVERKWDLKIMFA  175

Query  557   SGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNL  378
              GGMPSSHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNL
Sbjct  176   CGGMPSSHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNL  235

Query  377   IVEDLFKWHPMSQRKLKELLGHTPSQVI  294
             IVEDLF+ HP+S+RKLKELLGHTPSQV+
Sbjct  236   IVEDLFEGHPISKRKLKELLGHTPSQVL  263



>ref|XP_008437892.1| PREDICTED: uncharacterized protein LOC103483186 isoform X1 [Cucumis 
melo]
Length=284

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 179/268 (67%), Gaps = 25/268 (9%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFN-------------LPNSFLRVHKPKTFGVSPITASQLNH---QN  906
             M++V + L   P  FN             L   FL+  K + F   P   S +N    +N
Sbjct  1     METVSVGLISSPFIFNGSPQRTRPCSTNFLSFGFLQSKKLRRF---PHNFSCINRPTTRN  57

Query  905   PYLQCGNHTSNRKPFLLLVPILKNLEDF----ASKNNWISPVLQTPGEEFGGELLQSGGF  738
                + G+ +     F +LVPIL++++        K   +S      G    G  LQSG  
Sbjct  58    EKYEGGDRSFRSNLFWVLVPILQSIKGVILSKTHKAQSVSGGFVNGG--LNGTYLQSGSV  115

Query  737   GMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCA  558
             G ALLSITATA  +ISPFVATLA NPTFVSGL AW  AQS+KV L F VERKWD ++M A
Sbjct  116   GTALLSITATAKHRISPFVATLATNPTFVSGLFAWFFAQSTKVLLNFFVERKWDLKIMFA  175

Query  557   SGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNL  378
              GGMPSSHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNL
Sbjct  176   CGGMPSSHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNL  235

Query  377   IVEDLFKWHPMSQRKLKELLGHTPSQVI  294
             IVEDLF+ HP+S+RKLKELLGHTPSQV+
Sbjct  236   IVEDLFEGHPISKRKLKELLGHTPSQVL  263



>ref|XP_008233149.1| PREDICTED: uncharacterized protein LOC103332206 [Prunus mume]
Length=293

 Score =   269 bits (687),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 157/199 (79%), Gaps = 7/199 (4%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFASK--NNWISPVLQTPG-----EEFGGELLQSGGFGMALLSITA  711
             P   LVP+L+++   AS     W+S +    G      E   + L + G G+ALLS+T+
Sbjct  74   NPIWFLVPVLQSIRVLASSRTQKWVSFLQAYRGTECVVHEKNNDFLHNSGIGVALLSVTS  133

Query  710  TAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHS  531
             A VKISPFVA LAANPTFVSGL AW +AQS+KV L F VERKWDFR++ ASGGMPSSHS
Sbjct  134  NAKVKISPFVAQLAANPTFVSGLFAWFMAQSTKVLLNFFVERKWDFRILYASGGMPSSHS  193

Query  530  ALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWH  351
            ALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN++VE LF+ H
Sbjct  194  ALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNIVVEYLFEGH  253

Query  350  PMSQRKLKELLGHTPSQVI  294
            P+SQ+KLKELLGHTPSQVI
Sbjct  254  PISQKKLKELLGHTPSQVI  272



>emb|CAN71954.1| hypothetical protein VITISV_024312 [Vitis vinifera]
Length=185

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -1

Query  773  EFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFC  594
            EF GE  Q+G FG+ALLS+T  A V+ SPF+ATLAAN TFVSG+ AW+VAQS KV L F 
Sbjct  5    EFNGEYYQNGAFGVALLSLTTNAKVRFSPFLATLAANSTFVSGVFAWVVAQSVKVVLNFF  64

Query  593  VERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVR  414
            VERKWD R+M ASGGMPSSH+ALCTALT SVALCHGVADSLFPVCLGFSLIVMYDA GVR
Sbjct  65   VERKWDLRIMFASGGMPSSHTALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDATGVR  124

Query  413  RHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            RHAGMQA+VLN+IVEDLFK HP+SQRKLKE+LGHTPSQV+
Sbjct  125  RHAGMQAEVLNMIVEDLFKGHPISQRKLKEILGHTPSQVL  164



>gb|KDP28486.1| hypothetical protein JCGZ_14257 [Jatropha curcas]
Length=183

 Score =   263 bits (672),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  773  EFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFC  594
            ++ G+ LQ+G FG+ALLSIT+ A V+ISPFVATLAANPTF+SG  AW +AQ+ KV L F 
Sbjct  3    DYSGKYLQNGAFGVALLSITSNAKVRISPFVATLAANPTFISGFFAWFIAQAIKVILNFF  62

Query  593  VERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVR  414
            VERKWD R++ ASGGMPSSHSALCTA+T SVALCHGVADSLFPVCLGFSLIVMYDAIGVR
Sbjct  63   VERKWDLRLLFASGGMPSSHSALCTAMTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVR  122

Query  413  RHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            RHAGM A++LN+IVEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  123  RHAGMHAEILNMIVEDLFQGHPISQRKLKELLGHTPSQV  161



>ref|XP_004155165.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101209825 
[Cucumis sativus]
Length=284

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/245 (60%), Positives = 173/245 (71%), Gaps = 12/245 (5%)
 Frame = -1

Query  1007  PPSRFNLPNSFLRVHKPKTFGVSPITASQLNH---QNPYLQCGNHTSNRKPFLLLVPILK  837
             P S   L + FL+  K + F   P   S +N    +N   + G+ + +   F +LVP+L+
Sbjct  24    PCSTNFLSSGFLQSKKLRRF---PHNFSCINRPTTRNQKYEGGDRSFSSNLFWVLVPVLQ  80

Query  836   NLEDF----ASKNNWISPVLQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVATLA  669
             +++        K   +S      G    G  LQSG  G ALLSITATA  +ISPFVATLA
Sbjct  81    SIKGVILSKTHKAQSVSEGFVNGG--LNGNYLQSGSVGTALLSITATAKHRISPFVATLA  138

Query  668   ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
              NPTFVSGL AW  AQS+KV L F VERKWD ++M A GGMPSSHSALCTALT SVALCH
Sbjct  139   TNPTFVSGLFAWFFAQSTKVLLNFFVERKWDLKIMFACGGMPSSHSALCTALTTSVALCH  198

Query  488   GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHT  309
             GVADS FPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLIVEDLF+ HP+S+RKLKELLGHT
Sbjct  199   GVADSXFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIVEDLFEGHPISKRKLKELLGHT  258

Query  308   PSQVI  294
             PSQV+
Sbjct  259   PSQVL  263



>ref|XP_002301410.2| hypothetical protein POPTR_0002s17230g [Populus trichocarpa]
 gb|EEE80683.2| hypothetical protein POPTR_0002s17230g [Populus trichocarpa]
Length=291

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/161 (80%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  776  EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKF  597
             E  G  + +G FG+ALLSIT+ A VKISPFVATLAANPTF+SGL AW +AQS KVFL F
Sbjct  110  SEHSGGFMLNGAFGLALLSITSHAKVKISPFVATLAANPTFISGLFAWFIAQSMKVFLNF  169

Query  596  CVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGV  417
             VERKWD R++ ASGGMPSSHSALCTALT SVA CHGVADSLFPVCLGFSLIVMYDAIGV
Sbjct  170  FVERKWDLRLLFASGGMPSSHSALCTALTTSVAFCHGVADSLFPVCLGFSLIVMYDAIGV  229

Query  416  RRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            RRHAGMQA+VLN+IVEDLF+ HP+SQRKLKELLGH PSQV+
Sbjct  230  RRHAGMQAEVLNMIVEDLFQGHPISQRKLKELLGHNPSQVL  270



>ref|XP_009336782.1| PREDICTED: uncharacterized protein LOC103929322 [Pyrus x bretschneideri]
Length=291

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 161/215 (75%), Gaps = 7/215 (3%)
 Frame = -1

Query  917  NHQNPYLQCGNHTSNRKPFLLLVPILKNLEDFASK--NNWISPVLQTPG-----EEFGGE  759
            N + P  +  +H   R P  +LVP+L+++   AS     W+S +    G     E    +
Sbjct  56   NPKYPKPRWDSHNFPRNPLWVLVPVLQSIRVLASSRTQKWVSFLQAYRGPESFVEAKSND  115

Query  758  LLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKW  579
             L + G G+ALLS+T  A VKISPFVA LAANPTFVSG  AW +AQS KV L F VERKW
Sbjct  116  FLHNSGIGVALLSVTTNAKVKISPFVAQLAANPTFVSGFFAWFMAQSMKVLLNFFVERKW  175

Query  578  DFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGM  399
            DFR++ +SGGMPSSHSALCTALT SVALCHGVADSLFPV LGFSLIVMYDAIGVRRHAGM
Sbjct  176  DFRILYSSGGMPSSHSALCTALTTSVALCHGVADSLFPVSLGFSLIVMYDAIGVRRHAGM  235

Query  398  QAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            QA+VLN++VE LF+ HP+SQ+KLKELLGHTPSQVI
Sbjct  236  QAEVLNIVVEYLFEGHPISQKKLKELLGHTPSQVI  270



>ref|XP_010266541.1| PREDICTED: uncharacterized protein LOC104604025 isoform X1 [Nelumbo 
nucifera]
Length=299

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/238 (60%), Positives = 180/238 (76%), Gaps = 16/238 (7%)
 Frame = -1

Query  962  KPKTFGVSPITASQLNHQN-PYLQCGNHTSNRKPFLLLVPILKNLEDF---ASKNNWISP  795
            K + F   P++    ++ N P  +C NH      F  L+P++++++DF   AS     + 
Sbjct  42   KRRNFAAIPVSYRPPSYLNFPRNRC-NHRIPTDLFYALMPLIQSIKDFVVVASGIRTGNV  100

Query  794  VLQTPGEEF-----GGELLQ------SGGFGMALLSITATAGVKISPFVATLAANPTFVS  648
            +L+   E++     G +L +      SGG G++LLS+T+TA V+ISP VATLAANPTFVS
Sbjct  101  LLKDLAEKWVSSLRGCDLWEGVSDDLSGGIGVSLLSVTSTAKVRISPVVATLAANPTFVS  160

Query  647  GLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLF  468
            GL+AW++AQ  K+FL F +ERKWDFR++ ASGGMPSSHSALCTALT SVALCHGVADSLF
Sbjct  161  GLIAWVIAQLIKIFLNFFMERKWDFRILFASGGMPSSHSALCTALTTSVALCHGVADSLF  220

Query  467  PVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            PVCLGFSLIVMYDAIGVRRHAGMQA+VLN+I++DLF+ HP+SQRKLKE LGHTPSQVI
Sbjct  221  PVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIIQDLFQGHPISQRKLKEFLGHTPSQVI  278



>ref|XP_006852638.1| hypothetical protein AMTR_s00021p00238190 [Amborella trichopoda]
 gb|ERN14105.1| hypothetical protein AMTR_s00021p00238190 [Amborella trichopoda]
Length=271

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 157/207 (76%), Gaps = 15/207 (7%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDF-------------ASKNNWISPVLQT--PGEEFGGELLQSGGFG  735
             PF +L+P+L  + D+              +   W+S V      G     +LL SGG G
Sbjct  7    SPFCVLIPVLHRITDYFTVKGFHGGKTLRTTMVKWVSGVKNGGRTGACLDDDLLNSGGIG  66

Query  734  MALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
            MALLS TA A   ISP +ATL+ANPTF+SGL AW++AQS+KV L F VERKWDF+M+ +S
Sbjct  67   MALLSTTAMAKGHISPVMATLSANPTFMSGLFAWVIAQSTKVLLNFFVERKWDFQMLVSS  126

Query  554  GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLI  375
            GGMPSSHSALCTALT SVALCHG++D+LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN+I
Sbjct  127  GGMPSSHSALCTALTTSVALCHGISDALFPVCLGFSLIVMYDATGVRRHAGMQAEVLNMI  186

Query  374  VEDLFKWHPMSQRKLKELLGHTPSQVI  294
            +EDLF+ HP+SQRKLKELLGHTPSQVI
Sbjct  187  IEDLFQGHPVSQRKLKELLGHTPSQVI  213



>ref|XP_004494823.1| PREDICTED: uncharacterized membrane protein YuiD-like [Cicer 
arietinum]
Length=240

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -1

Query  755  LQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWD  576
            LQ+GG G+ALLS+T  A V+ISPFV+TLA+NPTFVSGL AW+VAQS KVFL F V+RKWD
Sbjct  66   LQNGGLGVALLSVTTNAKVRISPFVSTLASNPTFVSGLFAWIVAQSIKVFLNFFVDRKWD  125

Query  575  FRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQ  396
             R++C+SGGMPSSHSALCTALT SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAG+Q
Sbjct  126  LRLLCSSGGMPSSHSALCTALTTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGIQ  185

Query  395  AQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            AQVLN+IV DLF+ HP+S+RKLKELLGHTPSQV
Sbjct  186  AQVLNMIVADLFQGHPISERKLKELLGHTPSQV  218



>ref|XP_008376095.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103439326 
[Malus domestica]
Length=291

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 166/228 (73%), Gaps = 12/228 (5%)
 Frame = -1

Query  944  VSPITASQLNHQNP-YLQCGNHTSN--RKPFLLLVPILKNLEDFASK--NNWISPVLQTP  780
             S I+ S     NP Y + G+ + N    P   LVP+L+++   AS     W+S  LQ  
Sbjct  44   TSSISCSHRPPSNPKYPKPGSDSHNFPLNPLWFLVPVLQSIGXLASSRTQKWVS-FLQAY  102

Query  779  G------EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQS  618
            G      E    + L + G G+ALLS+T  A VKISPFVA LAANPTFVSGL AW +AQ 
Sbjct  103  GGPESFVEAKNNDFLHNSGIGVALLSVTTNAKVKISPFVAQLAANPTFVSGLFAWFMAQX  162

Query  617  SKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIV  438
             KV L F VERKWDFR++ +SGGMPSSHSALCTALT SVALCHGVADSLFPV LGFSLIV
Sbjct  163  MKVLLNFFVERKWDFRILYSSGGMPSSHSALCTALTTSVALCHGVADSLFPVSLGFSLIV  222

Query  437  MYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            MYDAIGVRRHAGMQA+VLN++VE LFK HP+SQ+KLKELLGHTPSQVI
Sbjct  223  MYDAIGVRRHAGMQAEVLNIVVEYLFKGHPISQKKLKELLGHTPSQVI  270



>emb|CDY11380.1| BnaA09g39460D [Brassica napus]
Length=268

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 151/189 (80%), Gaps = 6/189 (3%)
 Frame = -1

Query  842  LKNLEDFASKNNWISPV------LQTPGEEFGGELLQSGGFGMALLSITATAGVKISPFV  681
            ++ ++   S   W+S        +    E F G+L Q+GG G+ALLSITA+A VKISPFV
Sbjct  55   IRTIKGLVSSRQWMSRFRAYRDDMAAFSEHFAGDLKQNGGLGVALLSITASAKVKISPFV  114

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            ATL+ANPTFVS + AW  AQ+SK+ + F +ERKWD  ++ ASGGMPSSHSALC ALT SV
Sbjct  115  ATLSANPTFVSAVFAWFFAQTSKMVINFFIERKWDLSLLFASGGMPSSHSALCMALTTSV  174

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKEL  321
            ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI+ DLF+ HP+SQRKLKEL
Sbjct  175  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIIRDLFEGHPISQRKLKEL  234

Query  320  LGHTPSQVI  294
            LGHTPSQV+
Sbjct  235  LGHTPSQVL  243



>ref|XP_010266542.1| PREDICTED: uncharacterized protein LOC104604025 isoform X2 [Nelumbo 
nucifera]
Length=290

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 178/236 (75%), Gaps = 16/236 (7%)
 Frame = -1

Query  962  KPKTFGVSPITASQLNHQN-PYLQCGNHTSNRKPFLLLVPILKNLEDF---ASKNNWISP  795
            K + F   P++    ++ N P  +C NH      F  L+P++++++DF   AS     + 
Sbjct  42   KRRNFAAIPVSYRPPSYLNFPRNRC-NHRIPTDLFYALMPLIQSIKDFVVVASGIRTGNV  100

Query  794  VLQTPGEEF-----GGELLQ------SGGFGMALLSITATAGVKISPFVATLAANPTFVS  648
            +L+   E++     G +L +      SGG G++LLS+T+TA V+ISP VATLAANPTFVS
Sbjct  101  LLKDLAEKWVSSLRGCDLWEGVSDDLSGGIGVSLLSVTSTAKVRISPVVATLAANPTFVS  160

Query  647  GLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLF  468
            GL+AW++AQ  K+FL F +ERKWDFR++ ASGGMPSSHSALCTALT SVALCHGVADSLF
Sbjct  161  GLIAWVIAQLIKIFLNFFMERKWDFRILFASGGMPSSHSALCTALTTSVALCHGVADSLF  220

Query  467  PVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQ  300
            PVCLGFSLIVMYDAIGVRRHAGMQA+VLN+I++DLF+ HP+SQRKLKE LGHTPSQ
Sbjct  221  PVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIIQDLFQGHPISQRKLKEFLGHTPSQ  276



>ref|XP_003554767.1| PREDICTED: uncharacterized protein LOC100793748 isoform X1 [Glycine 
max]
 gb|KHN43097.1| Putative membrane protein yuiD [Glycine soja]
Length=214

 Score =   259 bits (662),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  746  GGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRM  567
            GG G+ALLS+TA A ++ISPFVATLAANPTFVSGLLAWL+AQS KVFL F +ERKWD R+
Sbjct  43   GGLGVALLSVTANAKLRISPFVATLAANPTFVSGLLAWLIAQSMKVFLNFFMERKWDLRL  102

Query  566  MCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV  387
            + ASGGMPSSHSALCTAL+ SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV
Sbjct  103  LFASGGMPSSHSALCTALSTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV  162

Query  386  LNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            LNLIV DLF+ HP+S+RKLKELLGHTPSQV
Sbjct  163  LNLIVADLFQGHPISERKLKELLGHTPSQV  192



>gb|KFK35365.1| hypothetical protein AALP_AA5G275800 [Arabis alpina]
Length=193

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  776  EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKF  597
            E   G+L  +GG G+ALLS+TA+A VKISPFVATL+ANPTFVS + AWL AQSSK+ + F
Sbjct  12   ENVVGDLEMNGGLGIALLSVTASAKVKISPFVATLSANPTFVSAVFAWLFAQSSKMVINF  71

Query  596  CVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGV  417
             VERKWD  ++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGV
Sbjct  72   FVERKWDLSLLYASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGV  131

Query  416  RRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            RRHAGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  132  RRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  172



>gb|KHG26804.1| putative membrane yuiD [Gossypium arboreum]
Length=319

 Score =   263 bits (671),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/234 (60%), Positives = 162/234 (69%), Gaps = 43/234 (18%)
 Frame = -1

Query  869  KPFLLLVPILKNLED--FASKNNWISPVLQ--TPGEE----FGGELLQSGGFGMALLSIT  714
             P L+LVP+L+++    F+    W S +    T  EE    + G   QSGG GMALLS+T
Sbjct  64   NPLLVLVPVLRSIRGLAFSHSQKWASRLHDCITESEEILDQYNGNYWQSGGLGMALLSVT  123

Query  713  ATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSH  534
            A+A V+ISPFVATLAANPTFVSGL AW +AQS K+FL F +ERKWDFR++ ASGGMPSSH
Sbjct  124  ASAKVRISPFVATLAANPTFVSGLFAWFIAQSMKIFLNFFIERKWDFRILFASGGMPSSH  183

Query  533  SALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA-------------  393
            SALCTALT SVA+CHG+ADSLFPVCLGFSLIVMYDAIGVRRHAGMQA             
Sbjct  184  SALCTALTTSVAICHGIADSLFPVCLGFSLIVMYDAIGVRRHAGMQAAGHRSWLFREKEK  243

Query  392  ----------------------QVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
                                   VLN+IVEDLF+ HP+SQRKLKELLGHTPSQV
Sbjct  244  ETCRHMPLDFHLHNLVLGVTDLMVLNMIVEDLFQGHPISQRKLKELLGHTPSQV  297



>ref|XP_009116844.1| PREDICTED: uncharacterized protein LOC103841999 [Brassica rapa]
Length=265

 Score =   258 bits (659),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 3/186 (2%)
 Frame = -1

Query  842  LKNLEDFASKNNWISPVLQTPGEEFG---GELLQSGGFGMALLSITATAGVKISPFVATL  672
            ++ ++   S   W+S       +      G+L Q+GG G+ALLSITA+A VKISPFVATL
Sbjct  55   IRTIKGLVSSRQWMSRFRAYRDDTAAFSAGDLKQNGGLGIALLSITASAKVKISPFVATL  114

Query  671  AANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALC  492
            +ANPTFVS + AW  AQ+SK+ + F +ERKWD  ++ ASGGMPSSHSALC ALT SVALC
Sbjct  115  SANPTFVSAVFAWFFAQTSKMVINFFIERKWDLSLLFASGGMPSSHSALCMALTTSVALC  174

Query  491  HGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGH  312
            HGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLNLI+ DLF+ HP+SQRKLKELLGH
Sbjct  175  HGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNLIIRDLFEGHPISQRKLKELLGH  234

Query  311  TPSQVI  294
            TPSQV+
Sbjct  235  TPSQVL  240



>ref|XP_010053826.1| PREDICTED: uncharacterized protein LOC104442179 [Eucalyptus grandis]
 gb|KCW78188.1| hypothetical protein EUGRSUZ_D02377 [Eucalyptus grandis]
Length=291

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 166/241 (69%), Gaps = 14/241 (6%)
 Frame = -1

Query  983  NSFLRVHKPKTFGVSPITASQLNHQNPYLQCGNHTSNRKPFLLLVPILKNLEDFASKNNW  804
             SF    +P+   VS    S  +  +      N +S  KP  + V   + ++DFA     
Sbjct  33   RSFTSCRRPRISSVSVSCKSPPDEGSSDFDGNNTSSPLKPTWVSVRAFRRIKDFAYS---  89

Query  803  ISPVLQTPGEEFGG-----------ELLQSGGFGMALLSITATAGVKISPFVATLAANPT  657
             +  L + G+E G              LQ+GG G+ LL++T +A VKISPFVATLAANPT
Sbjct  90   CTRKLVSSGQERGEPEEVADGCGGCGYLQNGGIGIVLLTLTYSAKVKISPFVATLAANPT  149

Query  656  FVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVAD  477
            FVSGLLAW  AQS KV L F VER WD R + A GGMPSSHSALCTALT SVALCHG+AD
Sbjct  150  FVSGLLAWFFAQSVKVVLNFFVERIWDLRFLFACGGMPSSHSALCTALTTSVALCHGMAD  209

Query  476  SLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            SLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN+IVEDLF+ HP+ +RKLKELLGHTPSQV
Sbjct  210  SLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNMIVEDLFQGHPIRKRKLKELLGHTPSQV  269

Query  296  I  294
            +
Sbjct  270  V  270



>emb|CDX71706.1| BnaC08g31680D [Brassica napus]
Length=258

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  767  GGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVE  588
             G+L Q+GG G+ALLSITA+A VKISPFVATL+ANPTFVS + AW  AQ+SK+ + F +E
Sbjct  76   AGDLKQNGGLGIALLSITASAKVKISPFVATLSANPTFVSAVFAWFFAQTSKMVINFFIE  135

Query  587  RKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  408
            RKWD  ++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH
Sbjct  136  RKWDLSLLFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  195

Query  407  AGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            AGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  196  AGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  233



>gb|KEH24632.1| acid phosphatase/vanadium-dependent haloperoxidase [Medicago 
truncatula]
Length=254

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -1

Query  755  LQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWD  576
            LQ+GG G+ALLS+TA A VKISPFVATLA+NPTFVSGL AW +AQS K FL F VERKWD
Sbjct  80   LQNGGLGIALLSVTANAKVKISPFVATLASNPTFVSGLFAWFLAQSIKFFLNFFVERKWD  139

Query  575  FRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQ  396
              + CASGGMPSSHSALCTALT SVA+CHGVADSLFPV LGFSLIVMYDAIGVRRHAGMQ
Sbjct  140  LSLFCASGGMPSSHSALCTALTTSVAICHGVADSLFPVSLGFSLIVMYDAIGVRRHAGMQ  199

Query  395  AQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            AQVLN+I+ D+F+ HP+S+RKLKELLGHTPSQV
Sbjct  200  AQVLNMILADMFQGHPISERKLKELLGHTPSQV  232



>ref|XP_007147313.1| hypothetical protein PHAVU_006G113300g [Phaseolus vulgaris]
 gb|ESW19307.1| hypothetical protein PHAVU_006G113300g [Phaseolus vulgaris]
Length=224

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 1/151 (1%)
 Frame = -1

Query  746  GGFGMALLS-ITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFR  570
            GG G+ALLS +TA A ++ISPFVATLAANPTFVSGL+AWL+AQS KV L F  +RKWDFR
Sbjct  52   GGLGVALLSSVTANAKLRISPFVATLAANPTFVSGLVAWLIAQSVKVLLNFFFDRKWDFR  111

Query  569  MMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            ++ ASGGMPSSHSALCTALT SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ
Sbjct  112  LLFASGGMPSSHSALCTALTTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  171

Query  389  VLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            VLNLIV DLF+ HPMS+RKLKELLGHTPSQV
Sbjct  172  VLNLIVADLFQGHPMSERKLKELLGHTPSQV  202



>emb|CDX67863.1| BnaA07g19030D [Brassica napus]
Length=280

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  767  GGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVE  588
            G +L +SGG G+ALLS+TA+A VKISPFVATL+ANPTFVS + AW  AQ+SK+ + F +E
Sbjct  102  GEDLKRSGGLGIALLSVTASAKVKISPFVATLSANPTFVSAVFAWFFAQTSKMVINFFIE  161

Query  587  RKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  408
            RKWD  ++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH
Sbjct  162  RKWDLSLLFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  221

Query  407  AGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            AGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  222  AGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  259



>ref|XP_009104347.1| PREDICTED: uncharacterized protein LOC103830326 [Brassica rapa]
Length=280

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  767  GGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVE  588
            G +L +SGG G+ALLS+TA+A VKISPFVATL+ANPTFVS + AW  AQ+SK+ + F +E
Sbjct  102  GEDLKRSGGLGIALLSVTASAKVKISPFVATLSANPTFVSAVFAWFFAQTSKMVINFFIE  161

Query  587  RKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  408
            RKWD  ++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH
Sbjct  162  RKWDLSLLFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  221

Query  407  AGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            AGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  222  AGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  259



>emb|CDY25075.1| BnaC06g18170D [Brassica napus]
Length=281

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  767  GGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVE  588
            G +L + GG G+ALLS+TA+A VKISPFVATL+ANPTFVS + AW  AQ+SK+ + F +E
Sbjct  103  GEDLKRRGGLGIALLSVTASAKVKISPFVATLSANPTFVSAVFAWFFAQTSKMVINFFIE  162

Query  587  RKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  408
            RKWD  ++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH
Sbjct  163  RKWDLSLLFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRH  222

Query  407  AGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQVI  294
            AGMQA+VLNLI+ DLF+ HP+SQRKLKELLGHTPSQV+
Sbjct  223  AGMQAEVLNLIIRDLFEGHPISQRKLKELLGHTPSQVL  260



>ref|XP_008799605.1| PREDICTED: uncharacterized protein LOC103714204 [Phoenix dactylifera]
 ref|XP_008799607.1| PREDICTED: uncharacterized protein LOC103714204 [Phoenix dactylifera]
 ref|XP_008799608.1| PREDICTED: uncharacterized protein LOC103714204 [Phoenix dactylifera]
 ref|XP_008799609.1| PREDICTED: uncharacterized protein LOC103714204 [Phoenix dactylifera]
 ref|XP_008799610.1| PREDICTED: uncharacterized protein LOC103714204 [Phoenix dactylifera]
Length=285

 Score =   243 bits (621),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 150/197 (76%), Gaps = 6/197 (3%)
 Frame = -1

Query  866  PFLLLVPILKNLEDFA-----SKNNWISPVLQTPGEEFGGELLQSGGFGMALLSITAT-A  705
            PF LL+PI  +   FA     +  +W+   L       G +LL  GG GM ++S TA  +
Sbjct  68   PFCLLLPIFHSFGVFAFSRAPNIRSWLKGGLVEDEGGCGNDLLCCGGIGMMVMSTTAALS  127

Query  704  GVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSAL  525
              ++SPF+ TLA NPTFVSGL+AW +AQ+ K+ L F VER+WDFRM+ +SGGMPSSHSAL
Sbjct  128  KAQVSPFLWTLAGNPTFVSGLVAWALAQTIKMLLNFFVERRWDFRMLFSSGGMPSSHSAL  187

Query  524  CTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPM  345
            C ALTASV +CHG ADSLFPVCLGFSLIVMYDA GVRRHAGMQA+VLN I+EDLF+ HP+
Sbjct  188  CMALTASVGMCHGAADSLFPVCLGFSLIVMYDATGVRRHAGMQAKVLNKIIEDLFQGHPI  247

Query  344  SQRKLKELLGHTPSQVI  294
            S+RKLKELLGHTPSQVI
Sbjct  248  SERKLKELLGHTPSQVI  264



>ref|XP_010924505.1| PREDICTED: uncharacterized protein LOC105047322 [Elaeis guineensis]
Length=287

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = -1

Query  866  PF-LLLVPILKNLEDFASK-----NNWISPVLQTPGEEFGGELLQSGGFGMALLSIT-AT  708
            PF LLL+PI  +  DF         +W+   L       G +LL  GG GM L+S T A 
Sbjct  69   PFCLLLLPIFHSFGDFVFAWMPKFRSWLKGGLVGDEGICGNDLLCCGGIGMMLMSTTTAL  128

Query  707  AGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSA  528
            +  ++SPF++TLA NPTFV+GL+AW +AQ+ K+ L F VER+WDF M+ +SGGMPSSHSA
Sbjct  129  SKARVSPFLSTLAGNPTFVAGLVAWAMAQTIKMLLNFFVERRWDFGMLFSSGGMPSSHSA  188

Query  527  LCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP  348
            LC ALTASV LCHG ADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN I+EDLF+ HP
Sbjct  189  LCMALTASVGLCHGAADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNKIIEDLFQGHP  248

Query  347  MSQRKLKELLGHTPSQVI  294
            +S+RKLKELLGHTPSQVI
Sbjct  249  ISERKLKELLGHTPSQVI  266



>ref|XP_010918287.1| PREDICTED: uncharacterized protein LOC105042688 [Elaeis guineensis]
Length=284

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/261 (54%), Positives = 175/261 (67%), Gaps = 14/261 (5%)
 Frame = -1

Query  1049  PIVRMDSVVINLPPP--PSRFN---LPNSFLRVHKPKTFGVSPITASQLNHQNPYLQCGN  885
             P VR+ +  ++  P   PS FN    P+S     KP     S +   +       L+   
Sbjct  8     PFVRVSAAHLSRNPKTTPSHFNPCATPHS-----KPSPPSFSFVAPPRKPRSLKTLETSP  62

Query  884   HTSNRKPFLLLVPILKNLEDFA-SKNNWISPVLQTPGEE--FGGELLQSGGFGMALLSIT  714
               ++  PF  L+PI  +   F  S+   I   L+   +E   G +LL  GG GM L+S T
Sbjct  63    DATSITPFCFLLPIFHSFGGFVLSRAPKIRSWLKGGLDEGMCGNDLLCCGGIGMMLMSTT  122

Query  713   AT-AGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSS  537
             A  +  ++SPF+ TLA NPTFVSGL+AW +AQ+ K+ L F VER+WDFRM+ +SGGMPSS
Sbjct  123   AMLSKAQVSPFLWTLAGNPTFVSGLVAWALAQTIKMLLNFFVERRWDFRMLFSSGGMPSS  182

Query  536   HSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFK  357
             HSALC ALTASV +CHG +DSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN I+EDLF+
Sbjct  183   HSALCMALTASVGMCHGASDSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNKIIEDLFQ  242

Query  356   WHPMSQRKLKELLGHTPSQVI  294
              HP+S+RKLKELLGHTPSQVI
Sbjct  243   GHPISERKLKELLGHTPSQVI  263



>ref|XP_009395045.1| PREDICTED: uncharacterized protein LOC103980379 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009395046.1| PREDICTED: uncharacterized protein LOC103980379 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFA-SKNNWISPVLQTPGEEFGGE--LLQSGGFGMALLSITAT-AG  702
             PF LL+PIL +   F  S+   + P L    +   GE   L  G  G  L++ TA  + 
Sbjct  68   NPFCLLLPILHSFGGFVLSRLPKVRPWLHGGLDGRDGEDGYLCCGSIGTLLMTTTAAVSK  127

Query  701  VKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALC  522
             ++SPF+ TLA NPTFVSGL+AW +AQ+ K+FL F VER+WD  M+ + GGMPSSHSALC
Sbjct  128  ARVSPFLWTLAGNPTFVSGLVAWSLAQTIKMFLNFFVERRWDLGMLFSCGGMPSSHSALC  187

Query  521  TALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMS  342
            TALTASVALCHGV+DSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN I++DLF+ HP+S
Sbjct  188  TALTASVALCHGVSDSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNKIIDDLFQGHPIS  247

Query  341  QRKLKELLGHTPSQV  297
            +RKLKELLGHTPSQV
Sbjct  248  ERKLKELLGHTPSQV  262



>ref|XP_009395047.1| PREDICTED: uncharacterized protein LOC103980379 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=283

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/195 (64%), Positives = 149/195 (76%), Gaps = 4/195 (2%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFA-SKNNWISPVLQTPGEEFGGE--LLQSGGFGMALLSITAT-AG  702
             PF LL+PIL +   F  S+   + P L    +   GE   L  G  G  L++ TA  + 
Sbjct  68   NPFCLLLPILHSFGGFVLSRLPKVRPWLHGGLDGRDGEDGYLCCGSIGTLLMTTTAAVSK  127

Query  701  VKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALC  522
             ++SPF+ TLA NPTFVSGL+AW +AQ+ K+FL F VER+WD  M+ + GGMPSSHSALC
Sbjct  128  ARVSPFLWTLAGNPTFVSGLVAWSLAQTIKMFLNFFVERRWDLGMLFSCGGMPSSHSALC  187

Query  521  TALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMS  342
            TALTASVALCHGV+DSLFPVCLGFSLIVMYDAIGVRRHAGMQA+VLN I++DLF+ HP+S
Sbjct  188  TALTASVALCHGVSDSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVLNKIIDDLFQGHPIS  247

Query  341  QRKLKELLGHTPSQV  297
            +RKLKELLGHTPSQV
Sbjct  248  ERKLKELLGHTPSQV  262



>ref|XP_001764463.1| predicted protein [Physcomitrella patens]
 gb|EDQ70730.1| predicted protein [Physcomitrella patens]
Length=215

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -1

Query  788  QTPGEEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKV  609
            ++  E+  G LLQ G  GMALLS +  A  +ISP + TL ANPTF+SGL+AW  AQ  KV
Sbjct  31   ESQWEDLDGALLQQGSLGMALLSTSMIARDRISPVLITLRANPTFMSGLVAWAFAQVLKV  90

Query  608  FLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYD  429
            F K+ VER+WD++M+  SGGMPSSHSALC  LT +VALCHGV DSLFPVCLGF+LIVMYD
Sbjct  91   FTKYFVERRWDWKMLVGSGGMPSSHSALCVGLTTAVALCHGVGDSLFPVCLGFTLIVMYD  150

Query  428  AIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            A GVRRHAG QA+VLN+IVEDLF+ HP+S++KLKELLGHTP QV
Sbjct  151  AAGVRRHAGRQAEVLNMIVEDLFQGHPVSEKKLKELLGHTPLQV  194



>ref|XP_001764571.1| predicted protein [Physcomitrella patens]
 gb|EDQ70553.1| predicted protein [Physcomitrella patens]
Length=181

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = -1

Query  776  EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKF  597
            E   G LL  G  GMALLSI+  A  +ISP + TL  NPTF+SGL+AW +AQ  KVF K+
Sbjct  1    ETSEGALLMQGSMGMALLSISMIARDRISPVLITLRTNPTFMSGLVAWAIAQVLKVFTKY  60

Query  596  CVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGV  417
             VER+WD++M+  SGGMPSSHSALC  LT +VALCHGV DSLFPVCLGF+LIVMYDA GV
Sbjct  61   FVERRWDWKMLVGSGGMPSSHSALCVGLTTAVALCHGVGDSLFPVCLGFTLIVMYDAAGV  120

Query  416  RRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            RRHAG QA+VLN+IVEDLF+ HP+S++KLKELLGHTP QV
Sbjct  121  RRHAGRQAEVLNMIVEDLFQGHPVSEKKLKELLGHTPLQV  160



>ref|XP_006491279.1| PREDICTED: uncharacterized protein LOC102622631 isoform X3 [Citrus 
sinensis]
 gb|KDO86485.1| hypothetical protein CISIN_1g022192mg [Citrus sinensis]
Length=262

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 136/177 (77%), Gaps = 10/177 (6%)
 Frame = -1

Query  869  KPFLLLVPILKNLEDFASKNN--WISPVLQTPG--------EEFGGELLQSGGFGMALLS  720
             PF +L PIL++++  AS     W S +             ++   + LQ+G FG ALLS
Sbjct  79   NPFCVLFPILQSIKGLASSQTKKWASRLQAHSSQLENINVIDQNSNDYLQTGAFGAALLS  138

Query  719  ITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPS  540
            +T+TA VKISPFVATLAANPTFVSGL AW++AQS+KVFL F VERKWD R++ ASGGMPS
Sbjct  139  VTSTAKVKISPFVATLAANPTFVSGLFAWMIAQSTKVFLNFFVERKWDLRLLFASGGMPS  198

Query  539  SHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
            SHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+V N++  
Sbjct  199  SHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAEVTNIVAR  255



>ref|XP_010534433.1| PREDICTED: uncharacterized protein LOC104809981 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523809.1| PREDICTED: uncharacterized protein LOC104802074 isoform X2 [Tarenaya 
hassleriana]
Length=237

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 139/187 (74%), Gaps = 12/187 (6%)
 Frame = -1

Query  914  HQNPYLQCGNHTSNR----KPFLLLVPILKNLEDFASKNN--WIS------PVLQTPGEE  771
            H NP     ++ +NR     P+L+L  I + ++  AS  +  W+S             E+
Sbjct  38   HSNPICPQPDYGTNRILRINPYLILRSIFRRIKGLASSQSQRWVSRSQAYRDDTAAFSEQ  97

Query  770  FGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCV  591
            F G+  + GGFG ALLS+TA+A VKISPFVATLAANPTFVSGL+AW VAQS KVFL F V
Sbjct  98   FAGDWEKHGGFGTALLSVTASAKVKISPFVATLAANPTFVSGLVAWFVAQSIKVFLNFFV  157

Query  590  ERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRR  411
            ERKWDFR++ ASGGMPSSHSALC ALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRR
Sbjct  158  ERKWDFRILFASGGMPSSHSALCMALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRR  217

Query  410  HAGMQAQ  390
            HAGMQA+
Sbjct  218  HAGMQAE  224



>gb|EAY98815.1| hypothetical protein OsI_20760 [Oryza sativa Indica Group]
 gb|EEE64482.1| hypothetical protein OsJ_19332 [Oryza sativa Japonica Group]
Length=269

 Score =   227 bits (578),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 2/149 (1%)
 Frame = -1

Query  740  FGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRM  567
             G  L+S TA A  K   +P++  LAANPTFVSGL+AW VAQ++KV L   VER+WD RM
Sbjct  98   IGTLLMSTTAAAVTKARENPYILALAANPTFVSGLVAWAVAQAAKVVLTSFVERRWDLRM  157

Query  566  MCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV  387
            + +SGGMPSSH+ALCTALTASVALCHGV+DSLFPVCLGF+LIVMYDA GVRRHAGMQA+V
Sbjct  158  LFSSGGMPSSHTALCTALTASVALCHGVSDSLFPVCLGFTLIVMYDATGVRRHAGMQAEV  217

Query  386  LNLIVEDLFKWHPMSQRKLKELLGHTPSQ  300
            LN IVEDLF+ HP+S+RKLKELLGHTPSQ
Sbjct  218  LNKIVEDLFQGHPISERKLKELLGHTPSQ  246



>ref|XP_010267624.1| PREDICTED: uncharacterized protein LOC104604791 isoform X2 [Nelumbo 
nucifera]
Length=273

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 158/233 (68%), Gaps = 23/233 (10%)
 Frame = -1

Query  941  SPITASQLNHQNPYL---QCGNHTSNRKPFLLLVPILKNLEDFAS--------KNNWISP  795
            S IT S      P L   +C  H     PF +L+P+L+++ DFA            W+S 
Sbjct  46   SAITVSYRAPSGPDLSRNRC-THCLPTNPFCVLIPVLQSIRDFAGLAASGTRRGYKWLS-  103

Query  794  VLQTPGE------EFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAW  633
             L+  G+      E+GG+   +GG G+ALLS+T+TA V+ISP VATLAANPTFVSGLLAW
Sbjct  104  CLRGCGDSGGVSNEWGGDYFHNGGIGVALLSVTSTAKVRISPVVATLAANPTFVSGLLAW  163

Query  632  LVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLG  453
            + AQS KVFL F VERKWDFR++ ASGGMPSSHSALCTALT SVALCHGVADSLFPVCLG
Sbjct  164  VAAQSIKVFLNFFVERKWDFRILFASGGMPSSHSALCTALTTSVALCHGVADSLFPVCLG  223

Query  452  FSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMS-QRKLKELLGHTPSQV  297
            F+LIVMYDAIGVRRHAGMQA+       + FK+H +   R  K + G   S+ 
Sbjct  224  FTLIVMYDAIGVRRHAGMQAEGR---WREEFKFHLVEWNRCWKSMKGGWDSET  273



>ref|XP_008437893.1| PREDICTED: uncharacterized protein LOC103483186 isoform X2 [Cucumis 
melo]
Length=248

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 129/241 (54%), Positives = 153/241 (63%), Gaps = 25/241 (10%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFN-------------LPNSFLRVHKPKTFGVSPITASQLNH---QN  906
             M++V + L   P  FN             L   FL+  K + F   P   S +N    +N
Sbjct  1     METVSVGLISSPFIFNGSPQRTRPCSTNFLSFGFLQSKKLRRF---PHNFSCINRPTTRN  57

Query  905   PYLQCGNHTSNRKPFLLLVPILKNLEDF----ASKNNWISPVLQTPGEEFGGELLQSGGF  738
                + G+ +     F +LVPIL++++        K   +S      G    G  LQSG  
Sbjct  58    EKYEGGDRSFRSNLFWVLVPILQSIKGVILSKTHKAQSVSGGFVNGG--LNGTYLQSGSV  115

Query  737   GMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCA  558
             G ALLSITATA  +ISPFVATLA NPTFVSGL AW  AQS+KV L F VERKWD ++M A
Sbjct  116   GTALLSITATAKHRISPFVATLATNPTFVSGLFAWFFAQSTKVLLNFFVERKWDLKIMFA  175

Query  557   SGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNL  378
              GGMPSSHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA++L+L
Sbjct  176   CGGMPSSHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAELLSL  235

Query  377   I  375
             +
Sbjct  236   L  236



>ref|XP_008649891.1| PREDICTED: uncharacterized protein LOC103630623 [Zea mays]
 gb|AFW78747.1| hypothetical protein ZEAMMB73_933479 [Zea mays]
Length=257

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 133/170 (78%), Gaps = 9/170 (5%)
 Frame = -1

Query  779  GEEFGGEL-------LQSGGFGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLV  627
            G   GGEL           G G  L+S TA A  K   SP++  LAANPTFVSGL+AW V
Sbjct  66   GGRTGGELPDLATAATGGAGIGTLLMSTTAAAVTKARESPYLLALAANPTFVSGLVAWAV  125

Query  626  AQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFS  447
            AQ++K  L   VER+WD RM+ +SGGMPSSH+ALCTALTASVALCHGV+D+LFPVCLGFS
Sbjct  126  AQAAKALLTSVVERRWDLRMLFSSGGMPSSHTALCTALTASVALCHGVSDALFPVCLGFS  185

Query  446  LIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            LIVMYDA GVRRHAGMQA+VLN IVEDLF+ HP+S+RKLKELLGHTPSQV
Sbjct  186  LIVMYDATGVRRHAGMQAEVLNKIVEDLFEGHPISERKLKELLGHTPSQV  235



>ref|XP_008437894.1| PREDICTED: uncharacterized protein LOC103483186 isoform X3 [Cucumis 
melo]
Length=235

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 127/236 (54%), Positives = 148/236 (63%), Gaps = 25/236 (11%)
 Frame = -1

Query  1037  MDSVVINLPPPPSRFN-------------LPNSFLRVHKPKTFGVSPITASQLNH---QN  906
             M++V + L   P  FN             L   FL+  K + F   P   S +N    +N
Sbjct  1     METVSVGLISSPFIFNGSPQRTRPCSTNFLSFGFLQSKKLRRF---PHNFSCINRPTTRN  57

Query  905   PYLQCGNHTSNRKPFLLLVPILKNLEDF----ASKNNWISPVLQTPGEEFGGELLQSGGF  738
                + G+ +     F +LVPIL++++        K   +S      G    G  LQSG  
Sbjct  58    EKYEGGDRSFRSNLFWVLVPILQSIKGVILSKTHKAQSVSGGFVNGG--LNGTYLQSGSV  115

Query  737   GMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCA  558
             G ALLSITATA  +ISPFVATLA NPTFVSGL AW  AQS+KV L F VERKWD ++M A
Sbjct  116   GTALLSITATAKHRISPFVATLATNPTFVSGLFAWFFAQSTKVLLNFFVERKWDLKIMFA  175

Query  557   SGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
              GGMPSSHSALCTALT SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA+
Sbjct  176   CGGMPSSHSALCTALTTSVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAE  231



>ref|XP_002960492.1| hypothetical protein SELMODRAFT_74719 [Selaginella moellendorffii]
 gb|EFJ38031.1| hypothetical protein SELMODRAFT_74719 [Selaginella moellendorffii]
Length=157

 Score =   210 bits (535),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -1

Query  707  AGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSA  528
            A   +SP + TL ANPTF+SGL+AW+VAQ+SKV   + V R+WD RM+  SGGMPSSHSA
Sbjct  2    ASAHLSPVIVTLRANPTFMSGLVAWMVAQASKVLTTYVVYRRWDLRMLVGSGGMPSSHSA  61

Query  527  LCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP  348
            LC  LT SVAL HGV D+LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN+I++DLF+ HP
Sbjct  62   LCLGLTTSVALSHGVGDALFPVCLGFSLIVMYDATGVRRHAGMQAEVLNMIIKDLFQGHP  121

Query  347  MSQRKLKELLGHTPSQVI  294
            +S++KLKELLGHTP QV+
Sbjct  122  VSEKKLKELLGHTPLQVV  139



>ref|XP_010266543.1| PREDICTED: uncharacterized protein LOC104604025 isoform X3 [Nelumbo 
nucifera]
Length=260

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 150/206 (73%), Gaps = 16/206 (8%)
 Frame = -1

Query  962  KPKTFGVSPITASQLNHQN-PYLQCGNHTSNRKPFLLLVPILKNLEDF---ASKNNWISP  795
            K + F   P++    ++ N P  +C NH      F  L+P++++++DF   AS     + 
Sbjct  42   KRRNFAAIPVSYRPPSYLNFPRNRC-NHRIPTDLFYALMPLIQSIKDFVVVASGIRTGNV  100

Query  794  VLQTPGEEF-----GGELLQ------SGGFGMALLSITATAGVKISPFVATLAANPTFVS  648
            +L+   E++     G +L +      SGG G++LLS+T+TA V+ISP VATLAANPTFVS
Sbjct  101  LLKDLAEKWVSSLRGCDLWEGVSDDLSGGIGVSLLSVTSTAKVRISPVVATLAANPTFVS  160

Query  647  GLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLF  468
            GL+AW++AQ  K+FL F +ERKWDFR++ ASGGMPSSHSALCTALT SVALCHGVADSLF
Sbjct  161  GLIAWVIAQLIKIFLNFFMERKWDFRILFASGGMPSSHSALCTALTTSVALCHGVADSLF  220

Query  467  PVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            PVCLGFSLIVMYDAIGVRRHAGMQA+
Sbjct  221  PVCLGFSLIVMYDAIGVRRHAGMQAE  246



>ref|XP_002440134.1| hypothetical protein SORBIDRAFT_09g026640 [Sorghum bicolor]
 gb|EES18564.1| hypothetical protein SORBIDRAFT_09g026640 [Sorghum bicolor]
Length=263

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -1

Query  743  GFGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFR  570
            G G  L+S TA A  K   SP++  LAANPTFVSGL+AW VAQ++K  L   VER+WD R
Sbjct  91   GIGTLLMSTTAAAVTKARESPYLLALAANPTFVSGLVAWAVAQAAKALLTSVVERRWDLR  150

Query  569  MMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            M+ +SGGMPSSH+ALCTALTASVALCHGV+D+LFPVCLGF+LIVMYDA GVRRHAGMQA+
Sbjct  151  MLFSSGGMPSSHTALCTALTASVALCHGVSDALFPVCLGFTLIVMYDATGVRRHAGMQAE  210

Query  389  VLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            VLN IVEDLF+ HP+S+RKLKELLGHTPSQV
Sbjct  211  VLNKIVEDLFEGHPISERKLKELLGHTPSQV  241



>ref|XP_006604907.1| PREDICTED: uncharacterized protein LOC100793748 isoform X2 [Glycine 
max]
Length=174

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -1

Query  746  GGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRM  567
            GG G+ALLS+TA A ++ISPFVATLAANPTFVSGLLAWL+AQS KVFL F +ERKWD R+
Sbjct  43   GGLGVALLSVTANAKLRISPFVATLAANPTFVSGLLAWLIAQSMKVFLNFFMERKWDLRL  102

Query  566  MCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            + ASGGMPSSHSALCTAL+ SVA+CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ
Sbjct  103  LFASGGMPSSHSALCTALSTSVAICHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  161



>ref|XP_002967232.1| hypothetical protein SELMODRAFT_86540 [Selaginella moellendorffii]
 gb|EFJ31831.1| hypothetical protein SELMODRAFT_86540 [Selaginella moellendorffii]
Length=149

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
             + TL ANPTF+SGL+AW+VAQ+SKV   + V R+WD RM+  SGGMPSSHSALC  LT 
Sbjct  1    MIVTLRANPTFMSGLVAWMVAQASKVLTTYVVYRRWDLRMLVGSGGMPSSHSALCLGLTT  60

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLK  327
            SVAL HGV D+LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN+I++DLF+ HP+S++KLK
Sbjct  61   SVALSHGVGDALFPVCLGFSLIVMYDATGVRRHAGMQAEVLNMIIKDLFQGHPVSEKKLK  120

Query  326  ELLGHTPSQVI  294
            ELLGHTP QV+
Sbjct  121  ELLGHTPLQVV  131



>ref|XP_004961400.1| PREDICTED: uncharacterized protein LOC101779439 [Setaria italica]
Length=263

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 126/146 (86%), Gaps = 2/146 (1%)
 Frame = -1

Query  728  LLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
            L+S TA A  K   SP++  LAANPTFVSGL+AW VAQ++K  L   VER+WD RM+ +S
Sbjct  96   LMSTTAAAVTKARESPYLLALAANPTFVSGLVAWAVAQAAKALLTSVVERRWDLRMLFSS  155

Query  554  GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLI  375
            GGMPSSH+ALCTALTASVALCHGV+D+LFPVCLGF+LIVMYDA GVRRHAGMQA+VLN I
Sbjct  156  GGMPSSHTALCTALTASVALCHGVSDALFPVCLGFTLIVMYDATGVRRHAGMQAEVLNKI  215

Query  374  VEDLFKWHPMSQRKLKELLGHTPSQV  297
            VEDLF+ HP+S+RKLKELLGHTPSQV
Sbjct  216  VEDLFEGHPISERKLKELLGHTPSQV  241



>ref|XP_008656483.1| PREDICTED: uncharacterized protein LOC103635879 [Zea mays]
 gb|AFW82567.1| hypothetical protein ZEAMMB73_734869 [Zea mays]
Length=259

 Score =   206 bits (524),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 127/151 (84%), Gaps = 2/151 (1%)
 Frame = -1

Query  743  GFGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFR  570
            G G  L+S TA A  K   SP++  LAANPTFVSGLLAW  AQ++K  L   VER+WD R
Sbjct  87   GIGTLLMSTTAAAVTKARESPYLLALAANPTFVSGLLAWAAAQAAKALLTSVVERRWDLR  146

Query  569  MMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            M+ +SGGMPSSH+ALCTALTASVALCHGV+D+LFPVCLGF+LIVMYDA GVRRHAGMQA+
Sbjct  147  MLFSSGGMPSSHTALCTALTASVALCHGVSDALFPVCLGFTLIVMYDATGVRRHAGMQAE  206

Query  389  VLNLIVEDLFKWHPMSQRKLKELLGHTPSQV  297
            VLN IVEDLF+ HP+S+RKLKELLGHTPSQV
Sbjct  207  VLNKIVEDLFEGHPISERKLKELLGHTPSQV  237



>ref|NP_001056147.2| Os05g0534100 [Oryza sativa Japonica Group]
 dbj|BAF18061.2| Os05g0534100 [Oryza sativa Japonica Group]
Length=249

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 101/121 (83%), Gaps = 2/121 (2%)
 Frame = -1

Query  740  FGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRM  567
             G  L+S TA A  K   +P++  LAANPTFVSGL+AW VAQ++KV L   VER+WD RM
Sbjct  98   IGTLLMSTTAAAVTKARENPYILALAANPTFVSGLVAWAVAQAAKVVLTSFVERRWDLRM  157

Query  566  MCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV  387
            + +SGGMPSSH+ALCTALTASVALCHGV+DSLFPVCLGF+LIVMYDA GVRRHAGMQA++
Sbjct  158  LFSSGGMPSSHTALCTALTASVALCHGVSDSLFPVCLGFTLIVMYDATGVRRHAGMQAEL  217

Query  386  L  384
            +
Sbjct  218  I  218



>ref|XP_010095753.1| hypothetical protein L484_017559 [Morus notabilis]
 gb|EXB62173.1| hypothetical protein L484_017559 [Morus notabilis]
Length=285

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  397  CIPAWRRTPIASYITIKLKPKQTGNKESATPWQSATEAVNAVHRAECEEGIPPEAHIILK  576
            CIPA RRTPIASYITI+L PKQTGN ESATPWQSAT+   AV RAEC+EGIPPEA+  LK
Sbjct  30   CIPACRRTPIASYITIRLNPKQTGNNESATPWQSATDVDKAVQRAECDEGIPPEANNNLK  89

Query  577  SHFLSTQNFRKTLLDCATNHARSPETNVGLAASVATNGLILTPAVAVMLSKAI  735
            SHFLST+ F  TL+DCA +HA SPETNVG AAS AT GLI T AVAV LS AI
Sbjct  90   SHFLSTKKFNTTLIDCAASHASSPETNVGFAASCATKGLIFTRAVAVTLSSAI  142



>gb|EMT33339.1| hypothetical protein F775_20499 [Aegilops tauschii]
Length=106

 Score =   157 bits (397),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -1

Query  548  MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
            MPSSHSALCTALTASVALCHGV D+LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN IVE
Sbjct  1    MPSSHSALCTALTASVALCHGVGDALFPVCLGFSLIVMYDATGVRRHAGMQAEVLNKIVE  60

Query  368  DLFKWHPMSQRKLKELLGHTPSQV  297
            DLF+ HP+S+RKLKELLGHTPSQV
Sbjct  61   DLFQGHPISERKLKELLGHTPSQV  84



>gb|EMS52991.1| hypothetical protein TRIUR3_19548 [Triticum urartu]
Length=280

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = -1

Query  548  MPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVE  369
            MPSSHSALCTALTASVALCHGV D+LFPVCLGFSLIVMYDA GVRRHAGMQA+VLN IVE
Sbjct  1    MPSSHSALCTALTASVALCHGVGDALFPVCLGFSLIVMYDATGVRRHAGMQAEVLNKIVE  60

Query  368  DLFKWHPMSQRKLKELLGHTPSQV  297
            DLF+ HP+S+RKLKELLGHTPSQV
Sbjct  61   DLFQGHPISERKLKELLGHTPSQV  84



>gb|AFW82568.1| hypothetical protein ZEAMMB73_734869 [Zea mays]
Length=278

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = -1

Query  746  GGFGMALLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDF  573
             G G  L+S TA A  K   SP++  LAANPTFVSGLLAW  AQ++K  L   VER+WD 
Sbjct  86   AGIGTLLMSTTAAAVTKARESPYLLALAANPTFVSGLLAWAAAQAAKALLTSVVERRWDL  145

Query  572  RMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQA  393
            RM+ +SGGMPSSH+ALCTALTASVALCHGV+D+LFPVCLGF+LIVMYDA GVRRHAGMQA
Sbjct  146  RMLFSSGGMPSSHTALCTALTASVALCHGVSDALFPVCLGFTLIVMYDATGVRRHAGMQA  205

Query  392  QV  387
            +V
Sbjct  206  EV  207



>ref|XP_001416200.1| Phosphatidic acid Phosphatase-related protein [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94493.1| Phosphatidic acid Phosphatase-related protein [Ostreococcus lucimarinus 
CCE9901]
Length=275

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 93/137 (68%), Gaps = 0/137 (0%)
 Frame = -1

Query  704  GVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSAL  525
            GV  S   + L  N  F+   L+WLVAQ +K+F  +  E +WD+R+M  SGGMPSSH+AL
Sbjct  121  GVSFSTAFSDLTGNHAFMCAFLSWLVAQVAKIFTAYYREGRWDYRVMFDSGGMPSSHTAL  180

Query  524  CTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPM  345
               LT S+A  HG+    FP+ L F+LIVMYDA GVRRHAG QA+VLN I+ D F   P+
Sbjct  181  VVGLTTSIAHLHGLGSVHFPMSLAFTLIVMYDAAGVRRHAGKQAEVLNKILADTFHGSPL  240

Query  344  SQRKLKELLGHTPSQVI  294
            S  KLKE+LGH+P QV+
Sbjct  241  SNTKLKEVLGHSPLQVV  257



>ref|XP_003056035.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH59411.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=145

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 0/127 (0%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            L+ N  F+    +WL AQ  K F  F  E  WD+R+M  SGGMPSSH+AL   LT ++A 
Sbjct  12   LSGNLIFMCAFWSWLTAQLMKYFTAFYRENAWDWRVMFDSGGMPSSHTALVVGLTTAIAY  71

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLG  315
             +G+  +LFP+ L FSLIVMYDA GVRRHAG QA+VLN I++D+F   P+S RKLKE+LG
Sbjct  72   QYGLGSALFPLSLAFSLIVMYDAAGVRRHAGKQAEVLNKILDDMFHGQPISDRKLKEVLG  131

Query  314  HTPSQVI  294
            H+P QV+
Sbjct  132  HSPLQVL  138



>ref|XP_002507531.1| phosphatidic acid phosphatase-related protein [Micromonas sp. 
RCC299]
 gb|ACO68789.1| phosphatidic acid phosphatase-related protein [Micromonas sp. 
RCC299]
Length=319

 Score =   150 bits (380),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 95/139 (68%), Gaps = 0/139 (0%)
 Frame = -1

Query  710  TAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHS  531
            T     +   A L+ N  F+    +WL AQ+ K F  F  E KWD+R+M  SGGMPSSH+
Sbjct  156  TTTAAFATVFAELSGNLVFMCAFWSWLTAQTMKYFTAFYREGKWDWRVMFDSGGMPSSHT  215

Query  530  ALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWH  351
            +L   LT ++A  +G+  +LFP+ L FSLIVMYDA GVRRHAG QA+VLN I+ED+F   
Sbjct  216  SLVVGLTTAIAYQYGLGSTLFPLSLAFSLIVMYDAAGVRRHAGKQAEVLNKILEDMFHGE  275

Query  350  PMSQRKLKELLGHTPSQVI  294
             +S+RKLKE+LGH+P QV+
Sbjct  276  SISERKLKEVLGHSPLQVM  294



>ref|XP_010231118.1| PREDICTED: uncharacterized protein LOC100840609 [Brachypodium 
distachyon]
Length=235

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 94/115 (82%), Gaps = 2/115 (2%)
 Frame = -1

Query  728  LLSITATAGVKI--SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
            L+S TA A  K   SP++  LAANPTFVSG++A+  AQ++K  L   VER+W  RM+ +S
Sbjct  109  LMSTTAAAVTKARESPYLLALAANPTFVSGVVAFAAAQAAKAVLASVVERRWRPRMLFSS  168

Query  554  GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
            GGMPSSHSALCTALTASVALCHGV DSLFPVCLGFSLIVMYDA GVRRHAGMQA+
Sbjct  169  GGMPSSHSALCTALTASVALCHGVGDSLFPVCLGFSLIVMYDATGVRRHAGMQAE  223



>ref|XP_006655523.1| PREDICTED: uncharacterized protein LOC102710880, partial [Oryza 
brachyantha]
Length=118

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = -1

Query  644  LLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFP  465
            L+AW VAQ++K  L   VER+WD RM+ +SGGMPSSH+ALCTALTASVALCHGV+DSLFP
Sbjct  1    LVAWAVAQAAKGVLTSFVERRWDLRMLFSSGGMPSSHTALCTALTASVALCHGVSDSLFP  60

Query  464  VCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLK  327
            VCLGF+LIVMYDA GVRRHAGMQA+V       ++ +   S R L+
Sbjct  61   VCLGFTLIVMYDATGVRRHAGMQAEVSQCFGCFVYFYLGYSIRSLR  106



>ref|XP_003074907.1| Pap2 Phosphatidic acid Phosphatase-related protein (IC) [Ostreococcus 
tauri]
 emb|CAL52175.2| Acid phosphatase/vanadium-dependent haloperoxidase-related [Ostreococcus 
tauri]
Length=271

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 91/136 (67%), Gaps = 0/136 (0%)
 Frame = -1

Query  701  VKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALC  522
            V  +   + L  N  F+   L+WLVAQ +K+F  +  E +WD+R+M  SGGMPSSH++L 
Sbjct  117  VSFASAFSDLRGNHVFLCAFLSWLVAQVAKIFTAYYREGRWDYRVMFDSGGMPSSHTSLV  176

Query  521  TALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMS  342
              LT S+   HG+    FP+ L FSLIVMYDA GVRRHAG QA+VLN I+ D F   P+S
Sbjct  177  VGLTTSIVHQHGLGSVYFPLALAFSLIVMYDAAGVRRHAGKQAEVLNKILADTFHGTPLS  236

Query  341  QRKLKELLGHTPSQVI  294
              KLKE+LGH+P QV+
Sbjct  237  NTKLKEVLGHSPLQVV  252



>ref|XP_005650276.1| DUF212-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25732.1| DUF212-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=463

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 0/127 (0%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            LA N  F +G  AWL AQ++K+F +   +  WD R +  SGGMPSSHSALCTA+T +V L
Sbjct  46   LARNYVFKAGFCAWLFAQTAKIFTRRLKKGVWDIRAIVDSGGMPSSHSALCTAVTTAVGL  105

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLG  315
              G+A SLF V L F+LI MYDA GVR H+G QA+VLN++VED+ + HP+S+++LKE+LG
Sbjct  106  EFGLASSLFAVSLCFTLITMYDATGVRYHSGKQAEVLNILVEDVMQGHPVSEQRLKEVLG  165

Query  314  HTPSQVI  294
            H P + I
Sbjct  166  HNPLEEI  172



>ref|XP_007509127.1| Phosphatidic acid Phosphatase-related protein [Bathycoccus prasinos]
 emb|CCO19584.1| Phosphatidic acid Phosphatase-related protein [Bathycoccus prasinos]
Length=223

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 97/139 (70%), Gaps = 0/139 (0%)
 Frame = -1

Query  713  ATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSH  534
            A  GV  +  +  L+AN  F++  L+WLVAQ +K+F     + +W+ ++M  SGGMPSSH
Sbjct  66   ALVGVSFARIIPELSANHIFMASFLSWLVAQVAKLFTNCYRKGRWELKVMFDSGGMPSSH  125

Query  533  SALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW  354
            ++L  +LT ++AL +G+   LFP+ L FSLIV YDA GVRRHAG QA+VLN I+ D+F  
Sbjct  126  TSLVFSLTTAIALQYGLGSPLFPLSLAFSLIVAYDAAGVRRHAGKQAEVLNRILADVFHG  185

Query  353  HPMSQRKLKELLGHTPSQV  297
             P+S  KLKE+LGH+P QV
Sbjct  186  SPISDTKLKEVLGHSPLQV  204



>ref|XP_001692930.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP03499.1| predicted protein [Chlamydomonas reinhardtii]
Length=268

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 93/144 (65%), Gaps = 5/144 (3%)
 Frame = -1

Query  710  TAGVKISPF----VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMP  543
             AG+ I P     VA L  N  F+ G  +W  AQ  K+F K   +  WD   M  SGGMP
Sbjct  109  AAGLAIPPVPGNGVADLLTNRVFLVGFWSWFSAQFLKIFTKRFKKGVWDLGAMLESGGMP  168

Query  542  SSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL  363
            SSHS+LC  +T ++A+  G+   LF  CL FS+IVMYDA+GVRRHAG QA+VLN ++++L
Sbjct  169  SSHSSLCAGITTAIAIQQGLGSPLFAACLCFSVIVMYDAMGVRRHAGKQAEVLNKVIDEL  228

Query  362  F-KWHPMSQRKLKELLGHTPSQVI  294
                HPM + KLKE+LGHTP QV+
Sbjct  229  LDDDHPMGEVKLKEVLGHTPRQVV  252



>ref|XP_002953421.1| hypothetical protein VOLCADRAFT_94209 [Volvox carteri f. nagariensis]
 gb|EFJ45394.1| hypothetical protein VOLCADRAFT_94209 [Volvox carteri f. nagariensis]
Length=180

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 95/153 (62%), Gaps = 10/153 (7%)
 Frame = -1

Query  737  GMALLSITATAGVKISPF----VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFR  570
            G+A+L     A V I P     V  L  N  F+ G  +W  AQ  K+F K   +  WD  
Sbjct  17   GLAML-----AAVAIPPIPGNGVTDLLTNRVFLVGFWSWFTAQFLKIFTKRFKKGIWDAG  71

Query  569  MMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQ  390
             M  SGGMPSSHS+LC  +T ++A+  G    LF  CL FS+IVMYDA+GVRRHAG QA+
Sbjct  72   AMLESGGMPSSHSSLCAGITTAIAIQQGFGSPLFAACLCFSVIVMYDAMGVRRHAGKQAE  131

Query  389  VLNLIVEDLF-KWHPMSQRKLKELLGHTPSQVI  294
            VLN ++++L    HPM + KLKE+LGHTP QVI
Sbjct  132  VLNKVIDELLDDDHPMGEVKLKEVLGHTPRQVI  164



>ref|XP_010248889.1| PREDICTED: uncharacterized protein LOC104591652 [Nelumbo nucifera]
Length=181

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = -1

Query  677  TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
            T+  N  F+S ++A+ +AQSSK F+ +  ER+WDF+ + +SGGMPSSHSA  TAL  ++ 
Sbjct  30   TVFTNYPFISAIIAFALAQSSKFFITWYKERRWDFKQLISSGGMPSSHSATVTALAIAIG  89

Query  497  LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKEL  321
               G   S+F + +  + +VM+DA GVR HAG QA+VLN IV +L   HP+++ R L+EL
Sbjct  90   FQDGFGGSVFAIAMILACVVMHDAFGVRLHAGRQAEVLNQIVFELPAEHPLAETRPLREL  149

Query  320  LGHTPSQVI  294
            LGHTPSQVI
Sbjct  150  LGHTPSQVI  158



>ref|XP_010930079.1| PREDICTED: uncharacterized protein LOC105051374 isoform X1 [Elaeis 
guineensis]
Length=169

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S LLA+ +AQS+K F+ +  E++WD + +  SGGMPSSHSA  TAL  ++ +  G
Sbjct  24   NYPLISALLAFAIAQSAKFFITWYKEKRWDAKQLIGSGGMPSSHSATVTALAVAIGIKDG  83

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S+F +   F+++VMYDA GVR HAG QA+VLN IV +L + HP++  R L+ELLGHT
Sbjct  84   FGSSMFAIAAIFAIVVMYDAFGVRLHAGKQAEVLNQIVIELPEEHPLADTRPLRELLGHT  143

Query  308  PSQVI  294
            P QV+
Sbjct  144  PPQVV  148



>ref|XP_008446081.1| PREDICTED: uncharacterized protein LOC103488911 isoform X2 [Cucumis 
melo]
Length=176

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 96/151 (64%), Gaps = 9/151 (6%)
 Frame = -1

Query  719  ITATAGVKI--------SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMM  564
            +TA++G  I        S F +T+  N   +S LLA+ +AQS K F  +  ER+WDF+ +
Sbjct  4    VTASSGSLINGPPSHTPSSFSSTIFTNYPLISALLAFAIAQSIKFFTSWYKERRWDFKKL  63

Query  563  CASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVL  384
              SGGMPSSHS+  +AL  ++ L  G   S+F V L  + +VMYDA GVR  AG QA+VL
Sbjct  64   VGSGGMPSSHSSTVSALAIAIGLQEGFGASVFAVALILACVVMYDATGVRLQAGRQAEVL  123

Query  383  NLIVEDLFKWHPMSQ-RKLKELLGHTPSQVI  294
            N IV +L   HP+++ R L+ELLGHTP QVI
Sbjct  124  NQIVYELPAEHPLAESRPLRELLGHTPPQVI  154



>ref|XP_008801866.1| PREDICTED: uncharacterized protein LOC103715868 [Phoenix dactylifera]
Length=170

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S LLA+ +AQS+K F+ +  E++WD + +  SGGMPSSHSA  TAL  ++ +  G
Sbjct  25   NYPLISALLAFAIAQSTKFFVTWYKEKRWDAKQLIGSGGMPSSHSATVTALAVAIGIKDG  84

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F V   F+++VMYDA GVR HAG QA+VLN IV +L   HP+S  R L+ELLGHT
Sbjct  85   FGSSTFAVAAIFAIVVMYDAFGVRLHAGRQAEVLNQIVIELPAEHPLSDTRPLRELLGHT  144

Query  308  PSQVI  294
            P+QV+
Sbjct  145  PAQVV  149



>ref|XP_002514991.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47545.1| conserved hypothetical protein [Ricinus communis]
Length=178

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQS+KVF  +  ER+WDF+ +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  30   NYPLLSALVAFAIAQSTKVFTSWYKERRWDFKQLVGSGGMPSSHSATVTALAIAIGLQEG  89

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF   L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  90   FGGSLFAAALILACVVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  149

Query  308  PSQVI  294
            P QVI
Sbjct  150  PPQVI  154



>ref|XP_004135303.1| PREDICTED: uncharacterized membrane protein YuiD-like [Cucumis 
sativus]
 ref|XP_004159671.1| PREDICTED: uncharacterized membrane protein YuiD-like [Cucumis 
sativus]
 gb|KGN51694.1| hypothetical protein Csa_5G590110 [Cucumis sativus]
Length=176

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (64%), Gaps = 9/151 (6%)
 Frame = -1

Query  719  ITATAGVKI--------SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMM  564
            +TA++G  I        S F +T+  N   +S LLA+ +AQS K F  +  ER+WDF+ +
Sbjct  4    VTASSGSLINGPPSHTPSSFSSTIFTNYPLISALLAFAIAQSIKFFTSWYKERRWDFKKL  63

Query  563  CASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVL  384
              SGGMPSSHS+  +AL  ++ L  G   S+F V L  + +VMYDA GVR  AG QA+VL
Sbjct  64   VGSGGMPSSHSSTVSALAIAIGLQEGFGASVFAVALILACVVMYDATGVRLQAGRQAEVL  123

Query  383  NLIVEDLFKWHPMSQ-RKLKELLGHTPSQVI  294
            N IV +L   HP+++ R L+ELLGHTP QV+
Sbjct  124  NQIVYELPAEHPLAESRPLRELLGHTPPQVV  154



>gb|AFK35217.1| unknown [Lotus japonicus]
Length=169

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -1

Query  734  MALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCAS  555
            MA++  T  A +  S   + ++ N   +S L+A+ +AQ  K F  +  ER+WD + + AS
Sbjct  1    MAMMGETEVAAMHSSTSFSLISVNYPLISALVAFALAQGIKFFTTWFKERRWDMKQLVAS  60

Query  554  GGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLI  375
            GGMPSSHSA+ TAL A++    G    LF + L  + IVMYDA GVR  AG QA+VLN I
Sbjct  61   GGMPSSHSAVVTALAAAIGFQEGFGGPLFAIALVLACIVMYDATGVRLQAGRQAEVLNQI  120

Query  374  VEDLFKWHPMSQRK-LKELLGHTPSQVI  294
            V +L   HP+++ K L+ELLGHTP QVI
Sbjct  121  VYELPAEHPLAESKPLRELLGHTPLQVI  148



>ref|XP_009359319.1| PREDICTED: uncharacterized protein LOC103949904 [Pyrus x bretschneideri]
Length=163

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQ  KVF  +  ER+WDF+ +  SGGMPSSHSA  TA+  +V    G
Sbjct  15   NYPLLSALVAFSIAQFIKVFTSWYKERRWDFKQLLGSGGMPSSHSATVTAIATAVGFQEG  74

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            +  SLF + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  75   IGGSLFAIVLVLACVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  134

Query  308  PSQVI  294
            P QV+
Sbjct  135  PLQVV  139



>ref|XP_005850480.1| hypothetical protein CHLNCDRAFT_13680, partial [Chlorella variabilis]
 gb|EFN58378.1| hypothetical protein CHLNCDRAFT_13680, partial [Chlorella variabilis]
Length=140

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 80/124 (65%), Gaps = 2/124 (2%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N  FV+  L +  AQS+KVF  +  E+KWDF  + +SGGMPSSH+ L   LT ++ +  G
Sbjct  2    NGAFVAAFLGFFFAQSAKVFTHYYTEQKWDFTRLVSSGGMPSSHTGLVMGLTTAIGVLEG  61

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR--KLKELLGH  312
                +F + L FSLIVMYDA GVR HAG QA VLN+I+ +L   HP+S     LK+ LGH
Sbjct  62   TNSPMFAIALVFSLIVMYDASGVRLHAGKQASVLNMIITELPPDHPVSNSAGTLKDTLGH  121

Query  311  TPSQ  300
            TP Q
Sbjct  122  TPLQ  125



>ref|XP_006584600.1| PREDICTED: uncharacterized protein LOC100812255 isoform X2 [Glycine 
max]
 gb|KHN12406.1| Putative membrane protein yuiD [Glycine soja]
Length=155

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            +++ +N   +S ++A+ +AQS K F  +  +R+WD + +  SGGMPSSHSA  TAL A++
Sbjct  6    SSITSNYPLISAIVAFALAQSIKFFTTWFKDRRWDLKQLVGSGGMPSSHSATVTALAAAI  65

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKE  324
             L  G    LF   L F+ IVMYDA GVR  AG QA+VLN IV +L   HP+++ R L+E
Sbjct  66   GLQEGFGGPLFATALVFACIVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRE  125

Query  323  LLGHTPSQVI  294
            LLGHTP QVI
Sbjct  126  LLGHTPPQVI  135



>ref|XP_008446080.1| PREDICTED: uncharacterized protein LOC103488911 isoform X1 [Cucumis 
melo]
Length=190

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 95/151 (63%), Gaps = 9/151 (6%)
 Frame = -1

Query  722  SITATAGVKI--------SPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRM  567
             +TA++G  I        S F +T+  N   +S LLA+ +AQS K F  +  ER+WDF+ 
Sbjct  3    DVTASSGSLINGPPSHTPSSFSSTIFTNYPLISALLAFAIAQSIKFFTSWYKERRWDFKK  62

Query  566  MCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQV  387
            +  SGGMPSSHS+  +AL  ++ L  G   S+F V L  + +VMYDA GVR  AG QA+V
Sbjct  63   LVGSGGMPSSHSSTVSALAIAIGLQEGFGASVFAVALILACVVMYDATGVRLQAGRQAEV  122

Query  386  LNLIVEDLFKWHPMSQ-RKLKELLGHTPSQV  297
            LN IV +L   HP+++ R L+ELLGHTP QV
Sbjct  123  LNQIVYELPAEHPLAESRPLRELLGHTPPQV  153



>ref|XP_004972960.1| PREDICTED: uncharacterized protein LOC101763832 [Setaria italica]
Length=174

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   V+ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  +V L  
Sbjct  28   SNCPLVAAVLAFAIAQSIKVFTTWYKENRWDAKQLIGSGGMPSSHSATVTALAVAVGLQE  87

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G A SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGH
Sbjct  88   GFASSLFATAAVFASVVMYDAFGVRLHAGKQAEVLNQIVYELPSEHPLAETRPLRELLGH  147

Query  311  TPSQV  297
            TP QV
Sbjct  148  TPPQV  152



>ref|XP_002888611.1| hypothetical protein ARALYDRAFT_315776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64870.1| hypothetical protein ARALYDRAFT_315776 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S LLA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NFPLISSLLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  78   FGGSHFAIALVLTTIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  137

Query  308  PSQVI  294
            P QVI
Sbjct  138  PPQVI  142



>ref|NP_176927.1| acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
 gb|AAG28897.1|AC008113_13 F12A21.27 [Arabidopsis thaliana]
 gb|AAM63870.1| unknown [Arabidopsis thaliana]
 gb|ABD65596.1| At1g67600 [Arabidopsis thaliana]
 gb|AEE34670.1| acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
Length=163

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NYPLISAVLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  78   FGGSHFAIALVLTTIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAETRPLRELLGHT  137

Query  308  PSQVI  294
            P QVI
Sbjct  138  PPQVI  142



>ref|XP_002443801.1| hypothetical protein SORBIDRAFT_07g002280 [Sorghum bicolor]
 gb|EES13296.1| hypothetical protein SORBIDRAFT_07g002280 [Sorghum bicolor]
Length=174

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  656  FVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVAD  477
             V+ +LA+ +AQS KV   +  E +WD + +  SGGMPSSHSA  TAL  +V L  G A 
Sbjct  32   LVAAVLAFAIAQSIKVLTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAVGLQEGFAS  91

Query  476  SLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHTPSQ  300
            SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHTP Q
Sbjct  92   SLFATAAVFASVVMYDAFGVRLHAGKQAEVLNQIVYELPSEHPLAETRPLRELLGHTPQQ  151

Query  299  V  297
            V
Sbjct  152  V  152



>ref|XP_009109836.1| PREDICTED: uncharacterized protein LOC103835422 [Brassica rapa]
Length=164

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  677  TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
            T+  N   +S L A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ 
Sbjct  14   TIFTNYPLISSLTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIG  73

Query  497  LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKEL  321
            L  G   S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL
Sbjct  74   LQEGFGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLREL  133

Query  320  LGHTPSQVI  294
            LGHTP QVI
Sbjct  134  LGHTPPQVI  142



>gb|KFK44497.1| hypothetical protein AALP_AA1G264800 [Arabis alpina]
Length=166

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 90/142 (63%), Gaps = 3/142 (2%)
 Frame = -1

Query  716  TATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSS  537
            TATA      F  ++  N   +S + A+ +AQ  K+F  +  ER+WD + +  SGGMPSS
Sbjct  5    TATATSSTHYF--SIFTNYPLISAITAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSS  62

Query  536  HSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFK  357
            HS+  TAL  ++ L  G   S F + L  + +VMYDA GVR HAG QA+VLN IV +L  
Sbjct  63   HSSTVTALAVAIGLQEGFGGSHFAISLVLASVVMYDATGVRLHAGRQAEVLNQIVYELPA  122

Query  356  WHPMSQRK-LKELLGHTPSQVI  294
             HP+++ K L+ELLGHTPSQV+
Sbjct  123  EHPLAESKPLRELLGHTPSQVV  144



>ref|WP_021621025.1| divergent PAP2 family protein [Aneurinibacillus aneurinilyticus]
 gb|ERI09614.1| divergent PAP2 family protein [Aneurinibacillus aneurinilyticus 
ATCC 12856]
Length=160

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 11/141 (8%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            ++ L +N    S LLA  +AQ  KV + F   RKWD+R+M ++GGMPSSHSA  TALT +
Sbjct  1    MSDLLSNFPLWSALLAIGIAQGIKVPITFFALRKWDWRLMFSTGGMPSSHSAAVTALTTA  60

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL---------FKWH  351
            V L  G   + F +C+ FS+I+M+DA GVRRHAG  A +LN+++ED           +  
Sbjct  61   VGLVEGFGSTYFAICVIFSIIIMFDAAGVRRHAGTHAAILNILLEDFNQLIDELKSMRVK  120

Query  350  PMSQR--KLKELLGHTPSQVI  294
            P  +R  KLKELLGH PS+V+
Sbjct  121  PRRERAKKLKELLGHQPSEVL  141



>emb|CDY36142.1| BnaA08g19060D [Brassica napus]
Length=167

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/129 (50%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  677  TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
            T+  N   +S L A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ 
Sbjct  17   TIFTNYPLISSLTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIG  76

Query  497  LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKEL  321
            L  G   S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL
Sbjct  77   LQEGFGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLREL  136

Query  320  LGHTPSQVI  294
            LGHTP QVI
Sbjct  137  LGHTPPQVI  145



>ref|XP_008389817.1| PREDICTED: uncharacterized protein LOC103452109 [Malus domestica]
 ref|XP_008389818.1| PREDICTED: uncharacterized protein LOC103452109 [Malus domestica]
Length=163

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S ++A+ +AQS K F  +  ER+WDF+ +  SGGMPSSHSA  TA+  ++    G
Sbjct  15   NYPLLSAVVAFSIAQSIKFFTSWYKERRWDFKQLLGSGGMPSSHSATVTAIATAIGFQEG  74

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            V  SLF + L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  75   VGGSLFAIALILACVVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  134

Query  308  PSQVI  294
            P QV+
Sbjct  135  PPQVV  139



>gb|AAG52298.1|AC011020_5 unknown protein [Arabidopsis thaliana]
Length=143

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NYPLISAVLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  78   FGGSHFAIALVLTTIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAETRPLRELLGHT  137

Query  308  PSQV  297
            P QV
Sbjct  138  PPQV  141



>emb|CDY54828.1| BnaC03g75800D [Brassica napus]
Length=166

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  677  TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
            T+  N   +S L A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ 
Sbjct  16   TIFTNYPLISSLTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIG  75

Query  497  LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKEL  321
            L  G   S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL
Sbjct  76   LQEGFGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLREL  135

Query  320  LGHTPSQVI  294
            LGHTP QV+
Sbjct  136  LGHTPPQVV  144



>ref|XP_009393775.1| PREDICTED: uncharacterized protein LOC103979374 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=150

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQS KVF  +  ER+WD + +  SGGMPSSHSA  TAL  ++ +  G
Sbjct  27   NYPLISAILAFAIAQSIKVFTTWYKERRWDAKQLIGSGGMPSSHSATVTALAVAIGIQDG  86

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            +  S F     F+ +VMYDA GVR HAG QA+VLN IV  L + HP++  R L ELLGHT
Sbjct  87   LGSSAFATATMFASVVMYDAFGVRLHAGKQAEVLNQIVYQLPEEHPLADTRPLHELLGHT  146

Query  308  PSQV  297
            P QV
Sbjct  147  PLQV  150



>ref|XP_003580012.1| PREDICTED: uncharacterized protein LOC100829864 [Brachypodium 
distachyon]
Length=152

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+GLLA+ VAQS+K F  +  E++WD R   ASGGMPSSHSA  TAL  SV +  G
Sbjct  7    NYPLVAGLLAFAVAQSTKFFTTWYKEKRWDARQFIASGGMPSSHSATVTALAVSVGIQEG  66

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               + F   + F+ +VM+DA GVR HAG QA+VLN IV +L   HP+S+ K L+E+LGHT
Sbjct  67   FRSATFATAMIFACVVMHDAFGVRLHAGKQAEVLNQIVYELPLEHPLSETKPLREILGHT  126

Query  308  PSQVI  294
              QV+
Sbjct  127  VPQVV  131



>ref|XP_006415796.1| hypothetical protein EUTSA_v10008942mg [Eutrema salsugineum]
 gb|ESQ34149.1| hypothetical protein EUTSA_v10008942mg [Eutrema salsugineum]
Length=166

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 1/140 (1%)
 Frame = -1

Query  710  TAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHS  531
            TA  + S    ++  N   +S ++A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHS
Sbjct  5    TATARSSTHYFSIFTNYPLISAVMAFTIAQFIKLFTSWYRERRWDLKQLVGSGGMPSSHS  64

Query  530  ALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWH  351
            A  TAL  ++ L  G   S F + L  + +VMYDA GVR H G QA+VLN IV +L   H
Sbjct  65   ATVTALAVAIGLQEGFGGSHFAIALILASVVMYDATGVRLHVGRQAEVLNQIVYELPAEH  124

Query  350  PMSQ-RKLKELLGHTPSQVI  294
            P+++ R L+ELLGHTP QVI
Sbjct  125  PLAESRPLRELLGHTPPQVI  144



>ref|WP_039767780.1| membrane protein [Caldicellulosiruptor sp. F32]
Length=148

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +  +  N     G ++W +AQ  K+ + F V  + DFR   +SGGMPSSHSA    L+ +
Sbjct  5    IYEIVTNKALQVGFVSWFIAQCLKIIITFFVSHQIDFRKFISSGGMPSSHSAFACGLSTA  64

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKE  324
            V    G + + F + L F+LIVMYDA GVRR AG QAQ LN ++E  F  H   Q KLKE
Sbjct  65   VGFIDGFSSTSFAISLTFTLIVMYDAAGVRREAGKQAQTLNELIEMYFSPHYKPQHKLKE  124

Query  323  LLGHTPSQV  297
            L+GH P++V
Sbjct  125  LIGHKPTEV  133



>ref|XP_009392613.1| PREDICTED: uncharacterized protein LOC103978515 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S ++++ VAQS K F+ +  ER+WD +++  SGGMPSSHSA  TAL A++ +  G
Sbjct  25   NYPLISAIVSFAVAQSIKFFMTWYRERRWDAKLLIGSGGMPSSHSATVTALAAAIGIQDG  84

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            +  S+F     F+ +VM+DA GVR HAG QA+VLN IV +L   HP+S  R L+EL+GHT
Sbjct  85   LGSSIFAAATIFASVVMHDAFGVRLHAGKQAEVLNQIVYELPADHPLSDTRPLRELIGHT  144

Query  308  PSQVI  294
            P QV+
Sbjct  145  PLQVV  149



>ref|NP_001150731.1| acid phosphatase/vanadium-dependent haloperoxidase related [Zea 
mays]
 gb|ACG40147.1| acid phosphatase/vanadium-dependent haloperoxidase related [Zea 
mays]
 gb|AFW74429.1| acid phosphatase/vanadium-dependent haloperoxidase protein [Zea 
mays]
Length=172

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   V+ +LA+ +AQS KV   +  E +WD + +  SGGMPSSHSA  TAL  +V L  
Sbjct  26   SNCPLVAAVLAFAIAQSIKVLTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAVGLQE  85

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G A SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGH
Sbjct  86   GFASSLFATTAVFASVVMYDAFGVRLHAGKQAEVLNQIVYELPSEHPLAETRPLRELLGH  145

Query  311  TPSQV  297
            TP QV
Sbjct  146  TPPQV  150



>ref|XP_009393774.1| PREDICTED: uncharacterized protein LOC103979374 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=174

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQS KVF  +  ER+WD + +  SGGMPSSHSA  TAL  ++ +  G
Sbjct  27   NYPLISAILAFAIAQSIKVFTTWYKERRWDAKQLIGSGGMPSSHSATVTALAVAIGIQDG  86

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            +  S F     F+ +VMYDA GVR HAG QA+VLN IV  L + HP++  R L ELLGHT
Sbjct  87   LGSSAFATATMFASVVMYDAFGVRLHAGKQAEVLNQIVYQLPEEHPLADTRPLHELLGHT  146

Query  308  PSQV  297
            P QV
Sbjct  147  PLQV  150



>ref|XP_006304265.1| hypothetical protein CARUB_v10010495mg [Capsella rubella]
 gb|EOA37163.1| hypothetical protein CARUB_v10010495mg [Capsella rubella]
Length=166

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  20   NYPLISAVTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  79

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  80   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLSESRPLRELLGHT  139

Query  308  PSQVI  294
            P QV+
Sbjct  140  PPQVV  144



>ref|XP_010926594.1| PREDICTED: uncharacterized protein LOC105048831 isoform X2 [Elaeis 
guineensis]
Length=178

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ VAQS+K+   +  E++WD + +  SGGMPSSHSA  TAL A++    G
Sbjct  22   NYPLISALVAFAVAQSAKLLTTWYKEKRWDAKQLIGSGGMPSSHSATVTALAAAIGFQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
             A S F   L  + IVMYDA GVR HAG QA+VLN IV +L   HP++  R L+ELLGHT
Sbjct  82   FAGSTFATALILACIVMYDAFGVRLHAGRQAEVLNQIVYELPAEHPLADTRPLRELLGHT  141

Query  308  PSQV  297
            P QV
Sbjct  142  PPQV  145



>ref|XP_011071195.1| PREDICTED: uncharacterized protein LOC105156684 [Sesamum indicum]
Length=185

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQS+K    +  E++WD + +  SGGMPSSHS+  TAL  +V L  G
Sbjct  38   NYPLISAILAFAIAQSTKFVASWYKEKRWDLKQLVGSGGMPSSHSSTVTALAVAVGLQEG  97

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  +L+VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  98   FGGSQFAIALVLALVVMYDATGVRLHAGRQAEVLNQIVCELPAEHPLAESRPLRELLGHT  157

Query  308  PSQVI  294
            P QV+
Sbjct  158  PPQVV  162



>emb|CEF97148.1| Acid phosphatase/vanadium-dependent haloperoxidase-related [Ostreococcus 
tauri]
Length=161

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            + ++P  V+ LL++ +AQ +KVF  +    K D+  +  SGGMPSSH+AL   L  S+ L
Sbjct  11   VVSSPALVAALLSFSIAQIAKVFTHYHATGKIDYTRVVGSGGMPSSHTALVVGLCTSIGL  70

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELL  318
              G++ S+F +CL FSL+VMYDA GVR HAG QA+VLN ++ +L + HP++  R L++ L
Sbjct  71   KEGMSSSIFALCLVFSLVVMYDATGVRLHAGRQAEVLNQLIVELPRDHPLTDSRPLRDTL  130

Query  317  GHTPSQVI  294
            GHTP QV+
Sbjct  131  GHTPIQVV  138



>ref|WP_025746508.1| hypothetical protein [Caldicoprobacter oshimai]
Length=147

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 78/127 (61%), Gaps = 0/127 (0%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            LAAN       LAW +AQ+SKV L     +K D R    SGGMPSSH+AL  +L  ++  
Sbjct  7    LAANSVLWVSFLAWFIAQASKVVLTVLTHKKLDLRRFVGSGGMPSSHTALVVSLATALGE  66

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLG  315
             +G    +F + L F+ +VMYDA GVRR AG QA VLN IVE L +   + Q KLKE +G
Sbjct  67   INGYDSYIFALSLVFAFVVMYDAAGVRRAAGKQAAVLNEIVERLQEGKDVPQEKLKEFIG  126

Query  314  HTPSQVI  294
            HTP +VI
Sbjct  127  HTPIEVI  133



>ref|XP_003078206.1| unnamed protein product [Ostreococcus tauri]
Length=211

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/136 (46%), Positives = 92/136 (68%), Gaps = 2/136 (1%)
 Frame = -1

Query  698  KISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCT  519
            KIS  +  + ++P  V+ LL++ +AQ +KVF  +    K D+  +  SGGMPSSH+AL  
Sbjct  54   KIS-HIPAVVSSPALVAALLSFSIAQIAKVFTHYHATGKIDYTRVVGSGGMPSSHTALVV  112

Query  518  ALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ  339
             L  S+ L  G++ S+F +CL FSL+VMYDA GVR HAG QA+VLN ++ +L + HP++ 
Sbjct  113  GLCTSIGLKEGMSSSIFALCLVFSLVVMYDATGVRLHAGRQAEVLNQLIVELPRDHPLTD  172

Query  338  -RKLKELLGHTPSQVI  294
             R L++ LGHTP QV+
Sbjct  173  SRPLRDTLGHTPIQVV  188



>ref|XP_004976017.1| PREDICTED: uncharacterized protein LOC101774394 [Setaria italica]
Length=156

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LLA+ +AQSSKVF  +  + +WD R   ASGGMPSSHSA  TAL  +V +  G
Sbjct  12   NYPLVAALLAFAIAQSSKVFTTWYKDNRWDARQFIASGGMPSSHSATVTALAVAVGIQEG  71

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               + F   L F+ +VM+DA GVR HAG QA+VLN IV +L + HP+S+ K L+E+LGHT
Sbjct  72   FRSATFATALVFACVVMHDAFGVRLHAGKQAEVLNQIVYELPQEHPLSETKPLREILGHT  131

Query  308  PSQVI  294
              QV+
Sbjct  132  VPQVV  136



>ref|XP_006367507.1| PREDICTED: uncharacterized protein LOC102588354 [Solanum tuberosum]
Length=175

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQS+K+F  +  ER+WD + +  SGGMPSSHS+  TAL  +V L  G
Sbjct  28   NYPLMSALIAFALAQSTKLFTSWYKERRWDLKQLVGSGGMPSSHSSTVTALAVAVGLQEG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF   L  + +VMYDA GVR HAG QA+VLN I+ +L   HP++  R L+ELLGHT
Sbjct  88   FGGALFACALVLACVVMYDATGVRLHAGRQAEVLNQILYELPSEHPLADSRPLRELLGHT  147

Query  308  PSQVI  294
            P QV+
Sbjct  148  PPQVV  152



>ref|XP_004310049.1| PREDICTED: uncharacterized membrane protein YuiD-like [Fragaria 
vesca subsp. vesca]
Length=166

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TA+  ++    G
Sbjct  19   NYPLLSALIAFALAQFIKLFTTWYKERRWDIKQLIGSGGMPSSHSATVTAIATAIGFQEG  78

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
            V  SLF + L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  79   VGGSLFAIALVLACVVMYDATGVRLQAGRQAEVLNQIVYELPSEHPLAESRPLRELLGHT  138

Query  308  PSQVI  294
            P QVI
Sbjct  139  PPQVI  143



>ref|XP_007158710.1| hypothetical protein PHAVU_002G175900g [Phaseolus vulgaris]
 gb|ESW30704.1| hypothetical protein PHAVU_002G175900g [Phaseolus vulgaris]
Length=152

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 86/130 (66%), Gaps = 1/130 (1%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            +++++N   +S  +A+ +AQS K F  +  ER+WD + +  SGGMPSSHSA  +AL A++
Sbjct  3    SSISSNYPLISAFVAFALAQSIKFFTTWFKERRWDLKQLVGSGGMPSSHSATVSALAAAI  62

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKE  324
                G+   LF   L F+  VMYDA GVR  AG QA+VLN IV +L   HP+++   L+E
Sbjct  63   GFQEGLEGPLFATSLVFACTVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESIPLRE  122

Query  323  LLGHTPSQVI  294
            LLGHTPSQVI
Sbjct  123  LLGHTPSQVI  132



>emb|CDY12658.1| BnaA02g13260D [Brassica napus]
Length=170

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  25   NYPLLSAVLAFTIAQFIKFFTTWYKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  84

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF +    + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  85   FGGSLFAMAFILTSIVMYDATGVRLHAGRQAEVLNQIVYELPSEHPLAESRPLRELLGHT  144

Query  308  PSQVI  294
            P QVI
Sbjct  145  PPQVI  149



>ref|WP_013403329.1| acid phosphatase [Caldicellulosiruptor hydrothermalis]
 ref|YP_003992526.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor hydrothermalis 108]
 gb|ADQ07157.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor hydrothermalis 108]
Length=148

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N     G+++W  AQ  K+ + F + RK D +   +SGGMPSSHSA  + L+ +V L  G
Sbjct  11   NKALEVGVVSWFAAQFLKIVIAFIITRKVDLKWFISSGGMPSSHSAFASGLSTAVGLIDG  70

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTP  306
             + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q KLKEL+GH P
Sbjct  71   FSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEMYLSPHYKPQYKLKELIGHKP  130

Query  305  SQV  297
            ++V
Sbjct  131  TEV  133



>ref|XP_002269103.1| PREDICTED: uncharacterized protein LOC100252740 [Vitis vinifera]
Length=173

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   ++ LL++++AQ+ KVF  +  +R+WD + +  SGGMPSSHSA  TAL A++ L  
Sbjct  25   SNYPLLAALLSFILAQTIKVFTSWYRDRRWDLKQLVGSGGMPSSHSATVTALAAAIGLQE  84

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGH  312
            G   S+F + L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++   L+ELLGH
Sbjct  85   GFGGSMFAISLVIACVVMYDAFGVRLQAGRQAEVLNQIVYELPAEHPLAESIPLRELLGH  144

Query  311  TPSQVI  294
            TP QVI
Sbjct  145  TPPQVI  150



>emb|CBI27561.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   ++ LL++++AQ+ KVF  +  +R+WD + +  SGGMPSSHSA  TAL A++ L  
Sbjct  24   SNYPLLAALLSFILAQTIKVFTSWYRDRRWDLKQLVGSGGMPSSHSATVTALAAAIGLQE  83

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGH  312
            G   S+F + L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++   L+ELLGH
Sbjct  84   GFGGSMFAISLVIACVVMYDAFGVRLQAGRQAEVLNQIVYELPAEHPLAESIPLRELLGH  143

Query  311  TPSQVI  294
            TP QVI
Sbjct  144  TPPQVI  149



>ref|WP_024049226.1| Acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Negativicoccus succinicivorans]
 gb|ETI84678.1| Acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Negativicoccus succinicivorans DORA_17_25]
Length=151

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
            ++  +A+N  F+S   AWL+AQ  KV L      ++D   +  SGGMPSSHSAL  AL  
Sbjct  4    YIRDIASNVVFLSAFSAWLIAQVIKVILFLVKHHRFDVERLVGSGGMPSSHSALVVALCC  63

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLK  327
            S+ +  G++ +LF +   F+ IVMYDA GVRR AG QA+ LN ++ +    HP +  K K
Sbjct  64   SIGIQEGISSNLFALAFFFATIVMYDAAGVRRAAGKQAKFLNELIHEFMAGHPFNDVKFK  123

Query  326  ELLGHTPSQV  297
            ELLGHTP +V
Sbjct  124  ELLGHTPLEV  133



>ref|WP_011917370.1| acid phosphatase [Caldicellulosiruptor saccharolyticus]
 ref|YP_001180627.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor saccharolyticus DSM 8903]
 gb|ABP67436.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor saccharolyticus DSM 8903]
Length=148

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +  +  N     G ++W VAQ  K+ + F +  + DF+   +SGGMPSSHSA    L+ +
Sbjct  5    IYEIVTNKALQVGFVSWFVAQCLKIIITFFMTHQIDFKKFISSGGMPSSHSAFACGLSTA  64

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKE  324
            V L  G + + F + L F+LIVMYDA GVRR AG QAQ LN ++E  F  H   Q KLKE
Sbjct  65   VGLIDGFSSTSFAISLTFTLIVMYDAAGVRREAGKQAQTLNELIEMYFSPHYKPQYKLKE  124

Query  323  LLGHTPSQV  297
            L+GH P++V
Sbjct  125  LIGHKPTEV  133



>dbj|BAJ96572.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = -1

Query  653  VSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADS  474
            ++ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  ++ L  G + S
Sbjct  30   IAAVLAFAIAQSIKVFTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAIGLQEGFSSS  89

Query  473  LFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHTPSQV  297
            LF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GHTP QV
Sbjct  90   LFATAAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGHTPPQV  149



>ref|XP_009783343.1| PREDICTED: uncharacterized protein LOC104231958 [Nicotiana sylvestris]
Length=175

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQS K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  28   NYPLMSALIAFALAQSIKLFTSWYKERRWDLKQLVGSGGMPSSHSATVTALAVAIGLQEG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
              ++LF   L  + +VMYDA GVR HAG QA+VLN I+ +L   HP++  R L+ELLGHT
Sbjct  88   FGEALFACALVLACVVMYDATGVRLHAGRQAEVLNQILYELPSEHPLADSRPLRELLGHT  147

Query  308  PSQVI  294
            P QV+
Sbjct  148  PPQVV  152



>ref|WP_034436167.1| hypothetical protein [Clostridiales bacterium S5-A11]
 gb|KGF12589.1| hypothetical protein HMPREF1633_00685 [Clostridiales bacterium 
S5-A11]
Length=151

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 81/130 (62%), Gaps = 0/130 (0%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
            ++  +A+N  F+S   AWL+AQ  KV L      ++D   +  SGGMPSSHSAL  AL  
Sbjct  4    YIRDIASNVVFLSAFSAWLIAQVIKVILFLVKHHRFDVERLVGSGGMPSSHSALVVALCC  63

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLK  327
            S+ +  G++ +LF +   F+ IVMYDA GVRR AG QA+ LN ++ +    HP +  K K
Sbjct  64   SIGIQEGISSNLFALAFFFATIVMYDAAGVRRAAGKQAKFLNELIHEFMAGHPFNDVKFK  123

Query  326  ELLGHTPSQV  297
            ELLGHTP +V
Sbjct  124  ELLGHTPLEV  133



>ref|XP_002947271.1| hypothetical protein VOLCADRAFT_79562 [Volvox carteri f. nagariensis]
 gb|EFJ51861.1| hypothetical protein VOLCADRAFT_79562 [Volvox carteri f. nagariensis]
Length=253

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 87/130 (67%), Gaps = 1/130 (1%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
            ++  L  N   VS ++A+ +AQ SKVF  +  E+ WD+  + +SGGMPSSH+AL  ALT 
Sbjct  28   WIVGLFVNGALVSAIVAFFIAQLSKVFTHYYREQVWDWTRLVSSGGMPSSHTALIIALTT  87

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KL  330
            +VA+  G   SLF +CL  SLIVMYDA GVR HAG QA VLN+I+ ++   HP+    +L
Sbjct  88   AVAVQDGTDSSLFAMCLVISLIVMYDATGVRLHAGRQATVLNIIIAEMPPDHPVQDSGRL  147

Query  329  KELLGHTPSQ  300
            ++ LGHTP Q
Sbjct  148  RDSLGHTPVQ  157



>ref|XP_006584599.1| PREDICTED: uncharacterized protein LOC100812255 isoform X1 [Glycine 
max]
Length=159

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 88/134 (66%), Gaps = 5/134 (4%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCV----ERKWDFRMMCASGGMPSSHSALCTAL  513
            +++ +N   +S ++A+ +AQS K F  + +    +R+WD + +  SGGMPSSHSA  TAL
Sbjct  6    SSITSNYPLISAIVAFALAQSIKFFTTWLICRFKDRRWDLKQLVGSGGMPSSHSATVTAL  65

Query  512  TASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-R  336
             A++ L  G    LF   L F+ IVMYDA GVR  AG QA+VLN IV +L   HP+++ R
Sbjct  66   AAAIGLQEGFGGPLFATALVFACIVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESR  125

Query  335  KLKELLGHTPSQVI  294
             L+ELLGHTP QVI
Sbjct  126  PLRELLGHTPPQVI  139



>ref|XP_010531343.1| PREDICTED: uncharacterized protein LOC104807658 isoform X1 [Tarenaya 
hassleriana]
Length=166

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + A+ +AQS K F  +  ER+WD +++  SGGMPS+HSA  TAL  ++ L +G
Sbjct  20   NYPLISAVAAFAIAQSIKFFTSWYRERRWDLKLLVGSGGMPSAHSATVTALAVAIGLQNG  79

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F +    + IVMYDA GVR HAG QA+VLN IV  L   HP+++R+ L ELLGHT
Sbjct  80   FGGSHFALAFIMASIVMYDATGVRLHAGRQAEVLNQIVYQLPAEHPLAERRPLHELLGHT  139

Query  308  PSQVI  294
            P QVI
Sbjct  140  PPQVI  144



>ref|XP_011041553.1| PREDICTED: uncharacterized protein LOC105137493 [Populus euphratica]
Length=177

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  LA+ +AQS K F  +  ER+WD + +  SGGMPSSHSA   AL  +V    G
Sbjct  29   NYPLISAFLAFAIAQSIKFFTSWYKERRWDLKQLVGSGGMPSSHSATVAALAMAVGFQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF + L  + +VMYDA GVR  AG QA+VLN I+ +L   HP+S+ R L+ELLGHT
Sbjct  89   FGGSLFSIALILACVVMYDATGVRLQAGRQAEVLNQILYELPAEHPLSESRPLRELLGHT  148

Query  308  PSQVI  294
            P QVI
Sbjct  149  PPQVI  153



>ref|XP_010478026.1| PREDICTED: uncharacterized protein LOC104757034 [Camelina sativa]
Length=163

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  T+L  ++ L  G
Sbjct  17   NYPLISALTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTSLAVAIGLQEG  76

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  77   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  136

Query  308  PSQVI  294
            P QV+
Sbjct  137  PPQVV  141



>gb|EYU25931.1| hypothetical protein MIMGU_mgv1a019225mg [Erythranthe guttata]
Length=170

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            AN   +S L+A+ +AQ++K    +  E +WD + +  SGGMPSSHSA  TAL+ +V L +
Sbjct  20   ANYPLMSALVAFAIAQATKFLSSWYKENRWDLKQLVGSGGMPSSHSATVTALSVAVGLQN  79

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G   S F + L  + +VMYDA GVR HAG QA+VLN I+ +L   HP+++ R L+ELLGH
Sbjct  80   GFGGSAFAIALVLAFVVMYDATGVRLHAGRQAEVLNQILCELPAEHPLAESRPLRELLGH  139

Query  311  TPSQVI  294
            TP+QV+
Sbjct  140  TPTQVV  145



>ref|XP_001699970.1| vanadium-dependent haloperoxidase-like protein [Chlamydomonas 
reinhardtii]
 gb|EDP07666.1| vanadium-dependent haloperoxidase-like protein [Chlamydomonas 
reinhardtii]
Length=199

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   VS  +A+ +AQ+ KVF  +  E+ WD + M  SGGMPSSH+AL  ALT +V + +G
Sbjct  45   NGCLVSAFIAFFIAQTCKVFTHYYTEQVWDLQRMVGSGGMPSSHTALIVALTTAVGVENG  104

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
             + +LF  CL  +LIVMYDA GVR HAG QA VLN+I+ ++   HP+    +L++ LGHT
Sbjct  105  TSSTLFAACLVLALIVMYDATGVRLHAGRQATVLNIIIAEMPPDHPVQDGGRLRDSLGHT  164

Query  308  PSQ  300
            P Q
Sbjct  165  PIQ  167



>dbj|BAK00335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
             N   ++ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  ++ L  
Sbjct  25   GNCPLIAAVLAFAIAQSIKVFTTWYKEDRWDAKQLVGSGGMPSSHSATVTALAVAIGLQE  84

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G + SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GH
Sbjct  85   GFSSSLFATAAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGH  144

Query  311  TPSQV  297
            TP QV
Sbjct  145  TPPQV  149



>ref|XP_009778706.1| PREDICTED: uncharacterized protein LOC104228020 [Nicotiana sylvestris]
Length=188

 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 10/151 (7%)
 Frame = -1

Query  725  LSITATAGVKISPFVATLAANPTF------VSGLLAWLVAQSSKVFLKFCVERKWDFRMM  564
            ++I+AT    I   V+  A+N +F      VS LLA+ +AQS+K+F  +  ER WD + +
Sbjct  18   INISATTTTTI---VSNYASNSSFLTNYPLVSALLAFALAQSAKLFTSWYKERHWDLKQL  74

Query  563  CASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVL  384
              SGGMPSSH++  TAL  +V L  G   SLF   L  + +VMYDA GVR  AG QA+VL
Sbjct  75   VGSGGMPSSHTSTVTALATAVGLQEGFGGSLFATALVLACVVMYDATGVRLQAGRQAEVL  134

Query  383  NLIVEDLFKWHPMSQR-KLKELLGHTPSQVI  294
            N IV +L   HP++    L+ELLGHTP QV+
Sbjct  135  NQIVCELPAGHPLADSIPLRELLGHTPPQVV  165



>ref|XP_006302908.1| hypothetical protein CARUB_v10021043mg [Capsella rubella]
 gb|EOA35806.1| hypothetical protein CARUB_v10021043mg [Capsella rubella]
Length=171

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S LLA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  24   NFPLISALLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALALAVGLQEG  83

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  84   FGGSHFAIALVLTAIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHT  143

Query  308  PSQVI  294
            P QVI
Sbjct  144  PPQVI  148



>ref|XP_001416961.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95254.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=161

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            + ++P  ++ LL++ +AQ +KVF  +    K D+  +  SGGMPSSH+AL   L  S+ L
Sbjct  11   VVSSPALIAALLSFSIAQIAKVFTHYHATGKVDYSRIVGSGGMPSSHTALVVGLCTSIGL  70

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELL  318
              G+  S+F +CL FSL+VMYDA GVR HAG QA+VLN ++ +L + HP++  R L++ L
Sbjct  71   KEGMQSSIFALCLVFSLVVMYDATGVRLHAGRQAEVLNQLIVELPRDHPLTDSRPLRDTL  130

Query  317  GHTPSQVI  294
            GHTP QV+
Sbjct  131  GHTPIQVV  138



>ref|XP_003573329.1| PREDICTED: uncharacterized protein LOC100821322 [Brachypodium 
distachyon]
Length=181

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            AN   ++ +LA+ +AQS KV   +  E +WD + +  SGGMPSSHSA  TAL  +V L  
Sbjct  33   ANCPLIAAVLAFAIAQSIKVLTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAVGLQE  92

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G + SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GH
Sbjct  93   GFSSSLFATSAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGH  152

Query  311  TPSQV  297
            TP QV
Sbjct  153  TPPQV  157



>ref|XP_002315626.2| hypothetical protein POPTR_0010s06670g [Populus trichocarpa]
 gb|EEF01797.2| hypothetical protein POPTR_0010s06670g [Populus trichocarpa]
Length=177

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  LA+ +AQS K F  +  ER+WD + +  SGGMPSSHSA   AL  +V    G
Sbjct  29   NYPLISAFLAFAIAQSIKFFTSWYKERRWDLKQLVGSGGMPSSHSATVAALAMAVGFQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF + L  + +VMYDA GVR  AG QA+VLN I+ +L   HP+S  R L+ELLGHT
Sbjct  89   FGGSLFSIALILACVVMYDATGVRLQAGRQAEVLNQILYELPAEHPLSDSRPLRELLGHT  148

Query  308  PSQVI  294
            P QVI
Sbjct  149  PPQVI  153



>ref|XP_004237231.1| PREDICTED: uncharacterized protein LOC101251275 [Solanum lycopersicum]
Length=167

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQS K+F  +  ER+WD + +  SGGMPSSHS+  TAL  +V L  G
Sbjct  20   NYPLMSALIAFALAQSIKLFTSWYKERRWDLKQLVGSGGMPSSHSSTVTALAVAVGLQEG  79

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF   L  + +VMYDA GVR HAG QA+VLN I+ +L   HP++  R L+ELLGHT
Sbjct  80   FGGALFACALVLACVVMYDATGVRLHAGRQAEVLNQILYELPSEHPLADSRPLRELLGHT  139

Query  308  PSQVI  294
            P QV+
Sbjct  140  PPQVV  144



>ref|XP_002501241.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62499.1| predicted protein [Micromonas sp. RCC299]
Length=156

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            ++P  VS LLA+ VAQ +KVF  +    K D+  +  SGGMPSSH+AL   LT SV L  
Sbjct  8    SSPALVSALLAFTVAQVAKVFTHWHTTGKLDYGRLVGSGGMPSSHTALVVGLTTSVGLKE  67

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
             +  S+F +CL FSL+VMYDA GVR HAG QA+VLN ++ +L   HP S+ R L+  LGH
Sbjct  68   SLDSSIFAMCLVFSLVVMYDATGVRLHAGRQAEVLNQMIMELPATHPASESRPLRNSLGH  127

Query  311  TPSQV  297
            TP +V
Sbjct  128  TPPEV  132



>ref|WP_013290562.1| acid phosphatase [Caldicellulosiruptor obsidiansis]
 ref|YP_003840549.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor obsidiansis OB47]
 gb|ADL42563.1| acid phosphatase/vanadium-dependent haloperoxidase related [Caldicellulosiruptor 
obsidiansis OB47]
Length=159

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = -1

Query  698  KISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCT  519
            K+   V  +  N     G+++W  AQ  K+ + F + RK D +   +SGGMPSSHSA   
Sbjct  11   KMKEVVLEILKNKALEVGVVSWFAAQFLKIVIAFIMTRKIDLKWFISSGGMPSSHSAFAC  70

Query  518  ALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ  339
             L+ +V L  G + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q
Sbjct  71   GLSTAVGLIDGFSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEMYLSPHYKPQ  130

Query  338  RKLKELLGHTPSQV  297
             KLKEL+GH P++V
Sbjct  131  YKLKELIGHKPTEV  144



>dbj|BAJ99829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=153

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 1/123 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   ++ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  26   NCPLIAAVLAFAIAQSIKVFTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAIGLQEG  85

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
             + SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GHT
Sbjct  86   FSSSLFATAAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGHT  145

Query  308  PSQ  300
            P Q
Sbjct  146  PPQ  148



>ref|XP_010499183.1| PREDICTED: uncharacterized protein LOC104776764 [Camelina sativa]
 ref|XP_010460466.1| PREDICTED: uncharacterized protein LOC104741327 [Camelina sativa]
Length=163

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  T+L  ++ L  G
Sbjct  17   NYPLISAVTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTSLAVAIGLQEG  76

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  77   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  136

Query  308  PSQVI  294
            P QV+
Sbjct  137  PPQVV  141



>ref|XP_003601814.1| Acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Medicago truncatula]
 gb|AES72065.1| acid phosphatase/vanadium-dependent haloperoxidase [Medicago 
truncatula]
 gb|AFK42227.1| unknown [Medicago truncatula]
Length=162

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQS K F  +  E++WD + +  SGGMPSSHSA  TAL  +V    G
Sbjct  17   NYPLISAILAFTIAQSIKFFTVWYKEKRWDPKQLVGSGGMPSSHSATVTALATAVGFHEG  76

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
                LF   L  ++IVMYDA GVR  AG QA+VLN IV +L   HP+S  R L+ELLGHT
Sbjct  77   FGGPLFATALVMAIIVMYDATGVRLQAGRQAEVLNQIVIELPAEHPLSDSRPLRELLGHT  136

Query  308  PSQVI  294
            P QVI
Sbjct  137  PPQVI  141



>ref|XP_006304264.1| hypothetical protein CARUB_v10010495mg [Capsella rubella]
 gb|EOA37162.1| hypothetical protein CARUB_v10010495mg [Capsella rubella]
Length=150

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  20   NYPLISAVTAFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  79

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  80   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLSESRPLRELLGHT  139

Query  308  PSQ  300
            P Q
Sbjct  140  PPQ  142



>ref|WP_026731738.1| acid phosphatase [Fischerella sp. PCC 9605]
Length=152

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V  L+A  +AQ+ K+ ++    RK + R++  +GGMPS+HSAL TAL A V   HG
Sbjct  10   NQVLVVALVACFMAQALKLIIELVKNRKLNVRVLVTTGGMPSAHSALVTALAAGVGQTHG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F +   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  S  +LKELLGHT
Sbjct  70   WASAEFALATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEHPEFSGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|XP_011086745.1| PREDICTED: uncharacterized protein LOC105168382 [Sesamum indicum]
Length=177

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L A+ +AQ+SK    +  E  WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  29   NYPLISALFAFAIAQASKFLNSWYKENHWDLKQLTGSGGMPSSHSATVTALAVAVGLQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF   L  + +VMYDA GVR HAG QA+VLN I+ +L   HP+++ R L+ELLGHT
Sbjct  89   FGGSLFATALILACVVMYDATGVRLHAGRQAEVLNQILFELPAEHPLAESRPLRELLGHT  148

Query  308  PSQVI  294
            P+QV+
Sbjct  149  PTQVV  153



>gb|KDD75107.1| PAP2 family protein [Helicosporidium sp. ATCC 50920]
Length=153

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = -1

Query  656  FVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVAD  477
            FV+  L +  AQ++KVF  + VERKWD   +  SGGMPSSH++    +T +V +  G   
Sbjct  13   FVAAFLGFFFAQTAKVFTHYYVERKWDLTRLVGSGGMPSSHTSSVMGVTTAVGVLCGTDS  72

Query  476  SLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR--KLKELLGHTPS  303
            ++F +C+ FSLIVMYDA GVR HAG QA VLN+I+ +L   HP++    +LK+ LGHTP 
Sbjct  73   AVFAMCVVFSLIVMYDATGVRLHAGKQASVLNMIIMELPPEHPVAANATQLKDTLGHTPL  132

Query  302  Q  300
            Q
Sbjct  133  Q  133



>ref|WP_015907768.1| acid phosphatase [Caldicellulosiruptor bescii]
 ref|YP_002573159.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor bescii DSM 6725]
 gb|ACM60386.1| acid phosphatase/vanadium-dependent haloperoxidase related [Caldicellulosiruptor 
bescii DSM 6725]
Length=159

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 81/134 (60%), Gaps = 0/134 (0%)
 Frame = -1

Query  698  KISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCT  519
            K+   V  +  N     G+++W VAQ  K+ + F + RK + +   +SGGMPSSHSA   
Sbjct  11   KMKEVVLEILKNKALEVGVVSWFVAQFLKIVIAFIMTRKVNLKWFISSGGMPSSHSAFAC  70

Query  518  ALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ  339
             L+ +V L  G + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q
Sbjct  71   GLSTAVGLIDGFSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEMYLSPHYKPQ  130

Query  338  RKLKELLGHTPSQV  297
             KLKEL+GH P++V
Sbjct  131  YKLKELIGHKPTEV  144



>gb|EYU22570.1| hypothetical protein MIMGU_mgv1a014481mg [Erythranthe guttata]
Length=188

 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  LA+ +AQS K    +  E +WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  42   NYPLISAFLAFAIAQSIKFVASWYKENRWDLKQLVGSGGMPSSHSATVTALAVAVGLQEG  101

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F V L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  102  FGGSTFAVALILAFVVMYDATGVRLHAGRQAEVLNQIVCELPAEHPLAESRPLRELLGHT  161

Query  308  PSQVI  294
            P QV+
Sbjct  162  PPQVV  166



>ref|XP_002890712.1| hypothetical protein ARALYDRAFT_890238 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66971.1| hypothetical protein ARALYDRAFT_890238 [Arabidopsis lyrata subsp. 
lyrata]
Length=170

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  24   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  83

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  84   FGGSHFAIALVLASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  143

Query  308  PSQVI  294
            P QV+
Sbjct  144  PPQVV  148



>ref|NP_564215.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
 dbj|BAH19764.1| AT1G24350 [Arabidopsis thaliana]
 gb|AEE30519.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
Length=168

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQVI  294
            P QV+
Sbjct  142  PPQVV  146



>ref|XP_006341745.1| PREDICTED: uncharacterized protein LOC102585439 [Solanum tuberosum]
Length=182

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 91/145 (63%), Gaps = 1/145 (1%)
 Frame = -1

Query  725  LSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGM  546
            ++I+AT    +S    +   N   +S ++A+ +AQS K F  +  E+ WD + +  SGGM
Sbjct  15   MNISATTTTIVSYGSCSFLTNCPLLSAIIAFALAQSIKFFTSWYREKHWDLKQLVGSGGM  74

Query  545  PSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVED  366
            PSSHS+  TAL  +V L  G   SLF + L  + +VMYDA GVR HAG QA+VLN IV +
Sbjct  75   PSSHSSTVTALATAVGLQEGFGGSLFAIALVLACVVMYDATGVRLHAGRQAEVLNQIVCE  134

Query  365  LFKWHPMSQR-KLKELLGHTPSQVI  294
            L + HP++    L+ELLGHTP QVI
Sbjct  135  LPEEHPLADTLPLRELLGHTPPQVI  159



>ref|XP_010415338.1| PREDICTED: uncharacterized protein LOC104701365 [Camelina sativa]
Length=165

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NFPLISAVLAFTIAQFIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  78   FGGSHFAIALVLTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHT  137

Query  308  PSQVI  294
            P QV+
Sbjct  138  PPQVV  142



>gb|AAM63820.1| unknown [Arabidopsis thaliana]
Length=168

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQVI  294
            P QV+
Sbjct  142  PPQVV  146



>ref|XP_009589503.1| PREDICTED: uncharacterized protein LOC104086864 [Nicotiana tomentosiformis]
Length=186

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 10/151 (7%)
 Frame = -1

Query  725  LSITATAGVKISPFVATLAANPTF------VSGLLAWLVAQSSKVFLKFCVERKWDFRMM  564
            ++I+AT    I   V+   +N +F      VS LLA+ +AQS+K+F  +  ER WD + +
Sbjct  18   INISATTTTTI---VSNYGSNSSFFTNYPLVSALLAFALAQSAKLFTSWYKERHWDLKQL  74

Query  563  CASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVL  384
              SGGMPSSH++  TAL  +V L  G   SLF   L  + +VMYDA GVR  AG QA+VL
Sbjct  75   VGSGGMPSSHTSTVTALATAVGLQEGFGGSLFATALVLACVVMYDATGVRLQAGRQAEVL  134

Query  383  NLIVEDLFKWHPMSQR-KLKELLGHTPSQVI  294
            N IV +L   HP++    L+ELLGHTP QV+
Sbjct  135  NQIVCELPAGHPLADSIPLRELLGHTPPQVV  165



>emb|CDX96079.1| BnaA07g26520D [Brassica napus]
Length=174

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  29   NYPLISAVLAFTIAQVIKFFTTWYKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
             A S F +    + IVMYDA GVR HAG QA+VLN IV +L   HP+S+   L+EL+GHT
Sbjct  89   FAGSHFAIAFILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLSESMPLRELIGHT  148

Query  308  PSQVI  294
            P QV+
Sbjct  149  PPQVV  153



>gb|KHG05528.1| putative membrane yuiD [Gossypium arboreum]
Length=156

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            +++  N   +S  +A+++AQ+ K F  +  E++WD + +  SGGMPSSHS+  TAL  ++
Sbjct  6    SSILTNYPLISAFIAFVIAQTIKFFTSWYKEKQWDLKQLVGSGGMPSSHSSTVTALATAI  65

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKE  324
                G   +LF   L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L+E
Sbjct  66   GFQEGFGGALFATALILACIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRE  125

Query  323  LLGHTPSQV  297
            LLGHTP QV
Sbjct  126  LLGHTPPQV  134



>gb|EMT32031.1| hypothetical protein F775_28345 [Aegilops tauschii]
Length=173

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
             N   ++ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  ++ L  
Sbjct  25   GNCPLIAAVLAFAIAQSIKVFTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAIGLQE  84

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G + SLF     F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GH
Sbjct  85   GFSCSLFATAAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGH  144

Query  311  TPSQV  297
            TP QV
Sbjct  145  TPPQV  149



>ref|WP_015171402.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Geitlerinema sp. PCC 7407]
 ref|YP_007108887.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Geitlerinema sp. PCC 7407]
 gb|AFY65835.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Geitlerinema sp. PCC 7407]
Length=154

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 1/131 (1%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +  + +N T +  LLA L+AQ  KV ++F    K + R +  +GGMPS+HSAL TAL   
Sbjct  4    IGDILSNRTLLVALLACLIAQVLKVIVEFARHGKVNLRALVETGGMPSAHSALVTALATG  63

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFK-WHPMSQRKLK  327
            V L  G A + F V L F++IVMYDA GVR+ AG QA++LN I++++F+  +  ++ +LK
Sbjct  64   VGLSVGWASNEFAVALIFAIIVMYDAAGVRQAAGKQAKILNQIIDEVFRDEYQFNEDRLK  123

Query  326  ELLGHTPSQVI  294
            ELLGHTP QVI
Sbjct  124  ELLGHTPVQVI  134



>ref|XP_010103187.1| hypothetical protein L484_006738 [Morus notabilis]
 gb|EXB94973.1| hypothetical protein L484_006738 [Morus notabilis]
Length=173

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 90/144 (63%), Gaps = 3/144 (2%)
 Frame = -1

Query  722  SITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMP  543
            ++ AT G  ++   +++ +N   +    A+ +AQ  K    +  ER+WD + +  SGGMP
Sbjct  9    AMAATGGGSLAS--SSIFSNYPLLCAFTAFAIAQFIKFLTAWYKERRWDLKQLVGSGGMP  66

Query  542  SSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL  363
            SSHSA  TAL A++    G   SLF   L  + IVMYDA GVR HAG QA+VLN IV +L
Sbjct  67   SSHSATVTALAAAIGFQEGFGGSLFATSLILACIVMYDATGVRLHAGRQAEVLNQIVYEL  126

Query  362  FKWHPMSQ-RKLKELLGHTPSQVI  294
               HP+++ R L+ELLGHTPSQV+
Sbjct  127  PAEHPLAESRPLRELLGHTPSQVV  150



>ref|XP_010470671.1| PREDICTED: uncharacterized protein LOC104750559 [Camelina sativa]
 ref|XP_010470672.1| PREDICTED: uncharacterized protein LOC104750559 [Camelina sativa]
 ref|XP_010470673.1| PREDICTED: uncharacterized protein LOC104750559 [Camelina sativa]
Length=165

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NFPLISAVLAFTIAQFIKFFTSWYKERRWDMKRLVGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  78   FGGSHFAIALVLTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHT  137

Query  308  PSQVI  294
            P QV+
Sbjct  138  PPQVV  142



>ref|WP_027414736.1| membrane protein [Aneurinibacillus terranovensis]
Length=159

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 85/130 (65%), Gaps = 11/130 (8%)
 Frame = -1

Query  650  SGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSL  471
            S +LA ++AQ+ K+ + +   RKWD +++ ++GGMPSSHSA  TALT +V    GV  S 
Sbjct  12   SAMLAIVLAQAVKIPITYFTTRKWDMKLLFSTGGMPSSHSAAVTALTTAVGFVDGVGSSA  71

Query  470  FPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL---------FKWHPMSQR--KLKE  324
            F + + F++IVM+DA GVRRHAG  A VLNL+VED           +  P  ++  KLKE
Sbjct  72   FAISVVFAVIVMFDAAGVRRHAGTHAAVLNLLVEDFQQVLNELKTLRVKPRREQAEKLKE  131

Query  323  LLGHTPSQVI  294
            LLGH PS+V+
Sbjct  132  LLGHQPSEVL  141



>ref|WP_013361557.1| acid phosphatase [[Clostridium] sticklandii]
 ref|YP_003936369.1| conserved protein of unknown function [ [[Clostridium] sticklandii]
 emb|CBH21464.1| conserved protein of unknown function [ [[Clostridium] sticklandii]
Length=149

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 81/126 (64%), Gaps = 4/126 (3%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N  F++  LAW +AQ  KV L +  E ++D      SGGMPSSH++  T+L  +V L  G
Sbjct  10   NQVFIACFLAWFIAQLIKVVLTYFFENRFDASRFVGSGGMPSSHTSFVTSLATAVGLVSG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWH---PMSQRKLKELLG  315
               S F + L  +L+VMYDA GVRR  G QAQ+LN I++D F+ H   P+++ +LKEL+G
Sbjct  70   YESSEFALSLVLALVVMYDAAGVRRSVGKQAQILNAIIDD-FQKHRKDPLNEERLKELIG  128

Query  314  HTPSQV  297
            HTP +V
Sbjct  129  HTPIEV  134



>emb|CDY03160.1| BnaC06g08130D [Brassica napus]
Length=118

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 74/103 (72%), Gaps = 3/103 (3%)
 Frame = -1

Query  776  EEFGGELLQSGGFGMALLSITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKF  597
            E F G+L Q+ G G+ALLSITA+A VKISPFVA L+A   FVS ++ W  AQ+SK+ + F
Sbjct  16   EHFAGDLKQNSGLGIALLSITASAKVKISPFVAMLSA---FVSAVVVWFFAQTSKMVINF  72

Query  596  CVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLF  468
             +ERKW   ++ ASGGMPSSHSALC ALT SVAL HG     F
Sbjct  73   FIERKWYLSLLFASGGMPSSHSALCMALTTSVALYHGAGTRCF  115



>ref|NP_001185084.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
 gb|AEE30521.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
Length=186

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQVI  294
            P Q++
Sbjct  142  PPQIV  146



>ref|NP_001148150.1| LOC100281758 [Zea mays]
 gb|ACG29897.1| acid phosphatase/vanadium-dependent haloperoxidase related [Zea 
mays]
 gb|ACG34120.1| acid phosphatase/vanadium-dependent haloperoxidase related [Zea 
mays]
Length=168

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + VAQS K FL +  E +WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  27   NYPLVAALLGFAVAQSIKFFLTWYKENRWDPKQLIGSGGMPSSHSATVTALAVAIGLQDG  86

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF     F+ +VMYDA G+R HAG QA VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  87   FNCSLFATATIFASVVMYDASGIRLHAGKQAAVLNQIVCELPSEHPLSETRPLRELLGHT  146

Query  308  PSQVI  294
            P+QV+
Sbjct  147  PTQVV  151



>gb|KFM23351.1| putative membrane protein YuiD [Auxenochlorella protothecoides]
Length=169

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 82/124 (66%), Gaps = 2/124 (2%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N  FV+  L +  AQ++K+F  +  ERKW+   +  SGGMPSSH++    LT++V +  G
Sbjct  26   NGAFVAAFLGFFFAQAAKMFTHYYSERKWELERLWGSGGMPSSHTSCVMGLTSAVGVLQG  85

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ--RKLKELLGH  312
             + S F +C+ FSL+VMYDA GVR HAG QA VLN+I+ +L   HP++    +LK+ LGH
Sbjct  86   TSSSYFAMCVVFSLVVMYDATGVRLHAGKQASVLNMIIMELPPDHPVASNVEQLKDQLGH  145

Query  311  TPSQ  300
            TP Q
Sbjct  146  TPLQ  149



>gb|EMS47761.1| hypothetical protein TRIUR3_14304 [Triticum urartu]
Length=152

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+GLLA+ VAQS+K F  +  E++WD R   ASGGMPSSHSA  TAL  SV +  G
Sbjct  7    NYPLVAGLLAFAVAQSAKFFTTWYKEKRWDARQFIASGGMPSSHSATVTALAVSVGIQEG  66

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               + F   +  + +VM+DA GVR HAG QA+VLN IV +L   HP+++ K L+E+LGHT
Sbjct  67   FRSATFATSVILACVVMHDAFGVRLHAGKQAEVLNQIVYELPIEHPLAETKPLREILGHT  126

Query  308  PSQVI  294
              QV+
Sbjct  127  VPQVV  131



>ref|XP_010926593.1| PREDICTED: uncharacterized protein LOC105048831 isoform X1 [Elaeis 
guineensis]
Length=190

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 1/123 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ VAQS+K+   +  E++WD + +  SGGMPSSHSA  TAL A++    G
Sbjct  22   NYPLISALVAFAVAQSAKLLTTWYKEKRWDAKQLIGSGGMPSSHSATVTALAAAIGFQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
             A S F   L  + IVMYDA GVR HAG QA+VLN IV +L   HP++  R L+ELLGHT
Sbjct  82   FAGSTFATALILACIVMYDAFGVRLHAGRQAEVLNQIVYELPAEHPLADTRPLRELLGHT  141

Query  308  PSQ  300
            P Q
Sbjct  142  PPQ  144



>dbj|BAJ91156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=154

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 85/131 (65%), Gaps = 1/131 (1%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +A    N   V+GLLA+ VAQS+K F  +  E++WD R   ASGGMPSSHSA  TAL  S
Sbjct  3    MAAAVVNYPLVAGLLAFAVAQSAKFFTTWYKEKRWDARQFIASGGMPSSHSATVTALAVS  62

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LK  327
            V +  G   + F   +  + +VM+DA GVR HAG QA+VLN IV +L   HP+++ K L+
Sbjct  63   VGIQEGFRSATFATSVILACVVMHDAFGVRLHAGKQAEVLNQIVYELPIEHPLAETKPLR  122

Query  326  ELLGHTPSQVI  294
            E+LGHT  QV+
Sbjct  123  EILGHTVPQVV  133



>ref|WP_035985451.1| acid phosphatase [Leptolyngbya sp. KIOST-1]
Length=151

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 1/131 (1%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            ++ +  N   +  L+A   AQ  K F++    RK + R+M  +GGMPS+HSAL TALT  
Sbjct  4    ISDILDNHVLIVALIACFTAQVLKAFIELVRHRKLNLRVMVGTGGMPSAHSALVTALTCG  63

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLK  327
            V    G A  LF     FS+IVMYDA GVR+ AG QA+VLN I+++LF+  P + + +LK
Sbjct  64   VGQTLGWASPLFAATSVFSIIVMYDAAGVRQAAGKQAKVLNQIIDELFQEKPELREDRLK  123

Query  326  ELLGHTPSQVI  294
            ELLGHTP QVI
Sbjct  124  ELLGHTPFQVI  134



>ref|XP_006391250.1| hypothetical protein EUTSA_v10019219mg [Eutrema salsugineum]
 gb|ESQ28536.1| hypothetical protein EUTSA_v10019219mg [Eutrema salsugineum]
Length=173

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  28   NYPLISAVLAFTIAQFIKFFTSWHKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F +    + IVMYDA GVR HAG QA+VLN IV +L   HP+++ R L ELLGHT
Sbjct  88   FGGSHFAIAFILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAETRPLSELLGHT  147

Query  308  PSQVI  294
            P QVI
Sbjct  148  PPQVI  152



>ref|XP_010511708.1| PREDICTED: uncharacterized protein LOC104787774 [Camelina sativa]
Length=165

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  18   NFPLISAVLAFTIAQFIKFFTSWYKERRWDLKRLFGSGGMPSSHSATVTALALAVGLQEG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  78   FGGSHFAIALILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHT  137

Query  308  PSQVI  294
            P QV+
Sbjct  138  PPQVV  142



>ref|XP_009604572.1| PREDICTED: uncharacterized protein LOC104099328 [Nicotiana tomentosiformis]
Length=175

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S L+A+ +AQS K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  28   NYPLMSALIAFALAQSIKLFTSWYKERRWDLKQLVGSGGMPSSHSATVTALAVAIGLQEG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
              ++LF   L  + +VMYDA GVR  AG QA+VLN I+ +L   HP++  R L+ELLGHT
Sbjct  88   FGEALFACALVLACVVMYDATGVRLQAGRQAEVLNQILYELPTEHPLADSRPLRELLGHT  147

Query  308  PSQVI  294
            P QV+
Sbjct  148  PPQVV  152



>ref|WP_017323616.1| membrane protein [cyanobacterium PCC 7702]
Length=152

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +  L+A LVAQ+ K+ ++    RK + R +  +GGMPS+HSAL TAL A V    G
Sbjct  10   NRVLLVALVACLVAQTLKLVIELVKNRKLNVRALVTTGGMPSAHSALVTALAAGVGQTRG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F V   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +  +LKELLGHT
Sbjct  70   WASTEFAVATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFDEHPEFTGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_022849418.1| membrane protein [Chloroflexi bacterium oral taxon 439]
Length=152

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 0/128 (0%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            A    NP  ++   +W VAQ+ K  + FC+ER+W++ ++  SGGMPSSHSAL T++ A++
Sbjct  5    ADFFTNPAIIAAFFSWFVAQALKPVVNFCIERRWNWFLVFQSGGMPSSHSALVTSVAATI  64

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKEL  321
             +  G     F V +   LIV YDA  VR  AG+QAQ +N ++ D F    +    LKE+
Sbjct  65   GIWQGFNSPTFGVAVALVLIVTYDASHVRWQAGLQAQKINQLIRDFFTGQQIDDELLKEV  124

Query  320  LGHTPSQV  297
            LGHTP QV
Sbjct  125  LGHTPRQV  132



>ref|WP_034639986.1| membrane protein [Bacillus manliponensis]
 gb|KEK18811.1| membrane protein [Bacillus manliponensis]
Length=141

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 80/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  677  TLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVA  498
            T+  N   ++ +LAW +AQ +KV  K   ER++DF    ASGGMPSSHS+  TAL A V 
Sbjct  3    TILHNAPLMAAILAWFLAQLTKVIFKLFKEREFDFAQFFASGGMPSSHSSTVTALAAGVG  62

Query  497  LCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELL  318
            +  GVA S+F V   F++IVMYDA GVR     QA++LN    D F     + +KL EL+
Sbjct  63   MEEGVASSIFAVAAIFAIIVMYDASGVRLAVSKQAKILN----DFFHGRQTNYKKLNELV  118

Query  317  GHTPSQVI  294
            GHTP QV+
Sbjct  119  GHTPYQVV  126



>ref|WP_006638925.1| transmembrane protein YuiD [Bacillus sonorensis]
 gb|EME73010.1| transmembrane protein YuiD [Bacillus sonorensis L12]
Length=158

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 11/130 (8%)
 Frame = -1

Query  653  VSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADS  474
            ++G  A   AQ  KV + F V RKWD+R++ ++GGMPSSHSA  TAL+  VAL  G+  S
Sbjct  10   LAGFAAIFFAQFIKVPIFFIVSRKWDWRLVTSTGGMPSSHSAAVTALSTGVALDQGIDSS  69

Query  473  LFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW-----------HPMSQRKLK  327
            LF V   F++I M+DA GVRRHAG QA VLN +V D  ++               Q+KLK
Sbjct  70   LFAVSSIFAVITMFDATGVRRHAGEQATVLNRLVRDFNRFVNEAKDFPKSHQEEKQKKLK  129

Query  326  ELLGHTPSQV  297
            ELLGH P +V
Sbjct  130  ELLGHQPIEV  139



>ref|WP_013430378.1| acid phosphatase [Caldicellulosiruptor kronotskyensis]
 ref|YP_004024090.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor kronotskyensis 2002]
 gb|ADQ46271.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor kronotskyensis 2002]
Length=148

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 77/123 (63%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N     G+++W VAQ  K+ + F + RK + +   +SGGMPSSHSA    L+ +V L  G
Sbjct  11   NKALEVGVVSWFVAQFLKIVIAFIMTRKVNLKWFISSGGMPSSHSAFACGLSTAVGLIDG  70

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTP  306
             + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q KLKEL+GH P
Sbjct  71   FSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEMYLSPHYKPQYKLKELIGHKP  130

Query  305  SQV  297
            ++V
Sbjct  131  TEV  133



>gb|AAF97982.1|AC000103_32 F21J9.1 [Arabidopsis thaliana]
Length=150

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQV  297
            P QV
Sbjct  142  PPQV  145



>ref|WP_013412020.1| acid phosphatase [Caldicellulosiruptor owensensis]
 ref|YP_004002440.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor owensensis OL]
 gb|ADQ04640.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor owensensis OL]
Length=159

 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 80/134 (60%), Gaps = 0/134 (0%)
 Frame = -1

Query  698  KISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCT  519
            K+   V  +  N     G+++W  AQ  K+ + F + +K D +   +SGGMPSSHSA   
Sbjct  11   KMKEVVLEILKNKALEVGVVSWFAAQFLKIVIAFIMTQKIDLKWFISSGGMPSSHSAFAC  70

Query  518  ALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ  339
             L+ +V L  G + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q
Sbjct  71   GLSTAVGLIDGFSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEMYLSPHYKPQ  130

Query  338  RKLKELLGHTPSQV  297
             KLKEL+GH P++V
Sbjct  131  YKLKELIGHKPTEV  144



>ref|WP_014794704.1| MULTISPECIES: membrane protein [Desulfitobacterium]
 ref|YP_006431017.1| hypothetical protein Desde_2921 [Desulfitobacterium dehalogenans 
ATCC 51507]
 gb|AFM01224.1| hypothetical protein Desde_2921 [Desulfitobacterium dehalogenans 
ATCC 51507]
Length=147

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 83/124 (67%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S ++AW +AQ+ K+ + F + R +D   + +SGG PSSHSA  +AL   V   +G
Sbjct  10   NIILISAIMAWFIAQTLKLIINFSIHRTFDVGFLFSSGGFPSSHSATVSALAIGVGKYYG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             +  +F + + F +IVMYDA GVRR AG QA+V+N +VE+L++    +SQ +LKEL+GHT
Sbjct  70   WSSPIFAIAVIFGMIVMYDAAGVRRAAGKQAEVINQLVEELYQQMSHLSQERLKELIGHT  129

Query  308  PSQV  297
            P +V
Sbjct  130  PFEV  133



>ref|WP_038268005.1| membrane protein [[Clostridium] litorale]
 gb|KDR94112.1| hypothetical protein CLIT_23c03850 [ [[Clostridium] litorale 
DSM 5388]
Length=149

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 82/134 (61%), Gaps = 2/134 (1%)
 Frame = -1

Query  689  PFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALT  510
             F   +  N  F+  + AW VAQ  KV L   +E+++D      SGGMPSSHS+   +L+
Sbjct  2    AFFEGVLKNEVFIVCITAWFVAQLIKVILTVLIEKRFDMSRFVGSGGMPSSHSSFVMSLS  61

Query  509  ASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW--HPMSQR  336
              V +  G    +F V L  SLIVMYDA GVRR  G QA++LN +++D+ K   H + ++
Sbjct  62   TGVGIIEGYDSVIFTVALVLSLIVMYDAAGVRRSVGKQAKILNALLDDIHKHKKHLLIEK  121

Query  335  KLKELLGHTPSQVI  294
            +LKEL+GHTP +V+
Sbjct  122  RLKELIGHTPVEVL  135



>ref|WP_015262814.1| membrane protein [Desulfitobacterium dichloroeliminans]
 ref|YP_007221238.1| hypothetical protein Desdi_2418 [Desulfitobacterium dichloroeliminans 
LMG P-21439]
 gb|AGA69842.1| hypothetical protein Desdi_2418 [Desulfitobacterium dichloroeliminans 
LMG P-21439]
Length=147

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S ++AWL+AQ  KV + F + R +D   + +SGG PSSHSA  +AL+  V   +G
Sbjct  10   NAILLSAMMAWLIAQVLKVIINFSIHRTFDVGFLFSSGGFPSSHSATVSALSIGVGKYYG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
                +F V + F +IVMYDA GVRR AG QA+V+N +V++L++    +SQ +LKEL+GHT
Sbjct  70   WNSPIFAVAVIFGMIVMYDAAGVRRAAGKQAEVINQLVQELYQQMSHLSQERLKELIGHT  129

Query  308  PSQV  297
            P +V
Sbjct  130  PFEV  133



>ref|WP_016875704.1| membrane protein [Chlorogloeopsis fritschii]
Length=152

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V  L+A L+AQ+ K+ ++    RK + R +  +GGMPS+HSAL T+L A V    G
Sbjct  10   NQVLVVALVACLIAQTLKLVIELIKNRKLNVRALVTTGGMPSAHSALVTSLAAGVGQTRG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F V   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +  +LKELLGHT
Sbjct  70   WASAEFAVATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFDEHPEFTGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_034131658.1| acid phosphatase [Peptococcaceae bacterium BIC-A1/1_c8]
Length=148

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 75/117 (64%), Gaps = 1/117 (1%)
 Frame = -1

Query  644  LLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFP  465
            L AW +AQ  KV +    +RKWDF  +  +GGMPSSHSAL T+L   +    G     F 
Sbjct  18   LFAWAIAQFLKVVIVLYTQRKWDFTRLVGAGGMPSSHSALVTSLATGIGRDFGFNSGEFA  77

Query  464  VCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWH-PMSQRKLKELLGHTPSQV  297
            + L  +L+VMYDA GVRR AG QA+VLN I++DL+      S ++LKELLGHTP +V
Sbjct  78   LALTIALVVMYDAAGVRRAAGKQAEVLNQILDDLYHHRTEFSSKRLKELLGHTPVEV  134



>ref|WP_012063634.1| acid phosphatase [Alkaliphilus metalliredigens]
 ref|YP_001320318.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Alkaliphilus metalliredigens QYMF]
 gb|ABR48659.1| acid phosphatase/vanadium-dependent haloperoxidase related [Alkaliphilus 
metalliredigens QYMF]
Length=149

 Score =   118 bits (295),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 84/133 (63%), Gaps = 2/133 (2%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
            F   +  N    + LLAW +AQ+ KV   F V+++++      SGGMPSSHS+    LT 
Sbjct  3    FFHGIGNNKILGTALLAWFIAQTIKVIHTFIVDKRFNLSRFVGSGGMPSSHSSFVMGLTT  62

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF--KWHPMSQRK  333
            ++ L  G   ++F V L FSL++MYDA GVRR  G QA +LN ++ED+   +   +++++
Sbjct  63   AIGLDKGFDSAIFAVSLAFSLVIMYDAAGVRRAVGKQAIILNRMIEDIHHKRKLKLTEQR  122

Query  332  LKELLGHTPSQVI  294
            LKEL+GHTP +V+
Sbjct  123  LKELIGHTPIEVL  135



>ref|NP_001077594.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
 dbj|BAC41988.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39918.1| At1g24350 [Arabidopsis thaliana]
 gb|AEE30520.1| Acid phosphatase/vanadium-dependent haloperoxidase-related protein 
[Arabidopsis thaliana]
Length=147

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 81/124 (65%), Gaps = 1/124 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQV  297
            P Q+
Sbjct  142  PPQL  145



>gb|EMS45766.1| hypothetical protein TRIUR3_17926 [Triticum urartu]
Length=173

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
             N   ++ +LA+ +AQS KVF  +  E +WD + +  SGGMPSSHSA  TAL  +V L  
Sbjct  25   GNCPLIAAVLAFAIAQSIKVFTTWYKENRWDAKQLVGSGGMPSSHSATVTALAVAVGLQE  84

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G++ S       F+ +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+EL+GH
Sbjct  85   GLSSSRLATAAIFASVVMYDAFGVRLHAGRQAEVLNQIVYELPSEHPLAETRPLRELIGH  144

Query  311  TPSQV  297
            TP QV
Sbjct  145  TPPQV  149



>emb|CDY15731.1| BnaA07g09020D [Brassica napus]
Length=169

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLK-FCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            N   +S   A+ +AQ  K+F   + +ER+WD + +  SGGMPSSHSA  TAL  ++ L  
Sbjct  22   NYPLISAFTAFAIAQFIKLFTSWYLLERRWDLKQLLGSGGMPSSHSATVTALAVAIGLQE  81

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G   S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGH
Sbjct  82   GFGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVFELPAEHPLAESRPLRELLGH  141

Query  311  TPSQVI  294
            TP QVI
Sbjct  142  TPPQVI  147



>ref|WP_012626455.1| membrane protein [Cyanothece sp. PCC 7425]
 ref|YP_002481718.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Cyanothece sp. PCC 7425]
 gb|ACL43357.1| acid phosphatase/vanadium-dependent haloperoxidase related [Cyanothece 
sp. PCC 7425]
Length=150

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +  L A L+AQ  K+ +++   RK +FR++  +GGMPSSHSAL  AL   V    G
Sbjct  10   NRVLLVSLSASLIAQILKLVIEYIKNRKLNFRVLVETGGMPSSHSALVAALATGVGQTKG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW-HPMSQRKLKELLGHT  309
               + F + L F+ IVMYDA GVR+ AG QA+VLN IV++ F+  H +S+ +LKELLGHT
Sbjct  70   WGGTEFAIALIFAFIVMYDAAGVRQAAGKQARVLNQIVDEFFQADHALSEARLKELLGHT  129

Query  308  PSQVI  294
            P QV+
Sbjct  130  PMQVV  134



>ref|WP_012159463.1| acid phosphatase [Alkaliphilus oremlandii]
 ref|YP_001513147.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Alkaliphilus oremlandii OhILAs]
 gb|ABW19151.1| acid phosphatase/vanadium-dependent haloperoxidase related [Alkaliphilus 
oremlandii OhILAs]
Length=149

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 81/132 (61%), Gaps = 2/132 (2%)
 Frame = -1

Query  686  FVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTA  507
            F+  +  N  F+  + +W +AQ  KV   F  E + DF     SGGMPSSH++    L+ 
Sbjct  3    FLKQIGKNEIFIVAVFSWFIAQVIKVVNTFIAEGRIDFTRFVGSGGMPSSHASFVMGLST  62

Query  506  SVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF--KWHPMSQRK  333
            +V L HG   + F + + FS+++MYDA GVRR  G QA +LN ++ED+   K   +++++
Sbjct  63   AVGLKHGWDSTYFAMSIAFSIVIMYDAAGVRRAVGKQAIILNKMIEDIHRRKEKKLTEKR  122

Query  332  LKELLGHTPSQV  297
            LKEL+GHTP +V
Sbjct  123  LKELIGHTPVEV  134



>ref|XP_006645184.1| PREDICTED: uncharacterized protein LOC102713420 [Oryza brachyantha]
Length=175

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + VAQS K F+    E +WD + +  SGGMPSSHSA  TAL  ++    G
Sbjct  28   NYPLVAALLGFAVAQSIKFFVTRYKENRWDPKQLIGSGGMPSSHSATVTALAVAIGFQDG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF     F+ +VMYDA G+R HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  88   FGSALFATAAIFASVVMYDASGIRLHAGKQAEVLNQIVCELPAEHPLSETRPLRELLGHT  147

Query  308  PSQVI  294
            P+QV+
Sbjct  148  PTQVV  152



>ref|XP_010556163.1| PREDICTED: uncharacterized protein LOC104825518 [Tarenaya hassleriana]
Length=163

 Score =   117 bits (294),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  +++ +AQ  K F  +  ER+WD + +  SGGMPS+HSA  TAL  SV L  G
Sbjct  16   NYPLISAFVSFSIAQLIKFFTSWYKERRWDLKQLVGSGGMPSAHSATVTALAVSVGLQEG  75

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + IVMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  76   FDGSHFAIALILASIVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  135

Query  308  PSQVI  294
            P QVI
Sbjct  136  PPQVI  140



>ref|XP_010531349.1| PREDICTED: uncharacterized protein LOC104807658 isoform X2 [Tarenaya 
hassleriana]
Length=164

 Score =   117 bits (294),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + A+ +AQS K F  +  ER+WD +++  SGGMPS+HSA  TAL  ++ L +G
Sbjct  20   NYPLISAVAAFAIAQSIKFFTSW--ERRWDLKLLVGSGGMPSAHSATVTALAVAIGLQNG  77

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F +    + IVMYDA GVR HAG QA+VLN IV  L   HP+++R+ L ELLGHT
Sbjct  78   FGGSHFALAFIMASIVMYDATGVRLHAGRQAEVLNQIVYQLPAEHPLAERRPLHELLGHT  137

Query  308  PSQVI  294
            P QVI
Sbjct  138  PPQVI  142



>emb|CDP13311.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQS K    +  ER WD + +  SGGMPSSHSA   AL   V L  G
Sbjct  48   NYPLISAVLAFALAQSFKFLTSWYRERHWDLKQLVGSGGMPSSHSATVIALAIGVGLQEG  107

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF   L  + +VMYDA GVR HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  108  FGGSLFATALILACVVMYDATGVRLHAGRQAEVLNQIVCELPAEHPLSESRPLRELLGHT  167

Query  308  PSQVI  294
            P QV+
Sbjct  168  PPQVV  172



>ref|WP_013432570.1| MULTISPECIES: acid phosphatase [Caldicellulosiruptor]
 ref|YP_004026391.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor kristjanssonii I77R1B]
 ref|YP_004798303.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Caldicellulosiruptor lactoaceticus 6A]
 gb|ADQ40778.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor kristjanssonii I77R1B]
 gb|AEM73326.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Caldicellulosiruptor lactoaceticus 6A]
Length=148

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N     G+++W  AQ  K+ + F + RK + +   +SGGMPSSHSA    L+ +V L  G
Sbjct  11   NKALEVGVVSWFAAQFLKIVIAFIMTRKLNLKWFISSGGMPSSHSAFACGLSTAVGLIDG  70

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTP  306
             + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q KLKEL+GH P
Sbjct  71   FSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEIYLSPHYKPQYKLKELIGHKP  130

Query  305  SQV  297
            ++V
Sbjct  131  TEV  133



>ref|XP_009105303.1| PREDICTED: uncharacterized protein LOC103831184 [Brassica rapa]
Length=174

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  29   NYPLISAVLAFTIAQVIKFFTTWYKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F +    + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  89   FGGSHFVIAFILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESMPLRELLGHT  148

Query  308  PSQVI  294
            P QV+
Sbjct  149  PPQVV  153



>ref|XP_006438103.1| hypothetical protein CICLE_v10032910mg [Citrus clementina]
 gb|ESR51343.1| hypothetical protein CICLE_v10032910mg [Citrus clementina]
Length=172

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  +A+ +AQ +K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V    G
Sbjct  25   NFPLISAFVAFTIAQCAKFFTAWYKERRWDLKQLIGSGGMPSSHSATVTALAMAVGFQEG  84

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
                LF   L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  85   FGGPLFATALILACVVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  144

Query  308  PSQVI  294
            P+QVI
Sbjct  145  PAQVI  149



>ref|XP_006484048.1| PREDICTED: uncharacterized protein LOC102619129 [Citrus sinensis]
Length=173

 Score =   118 bits (295),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S  +A+ +AQ +K F  +  ER+WD + +  SGGMPSSHSA  TAL  +V    G
Sbjct  26   NFPLISAFVAFTIAQCAKFFTAWYKERRWDLKQLIGSGGMPSSHSATVTALAMAVGFQEG  85

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
                LF   L  + +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  86   FGGPLFATALILACVVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  145

Query  308  PSQVI  294
            P+QVI
Sbjct  146  PAQVI  150



>gb|EWH21263.1| membrane protein [Bacillus licheniformis S 16]
Length=158

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = -1

Query  638  AWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVC  459
            A   AQ  KV + F V +KWD+R++ ++GGMPSSHSA  TAL+  VAL HG+  SLF V 
Sbjct  15   AIFFAQFIKVPIYFVVSKKWDWRLITSTGGMPSSHSAAVTALSTGVALDHGMDSSLFAVS  74

Query  458  LGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW-----------HPMSQRKLKELLGH  312
              F++I M+DA GVRRHAG QA V+N +V D  ++               Q+KLKELLGH
Sbjct  75   AIFAVITMFDATGVRRHAGEQATVINRLVRDFNRFVNEAKDFPKSHQEEKQKKLKELLGH  134

Query  311  TPSQV  297
             P +V
Sbjct  135  QPIEV  139



>ref|WP_012410127.1| membrane protein [Nostoc punctiforme]
 ref|YP_001867099.1| acid phosphatase/vanadium-dependent haloperoxidase-like protein 
[Nostoc punctiforme PCC 73102]
 gb|ACC82156.1| acid phosphatase/vanadium-dependent haloperoxidase related [Nostoc 
punctiforme PCC 73102]
Length=153

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +  L+A L+AQ+ K+ ++    RK + R++  +GGMPS+HSAL TAL A V    G
Sbjct  10   NRVLLVALVACLIAQALKLVIEIVKNRKLNIRVLVTTGGMPSAHSALVTALAAGVGQTLG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A   F V + F++IVMYDA GVR+ AG QA++LN ++++LF   P  SQ +LKELLGHT
Sbjct  70   WASPDFAVAMIFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEKPDFSQDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PVQVI  134



>ref|WP_029227570.1| membrane protein [Caldicellulosiruptor acetigenus]
Length=148

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N     G+++W  AQ  K+ + F + RK + +   +SGGMPSSHSA    L+ +V L  G
Sbjct  11   NKALEVGVVSWFAAQFLKIVIAFIMTRKLNLKWFISSGGMPSSHSAFACGLSTAVGLIDG  70

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTP  306
             + + F + L F+LIVMYDA GVRR AG QAQ LN I+E     H   Q KLKEL+GH P
Sbjct  71   FSSTNFAISLTFTLIVMYDAAGVRREAGKQAQTLNEIIEIYLSPHYKPQYKLKELIGHKP  130

Query  305  SQV  297
            ++V
Sbjct  131  TEV  133



>ref|NP_001141241.1| acid phosphatase/vanadium-dependent haloperoxidase protein [Zea 
mays]
 gb|ACF85824.1| unknown [Zea mays]
 gb|AFW84283.1| acid phosphatase/vanadium-dependent haloperoxidase protein [Zea 
mays]
Length=168

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + VAQS K F+    E +WD + +  SGGMPSSHSA  TAL  ++    G
Sbjct  27   NYPLVAALLGFAVAQSIKFFVTRYKENRWDPKRLIGSGGMPSSHSATVTALAVAIGFQDG  86

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
             + SLF     F+ +VMYDA G+R HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  87   FSCSLFATATIFASVVMYDASGIRLHAGKQAEVLNQIVCELPSEHPLSETRPLRELLGHT  146

Query  308  PSQVI  294
            P+QV+
Sbjct  147  PTQVV  151



>gb|EPS65473.1| hypothetical protein M569_09304, partial [Genlisea aurea]
Length=155

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S LLA+ ++QSSK+   +  +++WD  ++  SGGMPS+HSA  +AL  +V L  G
Sbjct  8    NYPLISALLAFSISQSSKLIASWYKDKRWDLSLVFGSGGMPSAHSATVSALAMAVGLEEG  67

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F   L  +L+VMYDA GVR HAG QA+VLN IV  L   HP+S+   L+ELLGHT
Sbjct  68   FGGSQFATALVLALVVMYDATGVRLHAGHQAEVLNQIVLGLPSEHPLSEATPLRELLGHT  127

Query  308  PSQVI  294
            P QV+
Sbjct  128  PPQVV  132



>ref|WP_003184918.1| MULTISPECIES: membrane protein [Bacillus]
 ref|YP_080488.1| hypothetical protein BL03142 [Bacillus licheniformis DSM 13 = 
ATCC 14580]
 ref|YP_006714686.1| transmembrane protein YuiD [Bacillus licheniformis DSM 13 = ATCC 
14580]
 ref|YP_008079509.1| putative integral inner membrane protein YuiD [Bacillus licheniformis 
9945A]
 gb|AAU24850.1| conserved membrane protein YuiD [Bacillus licheniformis DSM 13 
= ATCC 14580]
 gb|AAU42219.1| transmembrane protein YuiD [Bacillus licheniformis DSM 13 = ATCC 
14580]
 gb|EFV70763.1| YuiD protein [Bacillus sp. BT1B_CT2]
 gb|EID48241.1| hypothetical protein MUY_03545 [Bacillus licheniformis WX-02]
 gb|AGN37772.1| putative integral inner membrane protein YuiD [Bacillus licheniformis 
9945A]
 gb|EQM26510.1| membrane protein [Bacillus licheniformis CG-B52]
 gb|ETB71413.1| membrane protein [Bacillus sp. CPSM8]
 gb|KFM84165.1| divergent PAP2 family protein [Bacillus licheniformis]
Length=158

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = -1

Query  638  AWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVC  459
            A   AQ  KV + F V +KWD+R++ ++GGMPSSHSA  TAL+  VAL HG+  SLF V 
Sbjct  15   AIFFAQFIKVPIYFVVSKKWDWRLVTSTGGMPSSHSAAVTALSTGVALDHGMDSSLFAVS  74

Query  458  LGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW-----------HPMSQRKLKELLGH  312
              F++I M+DA GVRRHAG QA V+N +V D  ++               Q+KLKELLGH
Sbjct  75   AIFAVITMFDATGVRRHAGEQATVINRLVRDFNRFVNEAKDFPKSHQEEKQKKLKELLGH  134

Query  311  TPSQV  297
             P +V
Sbjct  135  QPIEV  139



>gb|EMT20290.1| hypothetical protein F775_07250 [Aegilops tauschii]
Length=180

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + +AQS K FL    E++WD + +  SGGMPSSHSA  TAL+ ++    G
Sbjct  33   NFPLVAALLGFAIAQSIKFFLTRYKEKRWDPKRLIGSGGMPSSHSATVTALSVAIGFQEG  92

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF     F+ +VMYDA GVR HAG QA VLN IV +L   HP+++ R L+ELLGHT
Sbjct  93   FGSALFATSTIFASVVMYDASGVRLHAGKQAAVLNQIVCELPAEHPLAETRPLRELLGHT  152

Query  308  PSQVI  294
            P+QV+
Sbjct  153  PTQVV  157



>ref|WP_034145672.1| membrane protein [Desulfosporosinus sp. BIC-A1/1_c9]
Length=146

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + AWL+AQ  KV + F + RK +F+M+ +SGG PSSHSA  +AL   +   +G
Sbjct  10   NAILISAVTAWLIAQLLKVAVNFILLRKLNFQMIISSGGFPSSHSATVSALALGIGKYYG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKLKELLGHTP  306
                +F V   F +IV+YDA GVRR AG QA+VLN ++E L+     +Q KLKEL+GHTP
Sbjct  70   CDSPIFAVAAVFGMIVLYDAAGVRRAAGKQAEVLNQLIERLYHGPVPAQEKLKELIGHTP  129

Query  305  SQV  297
             +V
Sbjct  130  LEV  132



>ref|WP_026588609.1| membrane protein [Bacillus sp. NSP9.1]
Length=158

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 79/125 (63%), Gaps = 11/125 (9%)
 Frame = -1

Query  638  AWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVC  459
            A   AQ  KV + F V +KWD+R++ ++GGMPSSHSA  TAL+  VAL HG+  SLF V 
Sbjct  15   AIFFAQFIKVPIYFVVSKKWDWRLLTSTGGMPSSHSAAVTALSTGVALDHGMDSSLFAVS  74

Query  458  LGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKW-----------HPMSQRKLKELLGH  312
              F++I M+DA GVRRHAG QA V+N +V D  ++               Q+KLKELLGH
Sbjct  75   SIFAVITMFDATGVRRHAGEQATVINRLVRDFNRFVSEAKDFPKVHQEEKQKKLKELLGH  134

Query  311  TPSQV  297
             P +V
Sbjct  135  QPIEV  139



>ref|WP_015150995.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007088298.1| hypothetical protein Oscil6304_4872 [Oscillatoria acuminata PCC 
6304]
 gb|AFY84378.1| hypothetical protein Oscil6304_4872 [Oscillatoria acuminata PCC 
6304]
Length=151

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 87/131 (66%), Gaps = 1/131 (1%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +  +  N   +   LA L+AQS+K+ ++    RK++FR++  +GGMPS+HSAL TAL   
Sbjct  4    IGNIIDNRVLLVATLACLIAQSAKLAIELARNRKFNFRVLVETGGMPSAHSALVTALATG  63

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF-KWHPMSQRKLK  327
            +    G   + F +   F++IVMYDA GVR+ AG QA++LN IV++ F + H +++ +LK
Sbjct  64   IGQTAGWNSTEFALATIFAVIVMYDAAGVRQAAGKQARILNQIVDEFFSEDHDLNEARLK  123

Query  326  ELLGHTPSQVI  294
            ELLGHTP QVI
Sbjct  124  ELLGHTPFQVI  134



>ref|XP_002458933.1| hypothetical protein SORBIDRAFT_03g042940 [Sorghum bicolor]
 gb|EES04053.1| hypothetical protein SORBIDRAFT_03g042940 [Sorghum bicolor]
Length=167

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + +AQS K F+ +  E +WD + +  SGGMPSSHSA  TAL  ++    G
Sbjct  26   NYPLVAALLGFAIAQSIKFFVTWYKENRWDPKQLIGSGGMPSSHSATVTALAVAIGFQDG  85

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF     F+ +VMYDA G+R HAG QA VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  86   FNCSLFATATIFASVVMYDASGIRLHAGKQAAVLNQIVCELPSEHPLSETRPLRELLGHT  145

Query  308  PSQVI  294
            P+QVI
Sbjct  146  PTQVI  150



>emb|CDY32544.1| BnaC02g17370D [Brassica napus]
Length=170

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  25   NYPLLSAVLAFTIAQFIKFFTTWYKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  84

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF +    + IVM DA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  85   FGGSLFAMAFILTSIVMCDATGVRLHAGRQAEVLNQIVYELPSEHPLAESRPLRELLGHT  144

Query  308  PSQVI  294
            P QVI
Sbjct  145  PPQVI  149



>emb|CDM84900.1| unnamed protein product [Triticum aestivum]
Length=180

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + +AQS K FL    E++WD + +  SGGMPSSHSA  TAL+ ++    G
Sbjct  33   NFPLVAALLGFAIAQSIKFFLTRYKEKRWDPKRLIGSGGMPSSHSATVTALSVAIGFQEG  92

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF     F+ +VMYDA GVR HAG QA VLN IV +L   HP+++ R L+ELLGHT
Sbjct  93   FGSALFATSTIFASVVMYDASGVRLHAGKQAAVLNQIVCELPAEHPLAETRPLRELLGHT  152

Query  308  PSQVI  294
            P+QV+
Sbjct  153  PTQVV  157



>ref|WP_003134379.1| acid phosphatase [Lactococcus garvieae]
 gb|EKF52436.1| hypothetical protein C426_0009 [Lactococcus garvieae DCC43]
Length=147

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 80/131 (61%), Gaps = 0/131 (0%)
 Frame = -1

Query  689  PFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALT  510
             F   + +N   V+ ++ W  AQ  K+F+     +K D R++ A+GGMPSSHSAL  ++T
Sbjct  2    DFFKEIISNQILVTAIVGWFAAQIIKIFVDIFRYKKLDLRLLFATGGMPSSHSALVVSMT  61

Query  509  ASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKL  330
             +  L  G   ++F +   F+ +VMYDA G+RR AG  A +LN+I++ +      ++R L
Sbjct  62   TATGLTQGFDSAIFAMATVFAFVVMYDAQGIRRQAGTHAYILNIIIKTIENPKINAERAL  121

Query  329  KELLGHTPSQV  297
            KELLGHTP QV
Sbjct  122  KELLGHTPLQV  132



>emb|CDY01824.1| BnaC06g28640D [Brassica napus]
Length=174

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S +LA+ +AQ  K F  +  E++WD + +  SGGMPSSHSA  TAL  +V L  G
Sbjct  29   NYPLISAVLAFTIAQLIKFFTTWYKEKRWDLKRLVGSGGMPSSHSATVTALAMAVGLQEG  88

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F +    + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  89   FGGSHFAIAFILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESMPLRELLGHT  148

Query  308  PSQVI  294
            P QV+
Sbjct  149  PPQVV  153



>ref|XP_004239189.1| PREDICTED: uncharacterized protein LOC101261814 [Solanum lycopersicum]
Length=182

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 83/126 (66%), Gaps = 1/126 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   +S ++A+ +AQS K F  +  E+ WD + +  SGGMPSSHS+  TAL  +V L  
Sbjct  34   SNCPLLSAIIAFALAQSIKFFTSWYREKHWDLKQLVGSGGMPSSHSSTVTALATAVGLQE  93

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQR-KLKELLGH  312
            G   SLF + L  + +VMYDA GVR HAG QA+VLN IV +L + HP++    L+ELLGH
Sbjct  94   GFGGSLFAISLVLACVVMYDATGVRLHAGRQAEVLNQIVCELPEEHPLADTLPLRELLGH  153

Query  311  TPSQVI  294
            TP QVI
Sbjct  154  TPPQVI  159



>ref|XP_010025345.1| PREDICTED: uncharacterized protein LOC104415704 [Eucalyptus grandis]
 gb|KCW61981.1| hypothetical protein EUGRSUZ_H04664 [Eucalyptus grandis]
Length=187

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  623  QSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHGVADSLFPVCLGFSL  444
            QS K F  +  ER+WD + +  SGGMPSSHSA  TALTA++    G   + F + L  +L
Sbjct  56   QSIKFFTSWYKERRWDLKRLVGSGGMPSSHSATVTALTAAIGFQDGFGGTTFAITLILAL  115

Query  443  IVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHTPSQVI  294
            +VMYDA GVR  AG QA+VLN IV +L   HP+++ R L+ELLGHTP QVI
Sbjct  116  VVMYDATGVRLQAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHTPPQVI  166



>emb|CDP13798.1| unnamed protein product [Coffea canephora]
Length=168

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 82/126 (65%), Gaps = 1/126 (1%)
 Frame = -1

Query  668  ANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCH  489
            +N   VS  LA LVAQ  K+F  +  ERKWD R M +SGGMPSSHSA  TAL  ++ L  
Sbjct  26   SNLPLVSAFLACLVAQFLKIFTHWFKERKWDSRRMLSSGGMPSSHSATVTALAVAIGLQD  85

Query  488  GVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGH  312
            G   S F + +  + +VMYDA GVR HAG QA++LN IV +L   HP++  R L++ LGH
Sbjct  86   GAGTSAFAIAVVLACVVMYDATGVRLHAGRQAELLNQIVCELPPEHPVANVRPLRDSLGH  145

Query  311  TPSQVI  294
            TP QV+
Sbjct  146  TPFQVV  151



>ref|XP_003596939.1| Membrane protein, putative [Medicago truncatula]
 gb|AES67190.1| acid phosphatase/vanadium-dependent haloperoxidase [Medicago 
truncatula]
Length=167

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 92/144 (64%), Gaps = 3/144 (2%)
 Frame = -1

Query  722  SITATAGVKISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMP  543
             +TA+    +SPFV +  +N   +S  L++ +AQ  K+F  +  E++WD + +  SGGMP
Sbjct  9    DVTASTASSLSPFVPS--SNLPLISAFLSFALAQFLKIFTTWYKEKRWDSKRLLDSGGMP  66

Query  542  SSHSALCTALTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL  363
            SSHSA  +AL  ++    G+  S+F + +  + IVMYDA GVR HAG QA++LN IV +L
Sbjct  67   SSHSATVSALAVAIGFQEGIGSSVFAIAVILACIVMYDATGVRLHAGRQAELLNQIVCEL  126

Query  362  FKWHPMSQ-RKLKELLGHTPSQVI  294
               HP+S  R L++ LGHTP QV+
Sbjct  127  PPEHPLSNVRPLRDSLGHTPLQVV  150



>ref|WP_037224641.1| acid phosphatase [Richelia intracellularis]
 emb|CDN17182.1| FIG00872893: hypothetical protein [Richelia intracellularis]
Length=151

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/131 (46%), Positives = 85/131 (65%), Gaps = 1/131 (1%)
 Frame = -1

Query  683  VATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTAS  504
            +  +  N   +  L+A ++AQ  K+ ++    RK D R++  +GGMPSSHSAL TAL   
Sbjct  4    IGNILDNRVLLVALVACVIAQLLKLIIEVIRNRKLDLRVLVTTGGMPSSHSALVTALATG  63

Query  503  VALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLK  327
            V    G + S F +   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +Q +LK
Sbjct  64   VGQTIGWSSSEFALATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFYEHPEFNQDRLK  123

Query  326  ELLGHTPSQVI  294
            ELLGHTP QVI
Sbjct  124  ELLGHTPFQVI  134



>ref|WP_014183540.1| membrane protein [Desulfosporosinus orientis]
 ref|YP_004969234.1| hypothetical protein Desor_1045 [Desulfosporosinus orientis DSM 
765]
 gb|AET66719.1| hypothetical protein Desor_1045 [Desulfosporosinus orientis DSM 
765]
Length=146

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 81/128 (63%), Gaps = 0/128 (0%)
 Frame = -1

Query  689  PFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALT  510
            P +  +  N    S L+AW  AQ  K+ +  C+ RK+D  +M +SGG PSSHSA+ +AL+
Sbjct  2    PIIPGIFHNTILNSALVAWFCAQFLKLIINLCLIRKFDIHLMVSSGGFPSSHSAIVSALS  61

Query  509  ASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKL  330
              +   +G    +F     FS+IV+YDA GVRR AG QA+VLN +VE L+    ++Q +L
Sbjct  62   LGIGRYYGWDSPMFAAAAVFSMIVLYDAAGVRRAAGKQAEVLNQLVERLYHGPDLTQERL  121

Query  329  KELLGHTP  306
            KEL+GHTP
Sbjct  122  KELIGHTP  129



>gb|AAC00597.1| Hypothetical protein [Arabidopsis thaliana]
Length=181

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 1/123 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S + ++ +AQ  K+F  +  ER+WD + +  SGGMPSSHSA  TAL  ++ L  G
Sbjct  22   NYPLISAVTSFTIAQFIKLFTSWYRERRWDLKQLIGSGGMPSSHSATVTALAVAIGLQEG  81

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  82   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESRPLRELLGHT  141

Query  308  PSQ  300
            P Q
Sbjct  142  PPQ  144



>ref|XP_008803556.1| PREDICTED: uncharacterized protein LOC103717088 [Phoenix dactylifera]
Length=171

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 84/129 (65%), Gaps = 1/129 (1%)
 Frame = -1

Query  680  ATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASV  501
            ++LAANP+ VS  LA+  AQ  K+F  +  E++WD + +  SGGMPSSHSA   AL  ++
Sbjct  25   SSLAANPSLVSAFLAFSFAQFLKLFTTWFKEKRWDSKRLLESGGMPSSHSATVAALAVAI  84

Query  500  ALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKE  324
             L  G   S F + +  + IVMYDA G+R HAG QA++LN IV +L   HP+S  R L+E
Sbjct  85   GLQEGTGSSSFALAVILASIVMYDASGIRLHAGQQAELLNQIVCELPSEHPLSSVRPLRE  144

Query  323  LLGHTPSQV  297
             LGHTP QV
Sbjct  145  PLGHTPLQV  153



>ref|NP_001045113.1| Os01g0901800 [Oryza sativa Japonica Group]
 dbj|BAD82771.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD82112.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF07027.1| Os01g0901800 [Oryza sativa Japonica Group]
 gb|EAY76856.1| hypothetical protein OsI_04815 [Oryza sativa Indica Group]
 gb|EAZ14517.1| hypothetical protein OsJ_04440 [Oryza sativa Japonica Group]
 dbj|BAG91859.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 81/125 (65%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ LL + VAQS K F+    E +WD + +  SGGMPSSHSA  TAL  ++    G
Sbjct  24   NYPLVAALLGFAVAQSIKFFVTRYKENRWDPKQLIGSGGMPSSHSATVTALAVAIGFQDG  83

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               +LF     F+ +VMYDA G+R HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  84   FGCALFATAAIFASVVMYDASGIRLHAGKQAEVLNQIVCELPSEHPLSETRPLRELLGHT  143

Query  308  PSQVI  294
            P+QV+
Sbjct  144  PTQVV  148



>ref|WP_013190731.1| membrane protein [Trichormus azollae]
 ref|YP_003720836.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
['Nostoc azollae' 0708]
 gb|ADI63713.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
['Nostoc azollae' 0708]
Length=151

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +  L+A  VAQ  K+ ++    RK D R++  +GGMPS+HSAL TAL A V    G
Sbjct  10   NRVLLVALVACFVAQGLKLIVEVIKHRKIDMRVLVTTGGMPSAHSALVTALAAGVGQTLG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A   F V + F++IVMYDA GVR+ AG QA++LN ++++LF   P  SQ +LKELLGHT
Sbjct  70   WASPDFAVAVIFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEKPEFSQDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PVQVI  134



>gb|KFK41167.1| hypothetical protein AALP_AA2G094500 [Arabis alpina]
Length=173

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S ++A+ +AQ  K F  +  ER+ D + +  SGGMPSSHSA  TAL+ +V L  G
Sbjct  28   NYPLISAVVAFTIAQLIKFFTSWYKERRCDLKRLVGSGGMPSSHSATVTALSLAVGLQEG  87

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRK-LKELLGHT  309
               S F + L  + IVMYDA GVR HAG QA+VLN IV +L   HP+++   L+ELLGHT
Sbjct  88   FGGSHFAIALILTSIVMYDATGVRLHAGRQAEVLNQIVYELPAEHPLAESIPLRELLGHT  147

Query  308  PSQVI  294
            PSQV+
Sbjct  148  PSQVV  152



>emb|CDY03897.1| BnaC07g11220D [Brassica napus]
Length=168

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +S   A+ +AQ  K+F  +  ER+WD + +  SGGMPSSHS+  TAL  ++ L  G
Sbjct  21   NYPLISAFTAFAIAQFIKLFTSWYRERRWDLKQLLGSGGMPSSHSSTVTALAVAIGLQEG  80

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               S F + L  + +VMYDA GVR HAG QA+VLN IV +L   HP+++ R L+ELLGHT
Sbjct  81   FGGSHFAIALILASVVMYDATGVRLHAGRQAEVLNQIVFELPAQHPLAESRPLRELLGHT  140

Query  308  PSQVI  294
            P Q +
Sbjct  141  PPQQV  145



>ref|WP_034597146.1| membrane protein [Desulfosporosinus sp. HMP52]
 gb|KGK91718.1| membrane protein [Desulfosporosinus sp. HMP52]
Length=146

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -1

Query  689  PFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALT  510
            PF   +  N   +S + AW  AQ  KV +   V RK +F +  +SGG PSSHSA+ +AL 
Sbjct  2    PFFLGIFHNAILISAITAWFSAQFLKVIVNLIVIRKLNFSLFFSSGGFPSSHSAMVSALA  61

Query  509  ASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKL  330
              V   HG    +F V   F ++V+YDA GVRR AG QA+VLN ++E L+    ++Q++L
Sbjct  62   LGVGKYHGWDSPIFAVAAVFLIVVLYDATGVRRAAGKQAEVLNKLIEFLYHGPDLAQKRL  121

Query  329  KELLGHTPSQV  297
            KEL+GHTP +V
Sbjct  122  KELIGHTPFEV  132



>ref|XP_004970952.1| PREDICTED: uncharacterized protein LOC101784880 isoform X2 [Setaria 
italica]
Length=167

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V+ +L + +AQS K F+ +  E +WD + +  SGGMPSSHSA  TAL  ++    G
Sbjct  26   NYPLVAAMLGFAIAQSIKFFVTWYKENRWDPKQLIGSGGMPSSHSATVTALAVAIGFQDG  85

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQ-RKLKELLGHT  309
               SLF     F+ +VMYDA G+R HAG QA+VLN IV +L   HP+S+ R L+ELLGHT
Sbjct  86   FNCSLFATATIFASVVMYDASGIRLHAGKQAEVLNQIVCELPSEHPLSEARPLRELLGHT  145

Query  308  PSQVI  294
            P+QV+
Sbjct  146  PTQVV  150



>ref|WP_009460306.1| MULTISPECIES: membrane protein [Fischerella]
 gb|EHC08441.1| acid phosphatase/vanadium-dependent haloperoxidase related protein 
[Fischerella sp. JSC-11]
Length=152

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 83/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V  L+A L+AQ+ K+ ++    RK +  ++  +GGMPS+HSAL TAL   V   HG
Sbjct  10   NRVLVVALVACLMAQALKLIIELVKNRKLNVSVLVTTGGMPSAHSALVTALAVGVGQTHG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F +   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +  +LKELLGHT
Sbjct  70   WASAEFALATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEHPEFTGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_014901978.1| membrane protein [Desulfosporosinus meridiei]
 ref|YP_006620930.1| hypothetical protein Desmer_1035 [Desulfosporosinus meridiei 
DSM 13257]
 gb|AFQ43059.1| hypothetical protein Desmer_1035 [Desulfosporosinus meridiei 
DSM 13257]
Length=146

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 0/131 (0%)
 Frame = -1

Query  689  PFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALT  510
            PF   +  N   +S + AW  AQ  KV +   V RK +F +  +SGG PSSHSA+ +AL 
Sbjct  2    PFFLGIFHNTILISAITAWFSAQFLKVIVNLIVIRKLNFSLFFSSGGFPSSHSAMVSALA  61

Query  509  ASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHPMSQRKL  330
              V   HG    +F V   F ++V+YDA GVRR AG QA+VLN ++E L+    ++Q++L
Sbjct  62   LGVGKYHGWDSPIFAVAAVFLIVVLYDATGVRRAAGKQAEVLNKLIEFLYHGPDLAQKRL  121

Query  329  KELLGHTPSQV  297
            KEL+GHTP +V
Sbjct  122  KELIGHTPFEV  132



>ref|WP_016859662.1| MULTISPECIES: membrane protein [Fischerella]
Length=152

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V  L A L+AQ+ K+ ++    RK +  ++  +GGMPS+HSAL TAL   V   HG
Sbjct  10   NRVLVVALFACLMAQALKLIIELVKNRKLNVSVLVTTGGMPSAHSALVTALAVGVGQTHG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F +   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +  +LKELLGHT
Sbjct  70   WASAEFALATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEHPEFTGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_017302090.1| membrane protein [Nodosilinea nodulosa]
Length=151

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   +  L+A L AQ  K  ++    RK + R+M  +GGMPS+HSAL TAL   +    G
Sbjct  10   NHVLIVALIACLTAQVLKAIIELVRHRKLNLRVMVGTGGMPSAHSALVTALACGIGQTLG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A  LF     FS+IVMYDA GVR+ AG QA+VLN I+++LF+  P + + +LKELLGHT
Sbjct  70   WASPLFAATSVFSIIVMYDAAGVRQAAGKQAKVLNQIIDELFQEKPELREDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_017313375.1| membrane protein [Fischerella sp. PCC 9339]
Length=152

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 82/125 (66%), Gaps = 1/125 (1%)
 Frame = -1

Query  665  NPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVALCHG  486
            N   V  L A L+AQ+ K+ ++    RK +  ++  +GGMPS+HSAL TAL   V   HG
Sbjct  10   NRVLVVALFACLMAQALKLIIELIKNRKLNVSVLVTTGGMPSAHSALVTALAVGVGQTHG  69

Query  485  VADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLFKWHP-MSQRKLKELLGHT  309
             A + F +   F++IVMYDA GVR+ AG QA++LN ++++LF  HP  +  +LKELLGHT
Sbjct  70   WASAEFALATVFAIIVMYDAAGVRQAAGKQARILNQMIDELFHEHPEFTGDRLKELLGHT  129

Query  308  PSQVI  294
            P QVI
Sbjct  130  PFQVI  134



>ref|WP_020491638.1| membrane protein [Dehalobacter sp. FTH1]
Length=152

 Score =   115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 88/139 (63%), Gaps = 7/139 (5%)
 Frame = -1

Query  695  ISPFVATLAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTA  516
            ++P  + L  N  ++S L AW++AQ  K+ + F +E+KWDF ++ +SGG PSSH+A+  A
Sbjct  1    MNPISSILHNNIMWIS-LFAWILAQILKILINFVIEKKWDFDLLTSSGGFPSSHTAIVCA  59

Query  515  LTASVALCHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDL------FKW  354
            L  ++    G   SLF + +  ++IVMYDA GVRR AG  A+++N +VE +      F  
Sbjct  60   LAITIGKIDGWDSSLFAIAVTLAVIVMYDAAGVRRAAGNHARIINYLVEWMRQHPTDFMG  119

Query  353  HPMSQRKLKELLGHTPSQV  297
            + + + K KEL+GHTP +V
Sbjct  120  YNIQEEKFKELIGHTPFEV  138



>ref|WP_038027283.1| acid phosphatase [Synechococcus sp. PCC 7336]
Length=150

 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  674  LAANPTFVSGLLAWLVAQSSKVFLKFCVERKWDFRMMCASGGMPSSHSALCTALTASVAL  495
            LAAN      LL+ L+AQ+ K+ +++    K DF ++  +GGMPSSH+AL TAL   V L
Sbjct  4    LAANRLLWMALLSSLIAQAFKLLIRYLQSGKIDFHVLVETGGMPSSHAALVTALAFGVGL  63

Query  494  CHGVADSLFPVCLGFSLIVMYDAIGVRRHAGMQAQVLNLIVEDLF-KWHPMSQRKLKELL  318
              G    LF V   F+ IVMYDA G+R+ AG QA+VLN ++E+LF + H   + +LKELL
Sbjct  64   QEGWDSVLFAVSSVFAFIVMYDAAGIRQAAGKQARVLNQMLEELFGEKHEFKEVRLKELL  123

Query  317  GHTPSQVI  294
            GHTP QVI
Sbjct  124  GHTPIQVI  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764