BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81706_g1_i1 len=585 path=[563:0-584]

Length=585
                                                                      Score     E

ref|XP_002889341.1|  hypothetical protein ARALYDRAFT_333455             100   6e-21   
ref|NP_171705.1|  C2H2-like zinc finger protein                       96.7    1e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42573.1|  hypothetical protein AALP_AA1G013200                  93.6    1e-19   
ref|XP_002320706.2|  zinc finger family protein                       91.7    9e-19   Populus trichocarpa [western balsam poplar]
ref|XP_011081260.1|  PREDICTED: zinc finger protein ZAT1-like         89.7    3e-18   
gb|EYU33551.1|  hypothetical protein MIMGU_mgv1a018149mg              86.7    4e-17   
ref|XP_006368233.1|  hypothetical protein POPTR_0001s00800g           83.6    4e-16   
gb|AAY40249.1|  Cys2/His2 zinc-finger transcription factor            83.2    7e-16   Silene latifolia
ref|XP_006418480.1|  hypothetical protein EUTSA_v10009894mg           82.8    1e-15   
ref|XP_002301264.1|  zinc finger family protein                       82.8    1e-15   Populus trichocarpa [western balsam poplar]
emb|CDY41155.1|  BnaA09g38600D                                        81.3    3e-15   
emb|CDX71799.1|  BnaC08g30750D                                        80.5    4e-15   
emb|CDY71582.1|  BnaCnng73530D                                        76.6    1e-13   
ref|XP_009142317.1|  PREDICTED: zinc finger protein ZAT4-like         76.6    1e-13   
emb|CBI16586.3|  unnamed protein product                              76.3    1e-13   
ref|NP_191617.1|  C2H2-like zinc finger protein                       76.3    1e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43008.1|  putative zinc finger protein                         75.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006355440.1|  PREDICTED: zinc finger protein ZAT1-like         74.7    7e-13   
gb|KFK37304.1|  hypothetical protein AALP_AA4G239800                  73.9    8e-13   
ref|XP_004246154.1|  PREDICTED: zinc finger protein ZAT1-like         73.2    2e-12   
ref|XP_004133770.1|  PREDICTED: zinc finger protein ZAT9-like         73.6    2e-12   
emb|CAN72592.1|  hypothetical protein VITISV_003575                   72.0    3e-12   Vitis vinifera
ref|XP_003525852.1|  PREDICTED: zinc finger protein ZAT4-like         72.4    3e-12   
ref|XP_009591197.1|  PREDICTED: zinc finger protein ZAT1-like         72.0    6e-12   
ref|XP_009615913.1|  PREDICTED: zinc finger protein ZAT9              72.4    6e-12   
ref|XP_009116736.1|  PREDICTED: zinc finger protein ZAT9-like         72.0    8e-12   
emb|CDY48363.1|  BnaC04g22120D                                        70.5    2e-11   
ref|XP_003517016.1|  PREDICTED: zinc finger protein ZAT9-like         71.6    2e-11   
emb|CDY27394.1|  BnaC04g50110D                                        70.1    2e-11   
dbj|BAA21927.1|  ZPT3-3                                               70.1    2e-11   Petunia x hybrida [garden petunia]
ref|XP_006291511.1|  hypothetical protein CARUB_v10017660mg           70.1    4e-11   
emb|CDX83402.1|  BnaA03g21040D                                        68.2    1e-10   
ref|XP_009758380.1|  PREDICTED: zinc finger protein ZAT9-like         68.2    2e-10   
gb|KCW90848.1|  hypothetical protein EUGRSUZ_A02901                   67.4    2e-10   
ref|XP_007155662.1|  hypothetical protein PHAVU_003G221000g           67.4    2e-10   
gb|EYU31947.1|  hypothetical protein MIMGU_mgv1a021269mg              67.4    3e-10   
ref|XP_002876568.1|  zinc finger family protein                       66.6    5e-10   
ref|XP_007038350.1|  C2H2 zinc finger protein, putative               67.0    5e-10   
ref|XP_010512387.1|  PREDICTED: zinc finger protein ZAT9-like         67.0    5e-10   
ref|XP_006587702.1|  PREDICTED: zinc finger protein ZAT9-like         65.9    1e-09   
ref|XP_004242283.1|  PREDICTED: zinc finger protein ZAT4              65.5    1e-09   
gb|KFK35261.1|  hypothetical protein AALP_AA5G262300                  64.7    2e-09   
gb|AHN52236.1|  C2H2-type zinc finger protein 5                       64.3    2e-09   
ref|XP_009389680.1|  PREDICTED: zinc finger protein ZAT1-like         64.3    3e-09   
emb|CDX67836.1|  BnaA07g18760D                                        63.9    5e-09   
ref|XP_009104273.1|  PREDICTED: zinc finger protein ZAT9-like         63.5    5e-09   
ref|XP_009759748.1|  PREDICTED: zinc finger protein ZAT1-like         63.9    6e-09   
ref|XP_009139311.1|  PREDICTED: zinc finger protein ZAT9-like         62.4    1e-08   
ref|XP_010527285.1|  PREDICTED: zinc finger protein ZAT1              62.4    1e-08   
ref|XP_003549916.1|  PREDICTED: zinc finger protein ZAT4-like         62.4    1e-08   
ref|XP_008376981.1|  PREDICTED: zinc finger protein ZAT9-like         62.8    2e-08   
ref|XP_009372862.1|  PREDICTED: zinc finger protein ZAT9-like         62.0    2e-08   
ref|XP_002278670.1|  PREDICTED: zinc finger protein ZAT4-like         62.0    3e-08   Vitis vinifera
ref|XP_010025302.1|  PREDICTED: zinc finger protein ZAT9-like         61.6    3e-08   
ref|XP_003635129.2|  PREDICTED: zinc finger protein ZAT4              62.0    3e-08   
emb|CAN66783.1|  hypothetical protein VITISV_013510                   62.0    4e-08   Vitis vinifera
ref|XP_006347910.1|  PREDICTED: zinc finger protein ZAT9-like         61.2    5e-08   
ref|XP_010469165.1|  PREDICTED: zinc finger protein ZAT9-like         60.8    6e-08   
emb|CDX89061.1|  BnaA04g01250D                                        60.5    6e-08   
ref|NP_001239999.1|  uncharacterized protein LOC100780611             60.8    9e-08   
gb|KHM99419.1|  Zinc finger protein ZAT9                              60.5    9e-08   
ref|XP_007219537.1|  hypothetical protein PRUPE_ppa021631mg           60.5    9e-08   
emb|CBI27269.3|  unnamed protein product                              60.5    1e-07   
ref|XP_009385850.1|  PREDICTED: zinc finger protein ZAT1-like         59.7    2e-07   
ref|XP_002528915.1|  hypothetical protein RCOM_1060190                56.6    2e-07   Ricinus communis
ref|XP_011017454.1|  PREDICTED: zinc finger protein ZAT4-like         59.7    2e-07   
ref|XP_010258927.1|  PREDICTED: zinc finger protein ZAT1-like         59.3    2e-07   
ref|XP_010451043.1|  PREDICTED: zinc finger protein ZAT3-like         58.5    3e-07   
ref|XP_002511651.1|  zinc finger protein, putative                    58.5    3e-07   Ricinus communis
ref|XP_007211271.1|  hypothetical protein PRUPE_ppa017179mg           57.8    3e-07   
gb|KDO85696.1|  hypothetical protein CISIN_1g044606mg                 58.9    3e-07   
ref|XP_011033847.1|  PREDICTED: zinc finger protein ZAT9-like iso...  58.9    3e-07   
ref|XP_011033839.1|  PREDICTED: zinc finger protein ZAT9-like iso...  58.9    3e-07   
ref|XP_002304278.2|  hypothetical protein POPTR_0003s07490g           58.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011018344.1|  PREDICTED: zinc finger protein ZAT9-like         58.5    4e-07   
ref|XP_009370510.1|  PREDICTED: uncharacterized protein LOC103959863  58.9    4e-07   
ref|XP_007157307.1|  hypothetical protein PHAVU_002G058900g           58.2    5e-07   
ref|XP_010264306.1|  PREDICTED: zinc finger protein ZAT1-like         58.2    5e-07   
gb|KGN56354.1|  hypothetical protein Csa_3G117400                     58.2    5e-07   
ref|XP_010444960.1|  PREDICTED: zinc finger protein ZAT3-like         57.8    5e-07   
ref|XP_008238519.1|  PREDICTED: zinc finger protein ZAT4              58.2    6e-07   
gb|KDP28801.1|  hypothetical protein JCGZ_14572                       58.2    6e-07   
ref|XP_003611310.1|  Cys2/His2 zinc-finger transcription factor       57.4    7e-07   
ref|XP_003517971.1|  PREDICTED: zinc finger protein ZAT9-like         58.2    7e-07   
ref|XP_007140808.1|  hypothetical protein PHAVU_008G143900g           57.8    7e-07   
gb|KDP39875.1|  hypothetical protein JCGZ_03406                       57.4    1e-06   
ref|XP_006445328.1|  hypothetical protein CICLE_v10020499mg           57.4    1e-06   
ref|XP_010544363.1|  PREDICTED: zinc finger protein ZAT1              57.0    1e-06   
gb|AAY40250.1|  Cys2/His2 zinc-finger transcription factor            57.0    1e-06   Silene latifolia
ref|XP_006838141.1|  hypothetical protein AMTR_s00106p00088880        57.0    1e-06   
ref|XP_010112022.1|  Zinc finger protein ZAT9                         56.6    2e-06   
gb|ADL36623.1|  C2H2L domain class transcription factor               56.6    2e-06   
ref|XP_008376003.1|  PREDICTED: zinc finger protein ZAT9-like         56.6    2e-06   
ref|XP_008437783.1|  PREDICTED: zinc finger protein ZAT9              56.6    2e-06   
ref|XP_010325535.1|  PREDICTED: zinc finger protein ZAT9-like         56.2    3e-06   
ref|XP_010110834.1|  Zinc finger protein ZAT9                         55.8    3e-06   
ref|XP_008644480.1|  PREDICTED: zinc finger protein 1-like            55.8    3e-06   
ref|XP_006279684.1|  hypothetical protein CARUB_v10026997mg           55.1    4e-06   
ref|XP_006421633.1|  hypothetical protein CICLE_v10007101mg           55.5    4e-06   
ref|XP_009334508.1|  PREDICTED: zinc finger protein ZAT4              55.5    5e-06   
ref|XP_009780461.1|  PREDICTED: zinc finger protein ZAT1-like         54.3    5e-06   
ref|XP_009340565.1|  PREDICTED: zinc finger protein ZAT9-like         55.1    5e-06   
ref|XP_008369456.1|  PREDICTED: zinc finger protein ZAT4              55.1    5e-06   
ref|XP_008355579.1|  PREDICTED: zinc finger protein ZAT4-like         55.1    5e-06   
ref|XP_006412124.1|  hypothetical protein EUTSA_v10025912mg           55.1    6e-06   
ref|XP_007219458.1|  hypothetical protein PRUPE_ppa021208mg           55.1    7e-06   
ref|XP_010038418.1|  PREDICTED: zinc finger protein ZAT1-like         54.7    8e-06   
ref|XP_010053941.1|  PREDICTED: zinc finger protein ZAT9              54.7    8e-06   
gb|KDO61436.1|  hypothetical protein CISIN_1g021090mg                 54.7    9e-06   
gb|KCW78318.1|  hypothetical protein EUGRSUZ_D02497                   54.7    9e-06   
ref|XP_006477184.1|  PREDICTED: zinc finger protein ZAT4-like         54.3    1e-05   
ref|XP_006440308.1|  hypothetical protein CICLE_v10021224mg           54.3    1e-05   
ref|XP_010242904.1|  PREDICTED: zinc finger protein ZAT3-like         54.3    1e-05   
ref|XP_008346565.1|  PREDICTED: zinc finger protein ZAT4-like         54.3    1e-05   
gb|KEH16508.1|  C2H2-type zinc finger protein, putative               54.3    1e-05   
gb|KCW46301.1|  hypothetical protein EUGRSUZ_K00165                   53.9    1e-05   
ref|XP_007039829.1|  C2H2-like zinc finger protein, putative          54.3    1e-05   
ref|XP_002313585.1|  zinc finger family protein                       53.9    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004299433.1|  PREDICTED: zinc finger protein ZAT4-like         53.9    1e-05   
ref|XP_004306958.1|  PREDICTED: zinc finger protein ZAT9-like         53.9    2e-05   
ref|XP_010436252.1|  PREDICTED: zinc finger protein ZAT3-like         53.9    2e-05   
ref|XP_008232572.1|  PREDICTED: zinc finger protein ZAT9-like         53.9    2e-05   
ref|XP_006490224.1|  PREDICTED: uncharacterized protein LOC102613230  53.9    2e-05   
ref|XP_004147254.1|  PREDICTED: zinc finger protein ZAT9-like         53.1    2e-05   
ref|XP_010506448.1|  PREDICTED: zinc finger protein ZAT4-like         53.1    2e-05   
ref|XP_010919568.1|  PREDICTED: LOW QUALITY PROTEIN: zinc finger ...  53.1    3e-05   
ref|XP_008448104.1|  PREDICTED: zinc finger protein ZAT3              53.1    3e-05   
ref|XP_011090203.1|  PREDICTED: zinc finger protein ZAT4-like         53.1    3e-05   
ref|XP_002510972.1|  zinc finger protein, putative                    52.8    4e-05   Ricinus communis
ref|NP_195254.1|  DUO1 activated  zinc finger 2                       52.8    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28666.1|  unknown                                               52.4    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29190.1|  Cys2/His2 zinc-finger transcription factor            52.8    4e-05   
gb|KGN43335.1|  hypothetical protein Csa_7G024090                     52.4    5e-05   
ref|NP_179309.1|  protein DUO1-ACTIVATED ZINC FINGER 1                52.4    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294533.1|  hypothetical protein CARUB_v10023569mg           52.4    5e-05   
gb|KDP22438.1|  hypothetical protein JCGZ_26269                       52.4    5e-05   
ref|NP_001053505.1|  Os04g0552700                                     52.4    5e-05   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67411.1|  OSIGBa0143N19.5                                      52.4    6e-05   Oryza sativa [red rice]
ref|XP_010484494.1|  PREDICTED: zinc finger protein AZF1-like         52.0    6e-05   
ref|XP_004294605.1|  PREDICTED: zinc finger protein ZAT11-like        50.8    6e-05   
ref|XP_010934955.1|  PREDICTED: zinc finger protein ZAT1-like         52.0    6e-05   
emb|CDY08718.1|  BnaA06g25060D                                        51.6    7e-05   
ref|XP_002460947.1|  hypothetical protein SORBIDRAFT_02g038000        51.6    8e-05   Sorghum bicolor [broomcorn]
ref|XP_008234415.1|  PREDICTED: zinc finger protein ZAT9              51.6    8e-05   
ref|XP_002279570.1|  PREDICTED: zinc finger protein ZAT10             51.2    9e-05   Vitis vinifera
ref|XP_002867079.1|  zinc finger family protein                       51.6    9e-05   
emb|CDP09473.1|  unnamed protein product                              51.6    1e-04   
ref|XP_010692450.1|  PREDICTED: uncharacterized protein LOC104905560  52.0    1e-04   
gb|AAO16037.1|AF525022_1  zinc finger protein                         51.2    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201546.1|  zinc-finger protein 1                               51.2    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011081399.1|  PREDICTED: zinc finger protein ZAT1-like         51.6    1e-04   
ref|XP_010518124.1|  PREDICTED: zinc finger protein ZAT4-like         51.2    1e-04   
ref|XP_004516354.1|  PREDICTED: zinc finger protein ZAT1-like         50.1    1e-04   
emb|CDX95629.1|  BnaC03g25100D                                        51.2    1e-04   
ref|XP_010538415.1|  PREDICTED: zinc finger protein ZAT4-like         51.2    1e-04   
ref|XP_010508210.1|  PREDICTED: zinc finger protein ZAT4-like         51.2    1e-04   
ref|XP_009415446.1|  PREDICTED: zinc finger protein ZAT1-like         51.2    1e-04   
ref|XP_008236445.1|  PREDICTED: zinc finger protein ZAT10-like        50.8    1e-04   
ref|XP_010444644.1|  PREDICTED: zinc finger protein AZF1-like         50.8    1e-04   
ref|XP_008375818.1|  PREDICTED: zinc finger protein ZAT9-like         51.2    1e-04   
ref|XP_010467471.1|  PREDICTED: zinc finger protein ZAT2-like         50.8    2e-04   
ref|XP_009121152.1|  PREDICTED: zinc finger protein ZAT2              50.8    2e-04   
ref|XP_010515478.1|  PREDICTED: zinc finger protein ZAT2-like         50.8    2e-04   
ref|XP_006650277.1|  PREDICTED: zinc finger protein 1-like            50.4    2e-04   
ref|XP_010489335.1|  PREDICTED: zinc finger protein ZAT2-like         50.8    2e-04   
ref|NP_182037.1|  C2H2-like zinc finger protein                       50.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004494014.1|  PREDICTED: zinc finger protein ZAT4-like         50.8    2e-04   
ref|XP_011000896.1|  PREDICTED: zinc finger protein ZAT3-like         50.4    2e-04   
ref|XP_002880157.1|  hypothetical protein ARALYDRAFT_483645           50.4    2e-04   
ref|XP_010941146.1|  PREDICTED: zinc finger protein ZAT1-like         50.4    2e-04   
ref|XP_010053481.1|  PREDICTED: zinc finger protein ZAT4-like         50.4    2e-04   
ref|XP_008787063.1|  PREDICTED: zinc finger protein ZAT9-like         50.4    2e-04   
ref|XP_009400680.1|  PREDICTED: zinc finger protein ZAT9-like         50.4    2e-04   
ref|XP_006397693.1|  hypothetical protein EUTSA_v10001538mg           50.1    3e-04   
ref|XP_010413542.1|  PREDICTED: zinc finger protein ZAT9-like         50.1    3e-04   
ref|XP_011031881.1|  PREDICTED: zinc finger protein ZAT9              50.1    3e-04   
gb|ACF84121.1|  unknown                                               50.1    3e-04   Zea mays [maize]
emb|CDY09671.1|  BnaC07g33900D                                        49.3    3e-04   
emb|CDY40527.1|  BnaC01g19850D                                        49.3    3e-04   
ref|XP_009145673.1|  PREDICTED: zinc finger protein ZAT9-like iso...  49.3    3e-04   
ref|XP_009769205.1|  PREDICTED: zinc finger protein ZAT10-like        49.7    3e-04   
ref|XP_010524399.1|  PREDICTED: zinc finger protein ZAT4-like iso...  50.1    3e-04   
ref|XP_006828716.1|  hypothetical protein AMTR_s00001p00024970        50.1    3e-04   
ref|XP_007200425.1|  hypothetical protein PRUPE_ppa011060mg           49.7    3e-04   
ref|XP_009123026.1|  PREDICTED: zinc finger protein ZAT9-like         49.3    3e-04   
ref|XP_009594475.1|  PREDICTED: zinc finger protein ZAT3-like         50.1    4e-04   
emb|CDY69391.1|  BnaA03g58060D                                        49.3    4e-04   
ref|XP_008669045.1|  PREDICTED: zinc finger protein ZAT1-like         49.7    4e-04   
emb|CDX75488.1|  BnaA01g02140D                                        49.7    4e-04   
ref|XP_009136798.1|  PREDICTED: zinc finger protein ZAT1-like         49.3    4e-04   
emb|CDX72529.1|  BnaC07g45510D                                        49.7    4e-04   
ref|XP_004958179.1|  PREDICTED: zinc finger protein 1-like            49.7    4e-04   
emb|CDY50848.1|  BnaC08g47940D                                        49.3    4e-04   
gb|KFK26522.1|  hypothetical protein AALP_AA8G260100                  48.9    4e-04   
ref|XP_006393949.1|  hypothetical protein EUTSA_v10004839mg           49.3    4e-04   
gb|KDP29659.1|  hypothetical protein JCGZ_18821                       49.7    4e-04   
ref|XP_008449167.1|  PREDICTED: zinc finger protein ZAT4-like         49.3    4e-04   
gb|KFK28431.1|  hypothetical protein AALP_AA8G513800                  49.3    5e-04   
sp|Q42430.1|ZFP1_WHEAT  RecName: Full=Zinc finger protein 1; AltN...  49.3    5e-04   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006406484.1|  hypothetical protein EUTSA_v10021307mg           49.3    5e-04   
ref|XP_010494287.1|  PREDICTED: zinc finger protein AZF3-like         48.5    5e-04   
ref|XP_006409340.1|  hypothetical protein EUTSA_v10023020mg           49.3    5e-04   
ref|XP_010487903.1|  PREDICTED: zinc finger protein AZF2              49.3    6e-04   
ref|XP_006422435.1|  hypothetical protein CICLE_v10030233mg           49.3    6e-04   
emb|CDY32274.1|  BnaA01g17100D                                        48.5    6e-04   
ref|XP_010464022.1|  PREDICTED: zinc finger protein AZF1-like         48.9    6e-04   
ref|XP_002463836.1|  hypothetical protein SORBIDRAFT_01g007170        48.9    6e-04   Sorghum bicolor [broomcorn]
ref|XP_008437075.1|  PREDICTED: zinc finger protein ZAT9 isoform X3   48.5    7e-04   
ref|XP_008437073.1|  PREDICTED: zinc finger protein ZAT9 isoform X1   48.9    8e-04   
emb|CDY36493.1|  BnaC03g48520D                                        48.5    8e-04   
emb|CDY43576.1|  BnaC02g16730D                                        48.1    8e-04   
ref|XP_006650639.1|  PREDICTED: zinc finger protein 1-like            48.5    0.001   
gb|KEH32850.1|  C2H2 and C2HC zinc finger protein                     48.5    0.001   
gb|EPS65907.1|  zinc finger family protein                            47.8    0.001   
ref|XP_009796301.1|  PREDICTED: zinc finger protein ZAT3-like         48.5    0.001   



>ref|XP_002889341.1| hypothetical protein ARALYDRAFT_333455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65600.1| hypothetical protein ARALYDRAFT_333455 [Arabidopsis lyrata subsp. 
lyrata]
Length=872

 Score =   100 bits (250),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 63/171 (37%), Positives = 85/171 (50%), Gaps = 39/171 (23%)
 Frame = +3

Query  15   EKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDP----------TGKPAQ  164
            E+ KCKLCWK FANG+ALGGHMRSH  P   + P+   S   DP          + KP +
Sbjct  3    ERHKCKLCWKSFANGRALGGHMRSHMLP---SQPESASSSMADPLQDRESETESSKKPTR  59

Query  165  GRSKRARRLFVSEENEESADQGA--------------KNEEEMGK---TAKLEENIAMCL  293
             RS+  RR   S E  +S   GA                +E M      A  EE++A+ L
Sbjct  60   KRSRLNRR---SNEEGKSETAGAAEVKIGVQELSESCTEQEPMSSVCDAATEEEDVALSL  116

Query  294  LMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            ++LS D        ++ ++ K+ + F CE C  VFK  QALG HR +HR +
Sbjct  117  MLLSRD------KWEKEERGKNNKWFECETCEKVFKSYQALGEHRASHRKR  161



>ref|NP_171705.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
 sp|Q39092.1|ZAT1_ARATH RecName: Full=Zinc finger protein ZAT1 [Arabidopsis thaliana]
 emb|CAA67227.1| C2H2 zinc finger protein [Arabidopsis thaliana]
 gb|AAC24367.1| C2H2 zinc finger protein [Arabidopsis thaliana]
 dbj|BAH30259.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE27369.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
Length=267

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/196 (34%), Positives = 92/196 (47%), Gaps = 41/196 (21%)
 Frame = +3

Query  15   EKQKCKLCWKEFANGKALGGHMRSH--FAPLPMTPPQKQDSGGVDP-------------T  149
            E+ KCKLCWK FANG+ALGGHMRSH    PLP + P+   S   DP             +
Sbjct  3    ERHKCKLCWKSFANGRALGGHMRSHMLIHPLP-SQPESYSSSMADPGFVLQDRESETESS  61

Query  150  GKPAQGRSKRARRLFVSEENEESADQGAK-------------------NEEE----MGKT  260
             KP++ RS+  RR   S  +++S ++G                      E+E    +   
Sbjct  62   KKPSRKRSRLNRRSISSLRHQQSNEEGKSETARAADIKIGVQELSESCTEQEPMSSVSDA  121

Query  261  AKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN--FRCEICNGVFKCSQALGSHRTA  434
            A  EE++A+ L++LS D           ++ K K N  F CE C  VFK  QALG HR +
Sbjct  122  ATTEEDVALSLMLLSRDKWEKEEEESDEERWKKKRNKWFECETCEKVFKSYQALGGHRAS  181

Query  435  HRNKTVNAGAGAGEKL  482
            H+ K         ++L
Sbjct  182  HKKKIAETDQLGSDEL  197



>gb|KFK42573.1| hypothetical protein AALP_AA1G013200 [Arabis alpina]
Length=267

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 90/188 (48%), Gaps = 37/188 (20%)
 Frame = +3

Query  15   EKQKCKLCWKEFANGKALGGHMRSH--FAPLPMTP-------PQKQDSGGVDPTGKPAQG  167
            EK KCKLCWK F NG+ALGGHMRSH    PLP  P       P +      + + KP + 
Sbjct  3    EKHKCKLCWKSFVNGRALGGHMRSHMLLHPLPSQPESASSSMPDQDRESETESSKKPTRK  62

Query  168  RSKRARR-LFVS-----EENEESADQGA--------KNEEEMGKT-------------AK  266
            RS+  RR  +VS     EE E+  +  A        K+ +E+ ++             A 
Sbjct  63   RSRLNRRSTYVSLHHQREEGEKKGETAAEVKTMIKPKSSQELSESCTEQEPMSSVSDAAT  122

Query  267  LEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
             EE++A  L+MLS D   +       +  K K+   CE C  VFK  QALG HR +H+ K
Sbjct  123  TEEDVAFSLMMLSRDKWEEEEESDDERWDKKKQK-TCETCGKVFKSYQALGGHRASHKKK  181

Query  447  TVNAGAGA  470
                G+ +
Sbjct  182  KALEGSSS  189



>ref|XP_002320706.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE99021.2| zinc finger family protein [Populus trichocarpa]
Length=307

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 92/205 (45%), Gaps = 64/205 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP------PQKQ------DSGGV-----  140
            MEK KCKLC+K F+NG+ALGGHMRSH   LP+ P      P  +      D+G V     
Sbjct  1    MEKHKCKLCFKSFSNGRALGGHMRSHLLKLPVPPKLEDQFPHIEFCFAAADAGSVVLQDR  60

Query  141  ----DPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKL-------------  269
                + +  P + RSKR  RL  +  ++    +  + +E      KL             
Sbjct  61   ESETESSKNPTRRRSKRTERLLENHHHQYHQQRPRQEQENNNIVKKLELKKMGTFKAAAE  120

Query  270  ------------------EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN------FRC  377
                              EE++A CL+MLS D        KR+++   +E+      ++C
Sbjct  121  SSSGQEPEPVSSISDTTTEEDVAFCLMMLSRD------RWKRKEQENQEEDRGLEEEYKC  174

Query  378  EICNGVFKCSQALGSHRTAHRNKTV  452
            E CN VFK  QALG HR +H+   V
Sbjct  175  ETCNKVFKSYQALGGHRASHKKLKV  199



>ref|XP_011081260.1| PREDICTED: zinc finger protein ZAT1-like [Sesamum indicum]
Length=272

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 91/193 (47%), Gaps = 51/193 (26%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP--PQKQDSGGVDPTGKPAQGRS----  173
            M   +CKLC K F+NGKALGGHMRSH+A LP+ P  PQ+Q+    DP   P +  S    
Sbjct  1    MAGMECKLCSKRFSNGKALGGHMRSHYAALPLPPKTPQRQEEEPSDP---PTESTSSFFS  57

Query  174  -----------------------------KRARRL---FVSEENEESADQGAKNEEEMGK  257
                                         KR R +   F   E+     +G  + E +  
Sbjct  58   CDEREGDERERESSAEKSSLSFGLREDPKKRLRLVDPEFFETESRFKRAKGVDDGEPL--  115

Query  258  TAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAH  437
               +EE++A+CL+MLS DV   S   +  +K      ++CE C+ VFK SQ LGSHR +H
Sbjct  116  ---MEEDVALCLVMLSRDVWRISEDSRTSEKV-----YKCERCDKVFKSSQGLGSHRASH  167

Query  438  RNKTVNAGAGAGE  476
              K  ++  G  +
Sbjct  168  FKKIKSSFDGFSD  180



>gb|EYU33551.1| hypothetical protein MIMGU_mgv1a018149mg [Erythranthe guttata]
Length=264

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 83/176 (47%), Gaps = 43/176 (24%)
 Frame = +3

Query  24   KCKLCWKEFANGKALGGHMRSHFAPLPMTP--PQKQD-----------------------  128
            +CKLC K+F NGKALGGHMRSH+A LP+ P  PQ+Q+                       
Sbjct  2    ECKLCSKKFINGKALGGHMRSHYATLPLPPKTPQRQELSEPPPPPPPPSSESTSSDERES  61

Query  129  -SGGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEM-GKTAK-----------L  269
             +G         +G  +++ RL   E  +  +D        +  K AK           +
Sbjct  62   STGEKSSLSYGLRGNPRKSYRLVDPEFYDVGSDASETESTRVRSKRAKVTTAAAATELGI  121

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAH  437
            EE +A+CL+MLS DV   S   +  +K       RCE C+ VFK SQ LGSHR +H
Sbjct  122  EEELALCLVMLSRDVWASSTESRTSQKVH-----RCESCDRVFKSSQGLGSHRASH  172



>ref|XP_006368233.1| hypothetical protein POPTR_0001s00800g [Populus trichocarpa]
 gb|ERP64802.1| hypothetical protein POPTR_0001s00800g [Populus trichocarpa]
Length=256

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 98/187 (52%), Gaps = 26/187 (14%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD-PTGKPAQGRSKR--  179
            MEK + CK+C + FANGKA+GGHMRSH A LP+ P         + P   P +  S R  
Sbjct  1    MEKTRICKICNRRFANGKAMGGHMRSHLAKLPLPPKPIPPQETYNTPKKSPPETESTREP  60

Query  180  -----ARRLFVSEENEESADQGAKNEEEMGKTAKL--EENIAMCLLMLS-DDVRGDSGTM  335
                  R    ++E  ES  +  ++ E++   + L  EE++A+CLLMLS D+   D+  +
Sbjct  61   TRRRSKRSRKSADEVAESMVKVTESSEQVSSISYLLAEEDVALCLLMLSRDNWSEDAKQV  120

Query  336  KR--------RKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVNA------GAGAG  473
            K+        R K K +  F+CE C   F+  QALG HR +H+   ++       G+G G
Sbjct  121  KKEDYLFGFTRAKYKSQGKFKCETCKKGFRSYQALGGHRASHKKIKIHEEHEEGNGSGCG  180

Query  474  EKLRNLG  494
            E  R++G
Sbjct  181  EDNRSVG  187



>gb|AAY40249.1| Cys2/His2 zinc-finger transcription factor [Silene latifolia]
Length=309

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 91/204 (45%), Gaps = 55/204 (27%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQG--------  167
            MEKQ+CKLC++ F+NG+ALGGHMRSH   +P+T   +          +P +G        
Sbjct  1    MEKQRCKLCYRRFSNGRALGGHMRSHMMNMPVTRKPELPVSSWTSESEPEEGEIIKGNSS  60

Query  168  ---------------------RSKRARRLFVS---------EENEESADQGAKNEEEMGK  257
                                 RSKRAR+   S         + + +S D    + E+   
Sbjct  61   SVTLQDRGSDTESTKNVTRMRRSKRARKPVSSILLRNSHDYKLSWDSFDNYYNDVEQQTG  120

Query  258  TAKL-----EENIAMCLLMLSDDVRGDSGTMKRRKKSKD------------KENFRCEIC  386
            ++ +     EE++A CL+M+S D    +    R    K+            K+ ++C+ C
Sbjct  121  SSSISEVTSEEDVAFCLMMMSRDKWHGNEHGHRHGYEKEFRNNVEIEPISYKKKYKCDTC  180

Query  387  NGVFKCSQALGSHRTAHRNKTVNA  458
            N VF+  QALG HR +H+   V A
Sbjct  181  NKVFRSYQALGGHRASHKKTRVTA  204



>ref|XP_006418480.1| hypothetical protein EUTSA_v10009894mg [Eutrema salsugineum]
 gb|ESQ36833.1| hypothetical protein EUTSA_v10009894mg [Eutrema salsugineum]
Length=286

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 88/203 (43%), Gaps = 54/203 (27%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFA--PLP--MTP-PQKQDSGGVDPTGKPAQGRSK  176
            ME++ CKLCWK F NG+ALGGHMRSH    PLP  + P P+   S   DP G   Q R  
Sbjct  1    MEEKYCKLCWKRFVNGRALGGHMRSHMLHHPLPSQVDPHPESASSLMADP-GFALQDRES  59

Query  177  RAR----------------RLFVSEENEESADQGAKNEEEMGKTAKL-------------  269
                                ++VS  ++E  ++G     E  KT K+             
Sbjct  60   ETESSKKPTRKRSRLTRRRSIYVSLRHQEPEEEGNSETAEEIKTMKVGPRTSQQLLSESC  119

Query  270  ----------------EENIAMCLLMLSDDVRG---DSGTMKRRKKSKDKENFRCEICNG  392
                            EE++A  L++LS D  G   +  +  R +  K ++ F CE C  
Sbjct  120  TEQEPKSSVSDAARTAEEDLAFSLVLLSRDKWGKEKEEESDDRIRWEKKRKWFECETCEK  179

Query  393  VFKCSQALGSHRTAHRNKTVNAG  461
            VFK  QALG HR +H+ K    G
Sbjct  180  VFKSYQALGGHRASHKKKRALEG  202



>ref|XP_002301264.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE80537.1| zinc finger family protein [Populus trichocarpa]
Length=332

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 96/246 (39%), Gaps = 83/246 (34%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ----------------DSGGV-  140
            MEK KCKLC+K F+NG+ALGGHMRSH   LP+ P  +                 D+G V 
Sbjct  1    MEKHKCKLCFKSFSNGRALGGHMRSHMLNLPIPPKLEDQFPDIEVNPEFSFAAVDAGSVV  60

Query  141  --------DPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEE------------MGKT  260
                    + +  P + RSKR + L   E + +   Q  + E+E            MG  
Sbjct  61   LQDRESETESSKNPTRRRSKRTKSLL--EHHHQYHQQRPRQEQENNIIIKKLEFKKMGTI  118

Query  261  --------------------AKLEENIAMCLLMLSDD----------------------V  314
                                   EE++A CL+MLS D                       
Sbjct  119  KAAAESSWGHEPEPVSSISGTTTEEDVAFCLVMLSRDKWKRKEQENQEEEQELEEELAEA  178

Query  315  RGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAG--EKLRN  488
              D     +  K+K +  ++CE CN VFK  QALG HR +H+   V   +     E+  N
Sbjct  179  ETDDSDEFKSCKTKTRGKYKCETCNKVFKSYQALGGHRASHKKLKVYTPSNEPKLERTEN  238

Query  489  LGVKNS  506
             G   S
Sbjct  239  AGASTS  244



>emb|CDY41155.1| BnaA09g38600D [Brassica napus]
Length=248

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 80/169 (47%), Gaps = 23/169 (14%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT--------PPQKQDSGGVDPTGKP---  158
            ME  KCK C+K F NG+ALGGHMRSH   L           P Q   + G+     P   
Sbjct  1    MESYKCKFCFKSFVNGRALGGHMRSHMPTLHKFSIQEEEERPSQLGQASGLREEKHPTMD  60

Query  159  ----AQGRSKRARRLFVSE---ENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDD--  311
                ++  S R  ++  S+   +NE  A+  A+  +        EE++A CL+MLS D  
Sbjct  61   DDDGSETESSRNIKMKTSQLGYKNELEAE--AEPPQSSASDTTTEEDLAFCLMMLSRDKW  118

Query  312  VRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAH-RNKTVN  455
             +   G    R  +  K  + CE C  VFK  QALG HR +H +N+  N
Sbjct  119  KKNKVGYKISRATTTTKGRYTCETCGKVFKSYQALGGHRASHKKNRVTN  167



>emb|CDX71799.1| BnaC08g30750D [Brassica napus]
Length=260

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 47/188 (25%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            ME  KCK C+K F NG+ALGGHMRSH   L     Q+++        +P+Q   +    +
Sbjct  1    MESYKCKFCFKSFVNGRALGGHMRSHMPTLHKFSIQEEEE-------RPSQLGDESKSDV  53

Query  192  FVSEENEESADQGAKNEEEMG----------------KTAKL------------------  269
              SEE +E    G++ E+                   KT++L                  
Sbjct  54   SSSEEGQEQKISGSREEKHPTMDDDGSETESSRDIKMKTSQLGYKNEPEAEPPQSSASDT  113

Query  270  --EENIAMCLLMLS-DDVRGD--SGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTA  434
              EE++A+CL+MLS D  R +  S  M  R  +  K  + CE C  VFK  QALG HR +
Sbjct  114  TTEEDLALCLMMLSRDKWRKNKVSDKMINRATTTTKGRYTCETCGKVFKSYQALGGHRAS  173

Query  435  H-RNKTVN  455
            H +N+  N
Sbjct  174  HKKNRVTN  181



>emb|CDY71582.1| BnaCnng73530D [Brassica napus]
Length=272

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 80/187 (43%), Gaps = 43/187 (23%)
 Frame = +3

Query  24   KCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD----SGGVDPT--------------  149
            KC+ C+K F NG+ALGGHMRSH   L     Q+++    S   D T              
Sbjct  6    KCRFCFKSFFNGRALGGHMRSHMPSLHKFSIQEEEGERASQVNDETESDVSSSSMMDDDD  65

Query  150  ---------------GKPAQGRSKRARRLFVSEENEESADQ-GAKNEEE------MGKTA  263
                             P + RSKR R+L      +  A Q G K E E           
Sbjct  66   PKVANESETESSRNITNPTRKRSKRTRKLETFATKKTKASQLGYKTEPECEPPHSSASDT  125

Query  264  KLEENIAMCLLMLSDDV---RGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTA  434
              +E++A CL++LS D    + +  T +   KS  K  F CE C  VFK  QALG HR +
Sbjct  126  TTDEDLAFCLMLLSRDKWMKKKNKATSEGYTKSSKKGRFTCETCGKVFKSYQALGGHRAS  185

Query  435  HRNKTVN  455
            H+   V+
Sbjct  186  HKKNRVS  192



>ref|XP_009142317.1| PREDICTED: zinc finger protein ZAT4-like [Brassica rapa]
 emb|CDY37027.1| BnaA04g26050D [Brassica napus]
Length=281

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 84/201 (42%), Gaps = 57/201 (28%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT-----PPQ-------------------  119
            ME+ KC+ C+K F NG ALGGHMRSH   L  +     P Q                   
Sbjct  1    MERYKCRFCFKSFINGSALGGHMRSHMLTLSSSKREERPSQLSEETESDASSSSSSDGDK  60

Query  120  ----------KQDSGGVDPTGKPAQGRSKRARRL--FVSEENEESADQGAKNEEEMGKTA  263
                      + +S  ++PT K    RSKR R+L  F  E  +    Q  + E      +
Sbjct  61   EEMEFGFSESETESSRINPTRK----RSKRTRKLGSFGFEFKKLKTSQLGETEHHHSSAS  116

Query  264  --KLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN--------------FRCEICNGV  395
                EE++A CL+MLS D        K+    ++ E+              F+CE C   
Sbjct  117  DTTTEEDLAFCLIMLSRDKWKQHNKTKQTLVEEEDESDHECKNRGRGGRGRFKCETCGKA  176

Query  396  FKCSQALGSHRTAHR-NKTVN  455
            FK  QALG HR +HR NKT  
Sbjct  177  FKSYQALGGHRASHRKNKTFT  197



>emb|CBI16586.3| unnamed protein product [Vitis vinifera]
Length=257

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 69/143 (48%), Gaps = 18/143 (13%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            MEK KCKLC++ F+NG+ALGGHMRSH   LP+ P Q+Q                K++ RL
Sbjct  21   MEKHKCKLCFRSFSNGRALGGHMRSHMLNLPIPPKQEQPKN------------PKKSIRL  68

Query  192  FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENF  371
               E +        + + ++ K +K E           + V   S        +  +  +
Sbjct  69   ADPEFSFAVDAASVQKKIKLDKLSKTES------WADPEPVSSISDATTEEDVAFSRGKY  122

Query  372  RCEICNGVFKCSQALGSHRTAHR  440
            +CE CN VF+  QALG HR +H+
Sbjct  123  KCETCNKVFRSYQALGGHRASHK  145



>ref|NP_191617.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
 sp|Q9M202.1|ZAT9_ARATH RecName: Full=Zinc finger protein ZAT9 [Arabidopsis thaliana]
 emb|CAB81844.1| zinc finger protein-like [Arabidopsis thaliana]
 gb|AEE80081.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
Length=288

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 88/202 (44%), Gaps = 55/202 (27%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFA--------PLPMTPPQKQDSGGVDP-------  146
            ME  KC++C+K F NGKALGGHMRSH +        P  ++   + D    DP       
Sbjct  1    MESYKCRVCFKSFVNGKALGGHMRSHMSNSHEEEQRPSQLSYETESDVSSSDPKFAFTSS  60

Query  147  ---------------TGKPAQGRSKRARRL--FVSEENEESADQGAKNEEEM------GK  257
                                + RSKR R+L  FV+++  +++  G K E +         
Sbjct  61   VLLEDGESESESSRNVINLTRKRSKRTRKLDSFVTKK-VKTSQLGYKPESDQEPPHSSAS  119

Query  258  TAKLEENIAMCLLMLSDDVRGDSGTMK----------------RRKKSKDKENFRCEICN  389
                EE++A CL+MLS D    + + K                +  ++  K  ++CE C 
Sbjct  120  DTTTEEDLAFCLMMLSRDKWKKNKSNKEVVEEIETEEESEGYNKINRATTKGRYKCETCG  179

Query  390  GVFKCSQALGSHRTAHRNKTVN  455
             VFK  QALG HR +H+   V+
Sbjct  180  KVFKSYQALGGHRASHKKNRVS  201



>dbj|BAC43008.1| putative zinc finger protein [Arabidopsis thaliana]
 gb|AAO63347.1| At3g60580 [Arabidopsis thaliana]
Length=288

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 88/202 (44%), Gaps = 55/202 (27%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFA--------PLPMTPPQKQDSGGVDP-------  146
            ME  KC++C+K F NGKALGGHMRSH +        P  ++   + D    DP       
Sbjct  1    MESYKCRVCFKSFVNGKALGGHMRSHMSNSHEEEQRPSQLSYETESDVSSSDPKFAFTSS  60

Query  147  ---------------TGKPAQGRSKRARRL--FVSEENEESADQGAKNEEEM------GK  257
                                + RSKR R+L  FV+++  +++  G K E +         
Sbjct  61   VLLEDGESESESSRNVINLTRKRSKRTRKLDSFVTKK-VKTSQLGYKPESDQEPPHSSAS  119

Query  258  TAKLEENIAMCLLMLSDDVRGDSGTMK----------------RRKKSKDKENFRCEICN  389
                EE++A CL+MLS D    + + K                +  ++  K  ++CE C 
Sbjct  120  DTTTEEDLAFCLMMLSRDKWKKNKSNKEVVEEIETEEESEGYNKINQATTKGRYKCETCG  179

Query  390  GVFKCSQALGSHRTAHRNKTVN  455
             VFK  QALG HR +H+   V+
Sbjct  180  KVFKSYQALGGHRASHKKNRVS  201



>ref|XP_006355440.1| PREDICTED: zinc finger protein ZAT1-like [Solanum tuberosum]
Length=298

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 95/226 (42%), Gaps = 81/226 (36%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSH---FAPLPMTPPQKQDSGG---------------  137
            MEK KCKLC K+F NGKALGGHMRSH       P TPP  QDSGG               
Sbjct  1    MEKHKCKLCSKKFLNGKALGGHMRSHLIPLPLPPKTPPLNQDSGGRSESTLSLCSSENQE  60

Query  138  -----------------------VDP----TGKPAQGRSKRARRLFVSEENEESADQGAK  236
                                   +DP     G   Q R         SE+N E+  +  +
Sbjct  61   DKVVEEKDFNYGLRENPKKSFRMIDPEFLEDGYVVQDRESETE----SEKNTENRRRSKR  116

Query  237  NEEEMGKTAKLEE------------------NIAMCLLMLSDDVRGDSGTMKRRKKSKDK  362
            N   +    ++EE                  +IAMCL+MLS D            KSK K
Sbjct  117  NRRMVENDERIEEVKVKIADFRSLNLYSDDADIAMCLMMLSTD-----------SKSKPK  165

Query  363  ENFRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKLRNLGVK  500
            ++ +C IC  VFK SQALGSH+T H+N+  N      EK R +  K
Sbjct  166  QH-QCGICYKVFKTSQALGSHKTIHKNR--NNYDNDEEKARKISSK  208



>gb|KFK37304.1| hypothetical protein AALP_AA4G239800 [Arabis alpina]
Length=262

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 85/182 (47%), Gaps = 35/182 (19%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKP-----------  158
            MEK KC++C+K F N +AL GHM+SH   L       Q S  V  +              
Sbjct  1    MEKYKCRVCFKSFINERALDGHMKSHMLNLEEQEKPSQLSNYVTESDTSSSSSDQEQEFD  60

Query  159  -------------AQGRSKRARRLFVSEENEESADQGAKNEEEMGKTA----KLEENIAM  287
                          + RSKR R+L   + + +     +  E E   ++      EE++A 
Sbjct  61   FAEEEESETESLITRKRSKRTRKLGSFDFDFKKLKGESVTELEQHHSSASDTTTEEDLAF  120

Query  288  CLLMLS-DDVRGDSGTMKRR----KKSKDKENFRCEICNGVFKCSQALGSHRTAHR--NK  446
            CL+MLS D  + +  TM ++    + SK +  F+CE CN VFK  QALG HR +H+  NK
Sbjct  121  CLIMLSRDKWKKNKKTMIKQDFEEEPSKIRGRFKCETCNKVFKSYQALGGHRASHKKNNK  180

Query  447  TV  452
            T 
Sbjct  181  TT  182



>ref|XP_004246154.1| PREDICTED: zinc finger protein ZAT1-like [Solanum lycopersicum]
Length=281

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 87/193 (45%), Gaps = 59/193 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSH---FAPLPMTPPQKQDSGG---------------  137
            MEK KCKLC K+  NGKALGGHMRSH       P TPP   DSGG               
Sbjct  1    MEKHKCKLCSKKLLNGKALGGHMRSHLIPLPLPPKTPPLNPDSGGRSESTLSLCSSENHE  60

Query  138  ------VDPTGKPAQGRSKRARRL---FVSEENEESADQGAKNEEEMGK-----TAKLEE  275
                   D   +  + R K  R +   F+  E++  +++  +N     K       K+ E
Sbjct  61   DKMVEEKDFNYELRENRKKSYRMIDPEFLDRESDTESEKNTENRRRRCKRNHERINKVNE  120

Query  276  N---------------IAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQ  410
            N               IAMCLLMLS           R  KS  K++ +C IC  VFK SQ
Sbjct  121  NISDFRSLNLYSDDSDIAMCLLMLS-----------RDSKSNPKQH-QCGICYKVFKTSQ  168

Query  411  ALGSHRTAHRNKT  449
            ALGSH+T H+N+ 
Sbjct  169  ALGSHKTIHKNRN  181



>ref|XP_004133770.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
 ref|XP_004173205.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
Length=317

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/216 (27%), Positives = 83/216 (38%), Gaps = 70/216 (32%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRA---  182
            M++ KCKLC++ F+NG+ALGGHMRSH   LP+ P   + S  VD      Q R       
Sbjct  1    MDRHKCKLCFRSFSNGRALGGHMRSHMLNLPLPPKDPEFSFAVDAASVVLQDRESETESS  60

Query  183  -----------------------------RRLFVSEENE-ESADQGAKNEEEMGKTAKLE  272
                                         +RL   + N  ES  +        G T   E
Sbjct  61   KNPTRRRSKRTRKPDRRHHHHLHHHYNVFKRLQEKKMNHPESWTEAEPVSSISGSTT--E  118

Query  273  ENIAMCLLMLSDD-----------------------------------VRGDSGTMKRRK  347
            E++A  L+MLS D                                      D     +  
Sbjct  119  EDVAFWLMMLSRDKWTKQQGGYEEEEDEEDEDEDEDEEEEEEELEESMEETDDSEAVKFP  178

Query  348  KSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
            K++++ N++CE CN VF+  QALG HR +H+   V+
Sbjct  179  KNRNRGNYKCETCNKVFRSYQALGGHRASHKKIKVS  214



>emb|CAN72592.1| hypothetical protein VITISV_003575 [Vitis vinifera]
Length=235

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 80/159 (50%), Gaps = 23/159 (14%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP-PQKQDSGG-----------VDPTGK  155
            ME  KCK+C+++F+N KALGGHMRSH A L + P PQK D+              D    
Sbjct  1    MESAKCKICFRQFSNRKALGGHMRSHMAKLSIQPKPQKPDNSSKFAVHDDQESETDTPKN  60

Query  156  PAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTM  335
             ++ RSKRA R    + +   +   +  ++         E+ A  L++LS + +   G  
Sbjct  61   QSRRRSKRACRSINKKADSPDSSVVSDVDDFSA------EDAAQLLVLLSRE-KWTRGKE  113

Query  336  KRRKKSKDKENF----RCEICNGVFKCSQALGSHRTAHR  440
               ++   ++NF    RCE CN  F+  QALG HR +H+
Sbjct  114  VDNEEXMKEDNFTIIYRCETCNKGFQSYQALGGHRASHK  152



>ref|XP_003525852.1| PREDICTED: zinc finger protein ZAT4-like [Glycine max]
 gb|KHN44071.1| Zinc finger protein ZAT9 [Glycine soja]
Length=265

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 85/186 (46%), Gaps = 47/186 (25%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP--------------------------  113
            M++ KCKLC + F+NG+ALGGHM++H A LP+ P                          
Sbjct  1    MDRHKCKLCSRSFSNGRALGGHMKAHLATLPLPPKPHSYSSSSDSEQEQEQESLNYALRE  60

Query  114  -PQK-------QDSGGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKL  269
             P+K       +D      +  P + RSKR R+  + +          +    +  T+  
Sbjct  61   NPKKSFRVADPEDRESETESRNPTRQRSKRNRKSTMPKLTPPPH-PEPEPLSSVSDTSP-  118

Query  270  EENIAMCLLMLSDDV-----RGDSGTMKRR--KKSKDKENFR----CEICNGVFKCSQAL  416
            EE++AMCL+MLS D        ++ T KRR    S+ K+N R    C  C+  F+ S+A 
Sbjct  119  EEDVAMCLMMLSRDTWQQHKHANAATPKRRCSSGSEIKKNVRGNHLCHKCHKSFRSSRAF  178

Query  417  GSHRTA  434
            GSHR  
Sbjct  179  GSHRNV  184



>ref|XP_009591197.1| PREDICTED: zinc finger protein ZAT1-like [Nicotiana tomentosiformis]
Length=301

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 44/71 (62%), Gaps = 12/71 (17%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM---TPPQKQDSGGVDPTGKPAQGRSKRA  182
            MEK KCKLC ++F NGKALGGHMRSH   LP+   TPP KQDSGG         GRS+  
Sbjct  1    MEKHKCKLCSRKFLNGKALGGHMRSHLMALPLSPKTPPLKQDSGG---------GRSQST  51

Query  183  RRLFVSEENEE  215
              L  SE  EE
Sbjct  52   LSLCSSENQEE  62


 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 69/130 (53%), Gaps = 15/130 (12%)
 Frame = +3

Query  105  MTPPQKQDSGGV--------DPTGKPAQGRSKRARRLFVS--EENEESADQGAKNEEEMG  254
            M  P+  D G V        +   KP   RSKR+ ++ V+  +E E+S D    +   + 
Sbjct  88   MIDPEFLDGGYVVQDRESETESIKKPTCRRSKRSNKMVVTVEKEKEKSVDFEPLS---LF  144

Query  255  KTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTA  434
              +  EE+IAMCL+MLS DV   S   K R K   K  ++C IC+ +FK SQALGSH+T 
Sbjct  145  SDSSSEEDIAMCLMMLSKDVWKSSQPSKLRPKHGKK--YQCGICHKMFKTSQALGSHKTI  202

Query  435  HRNKTVNAGA  464
            H+ K  N+  
Sbjct  203  HKIKNSNSST  212



>ref|XP_009615913.1| PREDICTED: zinc finger protein ZAT9 [Nicotiana tomentosiformis]
Length=313

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 91/170 (54%), Gaps = 26/170 (15%)
 Frame = +3

Query  18   KQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFV  197
            K+ CK+   EF +G    G +  H            +    + T KP + RSKR RR+F+
Sbjct  81   KKSCKIVDPEFLDG---AGSVVVH-----------DNESETESTKKPTRRRSKRTRRMFI  126

Query  198  SEEN--EESADQGAKNEEEMGKTAKL-----EENIAMCLLMLSDDV-RGDSGTMKRRKKS  353
            SE+   E   ++ A+ E E+   +       EE+IA+CL+MLS DV R   G+ + + ++
Sbjct  127  SEQEAVEVKKEKSAEFEPELEPVSSFSDTSPEEDIAICLMMLSKDVWRSSYGSDESKCRN  186

Query  354  KDKENFRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKLRNLGVKN  503
            + +  ++CEICN V K SQALGSH+T H+ +    G  + E  R L VKN
Sbjct  187  QKQGKYQCEICNKVLKSSQALGSHKTIHKIE----GIKSKENSRQLRVKN  232


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   MAMEKQKCKLCWKEFANGKALGGHMRSHF  92
           M+MEK KCKLC ++F++GKA+GGHMRSH 
Sbjct  1   MSMEKHKCKLCSRKFSSGKAMGGHMRSHL  29



>ref|XP_009116736.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
Length=321

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 77/216 (36%), Gaps = 68/216 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL--------PMTPPQKQDSGGVD--------  143
            ME  KCK C+K F NG+ALGGHMRSH   L           P Q  D    D        
Sbjct  25   MESYKCKFCFKSFVNGRALGGHMRSHMPTLHKFSIQEEEERPSQLGDESKSDVSSSEEGQ  84

Query  144  ---------PTGKPAQGRSKRARRLFV----------------SEENEESADQGAKNEEE  248
                     PT     G    + R  V                S +  +++  G KNE E
Sbjct  85   ASGLREEKHPTTDDDDGSETESSRNIVNLRRKRSKRTRKLDSFSSKKMKTSQLGYKNEPE  144

Query  249  M--------GKTAKLEENIAMCLLMLSDD------------------VRGDSGTMKRRKK  350
                           EE++A CL+MLS D                       G    R  
Sbjct  145  AEAEPPQSSASDTTTEEDLAFCLMMLSRDKWKKNKTSSSKEVLEEIETEASEGYKINRAT  204

Query  351  SKDKENFRCEICNGVFKCSQALGSHRTAH-RNKTVN  455
            +  K  + CE C  VFK  QALG HR +H +N+  N
Sbjct  205  TTTKGRYTCETCGKVFKSYQALGGHRASHKKNRVTN  240



>emb|CDY48363.1| BnaC04g22120D [Brassica napus]
Length=287

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 87/208 (42%), Gaps = 62/208 (30%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLP-------------------------MTPP  116
            ME  KCK C+K F N +AL GH+RSH   LP                          + P
Sbjct  1    MESYKCKFCFKSFVNERALDGHVRSHMPTLPNFCIEEEEEKVRPSQLSGDTESDVSSSSP  60

Query  117  QKQDSGGVDPTGKPA------------QGRSKRARRL-FVSEENEESADQGAKNEEEMGK  257
            +++    +D   K A            + RSKR R+L   + +  +++  G K E E   
Sbjct  61   EEERHRTMDDDQKFAFTGSQRNIINLTRKRSKRTRKLDSFATKKMKTSQLGYKTEPEPHH  120

Query  258  TA----KLEENIAMCLLMLSDD------------------VRGDSGTMKRRKKSKDKENF  371
            ++      +E++A CL+MLS D                  +  +S  M R   +K +  F
Sbjct  121  SSASDTTTDEDLAFCLMMLSRDKWKKKNKTSSSHKELVEEIDDNSSKMNRATTTKGR--F  178

Query  372  RCEICNGVFKCSQALGSHRTAHRNKTVN  455
             CE C  VFK  QALG HR +H+   V+
Sbjct  179  TCETCGKVFKSYQALGGHRASHKKNRVS  206



>ref|XP_003517016.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max]
Length=365

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 90/246 (37%), Gaps = 105/246 (43%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ----------------------  125
            MEK KCKLC + FANG+ALGGHMRSH   LP+ P Q +                      
Sbjct  1    MEKHKCKLCLRSFANGRALGGHMRSHMLNLPVPPKQSEFVPIQLSFEADSSPSQSSSSFY  60

Query  126  ----------------------DSGGV---------DPTGKPAQGRSKRARRLFVSEENE  212
                                  D+G V         + +  P + RSKRA +L    +  
Sbjct  61   GLRENPKKSFRFADPEFAFAAADTGSVILQDRESETESSRNPTRTRSKRAWQL--GGDGG  118

Query  213  ESADQGAKNEEEMGKTAKL---------------EENIAMCLLMLSDD------------  311
                   ++E+++ K  K+               EE++A CL+MLS D            
Sbjct  119  GGGGGSGESEKKIMKVCKISKTNESASSVSDTTREEDVAFCLMMLSRDKWKEENINNLLY  178

Query  312  ---------------------VRGDSGTMKRRKKSKDKE--NFRCEICNGVFKCSQALGS  422
                                   G     K  KKS +K    ++CE C  VF+  QALG 
Sbjct  179  DHDQDDDEDEEDDEEDENNEDDDGYESEEKSLKKSNNKVRGRYKCETCEKVFRSYQALGG  238

Query  423  HRTAHR  440
            HR +H+
Sbjct  239  HRASHK  244



>emb|CDY27394.1| BnaC04g50110D [Brassica napus]
Length=285

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 80/205 (39%), Gaps = 61/205 (30%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT----PPQ--------------------  119
            ME+ KC+ C K F NG ALGGHMRSH   L       P Q                    
Sbjct  1    MERYKCRFCLKSFINGSALGGHMRSHMLTLSSEREERPSQLSEETESDASSSSSSDDKKE  60

Query  120  --------KQDSGGVDPTGKPAQGRSKRARRL----FVSEENEESADQGAKNEEEMGKTA  263
                    + +S  ++PT K    RSKR R+L    F  ++ + S     ++        
Sbjct  61   MEFGFSESETESSRINPTRK----RSKRTRKLGSFGFDFKKVKTSQLGETEHHHSSASDT  116

Query  264  KLEENIAMCLLMLSDDVRGDSGTMKR----------RKKSKDKE----------NFRCEI  383
              EE++A CL+MLS D        K+               D E           F+CE 
Sbjct  117  TTEEDLAFCLIMLSRDKWKQQNKTKQTLVEEEEEEEEDDESDHECKNRGGGGRGRFKCET  176

Query  384  CNGVFKCSQALGSHRTAHR-NKTVN  455
            C   FK  QALG HR +HR NKT  
Sbjct  177  CGKAFKSYQALGGHRASHRKNKTFT  201



>dbj|BAA21927.1| ZPT3-3 [Petunia x hybrida]
 dbj|BAA96071.1| C2H2 zinc-finger protein ZPT3-3 [Petunia x hybrida]
Length=300

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 90/206 (44%), Gaps = 56/206 (27%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD-----------------SGG  137
            MEK K CKLC+++FANG+ALGGHMRSH   L +   Q  D                 +G 
Sbjct  1    MEKHKSCKLCFRKFANGRALGGHMRSHMMNLYVQKQQMTDEMEYSIPSSSWSSGEVAAGD  60

Query  138  VDPTG-----KPAQGRSKRARRLF----------VSEENEESADQGAKNEEEMGKTAKLE  272
             D +G     K ++  S R +  F          + +  E S+    +    + + +  E
Sbjct  61   ADDSGIVLPDKESETESSRNQAPFRKSKRSRKSRIVKVKEYSSLVDTEPVSSISENSP-E  119

Query  273  ENIAMCLLMLSDD---------------------VRGDSGTMKRRKKSK-DKENFRCEIC  386
            E++A CL+MLS D                       G+   +    K K  +  +RCE C
Sbjct  120  EDVAHCLMMLSRDKWIKQEYDDYSDDDEEEEKSEDSGELVKVTNSTKIKGSRGKYRCETC  179

Query  387  NGVFKCSQALGSHRTAHRNKTVNAGA  464
            N VF+  QALG HR +H+   V++ +
Sbjct  180  NKVFRSYQALGGHRASHKKIKVSSSS  205



>ref|XP_006291511.1| hypothetical protein CARUB_v10017660mg [Capsella rubella]
 gb|EOA24409.1| hypothetical protein CARUB_v10017660mg [Capsella rubella]
Length=317

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 86/229 (38%), Gaps = 81/229 (35%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD---------------------  128
            ME  KC+ C+K FANG+ALGGHMRSH  P      + +D                     
Sbjct  1    MESYKCRYCFKSFANGRALGGHMRSHIMPNLHVDDKDEDQERPSQLSYDTESDVSSSSSK  60

Query  129  --SGGVDP-----------------------TGKPAQGRSKRARRL--FVSEENEESADQ  227
              + G DP                            + RSKR R+L  F  ++  +++  
Sbjct  61   DKTNGDDPKFAFTSSLLLEEDGESETESSRNVINLTRKRSKRTRKLDSFALKKKVKTSQL  120

Query  228  GAKNEEE------MGKTAKLEENIAMCLLMLSDD--------------------------  311
            G K E +             EE++A CL+MLS D                          
Sbjct  121  GYKPESDPEPPHSSASDTTTEEDLAFCLMMLSRDKWKKNKSSSDKEVVKEIETDEEEEEE  180

Query  312  -VRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
               G +  + +  ++  K  ++CE C  VFK  QALG HR +H+   V+
Sbjct  181  SEEGYNNRLSKMNRATTKGRYKCETCGKVFKSYQALGGHRASHKKNRVS  229



>emb|CDX83402.1| BnaA03g21040D [Brassica napus]
Length=298

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 85/206 (41%), Gaps = 63/206 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLP-------MTPPQKQ---------------  125
            ME+ KC+ C+K F NG+ALGGHMRSH   LP       +T    Q               
Sbjct  1    MERYKCRFCFKSFLNGRALGGHMRSHMLTLPSKRELYELTERPSQLSEETESDASSSSDE  60

Query  126  --------DSGGVDPTGK-----PAQGRSKRARRL----FVSEENEESADQG-AKNEEEM  251
                    + GG +   +     P + RSKR R+L    F  ++ + S   G    E E 
Sbjct  61   QEEEEDHVNCGGFESETESSRMNPTRKRSKRTRKLGSLDFDFKKVKTSQPGGEVVTEPEH  120

Query  252  GKTAK---LEENIAMCLLMLSDD---------------VRGDSGTMKRRKKSKD-----K  362
              +A     EE++A CL+MLS D                       +  K SK+     +
Sbjct  121  HSSASDTTTEEDLAFCLIMLSRDKWKQQKNKTIVVEEEDHETDDEREDYKSSKNRGGRGR  180

Query  363  ENFRCEICNGVFKCSQALGSHRTAHR  440
              F+CE C  VF   QALG HR +H+
Sbjct  181  GRFKCETCGKVFNSYQALGGHRASHK  206



>ref|XP_009758380.1| PREDICTED: zinc finger protein ZAT9-like [Nicotiana sylvestris]
Length=321

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/178 (35%), Positives = 86/178 (48%), Gaps = 34/178 (19%)
 Frame = +3

Query  18   KQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFV  197
            K+ CK+   EF +G    G +  H            +    + T KP + RSKR RR+F+
Sbjct  81   KKSCKIVDPEFLDG---AGSVVVH-----------DNESETESTKKPTRRRSKRTRRIFI  126

Query  198  SEE-NEESADQGAKNEEEMGKTAKL-----EENIAMCLLMLSDDV-----RGDSGTMKRR  344
            SEE  E   ++ A+ E E    +       EE+IA+CL+MLS DV       D    +  
Sbjct  127  SEEATEVKKEKSAEFEPEPEPVSSFSDTSPEEDIAICLMMLSKDVWRSSYESDESKFREL  186

Query  345  KKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTV-----NAGAGAGEKLRNLGVKN  503
            K+ K    ++CEICN V K SQALGSH+T H+         N G  + E  R L +KN
Sbjct  187  KQGK----YQCEICNKVLKSSQALGSHKTIHKKNDSYIEDKNEGIKSKENSRQLRMKN  240


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   MAMEKQKCKLCWKEFANGKALGGHMRSHF  92
           M+MEK KCKLC ++F++GKA+GGHMRSH 
Sbjct  1   MSMEKHKCKLCSRKFSSGKAMGGHMRSHL  29



>gb|KCW90848.1| hypothetical protein EUGRSUZ_A02901, partial [Eucalyptus grandis]
Length=276

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 79/201 (39%), Gaps = 56/201 (28%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTP---------------------PQKQ  125
            MEK K C +C + FANGKA+GGHMRSH A LP+ P                     P + 
Sbjct  1    MEKNKVCTICNRRFANGKAMGGHMRSHLAKLPLPPKQPDVQTKRAPVPALSSSSLHPDRN  60

Query  126  DSGGVDPTGKP----AQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKLEEN--IAM  287
            ++   D  G P       RS  +   FV+  +    D+G++ E       K      +A+
Sbjct  61   EATLKDFRGSPKIYLPHDRSANSESSFVASTDPALHDKGSEAESLRNPKGKRSSRCYVAL  120

Query  288  CLLMLSDDVRGDSGTMKRRK----------------------------KSKDKENFRCEI  383
            CLLML  D     G    ++                              + +  + CE 
Sbjct  121  CLLMLLRDSWTRKGKEVVQEAVDDELAEEDEKDDEDDGDDESFNATLANHRPRPKYWCET  180

Query  384  CNGVFKCSQALGSHRTAHRNK  446
            CN VF+  QA G H+ +H +K
Sbjct  181  CNKVFRSYQAYGGHKASHSHK  201



>ref|XP_007155662.1| hypothetical protein PHAVU_003G221000g [Phaseolus vulgaris]
 gb|ESW27656.1| hypothetical protein PHAVU_003G221000g [Phaseolus vulgaris]
Length=281

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 85/196 (43%), Gaps = 58/196 (30%)
 Frame = +3

Query  18   KQKCKLCWKEFANGKALGGHMRSHFAPLPMTP-PQ---------------------KQDS  131
            + KCKLC + F NG+ALGGHM++H A LP+ P PQ                     +QDS
Sbjct  4    RHKCKLCSRSFTNGRALGGHMKAHLATLPLPPKPQTLTHSSFTYSSSSDSEQEQLKEQDS  63

Query  132  GG-------------VDPTGK--------PAQGRSKRARRLFVSEENEESADQGAKNEEE  248
                            DP  +        P + RSKR R+  + + +   +      E E
Sbjct  64   LSYALRENPKKSFRVTDPEDRESETESKNPTRQRSKRNRKSAMLKLSFVVSTPLITAEPE  123

Query  249  MGKTA---KLEENIAMCLLMLSDD---VRGDSGTMKRRKK---------SKDKENFRCEI  383
               +      EE++AM L+MLS D   V  ++G  +R K+          K +  + C  
Sbjct  124  PVSSVSDTSPEEDVAMSLMMLSRDTWNVVPNAGPPQRSKRHCTGSETKLKKLRGKYLCHT  183

Query  384  CNGVFKCSQALGSHRT  431
            C   F+ S+ALGSHRT
Sbjct  184  CGKAFRSSRALGSHRT  199



>gb|EYU31947.1| hypothetical protein MIMGU_mgv1a021269mg [Erythranthe guttata]
Length=302

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 82/199 (41%), Gaps = 52/199 (26%)
 Frame = +3

Query  12   MEK-QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPT-------------  149
            MEK  +CKLC + F NG+ALGGHMRSH      +  ++Q     D               
Sbjct  1    MEKRHRCKLCLRSFGNGRALGGHMRSHMMKFYASNKREQVKHAFDSVDFDVVHDSYSSSS  60

Query  150  --------------------GKPAQGRSKRARRLFVS--EENEESADQGAK------NEE  245
                                  P   RS R R+  VS  E+     D+  K       E 
Sbjct  61   DDDDEEEESALLVDHGFGSESDPICRRSNRVRKSRVSDLEDGFFHVDKKLKFGGYCSPEA  120

Query  246  EMGKTAKL--EENIAMCLLMLSDDV------RGDSGTMKRRKKSKDKENFRCEICNGVFK  401
            E+   +    EE++A CL+MLS D          SG   + K  + K  +RCE CN +F+
Sbjct  121  ELSSVSDTTSEEHLAHCLIMLSRDTWQKEEEEEYSGAAVKAKVGRGK--YRCEECNKLFR  178

Query  402  CSQALGSHRTAHRNKTVNA  458
              QALG HR +H+   +N 
Sbjct  179  SYQALGGHRASHKKIKLNT  197



>ref|XP_002876568.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52827.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 86/213 (40%), Gaps = 66/213 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT------PPQKQDSGGV-----------  140
            ME  KC++C+K F NG+ALGGHMRSH   L +       P Q  D               
Sbjct  1    MESYKCRVCFKSFVNGRALGGHMRSHMPSLHVDEDEEQRPSQLSDETESDVSSSSSEEKR  60

Query  141  ------DP------------------TGKPAQGRSKRARRL--FVSEENEESADQGAKNE  242
                  DP                       + RSKR R+L  FV+++  +++  G K E
Sbjct  61   NGLRENDPKFSVLLEDGESETESSRNVINLTRKRSKRTRKLDSFVAKK-VKTSQLGYKPE  119

Query  243  EEM------GKTAKLEENIAMCLLMLSDDVRGDSGTMK----------------RRKKSK  356
             +             EE++A CL+MLS D    + + K                +  +  
Sbjct  120  SDHEPPHSSASDTTTEEDLAFCLMMLSRDKWKKNKSNKEVVEEIETEEESEGYNKINRIT  179

Query  357  DKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
             K  ++CE C  VFK  QALG HR +H+   V+
Sbjct  180  TKGRYKCETCGKVFKSYQALGGHRASHKKNRVS  212



>ref|XP_007038350.1| C2H2 zinc finger protein, putative [Theobroma cacao]
 gb|EOY22851.1| C2H2 zinc finger protein, putative [Theobroma cacao]
Length=312

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/229 (28%), Positives = 88/229 (38%), Gaps = 85/229 (37%)
 Frame = +3

Query  12   MEKQK--CKLCWKEFANGKALGGHMRSHFAPLP---------------------------  104
            MEK+   CK+C + FA+GKA+GGHMRSH A LP                           
Sbjct  1    MEKKSKTCKICNRRFASGKAMGGHMRSHLAKLPIPPKLSLPSSSSTPAPNNNKSPPPSSS  60

Query  105  ------------MTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEE  248
                        M P + + S   +    P   RSKR R++ ++     S    +     
Sbjct  61   ALSRDPSSEVNHMQPYRSELSSETESPRNPTGRRSKRLRKVALNMVGSPSDSVSSIVIPV  120

Query  249  M-GKTAKL-EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN------------------  368
            +  +T  L  E+ AMCLLMLS D      T+K+ +K    E+                  
Sbjct  121  IPAETETLSSEDAAMCLLMLSKD---KWTTIKKEQKEVYYESIDDEEEFDGDGDDDVDEN  177

Query  369  ---------------------FRCEICNGVFKCSQALGSHRTAHRNKTV  452
                                 ++CE CN VFK  QALG HR +H+NK V
Sbjct  178  ENNDDDDLFCVTNPGAQAHPKYKCETCNRVFKSHQALGGHRASHKNKQV  226



>ref|XP_010512387.1| PREDICTED: zinc finger protein ZAT9-like [Camelina sativa]
Length=323

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 86/228 (38%), Gaps = 80/228 (35%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDS--------------------  131
            ME  KC+ C+K FANG+ALGGHMRSH   L +   Q++ S                    
Sbjct  1    MENYKCRYCFKSFANGRALGGHMRSHMPSLHVDDEQEKPSQLSYETTESDVSSSSAKEKR  60

Query  132  -GGVDP--------------------------TGKPAQGRSKRARRL--FVSEENEESAD  224
             G  DP                               + RSKR R+L  F +++ +    
Sbjct  61   NGNDDPKFASTSSLLLLEDDDDDESETESSRNVINLTRKRSKRTRKLDSFATKKKKVKTS  120

Query  225  QGAKNEEE------MGKTAKLEENIAMCLLMLS------------------------DDV  314
            Q    E +             EE++A CL+MLS                        D+ 
Sbjct  121  QLGYKESDPEPPHSSASDTTTEEDLAFCLMMLSRDKWKKNKSSSNNKEVVKEIETDEDES  180

Query  315  RGDSGTM-KRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
             G +  + K  + +  K  ++CE C  VFK  QALG HR +H+   V+
Sbjct  181  EGYNNRLSKMNRTTTTKGRYKCETCGKVFKSYQALGGHRASHKKNRVS  228



>ref|XP_006587702.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max]
Length=326

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 85/200 (43%), Gaps = 62/200 (31%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDP---------------TGKPA  161
            CK+C K F++GKA+GGHMRSHFA LP+ P  K  +  +D                T  P 
Sbjct  29   CKICSKCFSSGKAMGGHMRSHFAKLPIPPKPKTKNQALDNSTELTHLPTQSASPLTSYPQ  88

Query  162  QGRSKRARRL------FVSEENEE-----------------------SADQGAKNEEEMG  254
            +  S+  R L      F++  N E                       +A+  A+ E +  
Sbjct  89   KQPSQNFRSLKHNVFAFLANSNRENESRSYPKNPTRKRSKCHRRFIPAAEMNAEAEPKQV  148

Query  255  KT---AKLEENIAMCLLMLSDDVRGDSGTMKRRK-KSKDKEN--------------FRCE  380
             +   + + E  A  LLMLS D   +S   K++K K KD EN              F+C+
Sbjct  149  SSKLDSLIAEEAAWTLLMLSRDKWPESKETKKQKMKGKDGENGCNDLLVQTQSRAKFQCK  208

Query  381  ICNGVFKCSQALGSHRTAHR  440
             C   F+  QALG H+  H+
Sbjct  209  RCGKTFQSYQALGGHKANHK  228



>ref|XP_004242283.1| PREDICTED: zinc finger protein ZAT4 [Solanum lycopersicum]
Length=306

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = +3

Query  123  QDSGGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEE--EMGKTAKL-----EENI  281
            +D    + T KP + RSKR RR+FVS+E         K E+  E    +       EE+I
Sbjct  105  RDQSETESTKKPTRRRSKRTRRMFVSDEAAVDDHPEVKKEKSAEFEPVSSFSDTSPEEDI  164

Query  282  AMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAH-RNKTVNA  458
            A+CL+MLS DV  +S    + +    KE ++CEICN V K SQALGSH+T H +N +   
Sbjct  165  AVCLMMLSKDVWRNS----KFRDQNSKEKYQCEICNKVLKSSQALGSHKTIHKKNNSEEQ  220

Query  459  GAGAGEKLR  485
              G   +LR
Sbjct  221  NQGKSRELR  229


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  6   MAMEKQKCKLCWKEFANGKALGGHMRSHF  92
           M+MEK KCKLC + F +GKA+GGHMRSH 
Sbjct  1   MSMEKHKCKLCSRIFTSGKAMGGHMRSHL  29



>gb|KFK35261.1| hypothetical protein AALP_AA5G262300 [Arabis alpina]
Length=286

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 89/204 (44%), Gaps = 63/204 (31%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFA-------PLPMTPP------------------  116
            ME  KCK C+K F NG+ALGGHMRSH         P  ++                    
Sbjct  1    MESYKCKFCFKSFFNGRALGGHMRSHMVHEEEEEKPSQLSYETESDVVSSSSSEEEEEEE  60

Query  117  -------QKQDSGGVDPTGKPAQGRSKRARRL--FVSEENEESADQGAKNE---------  242
                    + ++  V+ T K    RSKR R+L  FV+++ + ++  G K E         
Sbjct  61   ERNGFGFSESETEIVNLTRK----RSKRTRKLDSFVTKKTK-TSQLGYKTELEVEAEVET  115

Query  243  -----EEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKR--RKKSKDKEN------FRCEI  383
                          EE++A CL+MLS D    +   +    ++S+D  N      ++CE 
Sbjct  116  ETEPPHSSASDTTTEEDLAYCLMMLSRDKWKKNKNKEEFVTEESEDCYNNKIKGRYKCET  175

Query  384  CNGVFKCSQALGSHRTAHR--NKT  449
            C  VFK  QALG HR +H+  NKT
Sbjct  176  CGKVFKSYQALGGHRASHKKNNKT  199



>gb|AHN52236.1| C2H2-type zinc finger protein 5 [Glycine max]
Length=263

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 82/180 (46%), Gaps = 40/180 (22%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            M++ KCKLC + F+NG+ALGGHM++H A LP+  P K  S       K  Q   +  ++ 
Sbjct  1    MDRHKCKLCSRSFSNGRALGGHMKAHLASLPLPLPPKLHSCFSSSDSKQEQSLRENPKKT  60

Query  192  F--VSEENEESADQGAKNE-----------------------EEMGKTAKL--EENIAMC  290
               +  E+ ES  +  KN                        E +   +    EE++AMC
Sbjct  61   LRILDPEDRESETESNKNPTRQRSKRNWKSTMPKLSLGHPEAEPLSSVSDTSPEEDLAMC  120

Query  291  LLMLSDDV-----RGDSGTMKRR--------KKSKDKENFRCEICNGVFKCSQALGSHRT  431
            L+MLS D        ++G  K R         K+K +    C  C+  F+ S+ALGSHRT
Sbjct  121  LMMLSRDTWQEHKLANAGPPKTRCSSGSEIKLKNKVRSKHLCHACHKSFRSSRALGSHRT  180



>ref|XP_009389680.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=301

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 84/196 (43%), Gaps = 52/196 (27%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP-------PQKQDSGGVDPTGKPAQGR  170
            MEK KC++C++ F +G+ALGGHMRSH +     P       P        D  GK  +  
Sbjct  1    MEKHKCRICFRRFPSGRALGGHMRSHVSSATPPPKLHGHHCPAGHAVAEGDEEGKLTEQA  60

Query  171  S--------KRAR---------------RLFVSEENEESAD----------QGAKNEEEM  251
            S        KR+R                  V E+ E   D          + A +  E 
Sbjct  61   SCGLRVKGRKRSRLEDPESSSAFAAVGSTYAVVEDGESETDANHRCRSKRARHAYSRPEP  120

Query  252  GKTAK---LEENIAMCLLMLSDD--VRGD--SGTMKR-----RKKSKDKENFRCEICNGV  395
              +A     EE++A+CL+MLS D  + GD   G ++R     R   + +  F+C  C  V
Sbjct  121  ASSASDVTTEEDVALCLMMLSRDSWISGDVEEGNVRRITSRSRPPRRRRSRFQCGKCKKV  180

Query  396  FKCSQALGSHRTAHRN  443
            F+  QALG HR +  N
Sbjct  181  FRSYQALGGHRASRHN  196



>emb|CDX67836.1| BnaA07g18760D [Brassica napus]
Length=295

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 78/210 (37%), Gaps = 66/210 (31%)
 Frame = +3

Query  24   KCKLCWKEFANGKALGGHMRSHFAPL----------------------------------  101
            KC+ C + F NG+ALGGHMRSH   L                                  
Sbjct  6    KCRFCSQSFFNGRALGGHMRSHMPSLHKFSIQEEERASQLNDETESDVSSSSSEREEGKR  65

Query  102  --------PMTPPQKQDSGGVDPTGKPAQGRSKRARRL-FVSEENEESADQGAKNEEE--  248
                    P+    + ++        P + RSKR R++   + +  +++  G K E E  
Sbjct  66   NGLRDNKHPIMEDNESETESSRNVTNPTRKRSKRTRKVETFATKKRKTSQLGYKTEPECE  125

Query  249  ----MGKTAKLEENIAMCLLMLSDDVRG-----------------DSGTMKRRKKSKDKE  365
                       EE++A CL++LS D                    ++   +   KS  K 
Sbjct  126  PPQSSASDTTTEEDLAFCLMLLSRDKWKKKKKNKASSNKEVVEEIETEASEGYNKSSKKG  185

Query  366  NFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
             F CE C  VFK  QALG HR +H+   V+
Sbjct  186  RFTCETCGKVFKSYQALGGHRASHKKNRVS  215



>ref|XP_009104273.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
Length=297

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 77/212 (36%), Gaps = 68/212 (32%)
 Frame = +3

Query  24   KCKLCWKEFANGKALGGHMRSHFAPL----------------------------------  101
            KC+ C K F NG+ALGGHMRSH   L                                  
Sbjct  6    KCRFCSKSFFNGRALGGHMRSHMPSLHKFSIQDEEGERASQLNDETESDVSSSSSEKEED  65

Query  102  ----------PMTPPQKQDSGGVDPTGKPAQGRSKRARRL-FVSEENEESADQGAKNEEE  248
                      PM    + ++        P + RSKR R++   + +  +++  G K E E
Sbjct  66   KRNGLRDNKHPMMEDNESETESSRNITNPTRKRSKRTRKMETFAAKKRKTSQLGYKTEPE  125

Query  249  ------MGKTAKLEENIAMCLLMLSDDVRG-----------------DSGTMKRRKKSKD  359
                         EE++A CL++LS D                    ++   +    S  
Sbjct  126  CEPPQSSASDTTTEEDLAFCLMLLSRDKWKKKKKNKASSNKEVVEEIETEASEGHNTSSK  185

Query  360  KENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
            K  F CE C  VFK  QALG HR +H+   V+
Sbjct  186  KGRFTCETCGKVFKSYQALGGHRASHKKNRVS  217



>ref|XP_009759748.1| PREDICTED: zinc finger protein ZAT1-like [Nicotiana sylvestris]
Length=312

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 70/134 (52%), Gaps = 16/134 (12%)
 Frame = +3

Query  105  MTPPQKQDSGGV--------DPTGKPAQGRSKRARRLFVSEENEESADQGAKNEE-----  245
            M  P+  D G V        + T KP   RS R+R++ ++   +E  ++  K +      
Sbjct  92   MIDPEFLDGGYVVQDRESETESTKKPTCRRSNRSRKMVLTIPADEKNEEKMKEKSVDFEP  151

Query  246  -EMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGS  422
              +   +  EE+IAMCL+MLS DV   S   K R  SK  + ++C IC+ +FK SQALGS
Sbjct  152  LSLFSDSSSEEDIAMCLMMLSKDVWKSSQPSKLR--SKHGKKYQCGICHRMFKTSQALGS  209

Query  423  HRTAHRNKTVNAGA  464
            H+T H+ K  N+  
Sbjct  210  HKTIHKIKNSNSST  223


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 3/45 (7%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAP---LPMTPPQKQDSGG  137
            MEK KCKLC ++F NGKALGGHMRSH       P TPP KQDSGG
Sbjct  1    MEKHKCKLCSRKFLNGKALGGHMRSHLMALPLPPKTPPLKQDSGG  45



>ref|XP_009139311.1| PREDICTED: zinc finger protein ZAT9-like, partial [Brassica rapa]
Length=284

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 89/208 (43%), Gaps = 60/208 (29%)
 Frame = +3

Query  3    IMAMEKQKCKLCWKEFANGKALGGHMRS--HFAPLPMTPP--------------------  116
            ++  E  KCK C+K F N +ALGGHM S  +F       P                    
Sbjct  5    LLKTESYKCKFCFKSFVNERALGGHMLSLHNFCIEEEARPSQLSDDSESDVSSSSYSHEV  64

Query  117  QKQDSGGVD---PTGKPAQ--------GRSKRARRL--FVSEENEESADQGAKNEEE---  248
            +++ SG  +   PT    Q         RSKR R+L  F S++ + ++  G K E E   
Sbjct  65   ERKRSGLREEKHPTMYDDQRNITNLTRKRSKRTRKLDSFASKKMK-TSQLGYKTEPEPPY  123

Query  249  -MGKTAKLEENIAMCLLMLSDD------------------VRGDSGTMKRRKKSKDKENF  371
                    E+++A+CL+MLS D                  +  +S  M R  ++K +  F
Sbjct  124  SSASDTTTEKDLAVCLMMLSRDKWKKKNKTSSSTKEVVEEIDNNSSKMNRATRTKGR--F  181

Query  372  RCEICNGVFKCSQALGSHRTAHRNKTVN  455
             CE C  VFK  QALG HR +H+   V+
Sbjct  182  TCETCGKVFKSYQALGGHRASHKKNRVS  209



>ref|XP_010527285.1| PREDICTED: zinc finger protein ZAT1 [Tarenaya hassleriana]
Length=286

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 81/194 (42%), Gaps = 68/194 (35%)
 Frame = +3

Query  15   EKQKCKLCWKEFANGKALGGHMRSHFAPLPM-TPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            +++ C +C + FANGKA+GGHMR+H A LP+ T PQ        P   PA+ +S    R 
Sbjct  21   KRKICPICDRTFANGKAMGGHMRAHLAKLPLPTKPQ--------PESAPAREKSPVKTR-  71

Query  192  FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDV-------------------  314
                 N  ++  G+ +   +      ++ +A+CLL L++DV                   
Sbjct  72   ----SNSVTSKPGSSSGYCL-----TDKEVALCLLKLTNDVWPNGVRPVIRFPLTRGCKR  122

Query  315  RGD------------------------------SGTMKRRKKSKDKENFRCEICNGVFKC  404
            RG+                              S T   R   K +  ++C  C  VF+ 
Sbjct  123  RGELKSSDLVDEAQDKEEDEEEEEEEEDDDASFSVTRTTRSMKKSRGKYKCVACPRVFRS  182

Query  405  SQALGSHRTAHRNK  446
            S++LG HR +H NK
Sbjct  183  SRSLGGHRASHENK  196



>ref|XP_003549916.1| PREDICTED: zinc finger protein ZAT4-like [Glycine max]
 gb|KHN09825.1| Zinc finger protein ZAT9 [Glycine soja]
Length=263

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 81/186 (44%), Gaps = 52/186 (28%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAP-------------------------------  98
            M++ KCKLC + F+NG+ALGGHM++H A                                
Sbjct  1    MDRHKCKLCSRSFSNGRALGGHMKAHLASLPLPLPPKLHSCFSSSDSEQEQSLRENPKKT  60

Query  99   LPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKL--E  272
            L +  P+ ++S   +    P + RSKR  +  + +        G    E +   +    E
Sbjct  61   LRILDPEDRESE-TESNKNPTRQRSKRNWKSTMPK-----LSLGHPEAEPLSSVSDTSPE  114

Query  273  ENIAMCLLMLSDDV-----RGDSGTMKRR--------KKSKDKENFRCEICNGVFKCSQA  413
            E++AMCL+MLS D        ++G  K R         K+K +    C  C+  F+ S+A
Sbjct  115  EDLAMCLMMLSRDTWQEHKLANAGPPKTRCSSGSEIKLKNKVRSKHLCHACHKSFRSSRA  174

Query  414  LGSHRT  431
            LGSHRT
Sbjct  175  LGSHRT  180



>ref|XP_008376981.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=317

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 81/209 (39%), Gaps = 71/209 (34%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPL-----------------------------  101
            MEKQ+ CK+C K F+NGKA+GGHMRSH A L                             
Sbjct  1    MEKQRICKICNKRFSNGKAMGGHMRSHLAKLPLPPKPQSPPQQQHQQLSDSPESSSPPFS  60

Query  102  --------PMTPPQKQDSGGVDPTG---KPAQGRSKRARRLFVSEENEESADQGAKNEEE  248
                     +      D G  D       P   RSKR R++      + S     + E+ 
Sbjct  61   TSNRAMHSSLDSAVVHDGGDSDSESHPRNPTHRRSKRRRKVI----GKSSLTMPFEAEQV  116

Query  249  MGKT-AKLEENIAMCLLMLSDD------------------------VRGDSGTMKRRKKS  353
               T A   E++AMCL+MLS D                         RG  G  +   + 
Sbjct  117  SSVTDAFSTEDVAMCLIMLSMDKWEKVKVKNGVDESADEEEEDESDDRGGFG-FRSHARV  175

Query  354  KDKENFRCEICNGVFKCSQALGSHRTAHR  440
            + +  ++CE C+ VF   QALG HR +H+
Sbjct  176  RTRGKYKCETCDKVFISYQALGGHRASHK  204



>ref|XP_009372862.1| PREDICTED: zinc finger protein ZAT9-like [Pyrus x bretschneideri]
Length=320

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 82/212 (39%), Gaps = 74/212 (35%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPL-----------------------------  101
            MEKQ+ CK+C K F+NGKA+GGHMRSH A L                             
Sbjct  1    MEKQRICKICNKRFSNGKAMGGHMRSHLAKLPLPPKPQSPPQQQHHQLSDSPESSSPPFS  60

Query  102  --------PMTPPQKQDSGGVDPTG---KPAQGRSKRARRLFVSEENEESADQGAKNEEE  248
                     +      D G  D       P   RSKR R++      + S     + E+ 
Sbjct  61   TSNRGMHSSLDSAVVHDGGDSDSESHPRNPTHRRSKRRRKVI----GKSSLTLPFEAEQV  116

Query  249  MGKTAKLE-ENIAMCLLMLSDD---------------------------VRGDSGTMKRR  344
               T     E++A CL+MLS D                            RG SG ++  
Sbjct  117  SSVTDAFSTEDVARCLIMLSMDKWDKWEKVKVKNGVDESADEEEEDESDDRGGSG-LRSH  175

Query  345  KKSKDKENFRCEICNGVFKCSQALGSHRTAHR  440
             + + +  ++CE C+ VF+  QALG HR +H+
Sbjct  176  TRVRTRGKYKCETCDKVFRSYQALGGHRASHK  207



>ref|XP_002278670.1| PREDICTED: zinc finger protein ZAT4-like [Vitis vinifera]
Length=359

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDS  131
            MEK KCKLC++ F+NG+ALGGHMRSH   LP+ P Q+Q S
Sbjct  1    MEKHKCKLCFRSFSNGRALGGHMRSHMLNLPIPPKQEQPS  40



>ref|XP_010025302.1| PREDICTED: zinc finger protein ZAT9-like [Eucalyptus grandis]
Length=329

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/231 (26%), Positives = 88/231 (38%), Gaps = 90/231 (39%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTP---------------------PQKQ  125
            MEK K C +C + FANGKA+GGHMRSH A LP+ P                     P + 
Sbjct  1    MEKNKVCTICNRRFANGKAMGGHMRSHLAKLPLPPKQPDVQTKRAPVPALSSSSLHPDRN  60

Query  126  DSGGVDPTGKP----AQGRSKRARRLFVSEENEESADQGAKNEE----------------  245
            ++   D  G P       RS  +   FV+  +    D+G++ E                 
Sbjct  61   EATLKDFRGSPKIYLPHDRSANSESSFVASTDPALHDKGSEAESLRNPKGKRSSRCCKPA  120

Query  246  ------EMGKTAKLE------ENIAMCLLMLSDDVRGDSGTMKRRK--------------  347
                  E  +   L+      E++A+CLLML   +R DS T K ++              
Sbjct  121  MNEARAETSEQVSLDSENFSVEDVALCLLML---LR-DSWTRKGKEVVQEAVDDELAEED  176

Query  348  ------------------KSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
                                + +  + CE CN VF+  QA G H+ +H +K
Sbjct  177  EKDDEDDGDDESFNATLANHRPRPKYWCETCNKVFRSYQAYGGHKASHSHK  227



>ref|XP_003635129.2| PREDICTED: zinc finger protein ZAT4 [Vitis vinifera]
Length=377

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  9    AMEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPT  149
            +MEK KCKLC + F++G+ALGGHMRSH A LP+ P   Q S   DP 
Sbjct  54   SMEKHKCKLCSRRFSSGRALGGHMRSHLATLPIPPKTPQHSDRTDPV  100



>emb|CAN66783.1| hypothetical protein VITISV_013510 [Vitis vinifera]
Length=829

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  9    AMEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPT  149
            +MEK KCKLC + F++G+ALGGHMRSH A LP+ P   Q S   DP 
Sbjct  469  SMEKHKCKLCSRRFSSGRALGGHMRSHLATLPIPPKTPQHSDRTDPV  515



>ref|XP_006347910.1| PREDICTED: zinc finger protein ZAT9-like [Solanum tuberosum]
Length=330

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 85/212 (40%), Gaps = 69/212 (33%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGR------  170
            MEK K CKLC ++FANG+ALGGHMRSH   L +   + +       + +  +G+      
Sbjct  1    MEKNKICKLCSRKFANGRALGGHMRSHMMNLQLHQHETESIPSSSWSDEEEKGKILNSSD  60

Query  171  ---SKRARRLFVSEENEESADQGAKNEEEMGKTAKL------------------------  269
                  A    V   ++ES  + +KN     ++ ++                        
Sbjct  61   ADADADADDSAVVLPDKESETESSKNPIRFKRSKRVRKSRKPNFVKITEYYSSVVETEPV  120

Query  270  --------EENIAMCLLMLSDD--------------------------VRGDSGTMKRRK  347
                    EE++A CL+MLS D                             + G +K   
Sbjct  121  SSISENSPEEDVAHCLMMLSRDKWNKKEQVDFYSDEEEEDEQVKEENSEDSEGGEVKVTT  180

Query  348  KS-KDKENFRCEICNGVFKCSQALGSHRTAHR  440
            KS + +  +RCE CN VF+  QALG HR +H+
Sbjct  181  KSTRGRGKYRCETCNKVFRSYQALGGHRASHK  212



>ref|XP_010469165.1| PREDICTED: zinc finger protein ZAT9-like [Camelina sativa]
Length=325

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 63/234 (27%), Positives = 87/234 (37%), Gaps = 86/234 (37%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT---PPQ---------------------  119
            ME  KC+ C+K FANG+ALGGHMRSH   L +    P Q                     
Sbjct  1    MENYKCRYCFKSFANGRALGGHMRSHMPSLHVDEERPSQLSYETTESDVSSSSSKEKRNG  60

Query  120  ----------------KQDSGGVDPTGKPA--------QGRSKRARRL--FVSEENEESA  221
                             +D  G D +   +        + RSKR R+L  F +++ +   
Sbjct  61   KKNDDPKFASTSSLLLLEDGDGDDESETESSRNVINLTRKRSKRTRKLDSFATKKKKVKT  120

Query  222  DQ-GAKNEEE----MGKTAKLEENIAMCLLMLSDD------------------------V  314
             Q G K++ E           EE++A CL+MLS D                         
Sbjct  121  SQLGYKSDPEPPHSSASDTTTEEDLAFCLMMLSRDKWKKNKSSNNSKEVVEEIETEEEEE  180

Query  315  RGDSGTMKRRKK-------SKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
                G   R  K       +  K  ++CE C  VFK  QALG HR +H+   V+
Sbjct  181  EELEGYNNRLSKMNRTTRTTTTKGRYKCETCGKVFKSYQALGGHRASHKKNRVS  234



>emb|CDX89061.1| BnaA04g01250D [Brassica napus]
Length=263

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 79/189 (42%), Gaps = 42/189 (22%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRS--HFAPLPMTPPQK--------------------Q  125
            ME  KCK C+K F N +ALGGHM S  +F       P +                    +
Sbjct  1    MESYKCKFCFKSFVNERALGGHMLSLHNFCIEEEARPSQLSDDSESDVSSSSSSSHEVER  60

Query  126  DSGGVDPTGKPA------------QGRSKRARRL--FVSEENEESADQGAKNEEE----M  251
               G+     P             + RSKR R+L  F S++ + ++  G K E E     
Sbjct  61   KRNGLREEKHPTMDDDQRNVTNLTRKRSKRTRKLDSFASKKMK-TSQLGYKTEPEPRHSS  119

Query  252  GKTAKLEENIAMCLLMLS-DDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHR  428
                  EE++A CL+MLS D  +      K    +  K  F CE C  VFK  QALG HR
Sbjct  120  ASDTTTEEDLAFCLMMLSRDKWKKKKKNNKTSSTTTTKGRFTCETCGKVFKSYQALGGHR  179

Query  429  TAHRNKTVN  455
             +H+   V+
Sbjct  180  ASHKKNRVS  188



>ref|NP_001239999.1| uncharacterized protein LOC100780611 [Glycine max]
 gb|ACU20788.1| unknown [Glycine max]
Length=388

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC + FANG+ALGGHMRSH   LP+ P Q +
Sbjct  1    MEKHKCKLCLRSFANGRALGGHMRSHMMNLPVPPKQSE  38



>gb|KHM99419.1| Zinc finger protein ZAT9 [Glycine soja]
Length=365

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC + FANG+ALGGHMRSH   LP+ P Q +
Sbjct  1    MEKHKCKLCLRSFANGRALGGHMRSHMMNLPVPPKQSE  38



>ref|XP_007219537.1| hypothetical protein PRUPE_ppa021631mg, partial [Prunus persica]
 gb|EMJ20736.1| hypothetical protein PRUPE_ppa021631mg, partial [Prunus persica]
Length=337

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 82/201 (41%), Gaps = 57/201 (28%)
 Frame = +3

Query  9    AMEKQK-CKLCWKEFANGKALGGHMRSHFA--PLPMTPPQKQDSGGVDPTGKPAQGRSKR  179
            +MEK + CK+C K FANGKA+GGHMRSH A  PLP  P   Q    +  + + +   S  
Sbjct  20   SMEKHRICKICNKRFANGKAMGGHMRSHLAKLPLPAKPQSPQQQQQLSNSPESSPPLSST  79

Query  180  ARRLFVSEENEESADQGAKNEEE----------------MGKT---------------AK  266
             R +  S   + +   G  + E                 +GK                A 
Sbjct  80   NRAMHSSPSLDSAIHDGDSDTESHPRNPTRRRSKRRRKVIGKAAEAALEAEQVSSVSDAF  139

Query  267  LEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN-----------------------FRC  377
              E++A CL+MLS D  G     K +K+  +  +                       ++C
Sbjct  140  STEDVARCLIMLSMDKWGKWEKAKLKKQVDESVDEDEDEDEDESAFQAQTGALTQGKYKC  199

Query  378  EICNGVFKCSQALGSHRTAHR  440
            E CN  F+  QALG HR +H+
Sbjct  200  ETCNKAFRSYQALGGHRASHK  220



>emb|CBI27269.3| unnamed protein product [Vitis vinifera]
Length=554

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 72/163 (44%), Gaps = 36/163 (22%)
 Frame = +3

Query  18   KQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFV  197
            K  CKLC K + +GK+LGGHMRSH         +++    ++       GRS +      
Sbjct  273  KHVCKLCNKRYPSGKSLGGHMRSHMIGNSAEAAERKKISSLN------GGRSSK------  320

Query  198  SEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGT-----MKRRKK--SK  356
                +ES  Q     +E       ++ +A+CL+MLS D     G      + +R K  S 
Sbjct  321  ----KESGSQQENKPQE-------QQELAICLMMLSRDSGHWGGLNSLYDLSKRAKNDSY  369

Query  357  DKENFR------CEICNGVFKCSQALGSHRTAHRNKTVNAGAG  467
             +EN R      C  CN  F   QALG HR  H+ K    G+G
Sbjct  370  SEENVRKRSKYQCLTCNKTFHSHQALGGHRANHKRKLARFGSG  412



>ref|XP_009385850.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=338

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 85/247 (34%), Gaps = 83/247 (34%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMT-----------------PPQKQD----  128
            ME+ +CKLC + F+NG+ALGGHMRSH AP P                   P   +D    
Sbjct  1    MERHRCKLCHRRFSNGRALGGHMRSHVAPAPRPMKAQQHLPSPCASSSSFPAADEDSVAP  60

Query  129  -------------SGGVDP-------TGKPA---------QGRSKRARRLFVSEENEESA  221
                         SG VDP       T K A          G S                
Sbjct  61   ATTYGLREKSRRRSGLVDPEFSSSIATAKGAGSGAFPVVQDGESDTESSFRRRLTRPRRR  120

Query  222  DQGAKNEEEMGKT--AKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKEN---------  368
            +  + + E +     A  +E++A CL++LS D         R+    D  N         
Sbjct  121  EDPSADAEPLSSVSDASPDEDVARCLMLLSRDAWSRCEAEGRQSNGCDNANEDEEDELYY  180

Query  369  --------------------FRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKLRN  488
                                ++C  C   F+  QALG HR +H+   V     AG  +RN
Sbjct  181  EEEEETQPQATARSWRKRTRYQCGTCKKYFRSYQALGGHRASHKRVGVECFPIAG--IRN  238

Query  489  LGVKNSE  509
             G   S+
Sbjct  239  RGKDPSD  245



>ref|XP_002528915.1| hypothetical protein RCOM_1060190 [Ricinus communis]
 gb|EEF33444.1| hypothetical protein RCOM_1060190 [Ricinus communis]
Length=109

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            ME+ KCKLC + FANG+ALGGHM++H A LP+ P
Sbjct  1    MERHKCKLCTRTFANGRALGGHMKAHLATLPLPP  34



>ref|XP_011017454.1| PREDICTED: zinc finger protein ZAT4-like [Populus euphratica]
Length=372

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD  128
            MEK KCKLC+K F+NG+ALGGHMRSH   LP+ PP+ +D
Sbjct  1    MEKHKCKLCFKSFSNGRALGGHMRSHMLNLPI-PPKLED  38



>ref|XP_010258927.1| PREDICTED: zinc finger protein ZAT1-like [Nelumbo nucifera]
Length=357

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+  CKLC+K FANG+ALGGHMRSH A LP  P  +Q
Sbjct  1    MERHSCKLCFKRFANGRALGGHMRSHMATLPPQPKAQQ  38



>ref|XP_010451043.1| PREDICTED: zinc finger protein ZAT3-like [Camelina sativa]
Length=285

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 64/141 (45%), Gaps = 29/141 (21%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C ++F + KAL GHMR H        P++Q  G   P    +   +  +++L   
Sbjct  74   RPCTECGRQFWSWKALFGHMRCH--------PERQWRGINPPPNYRSPTTAASSKQL---  122

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
              N+ S D  +   EE       + ++A CLLMLS+     S T +R         F C 
Sbjct  123  --NQRSLDWVSFMSEE-------DHDVASCLLMLSNGTPSSSSTSER---------FECG  164

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR +H+N
Sbjct  165  GCKKVFGSHQALGGHRASHKN  185



>ref|XP_002511651.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50320.1| zinc finger protein, putative [Ricinus communis]
Length=272

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC K F+NG+ALGGHMRSH   LP+   Q+Q
Sbjct  1    MEKHKCKLCLKSFSNGRALGGHMRSHMLNLPVLQKQQQ  38



>ref|XP_007211271.1| hypothetical protein PRUPE_ppa017179mg, partial [Prunus persica]
 gb|EMJ12470.1| hypothetical protein PRUPE_ppa017179mg, partial [Prunus persica]
Length=227

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ KCKLC + FANG+ALGGHM++H A LP+ P  +Q
Sbjct  1    MERHKCKLCARTFANGRALGGHMKAHLATLPLPPKTQQ  38



>gb|KDO85696.1| hypothetical protein CISIN_1g044606mg, partial [Citrus sinensis]
Length=413

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  3    IMAMEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQK  122
            +  MEK KC+LC+K F+NG+ALGGHMRSH   LP+  PQK
Sbjct  35   LFVMEKHKCRLCFKNFSNGRALGGHMRSHMLNLPI--PQK  72



>ref|XP_011033847.1| PREDICTED: zinc finger protein ZAT9-like isoform X2 [Populus 
euphratica]
Length=388

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD  128
            MEK +CKLC+K F+NG+ALGGHMRSH   LP+ PP+ +D
Sbjct  1    MEKHECKLCFKSFSNGRALGGHMRSHLLKLPV-PPKLED  38



>ref|XP_011033839.1| PREDICTED: zinc finger protein ZAT9-like isoform X1 [Populus 
euphratica]
Length=399

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (3%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD  128
            MEK +CKLC+K F+NG+ALGGHMRSH   LP+ PP+ +D
Sbjct  1    MEKHECKLCFKSFSNGRALGGHMRSHLLKLPV-PPKLED  38



>ref|XP_002304278.2| hypothetical protein POPTR_0003s07490g [Populus trichocarpa]
 gb|EEE79257.2| hypothetical protein POPTR_0003s07490g [Populus trichocarpa]
Length=297

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 77/184 (42%), Gaps = 50/184 (27%)
 Frame = +3

Query  9    AMEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD----------PTGKP  158
            +ME+ KCKLC + F NG+ALGGHM++H A        +Q  GG+D           +  P
Sbjct  32   SMERHKCKLCVRTFPNGRALGGHMKAHLA------ATRQQLGGLDRNESFSSSYSSSSDP  85

Query  159  AQGRSKRARRLFVSEENEESADQGAKNE------------EEMGKTAKL--EENIAMCLL  296
                +  A  + V +   E+  +                 E +   +    EE++A CL+
Sbjct  86   EFSFTVDAGSVVVQDRESETESRNPTRRRSKRIRKSCAEPEPVSSVSDTSPEEDVARCLM  145

Query  297  MLSDDVR------------GDSG--------TMKRRKKSKDKENFRCEICNGVFKCSQAL  416
            MLS DV             G  G          +  K SK +  FRCE C  +F+ S+AL
Sbjct  146  MLSRDVWMRNIEEEYEEQGGKDGERSVEMLEEAEEIKVSKIRGKFRCEKCMKLFRSSRAL  205

Query  417  GSHR  428
              H+
Sbjct  206  SGHK  209



>ref|XP_011018344.1| PREDICTED: zinc finger protein ZAT9-like [Populus euphratica]
Length=310

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 97/249 (39%), Gaps = 88/249 (35%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFA------------------------------P  98
            MEK + CK+C + FANGKA+GGHMRSH A                              P
Sbjct  1    MEKTRICKICNRRFANGKAMGGHMRSHLAKLPLPPKPIPPQETYNTPKKSPPSSSSLNYP  60

Query  99   LPMTPP--------QKQDSGGVDP---TGKPAQGRSKRARR---------LFVSEENEES  218
            L    P        Q+  S    P   T    +  ++  R+            ++E  ES
Sbjct  61   LLCNKPTQSSRSMKQEVSSTVSRPNLATSYDGESETESTRKPTRRRSKRSRKSADEVAES  120

Query  219  ADQGAKNEEEMGKTAKL--EENIAMCLLMLS-DDVRGDSGTMKR----------------  341
              +  ++ E++   + L  EE++A+CLLMLS D+   D+  +K+                
Sbjct  121  MVKVTESSEQVSSISYLLAEEDVALCLLMLSRDNWSEDAKQVKKEVCEDIKDHQHVNEVE  180

Query  342  ------------RKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVNAG------AG  467
                        R K K +  F+CE C   F+  QALG HR  H+   ++         G
Sbjct  181  NYEKEDYLFGVTRAKYKSQGKFKCETCKKGFQSYQALGGHRANHKKIKIHEEHEEGNVIG  240

Query  468  AGEKLRNLG  494
             GE  R++G
Sbjct  241  CGEDNRSVG  249



>ref|XP_009370510.1| PREDICTED: uncharacterized protein LOC103959863 [Pyrus x bretschneideri]
Length=560

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 80/211 (38%), Gaps = 73/211 (35%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPL-----------------------------  101
            MEKQ+ CK+C K F+NGKA+GGHMRSH A L                             
Sbjct  1    MEKQRICKICNKRFSNGKAMGGHMRSHLAKLPLPPPQQSPPQQHHQLGDSPESSSPPFST  60

Query  102  -------PMTPPQKQDSGGVDPTG---KPAQGRSKRARRLFVSEENEESADQGAKNEEEM  251
                    +      D G  D       P   RSKR R++      + S     + E+  
Sbjct  61   SNRGMHSSLDSAVVHDGGDSDSESHPRNPTHRRSKRRRKVI----GKSSLTLPFEAEQVS  116

Query  252  GKTAKLEE-NIAMCLLMLSDD---------------------------VRGDSGTMKRRK  347
              T      ++A CL+MLS D                            RG SG  +   
Sbjct  117  SVTDAFSTADVARCLIMLSMDKWDKWEKVKVKNGVDEFAVEEEEDESDDRGASG-FRLHT  175

Query  348  KSKDKENFRCEICNGVFKCSQALGSHRTAHR  440
            + + +  ++CE C+ VF+  QALG HR +H+
Sbjct  176  RVRTRGKYKCETCDKVFRSYQALGGHRASHK  206



>ref|XP_007157307.1| hypothetical protein PHAVU_002G058900g [Phaseolus vulgaris]
 gb|ESW29301.1| hypothetical protein PHAVU_002G058900g [Phaseolus vulgaris]
Length=296

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 31/38 (82%), Gaps = 1/38 (3%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP-PQK  122
            ME+ KCKLC + FANG+ALGGHM++H A LP+ P PQ+
Sbjct  1    MERHKCKLCSRTFANGRALGGHMKAHLATLPLPPKPQR  38



>ref|XP_010264306.1| PREDICTED: zinc finger protein ZAT1-like [Nelumbo nucifera]
Length=358

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            ME+  CKLC+K FANG+ALGGHMRSH A LP  P
Sbjct  1    MERHSCKLCFKRFANGRALGGHMRSHMATLPPQP  34



>gb|KGN56354.1| hypothetical protein Csa_3G117400 [Cucumis sativus]
Length=369

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDP  146
            M++ KCKLC++ F+NG+ALGGHMRSH   LP+ P  ++D+    P
Sbjct  1    MDRHKCKLCFRSFSNGRALGGHMRSHMLNLPLPPKGEEDAAPPHP  45



>ref|XP_010444960.1| PREDICTED: zinc finger protein ZAT3-like [Camelina sativa]
Length=285

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (45%), Gaps = 29/141 (21%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C ++F + KAL GHMR H        P++Q  G   P    +   +  +++L   
Sbjct  74   RPCTECGRQFWSWKALFGHMRCH--------PERQWRGINPPPNYRSPTTAASSKQL---  122

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
              N+ S D  +   EE       +  +A CLLMLS+     S T +R         F C 
Sbjct  123  --NQRSLDWVSFMSEE-------DHEVASCLLMLSNGTPSSSSTSER---------FECG  164

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR +H+N
Sbjct  165  GCKKVFGSHQALGGHRASHKN  185



>ref|XP_008238519.1| PREDICTED: zinc finger protein ZAT4 [Prunus mume]
Length=328

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ KCKLC + FANG+ALGGHM++H A LP+ P  +Q
Sbjct  1    MERHKCKLCARTFANGRALGGHMKAHLATLPLPPKTQQ  38



>gb|KDP28801.1| hypothetical protein JCGZ_14572 [Jatropha curcas]
Length=361

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD  128
            ME+ +CKLC K F+NG+ALGGHMRSH   LP+ P  ++D
Sbjct  1    MERHRCKLCLKSFSNGRALGGHMRSHMLNLPIPPKPEED  39



>ref|XP_003611310.1| Cys2/His2 zinc-finger transcription factor [Medicago truncatula]
 gb|AES94268.1| zinc finger ZAT9-like protein [Medicago truncatula]
Length=262

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 49/92 (53%), Gaps = 12/92 (13%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            ME+ KCKLC + F NGKALGGHM++HFA L ++ P  Q      P   P    S      
Sbjct  1    MERYKCKLCSRTFINGKALGGHMKAHFATLRLSLPNPQPQ--TQPHHTPTNLFS-----F  53

Query  192  FVSEENE---ESADQGAKNEEEMGKTAKLEEN  278
            F S ENE   ++ +Q   NE+ +    +L EN
Sbjct  54   FSSSENEQNQQTVEQRDSNEKSL--MYRLREN  83



>ref|XP_003517971.1| PREDICTED: zinc finger protein ZAT9-like [Glycine max]
 gb|KHN41258.1| Zinc finger protein ZAT9 [Glycine soja]
Length=389

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQK  122
            M++ KCKLC++ FANG+ALGGHMRSH   LP++ P++
Sbjct  1    MDRHKCKLCFRSFANGRALGGHMRSHMMNLPISKPEE  37



>ref|XP_007140808.1| hypothetical protein PHAVU_008G143900g [Phaseolus vulgaris]
 gb|ESW12802.1| hypothetical protein PHAVU_008G143900g [Phaseolus vulgaris]
Length=384

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQ  119
            M+K KCKLC+K F+NG+ALGGHMRSH   LP++ P+
Sbjct  1    MDKHKCKLCFKSFSNGRALGGHMRSHMMNLPLSKPE  36



>gb|KDP39875.1| hypothetical protein JCGZ_03406 [Jatropha curcas]
Length=329

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            ME+ KCKLC + FANG+ALGGHM++H A LP+ P
Sbjct  1    MERHKCKLCTRTFANGRALGGHMKAHLATLPLPP  34



>ref|XP_006445328.1| hypothetical protein CICLE_v10020499mg [Citrus clementina]
 ref|XP_006490850.1| PREDICTED: zinc finger protein ZAT9-like [Citrus sinensis]
 gb|ESR58568.1| hypothetical protein CICLE_v10020499mg [Citrus clementina]
Length=394

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQK  122
            MEK KC+LC+K F+NG+ALGGHMRSH   LP+  PQK
Sbjct  1    MEKHKCRLCFKNFSNGRALGGHMRSHMLNLPI--PQK  35



>ref|XP_010544363.1| PREDICTED: zinc finger protein ZAT1 [Tarenaya hassleriana]
Length=279

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 80/206 (39%), Gaps = 54/206 (26%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGK-ALGGHMRSHFAPLPMTPPQKQDS-------------GGVDP-  146
            M+K+K KLCWK FA+G+  LGGHM     PL   P                      DP 
Sbjct  1    MDKRKRKLCWKRFADGRRTLGGHMVKIPIPLVKHPESASSHSSSSSDDEEDKTISAADPE  60

Query  147  ---------------------TGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKT-  260
                                 T KP    S+R +     +E + S     +   ++ ++ 
Sbjct  61   FSSSVSEAESFKNPTRKGSRLTRKPGCISSRRPQLKPTKQEEQVSVKDTKRRTSQITESW  120

Query  261  --------------AKLEENIAMCLLMLSDD---VRGDSGTMKRRKKSKDKENFRCEICN  389
                          A  EE++A CL+MLS D   V  D       KK K ++N +CE C 
Sbjct  121  TEQEPASSVSDEDAATTEEDVAFCLMMLSRDKTQVENDQEHESENKKRKKRDNNKCETCG  180

Query  390  GVFKCSQALGSHRTAHRNKTVNAGAG  467
             +FK  QALG H  +H+ K  N  A 
Sbjct  181  RIFKSYQALGGHVASHKKKKKNRTAS  206



>gb|AAY40250.1| Cys2/His2 zinc-finger transcription factor [Silene latifolia]
Length=341

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 1/42 (2%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGG  137
            ME+ +CKLC + F NG+ALGGHMRSH A LP+ P +KQ + G
Sbjct  1    MERHRCKLCSRSFMNGRALGGHMRSHLATLPL-PLKKQKTPG  41



>ref|XP_006838141.1| hypothetical protein AMTR_s00106p00088880 [Amborella trichopoda]
 gb|ERN00710.1| hypothetical protein AMTR_s00106p00088880 [Amborella trichopoda]
Length=370

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 57/197 (29%), Positives = 79/197 (40%), Gaps = 52/197 (26%)
 Frame = +3

Query  6    MAMEKQKCKLCWKEFANGKALGGHMRSHFA-------------PLPMT-----------P  113
            M      CK C K FA   ALGGHMRSH               PLP++           P
Sbjct  1    MDPTPHTCKHCSKTFATFTALGGHMRSHSTTSTITTTTNTNPNPLPLSYSLRNNPKKTRP  60

Query  114  PQKQDSGGVDP--TGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKLEENIAM  287
                DS    P     P +   +++ ++  +     S D   +    +   A +EEN+A+
Sbjct  61   FVLYDSQTFTPRRNSHPPKNSGRKSGQIPCN-----SGDTDTEISSSISDAASVEENVAV  115

Query  288  CLLMLS----DD---------------VRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQ  410
             L++LS    D+               V  DSG  +  + SK K  F C  C  +FK  Q
Sbjct  116  SLMLLSRGMYDNPNSPKNRFSGEFSGVVLPDSGVCESSEPSK-KSKFECSACKKIFKSYQ  174

Query  411  ALGSHRTAH-RNKTVNA  458
            ALG HR  H R K ++A
Sbjct  175  ALGGHRARHMRIKGISA  191



>ref|XP_010112022.1| Zinc finger protein ZAT9 [Morus notabilis]
 gb|EXC32403.1| Zinc finger protein ZAT9 [Morus notabilis]
Length=418

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            MEK KCKLC++ F+NG+ALGGHMRSH   LP+
Sbjct  1    MEKHKCKLCFRSFSNGRALGGHMRSHMMSLPI  32



>gb|ADL36623.1| C2H2L domain class transcription factor [Malus domestica]
Length=319

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 61/207 (29%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD--------------P  146
            MEK + CK+C K F+NGKA+GGHMRSH A LP+ P  +                     P
Sbjct  1    MEKHRICKICNKRFSNGKAMGGHMRSHLAKLPLPPKPQSPPQQQQQHHQLSNSPETSSLP  60

Query  147  TGKPAQGRSKRARRLFVSEENEE-------SADQGAKNEEEMGKTAKL------------  269
                 +G         V ++++        +  +  +  + +GK++ L            
Sbjct  61   FSTSNRGMHSSLDSALVHDDSDSESHPRNPTRRRSKRRRKVIGKSSPLPFEAEQVSSVSD  120

Query  270  ---EENIAMCLLMLSDD-----------------------VRGDSGTMKRRKKSKDKENF  371
                E++A CL+MLS D                         G     + + + + +  +
Sbjct  121  TFSTEDVARCLIMLSMDKWEKAKVKNGVDESLEKEEEDESDSGGRSDFRIKDRVRSQGKY  180

Query  372  RCEICNGVFKCSQALGSHRTAHRNKTV  452
            +CE C+ VF+  QALG HR +H+ KT+
Sbjct  181  KCETCDKVFRSYQALGGHRASHK-KTI  206



>ref|XP_008376003.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=319

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 85/207 (41%), Gaps = 61/207 (29%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD--------------P  146
            MEK + CK+C K F+NGKA+GGHMRSH A LP+ P  +                     P
Sbjct  1    MEKHRICKICNKRFSNGKAMGGHMRSHLAKLPLPPKPQSPPQQQQQHHQLSNSPEXSSLP  60

Query  147  TGKPAQGRSKRARRLFVSEENEE-------SADQGAKNEEEMGKTAKL------------  269
                 +G         V ++++        +  +  +  + +GK++ L            
Sbjct  61   FSTSNRGMHSSLDSALVHDDSDSESHPRNPTRRRSKRRRKVIGKSSPLPFEAEQVSSVSD  120

Query  270  ---EENIAMCLLMLSDD-----------------------VRGDSGTMKRRKKSKDKENF  371
                E++A CL+MLS D                         G     + + + + +  +
Sbjct  121  TFSTEDVARCLIMLSMDKWEXXKVKNGVXESXEKEEEDESDSGGRSDFRIKDRVRSQGKY  180

Query  372  RCEICNGVFKCSQALGSHRTAHRNKTV  452
            +CE C+ VF+  QALG HR +H+ KT+
Sbjct  181  KCETCDKVFRSYQALGGHRASHK-KTI  206



>ref|XP_008437783.1| PREDICTED: zinc finger protein ZAT9 [Cucumis melo]
Length=373

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSG  134
            M+  KCKLC++ F+NG+ALGGHMRSH   LP+ P  ++D+ 
Sbjct  1    MDSHKCKLCFRSFSNGRALGGHMRSHMMNLPLPPKGEEDAA  41



>ref|XP_010325535.1| PREDICTED: zinc finger protein ZAT9-like [Solanum lycopersicum]
Length=350

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 80/209 (38%), Gaps = 70/209 (33%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPM---------------------------  107
            MEK K CKLC ++F NG+ALGGHMRSH   L +                           
Sbjct  28   MEKHKICKLCSRKFPNGRALGGHMRSHMMNLQLHQHETESIPSSSSWSDEEEEKGKILNS  87

Query  108  ----------TPPQKQDSGGVDPTGKPAQ-GRSKRARRLFVSEENEESADQGAKNEEEMG  254
                        P K+     + +  P +  RSKR R+    + N     +   +  E  
Sbjct  88   SDVDADDSVVVLPDKESE--TESSKNPIRFKRSKRVRK--SRKPNFMKITEYYSSVVETE  143

Query  255  KTAKLEEN-----IAMCLLMLSDDVRG--------------------DSG--TMKRRKKS  353
              + + EN     +A CL+MLS D                       DSG       K S
Sbjct  144  PVSSISENSPEEDVAHCLMMLSRDKWNKNEQVDFYSDEEFKEENSAEDSGGEVKVTTKSS  203

Query  354  KDKENFRCEICNGVFKCSQALGSHRTAHR  440
            + +  +RCE CN  F+  QALG HR +H+
Sbjct  204  RGRGKYRCETCNKFFRSYQALGGHRASHK  232



>ref|XP_010110834.1| Zinc finger protein ZAT9 [Morus notabilis]
 gb|EXC28313.1| Zinc finger protein ZAT9 [Morus notabilis]
Length=296

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            MEK +CKLC + F+NG+ALGGHM++H A LP+ P
Sbjct  1    MEKHRCKLCLRSFSNGRALGGHMKAHLAGLPLPP  34



>ref|XP_008644480.1| PREDICTED: zinc finger protein 1-like [Zea mays]
 gb|AFW67529.1| hypothetical protein ZEAMMB73_481459 [Zea mays]
Length=264

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 34/59 (58%), Gaps = 3/59 (5%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            EEN+A+CLLMLS   RGD   ++          FRC +C   F   QALG H+T+HR K
Sbjct  55   EENLALCLLMLS---RGDRHRVQAPPPPVPSAEFRCSVCGKSFGSYQALGGHKTSHRVK  110



>ref|XP_006279684.1| hypothetical protein CARUB_v10026997mg [Capsella rubella]
 gb|EOA12582.1| hypothetical protein CARUB_v10026997mg [Capsella rubella]
Length=248

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +3

Query  234  KNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQA  413
            +N+E   K A  EE +A+CLLML+      S     R    D  +++C +C   F   QA
Sbjct  50   QNQETDTKLASEEEYLALCLLMLARGSAVQSLPQSSRPSPSDHRDYKCSVCGKSFSSYQA  109

Query  414  LGSHRTAHRNKTVN  455
            LG H+T+HR  T N
Sbjct  110  LGGHKTSHRKPTNN  123



>ref|XP_006421633.1| hypothetical protein CICLE_v10007101mg [Citrus clementina]
 gb|ESR34873.1| hypothetical protein CICLE_v10007101mg [Citrus clementina]
Length=281

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 79/194 (41%), Gaps = 51/194 (26%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRAR-  185
            M+K + CK+C + FANGKA+GGHMRSHFA  P++      S    P+   +    +  R 
Sbjct  1    MDKHRICKICNRRFANGKAMGGHMRSHFAKHPISSSNINPSPPKYPSSSSSLSNMQTYRS  60

Query  186  ---RLFVSEENEESADQGAKNEEEMGK---------TAKLEEN------IAMCLLMLSDD  311
               R F   E+E  A+      +   K         +  + EN      +AMCLL LS D
Sbjct  61   VNNRPFSGLEDESEAESSRNLTKARSKRPLRTIESVSNSVTENFLSDREVAMCLLKLSKD  120

Query  312  ---------------------VRGDSGTMKRRKKSKDK----------ENFRCEICNGVF  398
                                 VRG S      ++   +            ++C+ C   F
Sbjct  121  NWLQKDKQVVVAEAVVDEDEYVRGKSDDGDNDEEEDKEEDESSLVSRTNKYKCKTCKKEF  180

Query  399  KCSQALGSHRTAHR  440
            +  QALG H+ +H+
Sbjct  181  RSYQALGGHKASHK  194



>ref|XP_009334508.1| PREDICTED: zinc finger protein ZAT4 [Pyrus x bretschneideri]
Length=332

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ +CKLC + FANG+ALGGHM++H A  P+ P   Q
Sbjct  1    MERHRCKLCSRAFANGRALGGHMKAHLATFPLPPKTHQ  38



>ref|XP_009780461.1| PREDICTED: zinc finger protein ZAT1-like [Nicotiana sylvestris]
Length=211

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 12/131 (9%)
 Frame = +3

Query  147  TGKPAQGRSKRARRLFVSEEN-EESADQGAKNEEEMGKTAKL-----EENIAMCLLMLSD  308
            T KP + RSKR RRLF+S+E  E   ++  K E E    +       EE+I + L+MLS 
Sbjct  72   TKKPTRRRSKRNRRLFISKEAMEVKKEKSTKFEPEPKPVSSFSDTFPEEDIVIFLMMLSK  131

Query  309  DV-RGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHR--NKTV---NAGAGA  470
            DV R    + + + ++K +  ++ EICN V    QALGS +T H+  N  +   N G  +
Sbjct  132  DVWRSSYESDESKFRNKKQGEYQYEICNKVLNSFQALGSQKTIHKKNNSYIEDQNEGIKS  191

Query  471  GEKLRNLGVKN  503
             E  R L +KN
Sbjct  192  KENSRQLRLKN  202



>ref|XP_009340565.1| PREDICTED: zinc finger protein ZAT9-like [Pyrus x bretschneideri]
Length=319

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 86/212 (41%), Gaps = 71/212 (33%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARR  188
            MEK + CK+C K F+NGKA+GGHMRSH A LP+    K  S             S  +  
Sbjct  1    MEKHRICKICNKRFSNGKAMGGHMRSHLAKLPLP--PKPQSPPPQQQQHHQLSNSPESSS  58

Query  189  LFVSEEN---EESADQGAKNEEE--------------------MGKTAKL----------  269
            L  S  N     S D    +++                     +GK++ L          
Sbjct  59   LPFSTSNRGMHSSLDSAVVHDDSDSESHPRNPTRRRSKRRRKVIGKSSPLPFEAEQVSSV  118

Query  270  -----EENIAMCLLMLSDD--------------------------VRGDSGTMKRRKKSK  356
                  E++A CL+MLS D                           R D   +K R +S+
Sbjct  119  SDTFSTEDVARCLIMLSMDKWKKVKVKNGVDESVEEEEEDESDSGGRSD-FRIKDRVRSQ  177

Query  357  DKENFRCEICNGVFKCSQALGSHRTAHRNKTV  452
             K  ++CE C+ VF+  QALG HR +H+ KT+
Sbjct  178  GK--YKCETCDKVFRSYQALGGHRASHK-KTI  206



>ref|XP_008369456.1| PREDICTED: zinc finger protein ZAT4 [Malus domestica]
Length=332

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ +CKLC + FANG+ALGGHM++H A  P+ P   Q
Sbjct  1    MERHRCKLCSRAFANGRALGGHMKAHLATFPLPPKTHQ  38



>ref|XP_008355579.1| PREDICTED: zinc finger protein ZAT4-like [Malus domestica]
Length=332

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ +CKLC + FANG+ALGGHM++H A  P+ P   Q
Sbjct  1    MERHRCKLCSRAFANGRALGGHMKAHLATFPLPPKTHQ  38



>ref|XP_006412124.1| hypothetical protein EUTSA_v10025912mg [Eutrema salsugineum]
 gb|ESQ53577.1| hypothetical protein EUTSA_v10025912mg [Eutrema salsugineum]
Length=287

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 60/141 (43%), Gaps = 29/141 (21%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K+F + KAL GHMR H        P++Q  G   P        +  +++L   
Sbjct  77   RPCTECGKKFWSLKALFGHMRCH--------PERQWRGINPPPNHRGSAAASSSKQL---  125

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
              N+ S +  +   EE       +  +A CLLMLSD     S +  R         F C 
Sbjct  126  --NQRSPNWLSSMSEE-------DHLVASCLLMLSDATPSSSTSHDR---------FECG  167

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR  H+N
Sbjct  168  GCKKVFGSHQALGGHRATHKN  188



>ref|XP_007219458.1| hypothetical protein PRUPE_ppa021208mg [Prunus persica]
 gb|EMJ20657.1| hypothetical protein PRUPE_ppa021208mg [Prunus persica]
Length=391

 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 40/65 (62%), Gaps = 7/65 (11%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM-TPPQKQDSGGVDPTGKPAQGRSKRARR  188
            ME+ KCKLC + F+NG+ALGGHMRSH   LP+   P+ ++   V P      GR++   +
Sbjct  1    MERHKCKLCMRSFSNGRALGGHMRSHMMNLPIPAKPELEEEEEVPP------GRNQDQVQ  54

Query  189  LFVSE  203
            L + E
Sbjct  55   LLIDE  59



>ref|XP_010038418.1| PREDICTED: zinc finger protein ZAT1-like [Eucalyptus grandis]
Length=291

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 72/199 (36%), Gaps = 63/199 (32%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPL-----------------------------  101
            ME+ + CK+C + F+NGKA+GGHMRSHFA L                             
Sbjct  1    MERNRVCKICNRRFSNGKAMGGHMRSHFAKLPPRLPLPQPTPTPTPSSSLSLSPQRLHQG  60

Query  102  -PMTPPQKQDSGG-------VDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGK  257
             P TP    D G                 GR+  A  L     + E A       E +  
Sbjct  61   KPQTPAAVHDRGSDTESSRRRKRNRSKRWGRAVGADALL--NADVEQAISSVSETETLS-  117

Query  258  TAKLEENIAMCLLMLS------------------DDVRGDSGTMKRRKKSKDKENFRCEI  383
                E + A+CL+MLS                  D     S T    +    +  +RCE 
Sbjct  118  ----EADGALCLMMLSRGKWPKRSSAETDGHEEDDGDDSVSVTQMNGRAGSSRPKYRCET  173

Query  384  CNGVFKCSQALGSHRTAHR  440
            CN  F   QALG HR +H+
Sbjct  174  CNKGFGSYQALGGHRASHK  192



>ref|XP_010053941.1| PREDICTED: zinc finger protein ZAT9 [Eucalyptus grandis]
Length=384

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            ME+ KCKLC K F NG+ALGGHMRSH   LP+
Sbjct  1    MERHKCKLCSKSFYNGRALGGHMRSHLVNLPL  32



>gb|KDO61436.1| hypothetical protein CISIN_1g021090mg [Citrus sinensis]
Length=317

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC + F+NG+ALGGHM++H A  P+ P   Q
Sbjct  1    MEKHKCKLCTRSFSNGRALGGHMKAHLAAHPLPPKTNQ  38



>gb|KCW78318.1| hypothetical protein EUGRSUZ_D02497, partial [Eucalyptus grandis]
Length=373

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            ME+ KCKLC K F NG+ALGGHMRSH   LP+
Sbjct  1    MERHKCKLCSKSFYNGRALGGHMRSHLVNLPL  32



>ref|XP_006477184.1| PREDICTED: zinc finger protein ZAT4-like [Citrus sinensis]
Length=318

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC + F+NG+ALGGHM++H A  P+ P   Q
Sbjct  1    MEKHKCKLCTRSFSNGRALGGHMKAHLAAHPLPPKTNQ  38



>ref|XP_006440308.1| hypothetical protein CICLE_v10021224mg [Citrus clementina]
 gb|ESR53548.1| hypothetical protein CICLE_v10021224mg [Citrus clementina]
Length=317

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            MEK KCKLC + F+NG+ALGGHM++H A  P+ P   Q
Sbjct  1    MEKHKCKLCTRSFSNGRALGGHMKAHLAAHPLPPKTNQ  38



>ref|XP_010242904.1| PREDICTED: zinc finger protein ZAT3-like [Nelumbo nucifera]
Length=306

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 32/139 (23%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q  G ++P   P   R        VS E
Sbjct  69   CSECGKQFWSWKALFGHMRCH--------PERQWRG-INP---PPNYRRP------VSPE  110

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
            N      GAK  EE       E  +A CL+ML++     +         +++E + C  C
Sbjct  111  NRIEEAAGAKLTEE-------EHEVASCLVMLANWPNEPTAM-------EEEERYECLSC  156

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR +H+N
Sbjct  157  KRVFDSHQALGGHRASHKN  175



>ref|XP_008346565.1| PREDICTED: zinc finger protein ZAT4-like [Malus domestica]
 ref|XP_008346566.1| PREDICTED: zinc finger protein ZAT4-like [Malus domestica]
 ref|XP_008346567.1| PREDICTED: zinc finger protein ZAT4-like [Malus domestica]
Length=329

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQ  125
            ME+ +CKLC + FANG+ALGGHM++H A  P+ P   Q
Sbjct  1    MERHRCKLCSRAFANGRALGGHMKAHLATFPLPPKTHQ  38



>gb|KEH16508.1| C2H2-type zinc finger protein, putative [Medicago truncatula]
Length=361

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGV  140
            M+K KCKLC++ F NG+ALGGHMRSH   L +T  +++ S  V
Sbjct  1    MDKYKCKLCYRSFNNGRALGGHMRSHMMNLLVTKQEEESSRTV  43



>gb|KCW46301.1| hypothetical protein EUGRSUZ_K00165, partial [Eucalyptus grandis]
Length=261

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/199 (28%), Positives = 72/199 (36%), Gaps = 63/199 (32%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPL-----------------------------  101
            ME+ + CK+C + F+NGKA+GGHMRSHFA L                             
Sbjct  1    MERNRVCKICNRRFSNGKAMGGHMRSHFAKLPPRLPLPQPTPTPTPSSSLSLSPQRLHQG  60

Query  102  -PMTPPQKQDSGG-------VDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGK  257
             P TP    D G                 GR+  A  L     + E A       E +  
Sbjct  61   KPQTPAAVHDRGSDTESSRRRKRNRSKRWGRAVGADALL--NADVEQAISSVSETETLS-  117

Query  258  TAKLEENIAMCLLMLS------------------DDVRGDSGTMKRRKKSKDKENFRCEI  383
                E + A+CL+MLS                  D     S T    +    +  +RCE 
Sbjct  118  ----EADGALCLMMLSRGKWPKRSSAETDGHEEDDGDDSVSVTQMNGRAGSSRPKYRCET  173

Query  384  CNGVFKCSQALGSHRTAHR  440
            CN  F   QALG HR +H+
Sbjct  174  CNKGFGSYQALGGHRASHK  192



>ref|XP_007039829.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
 gb|EOY24330.1| C2H2-like zinc finger protein, putative [Theobroma cacao]
Length=325

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGG  137
            MEK KCKLC + F+NG+ALGGHM+ H A  P+ P   Q   G
Sbjct  1    MEKHKCKLCARTFSNGRALGGHMKGHLATHPLPPKTTQHQLG  42



>ref|XP_002313585.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE87540.1| zinc finger family protein [Populus trichocarpa]
Length=297

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 66/141 (47%), Gaps = 27/141 (19%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K+F + KAL GHMR H        P++Q   G++P   P   R        VS
Sbjct  67   RPCSECGKKFWSWKALFGHMRCH--------PERQ-WRGINP---PPNYRRP------VS  108

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
              ++  +     N E+M  TA+  E +A CLLML+D    D   M     ++    F C 
Sbjct  109  PIDQPVSIANPTNWEDM-MTAEDHE-VASCLLMLAD---SDGAAMLEVNCTR----FECS  159

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR +H+N
Sbjct  160  SCRKVFGSHQALGGHRASHKN  180



>ref|XP_004299433.1| PREDICTED: zinc finger protein ZAT4-like [Fragaria vesca subsp. 
vesca]
Length=323

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 45/89 (51%), Gaps = 7/89 (8%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            MEK +CKLC + F NG+ALGGHM++H A LP+ P   Q          PA+     +   
Sbjct  1    MEKHQCKLCSRFFNNGRALGGHMKAHMAVLPLPPKTHQQLA-------PAESTHSASSFS  53

Query  192  FVSEENEESADQGAKNEEEMGKTAKLEEN  278
              SE+ ++      + E++ G    L EN
Sbjct  54   SSSEDEQQKGSHQPEEEDQKGLAYGLREN  82



>ref|XP_004306958.1| PREDICTED: zinc finger protein ZAT9-like [Fragaria vesca subsp. 
vesca]
Length=404

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            ME+ KCKLC + F+NG+ALGGHMRSH   LP+
Sbjct  1    MERHKCKLCMRSFSNGRALGGHMRSHMMNLPI  32



>ref|XP_010436252.1| PREDICTED: zinc finger protein ZAT3-like [Camelina sativa]
Length=287

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 60/149 (40%), Gaps = 48/149 (32%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL-----  191
            C  C ++F + KAL GHMR H        P++Q  G   P        +  +++L     
Sbjct  76   CTECGRQFWSWKALFGHMRCH--------PERQWRGINPPPNYRNPTTAASSKQLNQIRS  127

Query  192  -----FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSK  356
                 F+SEE+ E                     +A CLLMLS+     S T +R     
Sbjct  128  QNWVSFMSEEDHE---------------------VASCLLMLSNGTPTSSSTSER-----  161

Query  357  DKENFRCEICNGVFKCSQALGSHRTAHRN  443
                F C  C  VF   QALG HR +HRN
Sbjct  162  ----FECGGCKKVFGSHQALGGHRASHRN  186



>ref|XP_008232572.1| PREDICTED: zinc finger protein ZAT9-like [Prunus mume]
Length=396

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            ME+ KCKLC + F+NG+ALGGHMRSH   LP+
Sbjct  1    MERHKCKLCMRSFSNGRALGGHMRSHMMNLPI  32



>ref|XP_006490224.1| PREDICTED: uncharacterized protein LOC102613230 [Citrus sinensis]
Length=859

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 79/194 (41%), Gaps = 51/194 (26%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRAR-  185
            M+K + CK+C + FANGKA+GGHMRSHFA  P++      S    P+   +    +  R 
Sbjct  1    MDKHRICKICNRRFANGKAMGGHMRSHFAKHPISSSNINPSPPKYPSSSSSLSNMQTYRS  60

Query  186  ---RLFVSEENEESADQGAKNEEEMGK---------TAKLEEN------IAMCLLMLSDD  311
               R F   E+E  A+      +   K         +  + EN      +AMCLL LS D
Sbjct  61   VNNRPFSGLEDESEAESSRNLTKARSKRPLRTIESVSNSVTENFLSDREVAMCLLKLSRD  120

Query  312  ---------------------VRGDSGTMKRRKKSKDK----------ENFRCEICNGVF  398
                                 VRG S      ++   +            ++C+ C   F
Sbjct  121  NWLQKDKQVVVAEAVVDEDEYVRGKSDDGDNDEEEDKEEDESSLVSRTNKYKCKTCKKEF  180

Query  399  KCSQALGSHRTAHR  440
            +  QALG H+ +H+
Sbjct  181  RSYQALGGHKASHK  194



>ref|XP_004147254.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
 ref|XP_004162353.1| PREDICTED: zinc finger protein ZAT9-like [Cucumis sativus]
 gb|KGN55858.1| hypothetical protein Csa_3G019980 [Cucumis sativus]
Length=252

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 32/172 (19%)
 Frame = +3

Query  6    MAMEKQKCKLCWKEFANGKALGGHMRSHFAPLPM-------TPPQK-----------QDS  131
            M  E+ KC+LC + F NG+ALGGHM++H A   +       +P  +           QD 
Sbjct  1    MEEERHKCRLCSRSFTNGRALGGHMKAHLATFSIEHQKTFKSPDLEMLSANGSISIVQDR  60

Query  132  GGVDPTGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLS--  305
                 +  P + RSKR RRL     N ES    +            EE++A+CL+MLS  
Sbjct  61   ESETESKNPTRRRSKRTRRL-----NTESLPSPSPEPASSISDTSPEEDVAICLVMLSME  115

Query  306  --DDVRGDSGTMKRRKKS-----KDKENFRCEICNGVFKCSQALGSHRTAHR  440
                 +  S T +  K +     + +++FRC  C   F+ ++AL  HR   R
Sbjct  116  KPSSWKDQSRTPESEKSTAAMVGRVRKSFRCGKCRKTFRSNRALFGHRKVCR  167



>ref|XP_010506448.1| PREDICTED: zinc finger protein ZAT4-like [Camelina sativa]
Length=334

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQ  164
            ME+ KC+ C+K F NG+ALGGHMRSH   L   P   + +G      +P+Q
Sbjct  1    MERYKCRFCFKSFINGRALGGHMRSHMLTLSEKPELYELTGEQQEEERPSQ  51



>ref|XP_010919568.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein ZAT4 [Elaeis 
guineensis]
Length=373

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 2/37 (5%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQK  122
            MEK  CKLC++ FANG+ALGGHMRSH      TPP K
Sbjct  1    MEKHTCKLCFRRFANGRALGGHMRSHVT--LATPPAK  35



>ref|XP_008448104.1| PREDICTED: zinc finger protein ZAT3 [Cucumis melo]
Length=366

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 29/139 (21%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q  G + P            R + VS  
Sbjct  82   CTECGKKFWSDKALFGHMRCH--------PERQWRGIIPPVN--------YRRPISVSPN  125

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
               + +  + +  E       +++IA  LLML++   G + ++ R   S+    F C  C
Sbjct  126  FSPNLEHSSNSFTEE------DQDIANSLLMLAN---GPNFSISRVSDSR----FECSSC  172

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR +H+N
Sbjct  173  KKVFGSHQALGGHRASHKN  191



>ref|XP_011090203.1| PREDICTED: zinc finger protein ZAT4-like [Sesamum indicum]
Length=378

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 46/96 (48%), Gaps = 25/96 (26%)
 Frame = +3

Query  270  EENIAMCLLMLS---------------------DDVRGDSGTMKRRKKSKDKENFRCEIC  386
            EE++A CL+MLS                     +D   DSG   +  K+K +  +RCE C
Sbjct  187  EEHVAHCLIMLSRDKWRREEKEYQDEEEEGKFENDYSEDSGVQVKVIKTKVRGKYRCEAC  246

Query  387  NGVFKCSQALGSHRTAHR----NKTVNAGAGAGEKL  482
            N +F+  QALG HR +H+    N  V+A     EK+
Sbjct  247  NKLFRSYQALGGHRASHKKIKPNTAVDAPPQVVEKI  282



>ref|XP_002510972.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF51574.1| zinc finger protein, putative [Ricinus communis]
Length=284

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            MEK + CK+C + FANGKA+GGHMRSH A LP+ P
Sbjct  1    MEKNRICKICNRRFANGKAMGGHMRSHLAKLPLPP  35



>ref|NP_195254.1| DUO1 activated  zinc finger 2 [Arabidopsis thaliana]
 sp|O65499.1|ZAT3_ARATH RecName: Full=Zinc finger protein ZAT3; AltName: Full=Protein 
DUO1-ACTIVATED ZINC FINGER 2 [Arabidopsis thaliana]
 emb|CAA18741.1| putative zinc-finger protein [Arabidopsis thaliana]
 emb|CAB80245.1| putative zinc-finger protein [Arabidopsis thaliana]
 gb|ABE66112.1| zinc finger family protein [Arabidopsis thaliana]
 dbj|BAH30557.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86489.1| DUO1 activated zinc finger 2 [Arabidopsis thaliana]
Length=284

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 61/147 (41%), Gaps = 47/147 (32%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGK--PAQGRSKRARRL---  191
            C  C ++F + KAL GHMR H        P++Q  G   P     P    SK+  ++   
Sbjct  79   CTECGRKFWSWKALFGHMRCH--------PERQWRGINPPPNYRVPTAASSKQLNQILPN  130

Query  192  ---FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDK  362
               F+SEE+ E                     +A CLLMLS+      GT      S   
Sbjct  131  WVSFMSEEDHE---------------------VASCLLMLSN------GT----PSSSSI  159

Query  363  ENFRCEICNGVFKCSQALGSHRTAHRN  443
            E F C  C  VF   QALG HR +H+N
Sbjct  160  ERFECGGCKKVFGSHQALGGHRASHKN  186



>gb|ABK28666.1| unknown [Arabidopsis thaliana]
Length=285

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 47/147 (32%), Positives = 61/147 (41%), Gaps = 47/147 (32%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGK--PAQGRSKRARRL---  191
            C  C ++F + KAL GHMR H        P++Q  G   P     P    SK+  ++   
Sbjct  79   CTECGRKFWSWKALFGHMRCH--------PERQWRGINPPPNYRVPTAASSKQLNQILPN  130

Query  192  ---FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDK  362
               F+SEE+ E                     +A CLLMLS+      GT      S   
Sbjct  131  WVSFMSEEDHE---------------------VASCLLMLSN------GT----PSSSSI  159

Query  363  ENFRCEICNGVFKCSQALGSHRTAHRN  443
            E F C  C  VF   QALG HR +H+N
Sbjct  160  ERFECGGCKKVFGSHQALGGHRASHKN  186



>gb|KEH29190.1| Cys2/His2 zinc-finger transcription factor [Medicago truncatula]
Length=378

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLP  104
            MEK KCK C + F+NG+ALGGHMRSH   LP
Sbjct  2    MEKHKCKFCMRSFSNGRALGGHMRSHMMNLP  32



>gb|KGN43335.1| hypothetical protein Csa_7G024090 [Cucumis sativus]
Length=291

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 62/139 (45%), Gaps = 29/139 (21%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q  G + P            RR   +  
Sbjct  86   CTECGKKFWSDKALFGHMRCH--------PERQWRGIIPPVN---------YRRPVSASP  128

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
            N     + + N        + +++IA  LLML++   G + ++ R   S+    F C  C
Sbjct  129  NFSPNVEHSSN-----SFTEEDQDIANSLLMLAN---GPNFSISRVSDSR----FECSSC  176

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR +H+N
Sbjct  177  KKVFGSHQALGGHRASHKN  195



>ref|NP_179309.1| protein DUO1-ACTIVATED ZINC FINGER 1 [Arabidopsis thaliana]
 sp|Q9SIJ0.1|ZAT2_ARATH RecName: Full=Zinc finger protein ZAT2; AltName: Full=Protein 
DUO1-ACTIVATED ZINC FINGER 1 [Arabidopsis thaliana]
 gb|AAD25136.1| putative C2H2-type zinc finger protein [Arabidopsis thaliana]
 gb|AAY78685.1| zinc finger (C2H2 type) family protein [Arabidopsis thaliana]
 dbj|BAH30388.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC06595.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
Length=270

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 66/139 (47%), Gaps = 33/139 (24%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q   G++P        S   RR  ++  
Sbjct  67   CTECGKQFGSLKALFGHMRCH--------PERQ-WRGINPP-------SNFKRR--INSN  108

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
               S+     +EEE         NIA CLLM+++   GD  T    + S+ +E F C+ C
Sbjct  109  AASSSSSWDPSEEE--------HNIASCLLMMAN---GDVPT----RSSEVEERFECDGC  153

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR  H++
Sbjct  154  KKVFGSHQALGGHRATHKD  172



>ref|XP_006294533.1| hypothetical protein CARUB_v10023569mg [Capsella rubella]
 gb|EOA27431.1| hypothetical protein CARUB_v10023569mg [Capsella rubella]
Length=340

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            ME+ KC+ C+K F NGKALGGHMRSH   L   P
Sbjct  1    MERYKCRFCFKSFINGKALGGHMRSHMLTLSAKP  34



>gb|KDP22438.1| hypothetical protein JCGZ_26269 [Jatropha curcas]
Length=335

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            MEK + C++C + FANGKA+GGHMRSH A LP+ P
Sbjct  1    MEKNRICRICNRRFANGKAMGGHMRSHLAKLPLPP  35



>ref|NP_001053505.1| Os04g0552700 [Oryza sativa Japonica Group]
 emb|CAE01690.2| OSJNBa0010H02.11 [Oryza sativa Japonica Group]
 dbj|BAF15419.1| Os04g0552700 [Oryza sativa Japonica Group]
 dbj|BAH00746.1| unnamed protein product [Oryza sativa Japonica Group]
Length=311

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 76/196 (39%), Gaps = 54/196 (28%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTG----------KPA  161
            M K  CKLC++ F N +AL GHMRSH      +      S                 +P 
Sbjct  1    MAKNTCKLCYRRFGNPRALAGHMRSHSVAASRSQISSTSSASTSVAVGDDDGGGDAKRPI  60

Query  162  QG---RSKRARRL------FVSEENE----------ESADQGAKNEEEMGKT--AKLEEN  278
            QG   R K  RR+      F   E+E          + A+ G+ + E++     A  EE+
Sbjct  61   QGYVLREKPKRRVRLAESDFSDRESETEYYSSPPHGKRANTGSGDVEQVSSVSDATSEED  120

Query  279  IAMCLLMLSDDVRGDSGTMKRRKK-----------------------SKDKENFRCEICN  389
            +A+ L+MLS D    +       +                       ++ +  F+C  C 
Sbjct  121  VALSLMMLSRDTWPATPPPPPPYRLRGAGYDDGSDGGDAPPAPAAAAAQKRTRFQCPACK  180

Query  390  GVFKCSQALGSHRTAH  437
             VF+  QALG HR +H
Sbjct  181  KVFRSYQALGGHRASH  196



>emb|CAH67411.1| OSIGBa0143N19.5 [Oryza sativa Indica Group]
 gb|EAY95098.1| hypothetical protein OsI_16915 [Oryza sativa Indica Group]
Length=311

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 76/196 (39%), Gaps = 54/196 (28%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTG----------KPA  161
            M K  CKLC++ F N +AL GHMRSH      +      S                 +P 
Sbjct  1    MAKNTCKLCYRRFGNPRALAGHMRSHSVAASRSQISSTSSASTSVAVGDDDGGGDAKRPI  60

Query  162  QG---RSKRARRL------FVSEENE----------ESADQGAKNEEEMGKT--AKLEEN  278
            QG   R K  RR+      F   E+E          + A+ G+ + E++     A  EE+
Sbjct  61   QGYVLREKPKRRVRLAESDFSDRESETEYYSSPPHGKRANTGSGDVEQVSSVSDATSEED  120

Query  279  IAMCLLMLSDDVRGDSGTMKRRKK-----------------------SKDKENFRCEICN  389
            +A+ L+MLS D    +       +                       ++ +  F+C  C 
Sbjct  121  VALSLMMLSRDTWPATPPPPPPYRLRGAGYDDGSDGGDAPPAPAAAAAQKRTRFQCPACK  180

Query  390  GVFKCSQALGSHRTAH  437
             VF+  QALG HR +H
Sbjct  181  KVFRSYQALGGHRASH  196



>ref|XP_010484494.1| PREDICTED: zinc finger protein AZF1-like [Camelina sativa]
Length=249

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 43/83 (52%), Gaps = 5/83 (6%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDS--GTMKRRKKSKDKENFRCEICNGV  395
            D   +N+E   K    EE +A+CLLML+   RG +       R    D  +++C +C   
Sbjct  47   DHYQQNQETNTKLPSEEEYLALCLLMLA---RGSAVQSPPPSRPSPYDHRDYKCTVCGKS  103

Query  396  FKCSQALGSHRTAHRNKTVNAGA  464
            F   QALG H+T+HR  T N+ A
Sbjct  104  FSSYQALGGHKTSHRKPTNNSTA  126



>ref|XP_004294605.1| PREDICTED: zinc finger protein ZAT11-like [Fragaria vesca subsp. 
vesca]
Length=176

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (56%), Gaps = 1/70 (1%)
 Frame = +3

Query  276  NIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKTVN  455
            ++  CL++LS DV G +G+   +K+      F C+ CN  F   QALG HR +H    + 
Sbjct  13   DLVSCLMLLSKDV-GQTGSSPIKKQKTSDRAFACKTCNREFSSFQALGGHRASHNKPKLV  71

Query  456  AGAGAGEKLR  485
            AG GA + L+
Sbjct  72   AGNGAADLLQ  81



>ref|XP_010934955.1| PREDICTED: zinc finger protein ZAT1-like [Elaeis guineensis]
Length=357

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPP  116
            ME+ +C LC++ F++G+ALGGHMRSH  P P   P
Sbjct  1    MERHRCNLCFRRFSSGRALGGHMRSHVTPRPTRAP  35



>emb|CDY08718.1| BnaA06g25060D [Brassica napus]
Length=241

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 42/84 (50%), Gaps = 12/84 (14%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDS------GTMKRRKKSKDKENFRCEI  383
            DQ   N+E    T   EE +A+CLLML+   RG +           R+ S D  +F+C +
Sbjct  46   DQNHHNQE---TTPSEEEYLALCLLMLA---RGTAVQPPPTPPPPSRRLSSDHRDFKCTV  99

Query  384  CNGVFKCSQALGSHRTAHRNKTVN  455
            C   F   QALG H+T+HR    N
Sbjct  100  CGKSFNSYQALGGHKTSHRKPPAN  123



>ref|XP_002460947.1| hypothetical protein SORBIDRAFT_02g038000 [Sorghum bicolor]
 gb|EER97468.1| hypothetical protein SORBIDRAFT_02g038000 [Sorghum bicolor]
Length=239

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/66 (35%), Positives = 36/66 (55%), Gaps = 9/66 (14%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGT---------MKRRKKSKDKENFRCEICNGVFKCSQALGS  422
            +E +A+CLLMLS  +RGD  T         + +  +   +  + C +C  V+   QALG 
Sbjct  57   QEYLALCLLMLSRGLRGDDATDVGGGAAPTVAKTTQHHHQHGYECSVCGKVYPSYQALGG  116

Query  423  HRTAHR  440
            H+T+HR
Sbjct  117  HKTSHR  122



>ref|XP_008234415.1| PREDICTED: zinc finger protein ZAT9 [Prunus mume]
Length=324

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 27/33 (82%), Gaps = 1/33 (3%)
 Frame = +3

Query  12   MEKQK-CKLCWKEFANGKALGGHMRSHFAPLPM  107
            MEK + CK+C K FANGKA+GGHMRSH A LP+
Sbjct  1    MEKHRICKICNKRFANGKAMGGHMRSHLAKLPL  33



>ref|XP_002279570.1| PREDICTED: zinc finger protein ZAT10 [Vitis vinifera]
Length=233

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 5/62 (8%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKE-----NFRCEICNGVFKCSQALGSHRTA  434
            EE +A+CL+ML+   RGD  T  R             +++C +CN  F   QALG H+ +
Sbjct  47   EEYLALCLIMLAQGGRGDVATQLRHHSPPPPPPALTLSYKCSVCNKAFPSYQALGGHKAS  106

Query  435  HR  440
            HR
Sbjct  107  HR  108



>ref|XP_002867079.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43338.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=283

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 63/139 (45%), Gaps = 31/139 (22%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C ++F + KAL GHMR H        P++Q  G ++P        +  +R+L     
Sbjct  79   CTECGRQFWSWKALFGHMRCH--------PERQWRG-INPPPNYRASTTASSRQL-----  124

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
            N+ S +  +   EE       +  +A CLL+LS+      GT      S   E F C  C
Sbjct  125  NQRSPNWVSFMSEE-------DHEVASCLLLLSN------GT----PSSSSSERFECGGC  167

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR +H+N
Sbjct  168  KKVFGSHQALGGHRASHKN  186



>emb|CDP09473.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQD  128
            MEK +CKLC + FANG+ALGGHMRSH   L      KQ+
Sbjct  1    MEKHRCKLCSRNFANGRALGGHMRSHMMNLCAASKAKQE  39



>ref|XP_010692450.1| PREDICTED: uncharacterized protein LOC104905560 [Beta vulgaris 
subsp. vulgaris]
Length=916

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL  101
            ME+ +CKLC+++FANG+ALGGHMRSH   L
Sbjct  551  MERHRCKLCYRKFANGRALGGHMRSHMMNL  580



>gb|AAO16037.1|AF525022_1 zinc finger protein [Arabidopsis thaliana]
Length=245

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 9/93 (10%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDS------GTMKRRKKSKDKENFRCEI  383
            D G +N+E        EE +A+CLLML+   RG +        +  R    D  +++C +
Sbjct  45   DHGHQNQETNKNLPSEEEYLALCLLMLA---RGSAVQSPPLPPLPSRASPSDHRDYKCTV  101

Query  384  CNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKL  482
            C   F   QALG H+T+HR  T  +     ++L
Sbjct  102  CGKSFSSYQALGGHKTSHRKPTNTSITSGNQEL  134



>ref|NP_201546.1| zinc-finger protein 1 [Arabidopsis thaliana]
 sp|Q9SSW1.1|AZF1_ARATH RecName: Full=Zinc finger protein AZF1; AltName: Full=Zinc finger 
protein OZAKGYO; AltName: Full=Zinc-finger protein 1 [Arabidopsis 
thaliana]
 dbj|BAA85108.1| Cys2/His2-type zinc finger protein 1 [Arabidopsis thaliana]
 dbj|BAB09030.1| Cys2/His2-type zinc finger protein 1 [Arabidopsis thaliana]
 gb|AAM78034.1| zinc finger protein OZAKGYO [Arabidopsis thaliana]
 gb|AAO23629.1| At5g67450 [Arabidopsis thaliana]
 dbj|BAE99599.1| Cys2/His2-type zinc finger protein 1 [Arabidopsis thaliana]
 gb|AED98346.1| zinc-finger protein 1 [Arabidopsis thaliana]
 dbj|BAP16478.1| Cys2/His2-type zinc finger protein 1 [Cloning vector pTACAtg1]
Length=245

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 9/93 (10%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDS------GTMKRRKKSKDKENFRCEI  383
            D G +N+E        EE +A+CLLML+   RG +        +  R    D  +++C +
Sbjct  45   DHGHQNQETNKNLPSEEEYLALCLLMLA---RGSAVQSPPLPPLPSRASPSDHRDYKCTV  101

Query  384  CNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKL  482
            C   F   QALG H+T+HR  T  +     ++L
Sbjct  102  CGKSFSSYQALGGHKTSHRKPTNTSITSGNQEL  134



>ref|XP_011081399.1| PREDICTED: zinc finger protein ZAT1-like [Sesamum indicum]
Length=418

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 77/179 (43%), Gaps = 43/179 (24%)
 Frame = +3

Query  18   KQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTG-KPAQGRSKRARRL-  191
            +  CK+C + F    ALGGHMR+H     +       +  + P G +  +G +K +  L 
Sbjct  21   RHYCKVCNRGFNCAGALGGHMRAH-----VIGDVSHHNNVIPPHGDEHLRGNNKHSYFLR  75

Query  192  -----FVSEE---NEESAD-----------------------QGAKNE--EEMGKTAKLE  272
                 FV      N+E  +                       QG+K+E  +     +  E
Sbjct  76   AKTTRFVGYHQPSNDEDGELKKPSSFGRFGVEKERVLPMLSSQGSKSELFDHEYSASSEE  135

Query  273  ENIAMCLLMLSDDVRGDSGTMKRRKKSKD---KENFRCEICNGVFKCSQALGSHRTAHR  440
            E++A CL+MLS+     S   K   K+K+   K  F+C+ C  VF   QALG HR +H+
Sbjct  136  EDLANCLVMLSNKSYALSSDNKEENKAKEVAEKGLFQCKACKKVFNSHQALGGHRASHK  194



>ref|XP_010518124.1| PREDICTED: zinc finger protein ZAT4-like [Camelina sativa]
Length=337

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (59%), Gaps = 0/51 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQ  164
            ME+  C+ C+K F NG+ALGGHMRSH   L   P   + +G      +P+Q
Sbjct  1    MERYNCRFCFKSFINGRALGGHMRSHMLTLSEKPELYELTGEQQEEERPSQ  51



>ref|XP_004516354.1| PREDICTED: zinc finger protein ZAT1-like [Cicer arietinum]
Length=181

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD  143
            C +C K F+NGKALGGHM+SH A LP+ P    +S  ++
Sbjct  18   CTICNKSFSNGKALGGHMKSHLAKLPVPPKPPNNSQVIE  56



>emb|CDX95629.1| BnaC03g25100D [Brassica napus]
Length=274

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLP  104
            ME+ KC+ C+K F NG+ALGGHMRSH   LP
Sbjct  1    MERYKCRFCFKSFLNGRALGGHMRSHMLTLP  31



>ref|XP_010538415.1| PREDICTED: zinc finger protein ZAT4-like [Tarenaya hassleriana]
Length=254

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 25/32 (78%), Gaps = 1/32 (3%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHF-APLP  104
            MEK +CKLC K F NG+ALGGHM+SH  A LP
Sbjct  1    MEKHRCKLCLKSFVNGRALGGHMKSHIVASLP  32



>ref|XP_010508210.1| PREDICTED: zinc finger protein ZAT4-like [Camelina sativa]
Length=329

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            ME+ KC+ C+K F NG+ALGGHMRSH   L   P
Sbjct  1    MERYKCRFCFKSFVNGRALGGHMRSHMLTLSEKP  34



>ref|XP_009415446.1| PREDICTED: zinc finger protein ZAT1-like [Musa acuminata subsp. 
malaccensis]
Length=331

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLP  104
            ME+ +CKLC + F+NG+ALGGHMRSH A +P
Sbjct  1    MERHRCKLCHRRFSNGRALGGHMRSHVAHVP  31



>ref|XP_008236445.1| PREDICTED: zinc finger protein ZAT10-like [Prunus mume]
Length=241

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHR  440
            EE +A+CL+ML+     DS      +    K +++C +CN  F   QALG H+ +HR
Sbjct  52   EEYLALCLIMLARGTSADSDAELPPQPPALKLSYKCSVCNKAFSSYQALGGHKASHR  108



>ref|XP_010444644.1| PREDICTED: zinc finger protein AZF1-like [Camelina sativa]
Length=254

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (53%), Gaps = 5/80 (6%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDS--GTMKRRKKSKDKENFRCEICNGV  395
            D   +N+E   K    EE +A+CLLML+   RG +       R    D+ +++C +C   
Sbjct  47   DHHHQNQETNTKLPSEEEYLALCLLMLA---RGSTVQSPSPSRPSPSDQRDYKCTVCGKS  103

Query  396  FKCSQALGSHRTAHRNKTVN  455
            F   QALG H+T+HR  T N
Sbjct  104  FSSYQALGGHKTSHRKPTNN  123



>ref|XP_008375818.1| PREDICTED: zinc finger protein ZAT9-like [Malus domestica]
Length=386

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 34/65 (52%), Gaps = 13/65 (20%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            MEK +CK+C + F NG+ALGGHMRSH    P+ P             KP +  S R +  
Sbjct  1    MEKHECKICMRSFPNGRALGGHMRSHVRNHPIPP-------------KPGEEESNREQTQ  47

Query  192  FVSEE  206
            F  +E
Sbjct  48   FTMDE  52



>ref|XP_010467471.1| PREDICTED: zinc finger protein ZAT2-like [Camelina sativa]
Length=278

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 60/144 (42%), Gaps = 33/144 (23%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K+F + KAL GHMR H        P++Q  G + P   P   R          
Sbjct  68   RPCTECGKQFGSLKALFGHMRCH--------PERQWRGIIPP---PDHKRGT--------  108

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDD---VRGDSGTMKRRKKSKDKENF  371
              N  +A   +     + K+ + + NIA CLL+L+     +   SG   R         F
Sbjct  109  --NATAASSSSNLNVVLNKSEEEDHNIASCLLLLAKRPVVLSSSSGVEGR---------F  157

Query  372  RCEICNGVFKCSQALGSHRTAHRN  443
             C  C  VF   QALG HR  H++
Sbjct  158  ECGGCKKVFGSHQALGGHRATHKD  181



>ref|XP_009121152.1| PREDICTED: zinc finger protein ZAT2 [Brassica rapa]
Length=253

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 68/160 (43%), Gaps = 26/160 (16%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSG-----GVDPTGKPAQGRSKRAR  185
            + CK+C K+F + KAL GHMRSH        P++Q  G        PT  P    ++  +
Sbjct  61   EPCKVCGKKFWSSKALHGHMRSH--------PERQWRGINPPPNHQPTAPPVSVTAEEGQ  112

Query  186  RLFVSEENEESADQGAKNEEEMGKTA-----KLEENIAMCLLMLSDDVRGDSG---TMKR  341
             L  +     S   G + E E  K        L+ +I   +L L+ D    S     +  
Sbjct  113  VLANASTTGSSVGVGGRFECEGCKKVFESRQALDGHICSAILNLNVDPPPPSAPQEIVDE  172

Query  342  RKKSK-----DKENFRCEICNGVFKCSQALGSHRTAHRNK  446
              KSK      + N RC+IC+  F   QALG H   H +K
Sbjct  173  DDKSKSVMVVSEMNHRCDICSKAFSSGQALGGHMRRHWHK  212



>ref|XP_010515478.1| PREDICTED: zinc finger protein ZAT2-like [Camelina sativa]
Length=278

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/146 (31%), Positives = 59/146 (40%), Gaps = 41/146 (28%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPT----GKPAQGRSKRARRLF  194
            C  C K+F + KAL GHMR H        P++Q  G + P     G  A   S  +   F
Sbjct  70   CTECGKQFGSLKALFGHMRCH--------PERQWRGIIPPPDHKRGTNATAASSSSNLNF  121

Query  195  VSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDD---VRGDSGTMKRRKKSKDKE  365
            V  ++EE                  + NIA CLL+L+     +   SG   R        
Sbjct  122  VLNKSEEE-----------------DHNIASCLLLLAKRPVVLSSSSGVEGR--------  156

Query  366  NFRCEICNGVFKCSQALGSHRTAHRN  443
             F C  C  VF   QALG HR  H++
Sbjct  157  -FECGGCKKVFGSHQALGGHRATHKD  181



>ref|XP_006650277.1| PREDICTED: zinc finger protein 1-like [Oryza brachyantha]
Length=224

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKR-RKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            EE +A+ LLML+   R D   +   R++ ++K+  RC +C   F   QALG H+T+HR +
Sbjct  41   EEYLALSLLMLARGHRDDRPAVPAARQEEEEKQQHRCSVCGRAFSSYQALGGHKTSHRPR  100

Query  447  T  449
            T
Sbjct  101  T  101



>ref|XP_010489335.1| PREDICTED: zinc finger protein ZAT2-like [Camelina sativa]
Length=270

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 59/142 (42%), Gaps = 33/142 (23%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q  G + P   P   R            
Sbjct  70   CTECGKQFGSLKALFGHMRCH--------PERQWRGIIPP---PDHKRGT----------  108

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDD---VRGDSGTMKRRKKSKDKENFRC  377
            N  +A   +     + K+ + + NIA CLL+L+     +   SG   R         F C
Sbjct  109  NATAASSSSNLNFVLNKSEEEDHNIASCLLLLAKRPVVLSSSSGVEGR---------FEC  159

Query  378  EICNGVFKCSQALGSHRTAHRN  443
              C  VF   QALG HR  H++
Sbjct  160  GGCKKVFGSHQALGGHRATHKD  181



>ref|NP_182037.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
 sp|Q9SHD0.1|ZAT4_ARATH RecName: Full=Zinc finger protein ZAT4 [Arabidopsis thaliana]
 gb|AAL69471.1| At2g45120/T14P1.7 [Arabidopsis thaliana]
 dbj|BAH30429.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10509.1| C2H2-like zinc finger protein [Arabidopsis thaliana]
Length=314

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 43/91 (47%), Gaps = 14/91 (15%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRR-------------KKSKDKENFRCEICNGVFKCSQ  410
            EE++A CL+MLS D        K+R             K SK +  F+CE C  VFK  Q
Sbjct  148  EEDLAFCLIMLSRDKWKQQKKKKQRVEEDETDHDSEDYKSSKSRGRFKCETCGKVFKSYQ  207

Query  411  ALGSHRTAH-RNKTVNAGAGAGEKLRNLGVK  500
            ALG HR +H +NK         E    LGVK
Sbjct  208  ALGGHRASHKKNKACMTKTEQVETEYVLGVK  238


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL  101
            ME+ KC+ C+K F NG+ALGGHMRSH   L
Sbjct  1    MERYKCRFCFKSFINGRALGGHMRSHMLTL  30



>ref|XP_004494014.1| PREDICTED: zinc finger protein ZAT4-like [Cicer arietinum]
Length=355

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGV  140
            M+K  CKLC++ F+NG+ALGGHMRSH   L +   +++ S  +
Sbjct  1    MDKYNCKLCYRSFSNGRALGGHMRSHMMNLIVNKQEEKSSRTI  43



>ref|XP_011000896.1| PREDICTED: zinc finger protein ZAT3-like [Populus euphratica]
Length=297

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 61/141 (43%), Gaps = 27/141 (19%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K+F + KAL GHMR H        P++Q   G++P     +  S   + + ++
Sbjct  67   RPCSECGKKFWSWKALFGHMRCH--------PERQ-WRGINPPPNNLRPVSPIDQPVSIA  117

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
                      A++ E           +A CLLML+D    D   M     ++    F C 
Sbjct  118  SPTNWKGMMTAEDHE-----------VASCLLMLAD---SDGAAMLELNCTR----FECS  159

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR +H+N
Sbjct  160  SCRKVFGSHQALGGHRASHKN  180



>ref|XP_002880157.1| hypothetical protein ARALYDRAFT_483645 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56416.1| hypothetical protein ARALYDRAFT_483645 [Arabidopsis lyrata subsp. 
lyrata]
Length=325

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 49/95 (52%), Gaps = 11/95 (12%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL  191
            ME+ KC+ C+K F NG+ALGGHMRSH   L             + TG+ A+ R  +    
Sbjct  1    MERYKCRFCFKSFINGRALGGHMRSHMLSLSAKREL------YELTGEEAEERPSQ----  50

Query  192  FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLL  296
             +S++++  +D  +  EE+        +N+ M LL
Sbjct  51   -LSDDDDTESDASSSGEEQDHLNCGEFDNLKMNLL  84



>ref|XP_010941146.1| PREDICTED: zinc finger protein ZAT1-like [Elaeis guineensis]
Length=345

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFAP  98
           ME+ +CKLC++ F++G+ALGGHMRSH  P
Sbjct  1   MERHRCKLCFRRFSSGRALGGHMRSHVTP  29



>ref|XP_010053481.1| PREDICTED: zinc finger protein ZAT4-like [Eucalyptus grandis]
 gb|KCW77791.1| hypothetical protein EUGRSUZ_D02083 [Eucalyptus grandis]
Length=369

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPM  107
            ME+ +CKLC++ FANG+ALGGHM++H A L +
Sbjct  1    MERPRCKLCFRTFANGRALGGHMKAHLASLKI  32



>ref|XP_008787063.1| PREDICTED: zinc finger protein ZAT9-like [Phoenix dactylifera]
Length=376

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSH  89
           MEK  CKLC++ FANG+ALGGHMRSH
Sbjct  1   MEKHACKLCFRRFANGRALGGHMRSH  26



>ref|XP_009400680.1| PREDICTED: zinc finger protein ZAT9-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 3/33 (9%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHF---APL  101
            M++  C LC++ F+NG+ALGGHMRSHF   APL
Sbjct  1    MDRHTCNLCFRRFSNGRALGGHMRSHFIAAAPL  33



>ref|XP_006397693.1| hypothetical protein EUTSA_v10001538mg [Eutrema salsugineum]
 gb|ESQ39146.1| hypothetical protein EUTSA_v10001538mg [Eutrema salsugineum]
Length=341

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL  101
            MEK KC+ C+K F NG+ALGGHMRSH   L
Sbjct  1    MEKYKCRFCFKSFLNGRALGGHMRSHMLSL  30



>ref|XP_010413542.1| PREDICTED: zinc finger protein ZAT9-like [Camelina sativa]
Length=328

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL  101
            ME  KC+ C+K FANG+ALGGHMRSH   L
Sbjct  1    MENYKCRYCFKSFANGRALGGHMRSHMPSL  30



>ref|XP_011031881.1| PREDICTED: zinc finger protein ZAT9 [Populus euphratica]
Length=333

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 6/44 (14%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVD  143
            MEK KCKLC + F NG+ALGGHM++H A        +Q  GG+D
Sbjct  1    MEKHKCKLCVRTFPNGRALGGHMKAHLA------ATRQQLGGLD  38



>gb|ACF84121.1| unknown [Zea mays]
Length=275

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 30/59 (51%), Gaps = 2/59 (3%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            EEN+A+CLLMLS    G                FRC +C   F   QALG H+T+HR K
Sbjct  59   EENLALCLLMLSRG--GHHRVQAPPTPVPSAAEFRCSVCGKSFSSYQALGGHKTSHRVK  115



>emb|CDY09671.1| BnaC07g33900D [Brassica napus]
Length=200

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>emb|CDY40527.1| BnaC01g19850D [Brassica napus]
Length=194

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_009145673.1| PREDICTED: zinc finger protein ZAT9-like isoform X1 [Brassica 
rapa]
 ref|XP_009145681.1| PREDICTED: zinc finger protein ZAT9-like isoform X2 [Brassica 
rapa]
Length=200

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_009769205.1| PREDICTED: zinc finger protein ZAT10-like [Nicotiana sylvestris]
Length=222

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/63 (35%), Positives = 33/63 (52%), Gaps = 0/63 (0%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKT  449
            EE +A CLLML+      + T      S+ K  ++C +C   F   QALG H+ +HR + 
Sbjct  50   EEYLAFCLLMLARSGNSTNSTNLISTSSESKNLYKCSVCGKSFGSYQALGGHKASHRKQL  109

Query  450  VNA  458
            +N 
Sbjct  110  ING  112



>ref|XP_010524399.1| PREDICTED: zinc finger protein ZAT4-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010524400.1| PREDICTED: zinc finger protein ZAT4-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010524401.1| PREDICTED: zinc finger protein ZAT4-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010524402.1| PREDICTED: zinc finger protein ZAT4-like isoform X1 [Tarenaya 
hassleriana]
Length=357

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAPL  101
            ME+ KC+ C+K F NG+ALGGHMRSH   L
Sbjct  1    MERYKCRFCFKSFVNGRALGGHMRSHMLSL  30



>ref|XP_006828716.1| hypothetical protein AMTR_s00001p00024970 [Amborella trichopoda]
 gb|ERM96132.1| hypothetical protein AMTR_s00001p00024970 [Amborella trichopoda]
Length=456

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 63/161 (39%), Gaps = 34/161 (21%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K F + KAL GHMR H        P++Q   G++P   P   R            
Sbjct  108  CTECGKRFWSWKALFGHMRCH--------PERQ-WRGINPP--PHLIR------------  144

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGD------SGTMKRRKKSKDKEN  368
                 +            +  E++IA CL+M+S+D   +      S ++    +  D   
Sbjct  145  -----NPPPTPPPPPPPLSLEEQDIARCLVMMSNDDENENNELSLSLSLAPPPEPVDHSR  199

Query  369  FRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKLRNL  491
            F C  C  VF   QALG HR +H+N       G GE    L
Sbjct  200  FECSSCKRVFASHQALGGHRASHKNVKGCFAKGEGEDTEEL  240



>ref|XP_007200425.1| hypothetical protein PRUPE_ppa011060mg [Prunus persica]
 gb|EMJ01624.1| hypothetical protein PRUPE_ppa011060mg [Prunus persica]
Length=225

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 0/57 (0%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHR  440
            EE +A+CL+ML+     D+      +    K +++C +CN  F   QALG H+ +HR
Sbjct  52   EEYLALCLIMLARGTTADADAELPPQPPSLKLSYKCSVCNKAFSSYQALGGHKASHR  108



>ref|XP_009123026.1| PREDICTED: zinc finger protein ZAT9-like [Brassica rapa]
 emb|CDY53641.1| BnaA08g30310D [Brassica napus]
Length=209

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_009594475.1| PREDICTED: zinc finger protein ZAT3-like [Nicotiana tomentosiformis]
Length=316

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 72/177 (41%), Gaps = 33/177 (19%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSG-GVDPTGKPAQGRSKRARRLFV  197
            + C  C K+F + KAL GHMR H        P++Q  G    P  +     S  +   F 
Sbjct  93   RPCTECGKKFWSLKALFGHMRCH--------PERQWRGINPPPNFRRHNADSSTSAPEFS  144

Query  198  SEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLS------DDVRGDSGTMKRRKKSKD  359
              +NE S+ Q  K+   M  T + + +IA CLL+L+      DD       +K    + D
Sbjct  145  PRQNEVSS-QAPKSLPHMIMTDE-DHDIASCLLLLANGGPKPDDNDEPENVVKDNLINVD  202

Query  360  KE----------------NFRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGEKL  482
                               F C  C  VF   QALG H+ +H+N      +G+G  L
Sbjct  203  ASAEPSASFSGVGIAKCCQFECSSCKKVFGSHQALGGHKASHKNVKGCFASGSGSGL  259



>emb|CDY69391.1| BnaA03g58060D [Brassica napus]
Length=214

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_008669045.1| PREDICTED: zinc finger protein ZAT1-like [Zea mays]
 tpg|DAA36529.1| TPA: hypothetical protein ZEAMMB73_243689 [Zea mays]
Length=307

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 72/187 (39%), Gaps = 46/187 (25%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSH-------FAPLPMTPPQKQDSGGVDPTGK--PAQ  164
            M K  CKLC + FA+ +AL GHMR+H             +      + G+D   K  P +
Sbjct  1    MAKSTCKLCSRRFASPRALAGHMRAHSMASAKSQISSASSASTSITASGIDADKKRGPVR  60

Query  165  GRS-----KRARRLFVSEENEESADQGAKNEE---------------EMGKTAKLEENIA  284
            G +     KR  RL  S+   E+ D  + + +                +   A  EE++A
Sbjct  61   GHALRENPKRRGRLDDSDRESETTDYYSPSPDAKRSHAGSGDAEPVSSVSDAATPEEDVA  120

Query  285  MCLLMLSDDVRGDSGTMKRR-----------------KKSKDKENFRCEICNGVFKCSQA  413
            + L+MLS D          R                   ++ +  + C  C  VF+  QA
Sbjct  121  LSLMMLSRDSWPAPPPYSYRLDSDDDDESDARPAVVAATAQKRTRYECPACKKVFRSYQA  180

Query  414  LGSHRTA  434
            LG HR +
Sbjct  181  LGGHRAS  187



>emb|CDX75488.1| BnaA01g02140D [Brassica napus]
Length=275

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 56/144 (39%), Gaps = 42/144 (29%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRL-----  191
            C  C K F + KAL GHMR H        P++Q  G   P       R+  ++ L     
Sbjct  70   CTECGKTFWSWKALFGHMRCH--------PERQWRGINPPPNHRVPIRTSSSKHLNQRFS  121

Query  192  FVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENF  371
             +SEE+ E                     +A  LLMLS+         K    S   E F
Sbjct  122  LMSEEDYE---------------------VASYLLMLSE--------AKPLSPSSSGERF  152

Query  372  RCEICNGVFKCSQALGSHRTAHRN  443
             C  C  VF   QALG HR +H+N
Sbjct  153  ECRGCKKVFGSHQALGGHRASHKN  176



>ref|XP_009136798.1| PREDICTED: zinc finger protein ZAT1-like [Brassica rapa]
Length=214

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>emb|CDX72529.1| BnaC07g45510D [Brassica napus]
Length=290

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 61/141 (43%), Gaps = 30/141 (21%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K F + KAL GHMR H        P++Q  G ++P   P   R         S
Sbjct  79   RPCTECGKTFWSWKALFGHMRCH--------PERQWRG-INP---PPNHRGPTPASF--S  124

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCE  380
             +N+ S +  +   EE       +  +A  LLML++ +   S   +R         F C 
Sbjct  125  NQNQRSPNWVSLMTEE-------DHEVASYLLMLANSMPSSSSCGER---------FECG  168

Query  381  ICNGVFKCSQALGSHRTAHRN  443
             C  VF   QALG HR +H+N
Sbjct  169  GCKKVFGSHQALGGHRASHKN  189



>ref|XP_004958179.1| PREDICTED: zinc finger protein 1-like [Setaria italica]
Length=264

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 37/72 (51%), Gaps = 15/72 (21%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDS----GTMKRRKKSKD-----------KENFRCEICNGVFKC  404
            EE +A+CLLMLS  VRGD+    G +     SK             + + C +C  V+  
Sbjct  56   EEYLALCLLMLSRGVRGDAEDGGGGVVVASNSKSAGAAATTAARASQGYECSVCGKVYPS  115

Query  405  SQALGSHRTAHR  440
             QALG H+T+HR
Sbjct  116  YQALGGHKTSHR  127



>emb|CDY50848.1| BnaC08g47940D [Brassica napus]
Length=209

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>gb|KFK26522.1| hypothetical protein AALP_AA8G260100 [Arabis alpina]
Length=195

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M+K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MQKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_006393949.1| hypothetical protein EUTSA_v10004839mg [Eutrema salsugineum]
 gb|ESQ31235.1| hypothetical protein EUTSA_v10004839mg [Eutrema salsugineum]
Length=241

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 39/75 (52%), Gaps = 6/75 (8%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLS--DDVRGDSGTMKRRKKSKDKENFRCEICNGV  395
            DQ   N+E    T   EE +A+CLLML+    V+    T  R   S D   ++C +C   
Sbjct  46   DQNHHNQE---TTPSEEEYLALCLLMLARGSTVQSTPSTPSRPPLS-DHRGYKCTVCGKS  101

Query  396  FKCSQALGSHRTAHR  440
            F   QALG H+T+HR
Sbjct  102  FSSYQALGGHKTSHR  116



>gb|KDP29659.1| hypothetical protein JCGZ_18821 [Jatropha curcas]
Length=309

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 62/148 (42%), Gaps = 32/148 (22%)
 Frame = +3

Query  21   QKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVS  200
            + C  C K F + KAL GHMR H        P++Q   G++P  K               
Sbjct  67   EPCTECGKRFWSWKALFGHMRCH--------PERQ-WRGINPPPK-------------YQ  104

Query  201  EENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGD-----SGTMKRRKKSKDKE  365
              N +    G  NE  M  TA+  E +A CLL+L++   G      S      +   D  
Sbjct  105  RPNLQIEQLGNANEAIM--TAEDHE-VAACLLLLANSESGTILETASAGCSHSQVQNDMV  161

Query  366  N--FRCEICNGVFKCSQALGSHRTAHRN  443
            N  F C  C  VF   QALG HR +H+N
Sbjct  162  NCRFECSSCKKVFGSHQALGGHRASHKN  189



>ref|XP_008449167.1| PREDICTED: zinc finger protein ZAT4-like [Cucumis melo]
Length=255

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 72/171 (42%), Gaps = 28/171 (16%)
 Frame = +3

Query  6    MAMEKQKCKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSG-----GVDPTGKPAQGR  170
            M  E+ KC+LC + F NG+ALGGHM++H A   +   +   S       V+ +    Q R
Sbjct  1    MEEERHKCRLCSRSFTNGRALGGHMKAHLATFSIEHQKTFKSPDLEMVSVNGSISIVQDR  60

Query  171  SKRAR------------RLFVSEENEESADQGAKNEEEMGKTAKLEENIAMCLLMLS---  305
                             R F +E     +            +   EE++A+CL+MLS   
Sbjct  61   ESETESKNPTRRRSKRTRRFNTESLPSPSPSPEPASSISDTSP--EEDVAICLVMLSMEK  118

Query  306  -DDVRGDSGTMKRRKKS-----KDKENFRCEICNGVFKCSQALGSHRTAHR  440
                +  S T +  K +     + +++FRC  C   F+ ++AL  HR   R
Sbjct  119  PSSWKDQSRTPESEKSTAAMVGRVRKSFRCGKCRKTFRSNRALFGHRKVCR  169



>gb|KFK28431.1| hypothetical protein AALP_AA8G513800 [Arabis alpina]
Length=234

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (53%), Gaps = 7/68 (10%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSK----DKENFRCEICNGVFKCSQALGSHRTAH  437
            EE +A+CLLML+   RG S        S+    D  +++C +C   F   QALG H+T+H
Sbjct  57   EEYLALCLLMLA---RGSSAVQPPLPPSRPSPSDHRDYKCTVCGKSFSSYQALGGHKTSH  113

Query  438  RNKTVNAG  461
            R  T   G
Sbjct  114  RKPTTTPG  121



>sp|Q42430.1|ZFP1_WHEAT RecName: Full=Zinc finger protein 1; AltName: Full=WZF1 [Triticum 
aestivum]
 dbj|BAA03901.1| zinc-finger protein WZF1 [Triticum aestivum]
 dbj|BAA03902.1| zinc-finger protein WZF1 [Triticum aestivum]
Length=261

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 38/67 (57%), Gaps = 15/67 (22%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENF--------RCEICNGVFKCSQALGSH  425
            EEN+A+CLLMLS   RG     K+R ++   E+F        +C +C   F   QALG H
Sbjct  56   EENLALCLLMLS---RGG----KQRVQAPQPESFAAPVPAEFKCSVCGKSFSSYQALGGH  108

Query  426  RTAHRNK  446
            +T+HR K
Sbjct  109  KTSHRVK  115



>ref|XP_006406484.1| hypothetical protein EUTSA_v10021307mg [Eutrema salsugineum]
 gb|ABI74621.1| C2H2 zinc finger protein 1 [Eutrema halophilum]
 dbj|BAJ34197.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ47937.1| hypothetical protein EUTSA_v10021307mg [Eutrema salsugineum]
Length=276

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 35/64 (55%), Gaps = 5/64 (8%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKE-----NFRCEICNGVFKCSQALGSHRTA  434
            EE +A+CLLML++D   D     R + S   +     +++C +C   F   QALG H+ +
Sbjct  71   EEYLALCLLMLANDQPSDHQPQTRFQPSPPPQESTRLSYKCSVCGKAFPSYQALGGHKAS  130

Query  435  HRNK  446
            HR K
Sbjct  131  HRIK  134



>ref|XP_010494287.1| PREDICTED: zinc finger protein AZF3-like [Camelina sativa]
 ref|XP_010494288.1| PREDICTED: zinc finger protein AZF3-like [Camelina sativa]
Length=197

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 52/97 (54%), Gaps = 15/97 (15%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNKT  449
            EE +A CL++L+ D RGD  T+   KK     +++C +C+  F   QALG H+ +HR+  
Sbjct  46   EEYLAFCLMLLARD-RGDLDTVTAAKK----PDYKCGVCDKTFSSYQALGGHKASHRSLI  100

Query  450  VNAGAGAGEKLRNLGVKNSETS*AVFLEQLQILLESY  560
                 G G+K +++ V     S AV      I L+S+
Sbjct  101  -----GGGDKDKSMAV-----SAAVKSHVCSICLKSF  127



>ref|XP_006409340.1| hypothetical protein EUTSA_v10023020mg [Eutrema salsugineum]
 gb|ESQ50793.1| hypothetical protein EUTSA_v10023020mg [Eutrema salsugineum]
Length=285

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 62/140 (44%), Gaps = 38/140 (27%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C ++F + KAL GHMR H        P++Q   G++P   P   R+  +     S  
Sbjct  68   CTECGRQFWSMKALFGHMRCH--------PERQ-WRGINP--PPNHQRTATSSSSLASVA  116

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSD-DVRGDSGTMKRRKKSKDKENFRCEI  383
            +EE                  + NIA  LLML++  + G SG ++ R        F C +
Sbjct  117  SEE------------------DHNIASTLLMLANGSMTGSSGAVEAR--------FECGV  150

Query  384  CNGVFKCSQALGSHRTAHRN  443
            C  VF   QALG HR  H++
Sbjct  151  CKKVFGSHQALGGHRATHKH  170



>ref|XP_010487903.1| PREDICTED: zinc finger protein AZF2 [Camelina sativa]
Length=286

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 36/72 (50%), Gaps = 13/72 (18%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRR-------------KKSKDKENFRCEICNGVFKCSQ  410
            EE +A+CLLML+ D    S T + R             + SK   +++C +C   F   Q
Sbjct  69   EEYLALCLLMLAKDQPSPSTTTQTRFHLSQPQTQTPPPESSKTLSSYKCSVCGKAFPSYQ  128

Query  411  ALGSHRTAHRNK  446
            ALG H+ +HR K
Sbjct  129  ALGGHKASHRIK  140



>ref|XP_006422435.1| hypothetical protein CICLE_v10030233mg [Citrus clementina]
 gb|ESR35675.1| hypothetical protein CICLE_v10030233mg [Citrus clementina]
 gb|KDO68319.1| hypothetical protein CISIN_1g038358mg [Citrus sinensis]
Length=312

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 65/149 (44%), Gaps = 36/149 (24%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C K+F + KAL GHMR H        P++Q  G ++P   P   R     +   S E
Sbjct  81   CSECGKKFWSWKALFGHMRCH--------PERQWRG-INP--PPNFRRPASPVKEVTSVE  129

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSD-DVRGDSGTMKRRKKSKDKEN-----  368
            N  + +               +  +A CLLML++ DV   +G+ ++  + +D        
Sbjct  130  NVMTVE---------------DHEVAACLLMLANGDVGVGTGSFQQGIQVQDTNEVNLGG  174

Query  369  ----FRCEICNGVFKCSQALGSHRTAHRN  443
                F C  C  VF   QALG HR +H++
Sbjct  175  VSCRFECNSCKKVFGSHQALGGHRASHKH  203



>emb|CDY32274.1| BnaA01g17100D [Brassica napus]
Length=197

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  12  MEKQKCKLCWKEFANGKALGGHMRSHFA  95
           M K KCKLC K F NG+ALGGHM+SH  
Sbjct  1   MHKHKCKLCSKSFCNGRALGGHMKSHLV  28



>ref|XP_010464022.1| PREDICTED: zinc finger protein AZF1-like [Camelina sativa]
Length=257

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (49%), Gaps = 0/78 (0%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFK  401
            D   +N+E   K    EE +A+CLLML+            R     + +++C +C   F 
Sbjct  47   DHHHQNQETNTKLPSEEEYLALCLLMLARGSGAVQSPPPSRPSPSYQRDYKCTVCGKSFS  106

Query  402  CSQALGSHRTAHRNKTVN  455
              QALG H+T+HR  T N
Sbjct  107  SYQALGGHKTSHRKPTNN  124



>ref|XP_002463836.1| hypothetical protein SORBIDRAFT_01g007170 [Sorghum bicolor]
 gb|EER90834.1| hypothetical protein SORBIDRAFT_01g007170 [Sorghum bicolor]
Length=291

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
 Frame = +3

Query  270  EENIAMCLLMLS--DDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRN  443
            EEN+A+CLLMLS   + R  +        +     FRC +C   F   QALG H+T+HR 
Sbjct  63   EENLALCLLMLSRGGNHRVQAAPPLVPSAAPVAAEFRCSVCGKSFSSYQALGGHKTSHRV  122

Query  444  K  446
            K
Sbjct  123  K  123



>ref|XP_008437075.1| PREDICTED: zinc finger protein ZAT9 isoform X3 [Cucumis melo]
Length=210

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 55/136 (40%), Gaps = 45/136 (33%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAP----------------------LPMTPPQKQ  125
            M   KCKLC + F NG+ALGGHM++H                         L    P++ 
Sbjct  1    MVSHKCKLCSRAFTNGRALGGHMKAHLTAPPKPPPSPSSSFSDHDESTLYELREENPKRG  60

Query  126  DSGGVDP--------------TGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTA  263
            D    DP              +  P + RSKR R+  V  E E ++             A
Sbjct  61   DFRFSDPVFNIVLQDRESETESKNPTRKRSKRWRKPEVELEVEPASSVS---------DA  111

Query  264  KLEENIAMCLLMLSDD  311
              EE++A+CL+MLS D
Sbjct  112  SPEEDLAICLMMLSRD  127



>ref|XP_008437073.1| PREDICTED: zinc finger protein ZAT9 isoform X1 [Cucumis melo]
Length=272

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 55/136 (40%), Gaps = 45/136 (33%)
 Frame = +3

Query  12   MEKQKCKLCWKEFANGKALGGHMRSHFAP----------------------LPMTPPQKQ  125
            M   KCKLC + F NG+ALGGHM++H                         L    P++ 
Sbjct  1    MVSHKCKLCSRAFTNGRALGGHMKAHLTAPPKPPPSPSSSFSDHDESTLYELREENPKRG  60

Query  126  DSGGVDP--------------TGKPAQGRSKRARRLFVSEENEESADQGAKNEEEMGKTA  263
            D    DP              +  P + RSKR R+  V  E E ++             A
Sbjct  61   DFRFSDPVFNIVLQDRESETESKNPTRKRSKRWRKPEVELEVEPASSVS---------DA  111

Query  264  KLEENIAMCLLMLSDD  311
              EE++A+CL+MLS D
Sbjct  112  SPEEDLAICLMMLSRD  127



>emb|CDY36493.1| BnaC03g48520D [Brassica napus]
Length=241

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 41/81 (51%), Gaps = 6/81 (7%)
 Frame = +3

Query  222  DQGAKNEEEMGKTAKLEENIAMCLLMLS--DDVRGDSGTMKRRKKSK-DKENFRCEICNG  392
            DQ   N+E    T   EE +A+CLLML+    V+          +S+ D  +F+C +C  
Sbjct  46   DQNHHNQE---TTPSEEEYLALCLLMLARGTAVQPPLTPPPPSHRSRSDHRDFKCTVCGK  102

Query  393  VFKCSQALGSHRTAHRNKTVN  455
             F   QALG H+T+HR    N
Sbjct  103  SFNSYQALGGHKTSHRKPPAN  123



>emb|CDY43576.1| BnaC02g16730D [Brassica napus]
Length=209

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 35/64 (55%), Gaps = 4/64 (6%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDS-GTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            EE +A+CLLML+   RG +  +  R   S D   ++C +C   F   QALG H+T+HR  
Sbjct  59   EEYLALCLLMLA---RGSAVKSPLRPSPSSDHRGYKCTVCGKSFSSYQALGGHKTSHRKP  115

Query  447  TVNA  458
              N 
Sbjct  116  ASNV  119



>ref|XP_006650639.1| PREDICTED: zinc finger protein 1-like [Oryza brachyantha]
Length=251

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 31/59 (53%), Gaps = 2/59 (3%)
 Frame = +3

Query  270  EENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEICNGVFKCSQALGSHRTAHRNK  446
            EEN+A+CLLMLS    G          S     F+C +C   F   QALG H+T+HR K
Sbjct  53   EENLALCLLMLSRG--GHHRVQAPPPLSAAAAEFKCSVCGKSFSSYQALGGHKTSHRVK  109



>gb|KEH32850.1| C2H2 and C2HC zinc finger protein [Medicago truncatula]
Length=269

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTP  113
            C +C + F+NGKALGGHM+SH+A LP+ P
Sbjct  8    CLICNRSFSNGKALGGHMKSHYAKLPIHP  36



>gb|EPS65907.1| zinc finger family protein, partial [Genlisea aurea]
Length=198

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 56/139 (40%), Gaps = 38/139 (27%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSGGVDPTGKPAQGRSKRARRLFVSEE  206
            C  C++ F + KAL GHMR H        P++Q  G ++P                   E
Sbjct  41   CPECYRTFWSWKALFGHMRCH--------PKRQYRG-INPP------------------E  73

Query  207  NEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKENFRCEIC  386
            N       A  EEE  K    E  +A  LLML++    D   + R         F C  C
Sbjct  74   NFHRRQGKAPAEEEEFKAEDYE--VASYLLMLANGPPMDGPHVGR---------FVCSSC  122

Query  387  NGVFKCSQALGSHRTAHRN  443
              VF   QALG HR +H+N
Sbjct  123  KRVFNSHQALGGHRASHKN  141



>ref|XP_009796301.1| PREDICTED: zinc finger protein ZAT3-like [Nicotiana sylvestris]
Length=299

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 69/172 (40%), Gaps = 32/172 (19%)
 Frame = +3

Query  27   CKLCWKEFANGKALGGHMRSHFAPLPMTPPQKQDSG-GVDPTGKPAQGRSKRARRLFVSE  203
            C  C K+F + KAL GHMR H        P++Q  G    P  +     S  +   F   
Sbjct  114  CTECGKKFWSLKALFGHMRCH--------PERQWRGINPPPNFRRHSNDSSTSAPEFSPR  165

Query  204  ENEESADQGAKNEEEMGKTAKLEENIAMCLLMLSDDVRGDSGTMKRRKKSKDKE------  365
             NE S+ Q  K+   M  T + + +IA CLL+L++         +R    +D+       
Sbjct  166  RNEVSS-QSPKSLSHMIMTDE-DHDIASCLLLLANGGSKPDDNNERENVVRDRIIVDASA  223

Query  366  ---------------NFRCEICNGVFKCSQALGSHRTAHRNKTVNAGAGAGE  476
                            F C  C  VF   QALG HR +H+N      + +GE
Sbjct  224  EPSASSSGGGTVKCCRFECSSCKKVFGSHQALGGHRASHKNVKGCFASASGE  275



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 679482509436