BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81657_g1_i1 len=2406 path=[2384:0-2405]

Length=2406
                                                                      Score     E

ref|XP_009626278.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        922   0.0      
ref|XP_009759689.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        916   0.0      
ref|XP_004246021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    916   0.0      
ref|XP_004244440.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    905   0.0      
gb|AGK82806.1|  alcohol oxidase                                         900   0.0      
gb|AGK82825.1|  alcohol oxidase                                         897   0.0      
gb|AGK82821.1|  alcohol oxidase                                         897   0.0      
gb|AGK82832.1|  alcohol oxidase                                         897   0.0      
ref|XP_006361221.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    895   0.0      
ref|XP_006359947.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    887   0.0      
emb|CDP07225.1|  unnamed protein product                                882   0.0      
ref|XP_006359948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    873   0.0      
ref|XP_011072398.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    852   0.0      
ref|XP_003534338.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    847   0.0      
ref|XP_006482469.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    843   0.0      
ref|XP_006385149.1|  alcohol oxidase-related family protein             838   0.0      
gb|AES95453.2|  long-chain-alcohol oxidase FAO1-like protein            838   0.0      
ref|XP_003629014.1|  GMC-type oxidoreductase, putative                  837   0.0      
ref|XP_010054021.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        837   0.0      
ref|XP_006430998.1|  hypothetical protein CICLE_v10011111mg             835   0.0      
ref|XP_007210564.1|  hypothetical protein PRUPE_ppa014756mg             833   0.0      
ref|XP_003547818.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    832   0.0      
ref|XP_007156339.1|  hypothetical protein PHAVU_003G278200g             831   0.0      
ref|XP_003547733.2|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    830   0.0      
ref|XP_011078909.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    827   0.0      
ref|XP_011028488.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        829   0.0      
ref|XP_010275157.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    828   0.0      
ref|XP_007158083.1|  hypothetical protein PHAVU_002G122600g             827   0.0      
ref|XP_010054015.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    826   0.0      
ref|XP_003612495.1|  GMC-type oxidoreductase, putative                  827   0.0      
ref|XP_003517097.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    824   0.0      
ref|XP_008237995.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        822   0.0      
gb|KHN41766.1|  Long-chain-alcohol oxidase FAO4A                        823   0.0      
gb|KDP37816.1|  hypothetical protein JCGZ_06718                         816   0.0      
ref|XP_007040880.1|  Long-chain fatty alcohol dehydrogenase famil...    830   0.0      
ref|XP_004509495.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    818   0.0      
gb|EYU29124.1|  hypothetical protein MIMGU_mgv1a001761mg                815   0.0      
ref|XP_002269629.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        813   0.0      Vitis vinifera
ref|XP_004512334.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    815   0.0      
ref|XP_002519938.1|  electron carrier, putative                         799   0.0      Ricinus communis
ref|XP_004512333.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    802   0.0      
ref|XP_010274418.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    794   0.0      
gb|KDO72345.1|  hypothetical protein CISIN_1g0039902mg                  785   0.0      
ref|XP_010111511.1|  Long-chain-alcohol oxidase FAO4A                   788   0.0      
ref|XP_010676697.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    786   0.0      
gb|EYU37432.1|  hypothetical protein MIMGU_mgv1a022390mg                770   0.0      
ref|XP_008444238.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    767   0.0      
ref|XP_010676700.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    766   0.0      
ref|XP_010538590.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    754   0.0      
ref|XP_006283177.1|  hypothetical protein CARUB_v10004208mg             751   0.0      
ref|NP_193673.2|  Long-chain-alcohol oxidase FAO4A                      747   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274420.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    744   0.0      
ref|XP_002867943.1|  hypothetical protein ARALYDRAFT_914728             743   0.0      
ref|XP_006413983.1|  hypothetical protein EUTSA_v10024528mg             743   0.0      
ref|XP_010449364.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        741   0.0      
gb|KHN27504.1|  Long-chain-alcohol oxidase FAO4A                        736   0.0      
ref|XP_010538591.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    738   0.0      
ref|XP_011072475.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    733   0.0      
ref|XP_009132755.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        736   0.0      
ref|XP_010439724.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    736   0.0      
gb|KFK28594.1|  hypothetical protein AALP_AA7G017800                    732   0.0      
ref|XP_009384756.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    732   0.0      
ref|XP_010434428.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    729   0.0      
ref|XP_009137007.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    726   0.0      
gb|EPS61567.1|  hypothetical protein M569_13229                         722   0.0      
emb|CDY01593.1|  BnaC07g35830D                                          721   0.0      
gb|KHN11789.1|  Long-chain-alcohol oxidase FAO4A                        715   0.0      
gb|KCW78402.1|  hypothetical protein EUGRSUZ_D02568                     714   0.0      
ref|XP_008805948.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    713   0.0      
gb|KDP37817.1|  hypothetical protein JCGZ_06719                         705   0.0      
ref|XP_010942998.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        709   0.0      
gb|EPS64229.1|  hypothetical protein M569_10552                         701   0.0      
gb|KCW78401.1|  hypothetical protein EUGRSUZ_D02566                     701   0.0      
ref|XP_006878629.1|  hypothetical protein AMTR_s00011p00262370          698   0.0      
ref|XP_008776965.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    695   0.0      
ref|XP_009396212.1|  PREDICTED: long-chain-alcohol oxidase FAO4A        671   0.0      
ref|XP_004150760.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    646   0.0      
ref|XP_006283178.1|  hypothetical protein CARUB_v10004208mg             645   0.0      
emb|CAA18625.1|  putative protein                                       645   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444239.1|  PREDICTED: long-chain-alcohol oxidase FAO4A ...    646   0.0      
ref|XP_004167305.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    641   0.0      
ref|XP_008382148.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    619   0.0      
emb|CBI29206.3|  unnamed protein product                                610   0.0      
gb|ABR17814.1|  unknown                                                 602   0.0      Picea sitchensis
emb|CDY66156.1|  BnaA01g34950D                                          588   0.0      
emb|CDX98615.1|  BnaA03g44000D                                          593   0.0      
emb|CDX99382.1|  BnaC01g11700D                                          585   0.0      
ref|XP_006368110.1|  PREDICTED: long-chain-alcohol oxidase FAO4A-...    570   0.0      
ref|XP_008438494.1|  PREDICTED: long-chain-alcohol oxidase FAO1         578   0.0      
ref|XP_004134405.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    578   0.0      
ref|XP_009384649.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    571   0.0      
ref|XP_002314488.2|  alcohol oxidase-related family protein             565   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011030464.1|  PREDICTED: long-chain-alcohol oxidase FAO1         565   0.0      
ref|XP_010023906.1|  PREDICTED: long-chain-alcohol oxidase FAO1         564   0.0      
gb|KCW60303.1|  hypothetical protein EUGRSUZ_H03017                     564   0.0      
emb|CAN71289.1|  hypothetical protein VITISV_019349                     560   0.0      Vitis vinifera
ref|XP_007224435.1|  hypothetical protein PRUPE_ppa021498mg             558   0.0      
ref|XP_010684652.1|  PREDICTED: long-chain-alcohol oxidase FAO2         558   0.0      
ref|XP_008447391.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    557   0.0      
ref|XP_004152057.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    556   0.0      
ref|XP_002285334.1|  PREDICTED: long-chain-alcohol oxidase FAO1         556   0.0      Vitis vinifera
ref|XP_010920358.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    556   0.0      
ref|XP_008224323.1|  PREDICTED: long-chain-alcohol oxidase FAO1         556   0.0      
gb|KHN02487.1|  Long-chain-alcohol oxidase FAO2                         555   0.0      
ref|XP_003554295.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    554   0.0      
sp|B5WWZ8.1|FAO1_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    553   0.0      Lotus japonicus
gb|ACF22878.1|  alcohol oxidase                                         552   0.0      Glycine max [soybeans]
ref|XP_004289971.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    553   0.0      
ref|XP_004289970.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    553   0.0      
gb|KGN56837.1|  hypothetical protein Csa_3G134850                       550   0.0      
ref|XP_004982881.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    553   0.0      
ref|XP_010036770.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    551   0.0      
ref|XP_010264984.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    550   0.0      
gb|EYU46421.1|  hypothetical protein MIMGU_mgv1a001868mg                550   0.0      
gb|AES89853.2|  long-chain-alcohol oxidase FAO2-like protein            548   2e-180   
dbj|BAJ86655.1|  predicted protein                                      547   6e-180   
ref|XP_006367233.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    545   2e-179   
ref|XP_010069617.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    544   8e-179   
gb|EYU46424.1|  hypothetical protein MIMGU_mgv1a001883mg                544   8e-179   
ref|XP_004247518.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    543   1e-178   
ref|XP_001763007.1|  predicted protein                                  545   1e-178   
ref|XP_011091281.1|  PREDICTED: long-chain-alcohol oxidase FAO1         544   1e-178   
gb|KEH30749.1|  long-chain-alcohol oxidase FAO2-like protein            544   1e-178   
ref|XP_011029789.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    543   2e-178   
ref|XP_009376994.1|  PREDICTED: long-chain-alcohol oxidase FAO1         543   2e-178   
ref|XP_009790215.1|  PREDICTED: long-chain-alcohol oxidase FAO1         542   3e-178   
ref|XP_003571871.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    542   1e-177   
ref|XP_010093072.1|  Long-chain-alcohol oxidase FAO2                    541   1e-177   
ref|XP_009594479.1|  PREDICTED: long-chain-alcohol oxidase FAO2         541   2e-177   
ref|XP_007050220.1|  Alcohol oxidase                                    540   2e-177   
ref|XP_002311685.2|  alcohol oxidase-related family protein             540   3e-177   Populus trichocarpa [western balsam poplar]
ref|XP_008668721.1|  PREDICTED: uncharacterized protein LOC100274...    541   4e-177   
ref|XP_010262397.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    540   5e-177   
ref|XP_004247745.1|  PREDICTED: long-chain-alcohol oxidase FAO1         539   7e-177   
gb|KDP40361.1|  hypothetical protein JCGZ_02359                         539   1e-176   
ref|XP_006354463.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    538   2e-176   
ref|XP_006489686.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    538   2e-176   
ref|XP_008804287.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    538   3e-176   
ref|XP_010466677.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    538   3e-176   
ref|XP_006420281.1|  hypothetical protein CICLE_v10004405mg             537   4e-176   
ref|XP_006589281.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    536   8e-176   
ref|XP_004495357.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    536   9e-176   
gb|KDO60414.1|  hypothetical protein CISIN_1g004496mg                   536   9e-176   
ref|XP_003540021.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    536   1e-175   
ref|XP_006420282.1|  hypothetical protein CICLE_v10004403mg             536   1e-175   
ref|NP_566729.1|  long-chain-alcohol oxidase FAO3                       536   1e-175   Arabidopsis thaliana [mouse-ear cress]
gb|KHG17178.1|  Long-chain-alcohol oxidase FAO1                         535   2e-175   
ref|XP_006489687.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    535   3e-175   
ref|XP_007200494.1|  hypothetical protein PRUPE_ppa018458mg             535   3e-175   
gb|KFK39637.1|  hypothetical protein AALP_AA3G269600                    535   3e-175   
ref|XP_007035183.1|  Fatty alcohol oxidase 3 isoform 1                  535   4e-175   
ref|XP_009764096.1|  PREDICTED: long-chain-alcohol oxidase FAO2         533   8e-175   
ref|XP_010934290.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    534   9e-175   
gb|EPS58840.1|  hypothetical protein M569_15969                         531   9e-175   
ref|XP_010262396.1|  PREDICTED: long-chain-alcohol oxidase FAO2-l...    534   9e-175   
ref|XP_010512451.1|  PREDICTED: long-chain-alcohol oxidase FAO3         534   1e-174   
ref|XP_009610950.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    533   1e-174   
ref|XP_006443786.1|  hypothetical protein CICLE_v10018992mg             533   1e-174   
emb|CDP11641.1|  unnamed protein product                                533   1e-174   
ref|XP_006582261.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    532   3e-174   
gb|KHN28101.1|  Long-chain-alcohol oxidase FAO1-like protein            532   5e-174   
ref|XP_006296686.1|  hypothetical protein CARUB_v10013046mg             531   5e-174   
ref|XP_002529832.1|  electron carrier, putative                         531   7e-174   Ricinus communis
ref|XP_009102621.1|  PREDICTED: long-chain-alcohol oxidase FAO3         531   1e-173   
ref|XP_002883430.1|  hypothetical protein ARALYDRAFT_479855             531   1e-173   
ref|XP_010488398.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    531   1e-173   
ref|XP_008664883.1|  PREDICTED: long-chain-alcohol oxidase FAO1         531   2e-173   
ref|XP_008235630.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    530   5e-173   
ref|XP_006857358.1|  hypothetical protein AMTR_s00067p00112750          531   5e-173   
ref|XP_002966834.1|  hypothetical protein SELMODRAFT_87621              529   6e-173   
ref|XP_002961172.1|  hypothetical protein SELMODRAFT_73531              529   6e-173   
emb|CDX85097.1|  BnaC07g08090D                                          529   7e-173   
ref|XP_008364320.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    528   1e-172   
ref|NP_001176205.1|  Os10g0474966                                       528   1e-172   
ref|XP_010670985.1|  PREDICTED: long-chain-alcohol oxidase FAO1         527   2e-172   
ref|XP_004505474.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    527   5e-172   
ref|XP_008785203.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    527   5e-172   
ref|XP_007162567.1|  hypothetical protein PHAVU_001G162800g             526   6e-172   
ref|XP_003574052.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    526   8e-172   
emb|CAC87643.1|  alcohol oxidase                                        522   2e-171   Arabidopsis thaliana [mouse-ear cress]
gb|EYU18303.1|  hypothetical protein MIMGU_mgv1a001896mg                525   3e-171   
ref|XP_002464495.1|  hypothetical protein SORBIDRAFT_01g019470          525   4e-171   Sorghum bicolor [broomcorn]
emb|CDX94858.1|  BnaC03g43300D                                          523   9e-171   
ref|XP_010532672.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    523   9e-171   
ref|XP_007035188.1|  Fatty alcohol oxidase 3 isoform 6                  520   2e-170   
ref|XP_002464496.1|  hypothetical protein SORBIDRAFT_01g019480          521   6e-170   Sorghum bicolor [broomcorn]
gb|AAK64154.1|  unknown protein                                         521   7e-170   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002528823.1|  disulfide oxidoreductase, putative                 521   9e-170   Ricinus communis
gb|KDP26499.1|  hypothetical protein JCGZ_17657                         518   9e-170   
ref|XP_007132926.1|  hypothetical protein PHAVU_011G136600g             521   1e-169   
gb|AAM63097.1|  unknown                                                 520   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009369441.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    520   2e-169   
ref|NP_194586.1|  Long-chain-alcohol oxidase FAO4B                      520   3e-169   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001142399.1|  uncharacterized protein LOC100274574               516   4e-169   Zea mays [maize]
emb|CDX92985.1|  BnaA03g37070D                                          518   5e-169   
ref|XP_009336115.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    519   5e-169   
ref|XP_006406028.1|  hypothetical protein EUTSA_v10020141mg             519   5e-169   
ref|XP_008382898.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    515   1e-168   
emb|CDO99261.1|  unnamed protein product                                518   2e-168   
gb|KHG12235.1|  Long-chain-alcohol oxidase FAO1                         517   2e-168   
ref|XP_006354464.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    513   5e-168   
ref|XP_004982884.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    516   7e-168   
ref|XP_010457422.1|  PREDICTED: long-chain-alcohol oxidase FAO1         516   9e-168   
ref|XP_010532673.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    516   9e-168   
ref|XP_010532671.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    515   1e-167   
gb|AAP54248.2|  GMC oxidoreductase family protein, expressed            516   2e-167   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009369442.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    515   2e-167   
ref|XP_006412936.1|  hypothetical protein EUTSA_v10024496mg             514   3e-167   
ref|XP_002869492.1|  hypothetical protein ARALYDRAFT_491906             514   4e-167   
ref|XP_011080081.1|  PREDICTED: long-chain-alcohol oxidase FAO2         513   6e-167   
ref|XP_006306477.1|  hypothetical protein CARUB_v10012453mg             513   7e-167   
gb|KFK29401.1|  hypothetical protein AALP_AA7G128800                    513   1e-166   
emb|CDP03771.1|  unnamed protein product                                513   2e-166   
emb|CDX92884.1|  BnaC07g41420D                                          512   2e-166   
ref|XP_007144044.1|  hypothetical protein PHAVU_007G124200g             511   3e-166   
ref|XP_009136067.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    511   4e-166   
ref|XP_006283182.1|  hypothetical protein CARUB_v10004212mg             511   7e-166   
ref|XP_004296386.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    511   1e-165   
gb|KEH23950.1|  long-chain-alcohol oxidase FAO1                         509   1e-165   
ref|XP_010475034.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    510   1e-165   
gb|AGC65582.1|  fatty alcohol oxidase                                   509   1e-165   
ref|XP_002967201.1|  hypothetical protein SELMODRAFT_87684              509   2e-165   
gb|EPS66779.1|  hypothetical protein M569_07992                         508   4e-165   
ref|XP_002272123.2|  PREDICTED: long-chain-alcohol oxidase FAO2-like    509   4e-165   Vitis vinifera
emb|CDY51703.1|  BnaA03g58930D                                          508   4e-165   
emb|CDX89850.1|  BnaA10g02320D                                          509   4e-165   
ref|XP_002960521.1|  hypothetical protein SELMODRAFT_74601              508   5e-165   
ref|XP_006418179.1|  hypothetical protein EUTSA_v10006882mg             506   5e-164   
ref|XP_010433200.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        504   2e-163   
ref|XP_009119340.1|  PREDICTED: long-chain-alcohol oxidase FAO1         504   3e-163   
ref|XP_009137800.1|  PREDICTED: long-chain-alcohol oxidase FAO4B        502   2e-162   
ref|XP_010447958.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    501   4e-162   
gb|AAL31024.1|AC078948_8  putative alcohol oxidase                      500   1e-161   Oryza sativa [red rice]
ref|XP_002889487.1|  hypothetical protein ARALYDRAFT_470376             499   3e-161   
ref|XP_002454188.1|  hypothetical protein SORBIDRAFT_04g026370          499   3e-161   Sorghum bicolor [broomcorn]
ref|XP_010438427.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    498   8e-161   
gb|EEC73620.1|  hypothetical protein OsI_08118                          497   3e-160   Oryza sativa Indica Group [Indian rice]
sp|B5WWZ9.1|FAO2_LOTJA  RecName: Full=Long-chain-alcohol oxidase ...    496   3e-160   Lotus japonicus
ref|XP_011080082.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    495   6e-160   
ref|NP_001047464.1|  Os02g0621800                                       495   1e-159   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007035186.1|  Alcohol oxidase, putative isoform 4                491   2e-159   
ref|XP_004493801.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    492   7e-159   
ref|XP_004982882.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    493   9e-159   
gb|EEC67160.1|  hypothetical protein OsI_34014                          490   2e-158   Oryza sativa Indica Group [Indian rice]
ref|XP_003607676.1|  Annotation was added to scaffolds in Novembe...    486   5e-158   
emb|CDY18199.1|  BnaC05g02220D                                          490   6e-158   
dbj|BAK02336.1|  predicted protein                                      489   2e-157   
ref|NP_171895.2|  long-chain-alcohol oxidase FAO1                       489   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002981110.1|  hypothetical protein SELMODRAFT_114089             484   5e-157   
ref|XP_004982885.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    487   8e-157   
ref|XP_002982582.1|  hypothetical protein SELMODRAFT_116855             483   2e-156   
ref|XP_010526493.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    486   3e-156   
ref|XP_010548742.1|  PREDICTED: long-chain-alcohol oxidase FAO4B-...    484   8e-156   
ref|XP_002994642.1|  hypothetical protein SELMODRAFT_138935             481   1e-155   
ref|XP_006589282.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    478   1e-154   
gb|KHN30591.1|  Long-chain-alcohol oxidase FAO1                         478   1e-154   
gb|AAL31049.1|AC078893_12  putative oxidase                             476   3e-154   Oryza sativa [red rice]
gb|AAL31021.1|AC078948_5  putative alcohol oxidase                      475   3e-154   Oryza sativa [red rice]
ref|XP_004982883.1|  PREDICTED: long-chain-alcohol oxidase FAO1-l...    478   6e-154   
gb|ACN27562.1|  unknown                                                 479   1e-153   Zea mays [maize]
ref|XP_002454190.1|  hypothetical protein SORBIDRAFT_04g026390          478   4e-153   Sorghum bicolor [broomcorn]
ref|NP_001148058.1|  oxidoreductase                                     478   5e-153   Zea mays [maize]
gb|AAL31027.1|AC078948_11  putative alcohol oxidase                     473   7e-153   Oryza sativa [red rice]
ref|XP_004953134.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    477   2e-152   
ref|XP_001753124.1|  predicted protein                                  474   2e-152   
tpg|DAA49654.1|  TPA: hypothetical protein ZEAMMB73_468308              469   5e-152   
ref|XP_003575383.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    474   1e-151   
ref|XP_006412937.1|  hypothetical protein EUTSA_v10024496mg             469   2e-151   
ref|NP_001064839.2|  Os10g0474800                                       468   3e-151   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002464494.1|  hypothetical protein SORBIDRAFT_01g019460          466   6e-151   Sorghum bicolor [broomcorn]
ref|XP_010102592.1|  Long-chain-alcohol oxidase FAO1                    471   2e-150   
gb|EAY78905.1|  hypothetical protein OsI_34008                          459   2e-148   Oryza sativa Indica Group [Indian rice]
gb|AAD10696.1|  Unknown protein                                         460   2e-146   Arabidopsis thaliana [mouse-ear cress]
gb|EMT04470.1|  Putative GMC-type oxidoreductase                        464   2e-146   
gb|KEH15695.1|  long-chain-alcohol oxidase FAO1                         455   2e-145   
gb|KHG08529.1|  Long-chain-alcohol oxidase FAO2                         452   3e-144   
ref|XP_010523169.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    455   4e-144   
gb|KEH23951.1|  long-chain-alcohol oxidase FAO1                         445   9e-143   
ref|XP_010529119.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    437   1e-138   
ref|XP_003607656.1|  Annotation was added to scaffolds in Novembe...    434   1e-138   
dbj|BAK00483.1|  predicted protein                                      434   2e-138   
ref|XP_001761391.1|  predicted protein                                  434   5e-137   
gb|AES61079.2|  long-chain-alcohol oxidase FAO1-like protein            421   4e-134   
ref|XP_003590828.1|  Annotation was added to scaffolds in Novembe...    422   4e-134   
gb|ACF88407.1|  unknown                                                 414   3e-132   
gb|KFK42743.1|  hypothetical protein AALP_AA1G034000                    421   6e-132   
ref|XP_010501308.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    419   2e-130   
gb|EEE51130.1|  hypothetical protein OsJ_31873                          414   2e-130   
gb|EEE51131.1|  hypothetical protein OsJ_31875                          413   6e-130   
tpg|DAA49655.1|  TPA: hypothetical protein ZEAMMB73_468308              402   6e-128   
ref|XP_006489751.1|  PREDICTED: long-chain-alcohol oxidase FAO3-like    403   1e-126   
gb|ACR36076.1|  unknown                                                 386   1e-120   
gb|ACF87929.1|  unknown                                                 384   1e-120   
gb|EEC67159.1|  hypothetical protein OsI_34012                          389   1e-119   
gb|KGN53994.1|  hypothetical protein Csa_4G246400                       377   4e-119   
ref|XP_006662437.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    359   2e-110   
ref|XP_006379996.1|  hypothetical protein POPTR_0008s18750g             348   3e-108   
gb|EEE57396.1|  hypothetical protein OsJ_07570                          364   6e-107   
gb|KFH71384.1|  hypothetical protein MVEG_01683                         340   2e-101   
emb|CDS08066.1|  hypothetical protein LRAMOSA02015                      337   5e-100   
emb|CDX77517.1|  BnaA07g06550D                                          329   7e-99    
ref|XP_009831231.1|  hypothetical protein H257_07412                    328   1e-96    
ref|XP_004157702.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    313   3e-95    
ref|XP_008871235.1|  hypothetical protein H310_07607                    323   6e-95    
ref|XP_009831229.1|  hypothetical protein, variant 1                    323   4e-94    
ref|WP_040443572.1|  hypothetical protein                               316   2e-93    
ref|XP_009831227.1|  hypothetical protein, variant 5                    316   3e-93    
gb|EFH90466.1|  glucose-methanol-choline oxidoreductase                 317   1e-92    
gb|EXX66452.1|  hypothetical protein RirG_123640                        317   1e-91    
emb|CEI89775.1|  hypothetical protein RMCBS344292_04123                 313   3e-91    
emb|CEJ01770.1|  hypothetical protein RMCBS344292_15791                 313   3e-91    
ref|XP_005644346.1|  FAD/NAD(P)-binding domain-containing protein       306   1e-90    
emb|CEG67601.1|  hypothetical protein RMATCC62417_04004                 311   1e-90    
emb|CEG74394.1|  hypothetical protein RMATCC62417_09621                 310   4e-90    
emb|CBI23676.3|  unnamed protein product                                305   2e-89    
gb|EPB86823.1|  hypothetical protein HMPREF1544_06348                   308   2e-89    
ref|XP_009831225.1|  hypothetical protein H257_07411                    310   3e-89    
ref|XP_008615139.1|  hypothetical protein SDRG_10901                    310   3e-89    
gb|ESA06032.1|  hypothetical protein GLOINDRAFT_82554                   305   1e-88    
ref|XP_009831226.1|  hypothetical protein, variant 4                    304   2e-88    
ref|XP_009831228.1|  hypothetical protein, variant 3                    305   4e-88    
ref|XP_004157399.1|  PREDICTED: LOW QUALITY PROTEIN: puromycin-se...    309   1e-87    
ref|WP_019946571.1|  hypothetical protein                               303   1e-87    
gb|KDO33323.1|  hypothetical protein SPRG_02132                         305   2e-87    
emb|CDR40807.1|  RHTO0S05e07470g1_1                                     303   2e-87    
gb|EMS23820.1|  long chain fatty alcohol oxidase                        303   3e-87    
gb|KFY64266.1|  hypothetical protein V496_03367                         303   4e-87    
ref|XP_003328562.1|  hypothetical protein PGTG_10521                    303   6e-87    
ref|XP_005650828.1|  FAD/NAD(P)-binding domain-containing protein       295   2e-86    
ref|WP_029214956.1|  hypothetical protein                               297   1e-85    
ref|XP_001591990.1|  hypothetical protein SS1G_07437                    299   2e-85    
gb|EGU13115.1|  Long chain fatty alcohol oxidase                        298   2e-85    
gb|KFY10153.1|  hypothetical protein V492_05166                         298   4e-85    
ref|WP_033369528.1|  hypothetical protein                               296   5e-85    
ref|XP_007680563.1|  hypothetical protein BAUCODRAFT_274597             297   8e-85    
ref|XP_001214264.1|  conserved hypothetical protein                     296   2e-84    
gb|KFY48297.1|  hypothetical protein V495_01464                         295   2e-84    
gb|KFY36052.1|  hypothetical protein V494_05366                         296   3e-84    
gb|ELR10689.1|  hypothetical protein GMDG_04950                         294   4e-84    
ref|XP_658227.1|  hypothetical protein AN0623.2                         295   5e-84    
ref|XP_001268562.1|  long chain fatty alcohol oxidase, putative         295   8e-84    
gb|KFH47883.1|  Long-chain-alcohol oxidase-like protein                 294   9e-84    
ref|XP_009831230.1|  hypothetical protein, variant 2                    293   1e-83    
gb|AIZ62505.1|  hypothetical protein PK28_00185                         291   4e-83    
gb|KFZ00641.1|  hypothetical protein V501_10589                         295   8e-83    
gb|EKG12277.1|  Glucose-methanol-choline oxidoreductase                 291   1e-82    
emb|CDM31622.1|  Alcohol dehydrogenase, long-chain fatty                291   1e-82    
gb|KFY79221.1|  hypothetical protein V499_01756                         294   2e-82    
gb|KFY98584.1|  hypothetical protein V500_01604                         294   3e-82    
gb|KGO74925.1|  Alcohol dehydrogenase, long-chain fatty                 290   3e-82    
emb|CCD42906.1|  similar to long chain fatty alcohol oxidase            290   4e-82    
gb|AII52338.1|  hypothetical protein N008_10155                         288   5e-82    
ref|XP_001554225.1|  hypothetical protein BC1G_07362                    289   1e-81    
gb|EMS48507.1|  Long-chain-alcohol oxidase FAO1                         284   1e-81    
gb|EMR84578.1|  putative long chain fatty alcohol protein               288   2e-81    
gb|KGO40669.1|  Alcohol dehydrogenase, long-chain fatty                 288   2e-81    
gb|KFY15271.1|  hypothetical protein V492_02111                         286   3e-81    
ref|XP_002569337.1|  Pc21g23700                                         287   5e-81    
gb|KFY31288.1|  hypothetical protein V493_01243                         286   8e-81    
gb|KFZ24759.1|  hypothetical protein V502_00763                         278   1e-80    
ref|XP_006687527.1|  hypothetical protein CANTEDRAFT_108652             284   2e-80    
gb|KEY78297.1|  long chain fatty alcohol oxidase                        285   2e-80    
ref|XP_753079.1|  long chain fatty alcohol oxidase                      285   3e-80    
gb|KFY41130.1|  hypothetical protein V494_03193                         284   3e-80    
ref|XP_007697741.1|  hypothetical protein COCSADRAFT_295770             284   3e-80    
ref|XP_007375878.1|  fatty alcohol oxidase                              283   4e-80    
emb|CCT75976.1|  related to long chain fatty alcohol oxidase            283   4e-80    
ref|XP_007684042.1|  GMC oxidoreductase                                 284   5e-80    
ref|WP_018162755.1|  hypothetical protein                               280   2e-79    
gb|EHA26798.1|  long chain fatty alcohol oxidase                        283   2e-79    
ref|XP_001389382.1|  long chain fatty alcohol oxidase                   282   2e-79    
gb|KFZ10506.1|  hypothetical protein V501_05178                         281   3e-79    
gb|KIN05921.1|  hypothetical protein OIDMADRAFT_189585                  281   3e-79    
ref|WP_035567966.1|  hypothetical protein                               280   5e-79    
gb|KFY76557.1|  hypothetical protein V499_03848                         280   7e-79    
gb|EUN25552.1|  hypothetical protein COCVIDRAFT_39053                   280   9e-79    
gb|KFY68894.1|  hypothetical protein V496_00717                         279   2e-78    
gb|KEQ97416.1|  hypothetical protein AUEXF2481DRAFT_72855               280   2e-78    
dbj|GAA82032.1|  long chain fatty alcohol oxidase                       280   2e-78    
ref|XP_002618046.1|  hypothetical protein CLUG_01505                    278   2e-78    
gb|KFX48806.1|  Long-chain-alcohol oxidase FAO2                         280   2e-78    
gb|KDE02581.1|  hypothetical protein MVLG_06864                         279   2e-78    
ref|XP_001264046.1|  long chain fatty alcohol oxidase, putative         279   3e-78    
gb|EIE83566.1|  hypothetical protein RO3G_08271                         277   3e-78    
gb|EME47783.1|  hypothetical protein DOTSEDRAFT_69651                   279   4e-78    
gb|KFY02756.1|  hypothetical protein O988_01934                         278   4e-78    
gb|EPB87889.1|  hypothetical protein HMPREF1544_05296                   278   4e-78    
gb|KIL90183.1|  hypothetical protein FAVG1_06922                        277   4e-78    
ref|XP_003869427.1|  hypothetical protein CORT_0D04520                  278   4e-78    
ref|XP_007706606.1|  hypothetical protein COCCADRAFT_81154              278   4e-78    
gb|EXK85609.1|  hypothetical protein FOQG_10402                         278   5e-78    
gb|EPS25096.1|  hypothetical protein PDE_00027                          278   5e-78    
gb|KFY27803.1|  hypothetical protein V493_03299                         278   5e-78    
gb|EXA34422.1|  hypothetical protein FOVG_14401                         278   5e-78    
ref|XP_002147053.1|  long chain fatty alcohol oxidase, putative         278   6e-78    
gb|EMD94921.1|  hypothetical protein COCHEDRAFT_1201414                 278   8e-78    
ref|XP_008026917.1|  hypothetical protein SETTUDRAFT_20639              278   1e-77    
ref|XP_007837981.1|  hypothetical protein PFICI_11209                   277   1e-77    
ref|XP_001940486.1|  long chain fatty alcohol oxidase                   277   1e-77    
gb|KFZ16786.1|  hypothetical protein V502_04902                         276   1e-77    
gb|EWZ83069.1|  hypothetical protein FOWG_13006                         276   2e-77    
gb|KFY96639.1|  hypothetical protein V500_02373                         277   2e-77    
ref|XP_003855144.1|  hypothetical protein MYCGRDRAFT_37086              277   2e-77    
gb|KFY45551.1|  hypothetical protein V495_02926                         276   2e-77    
gb|EXM19432.1|  hypothetical protein FOTG_12485                         276   2e-77    
gb|KFH44797.1|  Long-chain-alcohol oxidase-like protein                 275   3e-77    
gb|AHH21230.1|  glucose-methanol-choline (GMC) oxidoreductase fam...    274   3e-77    
ref|XP_010038987.1|  PREDICTED: long-chain-alcohol oxidase FAO2-like    268   4e-77    
ref|XP_007373525.1|  fatty alcohol oxidase                              275   5e-77    
gb|AAS46880.1|  fatty alcohol oxidase                                   275   5e-77    
gb|EWZ33891.1|  hypothetical protein FOZG_13577                         275   6e-77    
ref|XP_003654573.1|  hypothetical protein THITE_2117674                 276   7e-77    
gb|ENH62892.1|  Long-chain-alcohol oxidase FAO2                         273   8e-77    
gb|KEQ64225.1|  long-chain fatty alcohol dehydrogenase                  275   1e-76    
dbj|GAA98883.1|  hypothetical protein E5Q_05571                         275   1e-76    
gb|ELR05461.1|  hypothetical protein GMDG_01756                         274   1e-76    
ref|XP_008084965.1|  FAD/NAD(P)-binding protein                         274   1e-76    
ref|XP_712386.1|  potential long chain fatty acid alcohol oxidase       273   2e-76    
dbj|GAM35263.1|  hypothetical protein TCE0_017r03459                    274   2e-76    
gb|EGU81929.1|  hypothetical protein FOXB_07532                         273   2e-76    
ref|XP_003298648.1|  hypothetical protein PTT_09421                     274   3e-76    
gb|KHC28526.1|  hypothetical protein MGQ_06035                          273   3e-76    
gb|EXK25528.1|  hypothetical protein FOMG_17829                         273   3e-76    
ref|XP_712350.1|  potential long chain fatty acid alcohol oxidase       272   3e-76    
ref|WP_039798089.1|  oxidoreductase                                     271   4e-76    
ref|XP_007922551.1|  hypothetical protein MYCFIDRAFT_52380              273   4e-76    
gb|AAS46878.1|  fatty alcohol oxidase                                   272   5e-76    
gb|KEQ82382.1|  long-chain fatty alcohol dehydrogenase                  273   5e-76    
ref|XP_002422236.1|  fatty alcohol oxidase, putative                    271   7e-76    
ref|XP_006648845.1|  PREDICTED: LOW QUALITY PROTEIN: long-chain-a...    270   8e-76    
gb|KEQ70398.1|  long-chain fatty alcohol dehydrogenase                  273   1e-75    
ref|XP_002841296.1|  hypothetical protein                               271   1e-75    
emb|CAB75353.1|  long chain fatty alcohol oxidase                       271   1e-75    
gb|EMS51759.1|  Long-chain-alcohol oxidase FAO2                         266   1e-75    
gb|KGU00959.1|  hypothetical protein MEQ_06042                          271   1e-75    
gb|KGQ82028.1|  hypothetical protein MEO_06026                          271   1e-75    
gb|KHC59946.1|  hypothetical protein MGI_06027                          271   2e-75    
gb|KGQ81126.1|  hypothetical protein MEU_06065                          270   2e-75    
ref|WP_027004897.1|  hypothetical protein                               269   3e-75    
gb|KGT63535.1|  hypothetical protein MEK_06076                          270   4e-75    
gb|EWY81831.1|  hypothetical protein FOYG_16040                         270   4e-75    
gb|KGU21594.1|  hypothetical protein MGM_06048                          269   6e-75    
gb|EDK39369.2|  hypothetical protein PGUG_03467                         269   6e-75    
ref|XP_001484086.1|  hypothetical protein PGUG_03467                    269   6e-75    
emb|CCE42800.1|  hypothetical protein CPAR2_204430                      269   6e-75    
gb|EEH19591.1|  hypothetical protein PABG_07795                         270   7e-75    
gb|EEQ43775.1|  hypothetical protein CAWG_02023                         269   7e-75    
gb|EXL42725.1|  hypothetical protein FOCG_15170                         269   8e-75    
gb|KGU18308.1|  hypothetical protein MG7_05986                          269   8e-75    
gb|KGQ81329.1|  hypothetical protein MG1_06098                          268   9e-75    
gb|KHC28037.1|  hypothetical protein MGO_06014                          268   1e-74    
gb|KGU01103.1|  hypothetical protein MEM_06199                          268   1e-74    
ref|XP_006662436.1|  PREDICTED: long-chain-alcohol oxidase FAO1-like    265   1e-74    
ref|XP_001243546.1|  hypothetical protein CIMG_02987                    269   1e-74    
gb|KGR01100.1|  hypothetical protein MG3_06097                          268   1e-74    
gb|KGR05615.1|  hypothetical protein MG9_06083                          268   1e-74    
ref|XP_010762144.1|  hypothetical protein PADG_06552                    269   2e-74    
ref|XP_002182547.1|  predicted protein                                  270   2e-74    
gb|KHC44433.1|  hypothetical protein MGC_06050                          268   2e-74    
dbj|GAD98322.1|  hypothetical protein PVAR5_7014                        268   2e-74    
ref|XP_001386087.1|  long chain fatty acid oxidase                      267   2e-74    
gb|EEQ89581.1|  long chain fatty alcohol oxidase                        268   3e-74    
gb|EFW14100.1|  long chain fatty alcohol oxidase                        268   3e-74    
gb|EWG51602.1|  hypothetical protein FVEG_10526                         267   4e-74    
gb|EPB87888.1|  hypothetical protein HMPREF1544_05295                   267   4e-74    
ref|XP_004361070.1|  glucose-methanol-choline oxidoreductase            270   5e-74    
gb|EIT74840.1|  choline dehydrogenase                                   267   6e-74    
ref|XP_003071927.1|  GMC oxidoreductase family protein                  267   7e-74    
gb|KDN64457.1|  putative GMC oxidoreductase                             268   7e-74    
gb|KGU01716.1|  hypothetical protein MEY_06068                          266   7e-74    
gb|EZF29717.1|  hypothetical protein H101_06625                         267   8e-74    
gb|KGR00851.1|  hypothetical protein MG5_06042                          266   8e-74    
ref|XP_001821106.1|  long chain fatty alcohol oxidase                   267   8e-74    
gb|ESZ93853.1|  hypothetical protein SBOR_5750                          267   8e-74    
emb|CCX32413.1|  Similar to Long-chain-alcohol oxidase FAO1; acc....    266   1e-73    
gb|EMT74381.1|  Long-chain-alcohol oxidase FAO2                         265   1e-73    
gb|AHJ99440.1|  hypothetical protein Hsw_3845                           265   1e-73    
ref|XP_002543430.1|  conserved hypothetical protein                     259   1e-73    
gb|EMF15130.1|  long-chain fatty alcohol dehydrogenase                  266   1e-73    
gb|EXL94556.1|  hypothetical protein FOIG_12751                         266   1e-73    
gb|AAS46879.1|  fatty alcohol oxidase                                   265   2e-73    
gb|EGD99881.1|  long chain fatty alcohol oxidase                        266   2e-73    
ref|WP_040788581.1|  oxidoreductase                                     264   2e-73    
gb|ACX81419.1|  fatty alcohol oxidase                                   264   2e-73    
ref|XP_002788971.1|  long chain fatty acid oxidase                      266   2e-73    
emb|CCE42799.1|  hypothetical protein CPAR2_204420                      265   3e-73    
ref|WP_032385620.1|  hypothetical protein                               263   3e-73    
ref|XP_002479333.1|  long chain fatty alcohol oxidase, putative         270   3e-73    
ref|XP_459506.2|  DEHA2E04268p                                          264   4e-73    
ref|XP_006692351.1|  hypothetical protein CTHT_0018560                  266   4e-73    
ref|XP_002622231.1|  long chain fatty alcohol oxidase                   265   5e-73    
gb|EER37923.1|  long chain fatty acid oxidase                           262   7e-73    
ref|XP_007296903.1|  hypothetical protein MBM_09014                     271   8e-73    
gb|ENH81120.1|  long chain fatty alcohol oxidase                        264   1e-72    
ref|XP_007412898.1|  hypothetical protein MELLADRAFT_78490              263   1e-72    
ref|WP_022566024.1|  MULTISPECIES: putative oxidoreductase              261   1e-72    
ref|XP_003348911.1|  hypothetical protein SMAC_01933                    263   2e-72    
gb|EKD05087.1|  hypothetical protein A1Q2_00631                         260   4e-72    
gb|EHL01767.1|  putative Long-chain-alcohol oxidase FAO2                261   4e-72    
ref|XP_004197171.1|  Piso0_004410                                       260   9e-72    



>ref|XP_009626278.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana tomentosiformis]
Length=773

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/754 (63%), Positives = 575/754 (76%), Gaps = 31/754 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINE---ALPETTDASVTNFFQTSAASTGTPHQV  2210
             E N    TLS +QM++L+A+C+T LP+I+       E  D   TNF QTSA+ TGTP  +
Sbjct  21    EKNVELGTLSSNQMDSLTAICDTILPSIDANSFYHQEAIDDPFTNFLQTSASMTGTPQHI  80

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             AW+I+ R++HPKLN   + LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  KRE IV
Sbjct  81    AWMISNRLQHPKLNLCKIALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNKREEIV  140

Query  2029  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh  1850
              SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+GY GPDP   ++ +  + 
Sbjct  141   LSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGPQD  200

Query  1849  hdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVI  1694
              + E++    LFGPLY+GII L   ++  F RL K+G SV+KP            P F I
Sbjct  201   QEEEEE----LFGPLYQGIISLKQSQKKTFERLQKIGFSVSKPHNFNNTRRSTECPDFTI  256

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             ECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+LG GLL 
Sbjct  257   ECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLT  316

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             +KD+D++LLAGSTVGGGS +NWSASI+TP +VL+EW E + L+LF S+ Y+ A+  VC K
Sbjct  317   SKDMDVMLLAGSTVGGGSTINWSASIQTPQHVLKEWSERYKLDLFQSEFYKGALKVVCEK  376

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ E EDE FQNM+LRKGC+ELGY V  IP+NA SDHYCGWC+ GCKDG+KKGTAETW
Sbjct  377   MGVQSEIEDEGFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMGCKDGKKKGTAETW  436

Query  1153  LVDLVKSGNGAILPECEALQVIH-------ERNKAKGVMFTFQR-DGVKQTAVIKSKVTV  998
             LVDLVKSGNGAI PECEAL+VIH        ++KA GV F FQ   GV++  ++KSKVT+
Sbjct  437   LVDLVKSGNGAIFPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKGVREICMVKSKVTI  496

Query  997   IAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--------NKKSYEGA  842
             +A GAL+TPSLL  SGLKN NIGRNLHLHPVV AWG+FPDTP +        +KKSYEG 
Sbjct  497   VACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDSNVLWPEADKKSYEGG  556

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             IM+AMS VV N  G+GYGA+IQTP LHPG+FSALMPW SG + KMRM +Y+RTA+I ALA
Sbjct  557   IMTAMSKVVANFEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYILALA  616

Query  661   RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA  482
             RDKGSGEAFSP SVTY +D+ DEENL+ GLEK+LRILAAAGAEEIG  HG G +LKVKDA
Sbjct  617   RDKGSGEAFSPYSVTYKMDQIDEENLKLGLEKMLRILAAAGAEEIGTQHGKGRSLKVKDA  676

Query  481   SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD  302
             S +EFERFVKEESS  +  H     SAHQMGSCRMGVDP  SVVN KGE WEVEGLF+GD
Sbjct  677   SLKEFERFVKEESSIEIGNHSVPICSAHQMGSCRMGVDPTTSVVNSKGELWEVEGLFLGD  736

Query  301   GSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
              SV PTA+GVNPMVTI ++SYC +QSV++ LK  
Sbjct  737   SSVFPTAIGVNPMVTIQAISYCTAQSVVQLLKNQ  770



>ref|XP_009759689.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Nicotiana sylvestris]
Length=772

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/754 (63%), Positives = 569/754 (75%), Gaps = 32/754 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINE---ALPETTDASVTNFFQTSAASTGTPHQV  2210
             E      TLS +QM++L+ALC+T LP+I+       E  D   TNF QTSA+ TGTP  +
Sbjct  21    EKKVELGTLSSNQMDSLTALCDTILPSIDANSFYQNEAIDDPFTNFLQTSASMTGTPQHI  80

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             AW+I+ R+ HPKLN   L LW LSTRIGTL+LCGK SLS+QFP+L  F  IS  +RE IV
Sbjct  81    AWMISNRLHHPKLNLCKLALWLLSTRIGTLILCGKASLSSQFPYLQSFSRISPNQREEIV  140

Query  2029  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh  1850
              SW+TS  + +R  F+A+K LVLLVFFT V++K  NPSWKA+GY GPDP   ++ +  + 
Sbjct  141   LSWSTSCFKLLRILFSAIKILVLLVFFTQVNEKSQNPSWKALGYSGPDPDFKKQNQGVQD  200

Query  1849  hdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVI  1694
              + E      LFGPLY+GII L   ++  F RL KLG SV+KP            P+F I
Sbjct  201   QEEEQ-----LFGPLYQGIISLKQSQKKAFERLQKLGFSVSKPHNFNDTRRSTECPNFTI  255

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             ECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+M+LG GLL 
Sbjct  256   ECDAVVVGSGSGGGVIAGILAKAGHKVLVLEKGSYLARTNLSLLEGPSMDQMYLGNGLLT  315

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             +KD+D++LLAGSTVGGGS +NWSASI+TP +VL+EW E + LELF S+ Y+ A+  VC K
Sbjct  316   SKDMDIMLLAGSTVGGGSTINWSASIQTPQHVLKEWSEKYKLELFQSEFYEGALKVVCEK  375

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ E EDE FQNM+LRKGC+ELGY V  IP+NA SDHYCGWC+ GCKDG+KKGTAETW
Sbjct  376   MGVQSEIEDEGFQNMILRKGCQELGYQVETIPRNAQSDHYCGWCSMGCKDGKKKGTAETW  435

Query  1153  LVDLVKSGNGAILPECEALQVIH-------ERNKAKGVMFTFQR-DGVKQTAVIKSKVTV  998
             LVDLVKSGNGAILPECEAL+VIH        ++KA GV F FQ   GV++  ++KSKVT+
Sbjct  436   LVDLVKSGNGAILPECEALEVIHVKKNDNSGKSKAIGVAFAFQNGKGVREICMVKSKVTI  495

Query  997   IAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--------NKKSYEGA  842
             +A GAL+TPSLL  SGLKN NIGRNLHLHPVV AWG+FPDTP +        NKKSYEG 
Sbjct  496   VACGALSTPSLLKKSGLKNPNIGRNLHLHPVVIAWGYFPDTPSDCNVLWPEANKKSYEGG  555

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             IM+AMS VV N  G+GYGA+IQTP LHPG+FSALMPW SG + KMRM +Y+RTA++ ALA
Sbjct  556   IMTAMSKVVANFEGSGYGAIIQTPGLHPGMFSALMPWVSGLDIKMRMCKYSRTAYLLALA  615

Query  661   RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA  482
             RD GSGEAFSP SVTY +D+ DEENL+ GLEK+LRILAAAGAE IG  HG G +L VKD 
Sbjct  616   RDMGSGEAFSPYSVTYKMDRIDEENLKLGLEKMLRILAAAGAEAIGTQHGKGRSLNVKDE  675

Query  481   SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD  302
             S +EFERFVKEESS  +  H     SAHQMGSCRMG DP  SVVN KGETWEVEGLF+GD
Sbjct  676   SLKEFERFVKEESSIKIGNHSVPICSAHQMGSCRMGEDPTTSVVNSKGETWEVEGLFLGD  735

Query  301   GSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
              SV PTA+GVNPMVTI ++SYC +QSVL+ LK  
Sbjct  736   SSVFPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  769



>ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=776

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/751 (63%), Positives = 579/751 (77%), Gaps = 35/751 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPE--------TTDASVTNFFQTSAASTGTPHQVAWV  2201
             LS +Q+++L+ LC+TF+P+I++A             D S   F QTSA+  GTP  +AW+
Sbjct  26    LSSNQLDSLTTLCDTFVPSIHDANSYGHQDQGNIDDDDSYAKFLQTSASMNGTPQHIAWM  85

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE  V SW
Sbjct  86    INNRLQHPKMNLCRLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPKKREESVKSW  145

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             ATS  + +R  F A K LVLLVF+T V+D+  N SWKA+GY GPDP   +++++  +   
Sbjct  146   ATSCFKLLRILFFAAKILVLLVFYTQVNDENKNSSWKALGYSGPDPDFKKQKQENMNSKK  205

Query  1840  eddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSFVIECD  1685
             +DD     FGPL++GII L   ++ +F+RL +LG SV+KP            P+F+IECD
Sbjct  206   KDDQP---FGPLHEGIISLKNSQKIIFHRLQELGFSVSKPHNFNNARRSTECPAFIIECD  262

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AVVVGSG GGGVI+G+LA AG+KV+VLEKG+Y AR+NLSLLEGPSMD+M+LG GLL+T+D
Sbjct  263   AVVVGSGSGGGVIAGILANAGHKVIVLEKGSYLARSNLSLLEGPSMDQMYLGSGLLITQD  322

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
             +D++LLAGSTVGGGS VNWSASI+TP +VL+EW E + L LF S++Y++AM+ VC KMGV
Sbjct  323   MDVMLLAGSTVGGGSTVNWSASIQTPRHVLKEWSESYNLRLFESELYKEAMEIVCEKMGV  382

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
             Q E EDE FQNM+LRKGC+ELGYPV  IP NAPSDHYCGWC+ GCKDG+KKGT+ETWLVD
Sbjct  383   QSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSMGCKDGKKKGTSETWLVD  442

Query  1144  LVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQR-DGVKQTAVIKSKVTVIAG  989
             LVKSGNGAILPECEAL+VIHE       ++KA GV F FQ  +G+++  ++KS VT+IA 
Sbjct  443   LVKSGNGAILPECEALEVIHEEKNGNSGKSKAIGVAFAFQNIEGMREICMVKSTVTIIAC  502

Query  988   GALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--------KKSYEGAIMS  833
             GAL+TPSLLI SGLKN NIGRNLHLHPVV AWG+FPD+P  +        KKSYEG IM+
Sbjct  503   GALSTPSLLIKSGLKNPNIGRNLHLHPVVIAWGYFPDSPSNSNETWPKAEKKSYEGGIMT  562

Query  832   AMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             AMS VV N  G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IFALARDK
Sbjct  563   AMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDK  622

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSGEAFSP SV+Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +AS +
Sbjct  623   GSGEAFSPYSVSYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNEASTK  682

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             EFERFV+EESS  + KH     SAHQMGSCRMG DPK SVVN KGETWEVEGLF+GD SV
Sbjct  683   EFERFVREESSIEIGKHSVPICSAHQMGSCRMGTDPKTSVVNSKGETWEVEGLFLGDSSV  742

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
              PTA+GVNPMVTI ++SYC +QSVL+ LK  
Sbjct  743   CPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  773



>ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum lycopersicum]
Length=774

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/747 (63%), Positives = 572/747 (77%), Gaps = 29/747 (4%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             +LS SQM++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R+
Sbjct  23    SLSFSQMDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERI  82

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             +HPKLN   L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ 
Sbjct  83    QHPKLNLCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNF  142

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
             + I+  F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++ +       E
Sbjct  143   KLIKLLFVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEE  202

Query  1825  ------ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvg  1670
                   E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVG
Sbjct  203   LSDKRDEHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVG  262

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GGGVI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ L
Sbjct  263   SGSGGGVIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFL  322

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAGSTVGGGS +NWSASI TP +VL+EWC+++ LELF S+ Y++A++T+  KMGVQ + +
Sbjct  323   LAGSTVGGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKID  382

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E FQNM+LRKGC ELGY V NIP+NA S+HYCGWC+ GCKDG KKGT ETWLVDLVKSG
Sbjct  383   EEGFQNMILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSG  442

Query  1129  NGAILPECEALQVIHE------RNKAKGVMFTFQRD-GVKQTAVIKSKVTVIAGGALTTP  971
             NGAI+ ECEAL+VIHE      ++KA GV   FQ D GVK+  ++KSKVT++A GAL+TP
Sbjct  443   NGAIIQECEALEVIHEHKNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALSTP  502

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAM  827
             SLL  SGLKN NIG+NLH+HPVVFAWGHFPDT            P  +KKSYEG IMS M
Sbjct  503   SLLKRSGLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSVM  562

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
             S VV N    GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGS
Sbjct  563   SKVVANTEEPGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGS  622

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             GE  SP S++Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S +EF
Sbjct  623   GETVSPYSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEF  682

Query  466   ERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
             E FVKEESS+ L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV P
Sbjct  683   ESFVKEESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFP  742

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             TALGVNPM+T+ ++SYC +Q+VL+ LK
Sbjct  743   TALGVNPMLTVQAISYCTAQNVLQLLK  769



>gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
Length=746

 Score =   900 bits (2326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/741 (62%), Positives = 567/741 (77%), Gaps = 29/741 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  2168
             M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  2167  slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  1988
                L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie------  1826
             F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++ +       E      
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSDKRD  180

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgcggg  1652
             E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG GGG
Sbjct  181   EHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             VI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAGSTV
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTV  300

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS +NWSASI TP +VL+EWC+++ LELF S+ Y++A++T+  KMGVQ + ++E FQN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQN  360

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LRKGC ELGY V NIP+NA S+HYCGWC+ GCKDG KKGT ETWLVDLVKSGNGAI+ 
Sbjct  361   MILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRD-GVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             ECEAL+VIHE      ++KA GV   FQ D GVK+  ++KSKVT++A GAL+TPSLL  S
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALSTPSLLKRS  480

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAMSTVVLN  809
             GLKN NIG+NLH+HPVVFAWGHFPDT            P  +KKSYEG IMS MS VV N
Sbjct  481   GLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSVMSKVVAN  540

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                 GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGSGE  SP
Sbjct  541   TEEPGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSP  600

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
              S++Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S +EFE FVKE
Sbjct  601   YSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKE  660

Query  448   ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
             ESS+ L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVN
Sbjct  661   ESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVN  720

Query  268   PMVTIMSVSYCISQSVLEFLK  206
             PM+T+ ++SYC +Q+VL+ LK
Sbjct  721   PMLTVQAISYCTAQNVLQLLK  741



>gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
Length=746

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/741 (62%), Positives = 569/741 (77%), Gaps = 29/741 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  2168
             M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMLSERIQHPKLN  60

Query  2167  slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  1988
                L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+L+FI+  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNLKFIKLL  120

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie------  1826
             F A+K L LLVFFT V++KG NPSWKA+GYCG DP   ++++++ +       E      
Sbjct  121   FVALKVLTLLVFFTQVNEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSDKRD  180

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgcggg  1652
             E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG GGG
Sbjct  181   EHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             VI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAGSTV
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTV  300

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS +NWSASI TP +VL+EWC+++ LELF S+ Y++A++T+  KMGVQ + ++E FQN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQN  360

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LRKGC ELGY V NIP+NA S+HYCGWC+ GCKDG KKGT ETWLVDLVKSGNGAI+ 
Sbjct  361   MILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRD-GVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             ECEAL+VIHE      ++KA GV   FQ D GVK+  +++SKVT++A GAL+TPSLL  S
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKRS  480

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAMSTVVLN  809
             GLKN NIG+NLH+HPVVFAWGHFPDT            P  +KKSYEG IMS MS VV N
Sbjct  481   GLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESDKKSYEGGIMSVMSKVVAN  540

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                 GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGSGE  SP
Sbjct  541   TEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSP  600

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
              S++Y LD+ DE+N++ G+EKLLRILAAAGAEEIG +H  G   KVK++S +EFE FVKE
Sbjct  601   YSISYKLDQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKE  660

Query  448   ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
             ESS+ L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVN
Sbjct  661   ESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVN  720

Query  268   PMVTIMSVSYCISQSVLEFLK  206
             PM+T+ ++SYC +Q+VL+ LK
Sbjct  721   PMLTVQAISYCTAQNVLQLLK  741



>gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
Length=746

 Score =   897 bits (2318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/741 (62%), Positives = 568/741 (77%), Gaps = 29/741 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  2168
             M++L+A+C+TFLP+I  N    E  D S+  F  TSA+   TP  +AW++++R++HPKLN
Sbjct  1     MDSLTAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNETPQHLAWMVSERIQHPKLN  60

Query  2167  slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  1988
                L LW LSTRIGT +LCGK SLS+QFP+L  F ++S  KRE IV SW+ S+ + I+  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSKVSPNKREEIVQSWSCSNFKLIKLL  120

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie------  1826
             F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++ +       E      
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEELSDKRD  180

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgcggg  1652
             E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG GGG
Sbjct  181   EHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             VI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAGSTV
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTV  300

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS +NWSASI TP +VL+EWC+++ LELF S+ Y++A++T+  KMGVQ + ++E FQN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCDIYNLELFQSEFYKEALETIREKMGVQDKIDEEGFQN  360

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LRKGC ELGY V NIP+NA S+HYCGWC+ GCKDG KKGT ETWLVDLVKSGNGAI+ 
Sbjct  361   MILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRD-GVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             ECEAL+VIHE      ++KA GV   FQ D GVK+  ++KSKVT++A GAL+TPSLL  S
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVKSKVTIVACGALSTPSLLKRS  480

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAMSTVVLN  809
             GLKN NIG+NLH+HPVVFAWGHFPDT            P  +KKSYEG IMSAMS VV N
Sbjct  481   GLKNPNIGKNLHVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSAMSKVVAN  540

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                 GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGSGE  SP
Sbjct  541   TEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSP  600

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
              S++Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S +EFE FVKE
Sbjct  601   YSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKE  660

Query  448   ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
             ESS+ L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVN
Sbjct  661   ESSRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVN  720

Query  268   PMVTIMSVSYCISQSVLEFLK  206
             PM+T+ ++SYC +Q+VL+ LK
Sbjct  721   PMLTVQAISYCTAQNVLQLLK  741



>gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
Length=746

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/744 (62%), Positives = 567/744 (76%), Gaps = 29/744 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  2168
             M++LSA+C+TFLP+I  N    E  D S+  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSLIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  2167  slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  1988
                L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie------  1826
             F A+K L LLVFFT VD+KG NPSWKA+GYCG DP   ++++++ +       E      
Sbjct  121   FVALKVLTLLVFFTQVDEKGQNPSWKALGYCGQDPDFKKQKQEKMNSKQSKHEEFSDKRD  180

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgcggg  1652
             E L+GPLYKGI+ L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG GGG
Sbjct  181   EHLYGPLYKGILTLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             VI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPSMD+MFLG GL+MTKD+D+ LLAGSTV
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTV  300

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS +NWSASI TP +VL+EWC+++ LELF S+ Y++A++T+  KMGVQ + ++E FQN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCDIYELELFQSEFYKEALETIRKKMGVQDKIDEEGFQN  360

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LRKGC ELGY V NIP+NA S+HYCGWC+ GCKDG KKGT ETWLVDLVKSGNGAI+ 
Sbjct  361   MILRKGCEELGYNVENIPRNAHSNHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRD-GVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             ECEAL+VIHE      ++KA GV   FQ D GVK+  +++SKVT++A GAL+TPSLL  S
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKRS  480

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAMSTVVLN  809
             GLKN NIG+NLH+HPVVFAWGHFPDT            P   KKSYEG IMS MS VV N
Sbjct  481   GLKNPNIGKNLHVHPVVFAWGHFPDTDSTDNVKNFEVWPESEKKSYEGGIMSVMSKVVAN  540

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                 GYG VIQTP+LHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGSGE  SP
Sbjct  541   TEEPGYGVVIQTPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSP  600

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
              S++Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G   KVK++S +EFE FVKE
Sbjct  601   YSISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVDEFESFVKE  660

Query  448   ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
             ESS+ L+       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVN
Sbjct  661   ESSRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVN  720

Query  268   PMVTIMSVSYCISQSVLEFLKTHD  197
             PM+T+ ++SYC +Q+VL+ LK  +
Sbjct  721   PMLTVQAISYCTAQNVLQLLKAKN  744



>ref|XP_006361221.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=745

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/740 (62%), Positives = 564/740 (76%), Gaps = 28/740 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKln  2168
             M++LSA+C+TFLP+I  N    E  D SV  F  TSA+  GTP  +AW++++R++HPKLN
Sbjct  1     MDSLSAICDTFLPSIDTNSLHQENMDDSVIKFLHTSASMNGTPQHLAWMVSERIQHPKLN  60

Query  2167  slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNF  1988
                L LW LSTRIGT +LCGK SLS+QFP+L  F  +S  KRE IV SW+ S+ + I+  
Sbjct  61    LCKLALWLLSTRIGTFILCGKASLSSQFPYLQNFSRVSPNKREEIVQSWSCSNFKLIKLL  120

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie------  1826
             F A+K L LLVFFT VD+K  NPSWKA+GYCG DP   + ++++ +       E      
Sbjct  121   FVALKVLTLLVFFTQVDEKCQNPSWKALGYCGQDPDFKKPKQEKMNSKQSKHEEFSDKRD  180

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG--PSFVIECDAvvvgsgcggg  1652
             E L+GPLYKGII L  P+  +FN+L KLG  V+KP      PSF+IECDAVVVGSG GGG
Sbjct  181   EHLYGPLYKGIITLKQPQNALFNKLQKLGFHVSKPNSSSNCPSFIIECDAVVVGSGSGGG  240

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             VI+GVLA AG+KVLVLEKG+Y ARTNLSLLEGPS+D+MFLG GL+MTKD+++ LLAGSTV
Sbjct  241   VIAGVLANAGHKVLVLEKGSYLARTNLSLLEGPSLDQMFLGNGLMMTKDMEVFLLAGSTV  300

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS +NWSASI TP +VL+EWC ++ LE+F S+ Y++A++ +  KMGVQ + ++E FQN
Sbjct  301   GGGSTINWSASIDTPSHVLKEWCGIYELEMFQSESYKEALEAIREKMGVQDKIDEEGFQN  360

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LRKGC ELGY V NIP+NAPS+H CGWC+ GCKDG KKGT ETWLVDLVKSGNGAI+ 
Sbjct  361   MILRKGCEELGYHVENIPRNAPSNHNCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQ  420

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             ECEAL+VIHE      ++KA GV   FQ +GVK+  ++KSKVT++A GAL+TPSLL  SG
Sbjct  421   ECEALEVIHEHKNNYNKSKAIGVACEFQHEGVKEIFMVKSKVTIVACGALSTPSLLKRSG  480

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDT------------PGENKKSYEGAIMSAMSTVVLNV  806
             LKN NIG+NLH+HPVVFAWGHFPDT            P   KKSYEG IMS MS VV N 
Sbjct  481   LKNPNIGKNLHVHPVVFAWGHFPDTNSSDNVKNFEVWPESKKKSYEGGIMSVMSKVVANF  540

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
               +GYG VIQTPALHPG+FS +MPW SG + KMRM +Y+RTAHIFALARDKGSGEA S  
Sbjct  541   EESGYGVVIQTPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGEAISSN  600

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEE  446
             S++Y LD+ DE+NL+ G+EKLLRILAAAGAEEIG +H  G TLKVK++S +EFE FVKEE
Sbjct  601   SISYKLDQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGKTLKVKESSVDEFESFVKEE  660

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
             SS+  +       SAHQMGSCRMG+DPK SVVNPKGETWEVE LF+GD SV PTALGVNP
Sbjct  661   SSRGFKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNP  720

Query  265   MVTIMSVSYCISQSVLEFLK  206
             MVT+ ++SYC +Q+VL+ LK
Sbjct  721   MVTVQAISYCTAQNVLQVLK  740



>ref|XP_006359947.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=702

 Score =   887 bits (2291),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/700 (66%), Positives = 548/700 (78%), Gaps = 27/700 (4%)
 Frame = -3

Query  2227  GTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  2048
             GTP  +AW+IN R++HPK+N   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS K
Sbjct  3     GTPQHIAWMINNRLQHPKMNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQTFSNISPK  62

Query  2047  KRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek  1868
             KRE  V SWATS  + +R  F A K LVLLVF+T V+D+  N SWKA+GY GPDP   ++
Sbjct  63    KREESVKSWATSCFKLLRILFFAAKILVLLVFYTQVNDESQNSSWKALGYSGPDPDFKKQ  122

Query  1867  qkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPP  1712
             +++  + + +DD     FGPLY+GII L   ++ +F+RL +LG SV+KP           
Sbjct  123   KQENMNSNEKDDQP---FGPLYEGIISLKNSQKIIFHRLQELGFSVSKPHNFKNARRSTE  179

Query  1711  GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  1532
              P+F+IECDAVVVGSG GGGVI+G+LA AG+KVLVLEKG+Y ARTNLSLLEG SMD+M+L
Sbjct  180   CPAFIIECDAVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLARTNLSLLEGTSMDQMYL  239

Query  1531  GGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAM  1352
             G GLL T+D+D++LLAGSTVGGGS +NWSASI+TP +VL+EW E + LELF S++Y++AM
Sbjct  240   GSGLLTTQDMDIMLLAGSTVGGGSTINWSASIQTPQHVLKEWSESYNLELFESELYKEAM  299

Query  1351  DTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKK  1172
               VC KMGVQ E EDE FQNM+LRKGC+ELGYPV  IP NAPSDHYCGWC+ GCKDG+KK
Sbjct  300   KIVCEKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSMGCKDGKKK  359

Query  1171  GTAETWLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQR-DGVKQTAVI  1016
             GTAETWLVDLVKSGNGAILPECEAL+VIHE       + KA GV F FQ  +G+++  ++
Sbjct  360   GTAETWLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRKAIGVAFAFQNIEGMREICMV  419

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--------K  860
             KSKVT++A GAL+TPSLL  SGLKN NIGRNLHLHPVV AWG+FPD+P  +        K
Sbjct  420   KSKVTIVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDSPSTSNEIWPKAEK  479

Query  859   KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTA  680
             KSYEG IM+AMS VV N  G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA
Sbjct  480   KSYEGGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTA  539

Query  679   HIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLT  500
             +IFALARDKGSGEA SP S++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +
Sbjct  540   YIFALARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRS  599

Query  499   LKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVE  320
             LKV +AS +EFERFVKEESS  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVE
Sbjct  600   LKVNEASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVE  659

Query  319   GLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             GLF+GD SV PTA+GVNPMVTI ++SYC +QSVL+ LK  
Sbjct  660   GLFLGDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  699



>emb|CDP07225.1| unnamed protein product [Coffea canephora]
Length=829

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/752 (60%), Positives = 569/752 (76%), Gaps = 30/752 (4%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  2195
             N  + +LS  QME+L ALC+T+LP+I+       D S   F+QTSA+  GTP ++  +I+
Sbjct  41    NPYSSSLSSRQMESLKALCDTYLPSID-GFHTKHDESTARFYQTSASVAGTPQRLGGLIS  99

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +R++HPKL    L LWFLST IGT  +CG  SLS  FP+L +F ++S +KRE+IV SW+ 
Sbjct  100   ERLQHPKLFMARLALWFLSTSIGTFAMCGIASLSGNFPYLQKFSQVSPEKREQIVLSWSR  159

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP----------SISekq  1865
             S +  +R  FTA+K L+LLVFF+ VDDK +N SWKAIGYCGPDP          ++ +  
Sbjct  160   SIIFPLRLLFTALKVLILLVFFSQVDDKEENLSWKAIGYCGPDPDFKRQTQRIKTLKQMF  219

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPPG  1709
             +  +    ++   E LFGPLYKGI++L+ P++ VF +L   G SV        AK K   
Sbjct  220   ESAEDQKQDEASAEELFGPLYKGIVNLDRPKQFVFEKLQNAGFSVSASSHLKNAKSKYNR  279

Query  1708  PSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLG  1529
             PSF I+CDAVVVGSG GGGV++G+LA AGYK LVLEKGNY+ARTNLSLLEG +MD+M+LG
Sbjct  280   PSFRIKCDAVVVGSGSGGGVVAGILAKAGYKTLVLEKGNYFARTNLSLLEGSTMDQMYLG  339

Query  1528  GGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMD  1349
              G + T+ +D++ LAGSTVGGGSAVNWS+SI+TPP+V++EW E + LELF S +Y++A+D
Sbjct  340   SGFMATEKMDVIFLAGSTVGGGSAVNWSSSIRTPPHVIKEWSESYELELFDSKLYEEALD  399

Query  1348  TVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKG  1169
              VC KMGVQ E E+E F NMVLRKGC ELGYPV  IP+NA +DHYCGWC FGCKDGRKKG
Sbjct  400   AVCQKMGVQSEIENEGFNNMVLRKGCEELGYPVNTIPRNATADHYCGWCCFGCKDGRKKG  459

Query  1168  TAETWLVDLVKSGNGAILPECEALQVIHER-NKAKG-----VMFTFQRDGVKQTAVIKSK  1007
             T ETWLVDL+ SGNG ILPEC+A++V+H+R NK KG     V F FQ  GV++  +++SK
Sbjct  460   TLETWLVDLLNSGNGLILPECKAIRVLHKRKNKKKGRHAVGVAFKFQNQGVEEIGIVESK  519

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGA  842
             VT++A GAL+TP LLI SGLKN NIG++LH+HPV  AWG+FPDT     P   KKSYEG 
Sbjct  520   VTIVACGALSTPELLIKSGLKNPNIGKHLHIHPVAMAWGYFPDTTPDPWPEAEKKSYEGG  579

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             IM+AMSTVV N  G+GYGAVIQTPALHPG+FSALMPW SG++FK RM +++RTAH+FALA
Sbjct  580   IMTAMSTVVANFEGSGYGAVIQTPALHPGMFSALMPWTSGRDFKDRMCKFSRTAHVFALA  639

Query  661   RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA  482
             RDKGSG+   P S+TY++DK DEEN++RGLEK+LRILA+AGAEEIG +H  G ++ VK  
Sbjct  640   RDKGSGKLLYPNSITYNMDKIDEENIKRGLEKVLRILASAGAEEIGTHHVKGRSINVKKV  699

Query  481   SREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD  302
             S  EF++FVKEESS+SL+       SAHQMGSCRMGVDPK SV NP GETWE+EGL++ D
Sbjct  700   SYTEFDKFVKEESSRSLKDLATPICSAHQMGSCRMGVDPKISVANPIGETWEIEGLYLAD  759

Query  301   GSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  760   SSVFPTALGVNPMVTVQAIAYCTAQSVLESLR  791



>ref|XP_006359948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum tuberosum]
Length=707

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/696 (65%), Positives = 543/696 (78%), Gaps = 27/696 (4%)
 Frame = -3

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             Q+AW+I+ R++HP+LN   L LW LSTRIGT +LCGK SLSTQFP+L  F  IS KKRE 
Sbjct  12    QMAWMISNRLQHPRLNLCKLALWLLSTRIGTFILCGKASLSTQFPYLQNFSNISPKKREE  71

Query  2035  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             IV SWATS  + +R  + AMK LVLLVFFT V+++  NPSWKA+GY GPD    +++++ 
Sbjct  72    IVKSWATSCFKLLRILYFAMKVLVLLVFFTQVNEESQNPSWKALGYIGPDLDFKKQKQEN  131

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP--------KPPGPSF  1700
              +   +DD     FGPLY+GII L   ++  F+RL KLG SV+KP            P+F
Sbjct  132   MNSKKKDDQP---FGPLYEGIISLKNSQKITFDRLKKLGFSVSKPHNFKNAKRSTECPAF  188

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              IE D VVVGSG GGGVI+G+LA AG+KVLVLEKG+Y AR+NLSLLEG SMD+M+LG G+
Sbjct  189   TIESDVVVVGSGSGGGVIAGILANAGHKVLVLEKGSYLARSNLSLLEGTSMDQMYLGSGI  248

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
             + TKD+D++LLAGSTVGGGS +NWSASI+TP +VL+EW E + L+LF S++Y++A+  VC
Sbjct  249   VATKDMDIILLAGSTVGGGSTINWSASIQTPQHVLKEWSESYNLKLFESELYKEALRIVC  308

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              KMGVQ E EDE FQNM+LRKGC+ELGYPV  IP NAPSDHYCGWC+ GCKDG+KKGTAE
Sbjct  309   EKMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSMGCKDGKKKGTAE  368

Query  1159  TWLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQR-DGVKQTAVIKSKV  1004
             TWLVDLVKSGNGAILPECEAL+VIHE       + KA GV F FQ  +G+++  ++KSKV
Sbjct  369   TWLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRKAIGVAFAFQNIEGMREICMVKSKV  428

Query  1003  TVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--------KKSYE  848
             T++A GAL+TPSLL  SGLKN NIGRNLHLHPVV AWG+FPD+P  +        KKSYE
Sbjct  429   TIVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDSPSTSNEIWPKAEKKSYE  488

Query  847   GAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFA  668
             G IM+AMS VV N  G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IFA
Sbjct  489   GGIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFA  548

Query  667   LARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK  488
             LARDKGSGEA SP S++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV 
Sbjct  549   LARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVN  608

Query  487   DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
             +AS +EFERFVKEESS  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVEGLF+
Sbjct  609   EASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFL  668

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             GD SV PTA+GVNPMVTI ++SYC +QSVL+ LK  
Sbjct  669   GDSSVCPTAIGVNPMVTIQAISYCTAQSVLQLLKNQ  704



>ref|XP_011072398.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Sesamum 
indicum]
Length=761

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/748 (59%), Positives = 551/748 (74%), Gaps = 32/748 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
              S  QME LSALC+TFLPAI+    +  P+   +    F+QTSA+  G PH V   +  +
Sbjct  8     FSCGQMEALSALCDTFLPAIDVDNYDVGPQLHSSLHRQFYQTSASMAGIPHHVGEFLGGK  67

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
             ++HPK+    L +  LSTRIG+L+LCG+ SLS +FP+   F ++S ++RE I+ SW+TSS
Sbjct  68    VEHPKMCLARLAIMLLSTRIGSLILCGRKSLSPKFPYFQTFSKVSCERREEILLSWSTSS  127

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe---  1838
                +R  FTA+K   LL+FFT V++KG+N SWKAIGYCGPDP  ++ ++    +  +   
Sbjct  128   FLLLRILFTALKIFTLLLFFTQVNEKGENLSWKAIGYCGPDPGCTKTRRLNAENTQQPPE  187

Query  1837  --------ddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKP-------KPPGPS  1703
                        +E LFG LYKGII+L+ P E   ++L  LG SV+ P       K   PS
Sbjct  188   ECEEKLADGASKEELFGSLYKGIINLSQPREDPLSKLQNLGFSVSIPHSRNRRMKSLNPS  247

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
             F+++CDAVVVGSG GGGV++GVLA AG+KVLVLEKG+Y+AR NLSLLEG +MD+M+LG G
Sbjct  248   FIVKCDAVVVGSGSGGGVMAGVLANAGHKVLVLEKGSYFARANLSLLEGEAMDQMYLGKG  307

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             +  T +LD++LLAGSTVGGGS +NWSASI TPP+V+REW E H L+LF S VYQ+A+D V
Sbjct  308   MATTDNLDVLLLAGSTVGGGSTINWSASIHTPPHVIREWSEKHKLKLFESKVYQQALDVV  367

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C KMGVQ E E E F NM+LRKGC +LGYPV  +P+NAPSDHYCGWC FGCKDGRKKGT+
Sbjct  368   CQKMGVQSEVEHEGFNNMILRKGCEKLGYPVETVPRNAPSDHYCGWCCFGCKDGRKKGTS  427

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHE----RNKAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             ETWLVDLV+SGNGAILP CEAL+VI E    + +A GV F F     ++  +++S VTV 
Sbjct  428   ETWLVDLVESGNGAILPACEALRVITEESNGKKRAIGVAFAFYTPFGREIGIVESDVTVA  487

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKKSYEGAIMS  833
             A GA+ TP LL  SGLKN+NIG+NLH+HPVV AWG+FPD+      P   K+SYEG I++
Sbjct  488   ASGAICTPPLLKRSGLKNRNIGKNLHIHPVVMAWGYFPDSASPDAWPAAEKRSYEGGIIT  547

Query  832   AMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             AMSTV+ N   +GYG VIQTP LHPG+FS LMPW SG + K RM +++RT HIFALARDK
Sbjct  548   AMSTVIANTETSGYGTVIQTPILHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFALARDK  607

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSG+  S T+V+Y L+ +D+ENL +GLEK++RI+AAAGAEEIG  H TG  LKVK AS E
Sbjct  608   GSGKITSETNVSYKLEYSDQENLSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEE  667

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             EFERFVKEES + L+K  +   SAHQMGSCRMGVDPK+S VNPKGETWEVEGLFV D SV
Sbjct  668   EFERFVKEESLRPLQKLSSPIGSAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSV  727

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFL  209
              PTALGVNPMVTI +++YC +QSVLE L
Sbjct  728   FPTALGVNPMVTIQAIAYCTAQSVLEVL  755



>ref|XP_003534338.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=807

 Score =   847 bits (2187),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/751 (58%), Positives = 552/751 (74%), Gaps = 31/751 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T +LSP QM++L+ALC+T LP++ +   +++D SVT F+Q SA+ TGTP +   +I++R+
Sbjct  52    TNSLSPRQMKSLTALCDTILPSVADHFVDSSDESVTKFYQISASMTGTPERFGGMISERL  111

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             KHP    L  +LW LST  GTL+ CG G LSTQFPF+  +P +S +KR++I+ SW+ S L
Sbjct  112   KHPLTGLLKFVLWLLSTWYGTLIFCGIGCLSTQFPFIHAYPHLSLQKRQKIMRSWSLSYL  171

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq----------  1856
             +  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    + K            
Sbjct  172   RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKAQLKNHFLDGTSKGGG  231

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-------PS  1703
             +    ED+  E + GPLYKG++ LN P++   + L + G   SV + K          PS
Sbjct  232   QEDKEEDEDAEEMIGPLYKGLVHLNYPQDITADALRRFGFPVSVIRRKHKAAAANLSCPS  291

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
              VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y A+ NLSLLEGP+MD+M+L GG
Sbjct  292   LVIQCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQMYLNGG  351

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             L+ + D+ + +L+GSTVGGGSA+NWSA IKTP +V +EWC+ HGLELF S++Y++A+D V
Sbjct  352   LVASDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWCDKHGLELFESELYREALDAV  411

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             CGKMGVQ E EDE F N +LRKGC+E+GYPV NIP+N+PS+HYCGWC  GCKDGRKKGT+
Sbjct  412   CGKMGVQSEIEDEGFNNAILRKGCQEMGYPVNNIPRNSPSNHYCGWCCMGCKDGRKKGTS  471

Query  1162  ETWLVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVT  1001
             ETWLVDLVKSGNGAILP CEA++V+H      +R  A+GV F F+  G K   V++SKVT
Sbjct  472   ETWLVDLVKSGNGAILPGCEAIKVLHKKKEGKDRKIARGVAFEFEYKGTKDVCVVESKVT  531

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN------KKSYEGAI  839
             ++A GAL+TP+LL  SGL+N+NIG+NLHLHPVV AWG+FPD P         KKSYEG I
Sbjct  532   IVACGALSTPALLKRSGLRNQNIGKNLHLHPVVMAWGYFPDAPESEVWPEAYKKSYEGGI  591

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             M+AMSTVV     +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIFALAR
Sbjct  592   MTAMSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALAR  651

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+GSG   +P  ++Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK  S
Sbjct  652   DQGSGTVKAPDRISYKPADVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVS  711

Query  478   REEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
               EFE+FVKEESS+SL        SAHQMGSCRMG +PK SVVNP GETWEVEGL+V D 
Sbjct  712   YHEFEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADA  771

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             SV PTALGVNPMVT+ +++YC +QSV+E LK
Sbjct  772   SVFPTALGVNPMVTVQAIAYCTAQSVVEVLK  802



>ref|XP_006482469.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Citrus sinensis]
Length=788

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/758 (57%), Positives = 557/758 (73%), Gaps = 33/758 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             EN+    +LS  +ME+LSALC+TFLPA++     + D  + +FF+ SA++ GTP ++  +
Sbjct  26    ENHCYVNSLSSQEMESLSALCDTFLPAVDVKTAASIDKDIADFFRASASAAGTPERLGGL  85

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             +++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ SW
Sbjct  86    MSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVSW  145

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             + S    +R  + AMK L+LLVFFT V++K +N SWKAIGY GPDP    K  ++K   +
Sbjct  146   SLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRN  205

Query  1840  eddieEL---------------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------  1730
             E   ++                L+GPLYKG+I++ LP   V + L ++G  V        
Sbjct  206   EGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNA  265

Query  1729  AKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
             A      PS VI+CDAVVVGSG GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +
Sbjct  266   APSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKT  325

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             MD+M+L GG+L T D+ ++LLAGSTVGGGS +NWSASIKTP +V  EWC+ + L+LF SD
Sbjct  326   MDQMYLAGGVLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESD  385

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
             +Y++AM+ VC +MGVQ E E+E F N VLR+GC+ELGYPV NIP+N+P DHYCGWC  GC
Sbjct  386   LYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGC  445

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIH----ERNKAKGVMFTFQRDGVKQTA  1022
             KDG KKGT+ETWLVDLV SGN AILP CEA++V+H    +RN A GV F FQ  G K   
Sbjct  446   KDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDIC  505

Query  1021  VIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENK  860
             V++SKVT++A GAL+TP+LL  SGLKN NIG+NLHLHPV  AWG+FP T      P E K
Sbjct  506   VVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKK  565

Query  859   KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTA  680
              SYEG IM+AMST V N   +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RTA
Sbjct  566   TSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTA  625

Query  679   HIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLT  500
             HIFALARD+GSG   SP S++Y ++  DEENL++G+EK+LR+LAAAGAEEIG +H  G T
Sbjct  626   HIFALARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRMLAAAGAEEIGTHHCKGKT  685

Query  499   LKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVE  320
             + VK AS EEFERFVKEESS+ LR      +SAHQMGSCRMG+DPK SVVN  GETW+VE
Sbjct  686   INVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWDVE  745

Query  319   GLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             GL++ D SV PTALGVNPMVT+ +++YC +QSVL+ L+
Sbjct  746   GLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  783



>ref|XP_006385149.1| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|ERP62946.1| alcohol oxidase-related family protein [Populus trichocarpa]
Length=748

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/747 (58%), Positives = 546/747 (73%), Gaps = 33/747 (4%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDA------SVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             ME+L+A+C+T  P++  +      A      S++ F+Q+SA+  GTP +V  +   R++H
Sbjct  1     MESLTAICDTLFPSVYNSSMMAASADDGSTNSISTFYQSSASMAGTPQRVGELFCDRVQH  60

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             PK   + L L+ LST IGT +LCG  S+S  FP+ LRF +ISQ KRE+IV SWATS    
Sbjct  61    PKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFLRFSQISQSKREQIVFSWATSFFYL  120

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F ++K ++ LVFF+ VD+K +N +WKAIGY GPDP+  ++Q +          +E 
Sbjct  121   LRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQTCGLPETLYAKEH  180

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK-----------PPGPSFVIECDAvvv  1673
             LFGPLY+G++DLNLP + V + L ++G  V+  +              PS VI+CDAVVV
Sbjct  181   LFGPLYRGLVDLNLPRDRVADSLRQIGFPVSIRRGKDIDSSRDFSTSNPSLVIKCDAVVV  240

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV++GVLA AGYKVLVLEKGNY+AR NLSLLEGPSMD+M+LG G+L + D+ +V
Sbjct  241   GSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGPSMDQMYLGAGMLASDDMGVV  300

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAGSTVGGGS +NWSASIKTP +V+ EW E + LELF S +Y++A+D VC KMGVQ + 
Sbjct  301   VLAGSTVGGGSTINWSASIKTPQHVINEWSETYDLELFDSKLYKEALDAVCEKMGVQSDI  360

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
             ++E F + VLR+GC ELGYPV  IP+N+  DHYCGWC FGCKDGRKKGT ETWL D+V S
Sbjct  361   DEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCGWCCFGCKDGRKKGTCETWLKDMVNS  420

Query  1132  GNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
             GNGAILP CEA++V+HER K K      GV F F+ +G+K   V++SKVT++AGGAL+TP
Sbjct  421   GNGAILPGCEAIKVLHERKKGKDRSTASGVAFGFEHNGMKDLCVVESKVTIVAGGALSTP  480

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTP-------GENKKSYEGAIMSAMSTVVL  812
             +LL  SGLKN NIG++LHLHPV  AWG+FP+ P        E KKSYEG IM+AMSTVV 
Sbjct  481   ALLKASGLKNANIGKHLHLHPVTMAWGYFPEAPISTTAWPEEQKKSYEGGIMTAMSTVVA  540

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
             NVN +GYGAVIQTP+LHPG+FS L+PW SG + K RM R++RTAH+FALARD+GSG   S
Sbjct  541   NVNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMCRFSRTAHVFALARDRGSGTVNS  600

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK  452
             P+S+ Y +D  DE+NLQ GLEK LRILAAAGAEEIG +H TG +L VK  S  EFERFVK
Sbjct  601   PSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHSTGKSLNVKKVSYREFERFVK  660

Query  451   EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  272
             EES++ LR       SAHQMGSCRMGV+PK S VN  GE WEVEGLFV D SV PTALGV
Sbjct  661   EESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGV  720

Query  271   NPMVTIMSVSYCISQSVLEFL---KTH  200
             NPMVT+ +++YC +QSV++ L   +TH
Sbjct  721   NPMVTVQAIAYCTAQSVVQLLSRKRTH  747



>gb|AES95453.2| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=831

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/762 (57%), Positives = 553/762 (73%), Gaps = 35/762 (5%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINEALP-ETTDASVTNFFQTSAASTGTPHQV  2210
             + +  T   +LS  QM++L+ALC+T LP+IN+ +P    D S   F++ SA+  GTP ++
Sbjct  65    REKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERL  124

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
               +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++I+
Sbjct  125   GGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIM  184

Query  2029  HSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk----  1862
              SW+ S  + +R FF  +K L LL+FFT VD+  DN SWKAIGYCGPDP    + K    
Sbjct  185   QSWSLSFFRHLRMFFRTIKLLTLLIFFTQVDESEDNCSWKAIGYCGPDPEFKAQLKNHFL  244

Query  1861  -----kqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--------KP  1721
                  +++  +  D+  EL  GPLYKG++ LN P + + + L + G  V+         P
Sbjct  245   HGACKEKQDSEEGDNDAELAIGPLYKGLVHLNYPRDIIVDTLRRFGFPVSVSRRKQKTAP  304

Query  1720  KPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDK  1541
                 PS V++CDAVVVGSG GGGV++G+LA AGYKVLVLEKG Y AR NLSLLEGP+MD+
Sbjct  305   SLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLVLEKGGYSARNNLSLLEGPTMDQ  364

Query  1540  MFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQ  1361
             M+  GGL+ T D+++ +L+GSTVGGGSA+NWSA IKTP +V +EWCE HGLELF S++YQ
Sbjct  365   MYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKTPQHVCKEWCEKHGLELFESELYQ  424

Query  1360  KAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG  1181
             +AM+ VC KMGVQ E E+E F N +LRKGC+E+GYPV NIP+NA  DHYCGWC  GCKDG
Sbjct  425   EAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVNNIPRNASPDHYCGWCCLGCKDG  484

Query  1180  RKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTAV  1019
             +KKGT+ETWLVDLVKSGNGAILP C A++V+H++ K      A+GV F F+  G K   V
Sbjct  485   KKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKKKKGSGEKTARGVAFEFEYRGSKDICV  544

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--------  863
             ++SKVT++A G L TPSLL  SGLKN NIGRNLHLHPVV AWG+FPDTP E         
Sbjct  545   VESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLHLHPVVMAWGYFPDTPVEPTGASEVWP  604

Query  862   ---KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRY  692
                KKSYEG IM+AMS VV     +GYGAVIQTPALHPG FS +MPW SG + K RM ++
Sbjct  605   ETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTPALHPGTFSIVMPWVSGSDIKDRMRKF  664

Query  691   ARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG  512
             +RTAHIFALARD+GSG   SP+ ++Y+++  DEENLQ+G++K+LRILAAAGAEEIG +H 
Sbjct  665   SRTAHIFALARDQGSGNVHSPSRISYEMEDVDEENLQKGIDKVLRILAAAGAEEIGTHHN  724

Query  511   TGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGET  332
              G TL VK+AS  EFE+FVK+ESS+SL        SAHQMGSCRMG +PK SVV   GET
Sbjct  725   KGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSAHQMGSCRMGSNPKESVVKETGET  784

Query  331   WEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             WEVE LFV D SV PTALG+NPM+T+ S++YC +QSVL+ LK
Sbjct  785   WEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVLQVLK  826



>ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gb|AET03490.1| long-chain-alcohol oxidase FAO1-like protein [Medicago truncatula]
Length=810

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/749 (57%), Positives = 554/749 (74%), Gaps = 31/749 (4%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEA-LPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             +LSP+QM++L ALC+T LP+I +  +  ++D  + NF++TSA+  GTP  VA ++++++K
Sbjct  59    SLSPTQMKSLVALCDTMLPSIKDNNVAASSDEFLNNFYRTSASMAGTPELVANLVSEKLK  118

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
             HP    L L LW LST  GTL+LCG  S+ST+FPF   +P++S +KR++++ SW+ S L+
Sbjct  119   HPSTWLLKLTLWLLSTWFGTLILCGIASISTKFPFFHSYPKLSPEKRQKVMLSWSVSYLR  178

Query  2002  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd---  1832
              +R  F  +K L LLVFFT VD++ +NPSWKAIGY GPD     ++K +  H    +   
Sbjct  179   PLRMLFRTIKLLTLLVFFTQVDEEKNNPSWKAIGYSGPDQEFKAQRKNKILHKTSKEGRQ  238

Query  1831  -------ieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVI  1694
                     +E + GPLY+G+++LN P + + + L + G  V+   P         PS VI
Sbjct  239   EKEDCDHDDEEVIGPLYEGLVNLNYPRDIISDSLRRFGFPVSVTPPTNKASTISSPSLVI  298

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CDAVVVGSG GGGV++GVLA +GYKVLVLEKG+Y+AR NLSLLEGP++D+M+L  GL+ 
Sbjct  299   QCDAVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNLSLLEGPTLDQMYLANGLIA  358

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T D+ +++LAGSTVGGGSA+NWSASIKTP +V +EWC+ H LELF S++Y++AMD VC K
Sbjct  359   TDDMSVLVLAGSTVGGGSAINWSASIKTPSHVCKEWCDRHELELFESELYKEAMDAVCEK  418

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ E E+E F N +LRKGC+E+GYPV NIP+NAP DHYCGWC  GCKDG+KKGT+ETW
Sbjct  419   MGVQSEFEEEGFNNAILRKGCQEMGYPVSNIPRNAPPDHYCGWCCLGCKDGKKKGTSETW  478

Query  1153  LVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVDLVKSGNGAILP CEA+QV++      +R  AKGV F    +G K   V++SKVT++A
Sbjct  479   LVDLVKSGNGAILPNCEAIQVLYREKKGTDRKIAKGVAFEIDYNGKKDICVVESKVTIVA  538

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-------NKKSYEGAIMS  833
              GAL TPSLL  SGLKN+NIGRNLHLHPV  AWG+FPD P         +KKSYEG IM+
Sbjct  539   CGALCTPSLLKRSGLKNENIGRNLHLHPVTMAWGYFPDAPSSPELWPEGHKKSYEGGIMT  598

Query  832   AMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             AMSTVV + N TGYGAVIQTP+LHPGLFS LMPW+SG + K RM +++RTAH+FALARD+
Sbjct  599   AMSTVVADFNATGYGAVIQTPSLHPGLFSVLMPWSSGMDIKDRMRKFSRTAHVFALARDQ  658

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSG   SPT ++Y +   D+ENL +G+EK+LRILAAAGAEEIG ++  G +L VK+ S  
Sbjct  659   GSGTVDSPTRISYQMKNVDKENLHKGIEKVLRILAAAGAEEIGTHNNKGRSLNVKEVSYH  718

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             EFE+FVKEESS  L        SAHQMGSCRMG +PK SVVN  GETWEVEGL++ D SV
Sbjct  719   EFEKFVKEESSMPLTDLSTPVCSAHQMGSCRMGTNPKESVVNQTGETWEVEGLYLADTSV  778

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              PTALGVNPMVT+ +++YC +Q VLE LK
Sbjct  779   FPTALGVNPMVTVQAIAYCTAQHVLEVLK  807



>ref|XP_010054021.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Eucalyptus grandis]
Length=814

 Score =   837 bits (2163),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/761 (58%), Positives = 556/761 (73%), Gaps = 43/761 (6%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAI-NEALPETTDA--------SVTNFFQTSAASTGTPHQVA  2207
             +LSP QM+TL+ALC+TFLP+I +   P  TD+         V  F++TSA+  GTP ++ 
Sbjct  48    SLSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLG  107

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE IV 
Sbjct  108   GLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVR  167

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP------------  1883
              W+ S    +R F   +K L  LVFFT VD+K  N SWKAIGY GPDP            
Sbjct  168   RWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLKRTS  227

Query  1882  ---SISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-----  1727
                S  E+Q K++        +E  FGPL++G+I +  P + V   L + G  V      
Sbjct  228   CQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRDIVTKSLRQFGFPVLICPSN  287

Query  1726  --KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGP  1553
                 KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVLVLEKG+Y AR+NLSLLEGP
Sbjct  288   HNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNLSLLEGP  347

Query  1552  SMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGS  1373
             +MD+M+L GG++ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF S
Sbjct  348   TMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFDS  407

Query  1372  DVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFG  1193
              +Y++A+D VC +MGVQ    +E F N VLRKGC+ELGYPV NIP+N+P+DHYCGWC  G
Sbjct  408   KLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWCCLG  467

Query  1192  CKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHER------NKAKGVMFTFQRDGVK  1031
             CKDG+KKGTAETWLVDLV+SGNGAILP CEA++V+H R      + A GV F F+ +GVK
Sbjct  468   CKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHSRQSRRGRDTATGVTFEFEHNGVK  527

Query  1030  QTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PG  869
             +  +I+SKVT++A GAL+TP+LL  SGLKN NIG+NLHLHPV  AWG+FPDT      P 
Sbjct  528   EVCIIESKVTIVACGALSTPALLKRSGLKNPNIGKNLHLHPVTMAWGYFPDTEMADLWPE  587

Query  868   ENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYA  689
             + KKSYEG IM+AMSTVV N N +GYGAVIQTPALHPG+FSALMPW SG + K RM++++
Sbjct  588   KEKKSYEGGIMTAMSTVVGNFNKSGYGAVIQTPALHPGMFSALMPWTSGLDMKERMTKFS  647

Query  688   RTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGT  509
             RTAH+F LARDKGSG   S TS++Y +D  DE+NLQ+GLEK+LRILAAAGAEEIG +HG 
Sbjct  648   RTAHLFTLARDKGSGTITSSTSISYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGE  707

Query  508   GLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETW  329
             G TLKVK  S  EFE+FVKEES++S++       SAHQMGSCRMG DP++S VNP GETW
Sbjct  708   GKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETW  767

Query  328   EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             EVEGL+V D SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  768   EVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  808



>ref|XP_006430998.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
 gb|ESR44238.1| hypothetical protein CICLE_v10011111mg [Citrus clementina]
Length=780

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/757 (57%), Positives = 554/757 (73%), Gaps = 32/757 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             EN+    +LS  +ME+LSALC+TFLPA++       D  + +FF+ SA++ GTP ++  +
Sbjct  19    ENHCYVNSLSSQEMESLSALCDTFLPAVDVKQAAAIDTDIADFFRASASAAGTPERLGGL  78

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             +++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ Q KRE ++ SW
Sbjct  79    MSERLKHPKKWLVRLCLWLLSTCIGSLILCGRYCFSSKFPYMHSFTQLPQNKREAVLVSW  138

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             + S    +R  + AMK L+ LVFFT V++K +N SWKAIGY GPDP    K  ++K   +
Sbjct  139   SLSYFYHLRMLYKAMKLLIFLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLRN  198

Query  1840  eddieEL--------------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKP  1715
             E   ++               L+GPLYKG+I++ LP   V + L ++G  V+    +   
Sbjct  199   EGLNDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRNAA  258

Query  1714  P----GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSM  1547
             P     PS VI+CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG+Y AR+NLSLLEG +M
Sbjct  259   PISIASPSLVIKCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGKTM  318

Query  1546  DKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDV  1367
             D+M+L GG+L T D+ ++LLAGSTVGGGS +NWSASIKTP +V  EWC+ + L+LF SD+
Sbjct  319   DQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFESDL  378

Query  1366  YQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCK  1187
             Y++AM+ VC ++GVQ E EDE F N VLR+GC+ELGYPV NIP+N+P DHYCGWC  GCK
Sbjct  379   YKEAMEVVCERIGVQSEVEDEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLGCK  438

Query  1186  DGRKKGTAETWLVDLVKSGNGAILPECEALQVIH----ERNKAKGVMFTFQRDGVKQTAV  1019
             DG KKGT+ETWLVDLV SGN AILP CEA++V+H    +RN A GV F FQ  G K   V
Sbjct  439   DGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDICV  498

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKK  857
             ++SKVT++A GAL+TP+LL  SGLKN NIG+NLHLHPV  AWG+FP T      P E K 
Sbjct  499   VESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEKKT  558

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG IM+AMST V N   +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RTAH
Sbjct  559   SYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRTAH  618

Query  676   IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL  497
             IF LARD+GSG   SP S++Y ++  DEENL++G+EK+LRILAAAGAEEIG +H  G T+
Sbjct  619   IFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGKTI  678

Query  496   KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
              VK AS EEFERFVKEESS+ LR      +SAHQMGSCRMG+DPK SVVN  GETW VEG
Sbjct  679   NVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGVEG  738

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             L++ D SV PTALGVNPMVT+ +++YC +QSVL+ L+
Sbjct  739   LYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  775



>ref|XP_007210564.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
 gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
Length=808

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/758 (58%), Positives = 555/758 (73%), Gaps = 34/758 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             E      +LS  +ME+L+ALC+TFLP+I+ +   TT+AS+  F++TSA+  GTP +V  +
Sbjct  44    ERQLYPNSLSSREMESLTALCDTFLPSIDVS-DTTTNASLVAFYRTSASMAGTPQRVGGL  102

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             I++RMKHPKL  + L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE I+ SW
Sbjct  103   ISERMKHPKLWLMRLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSW  162

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             + S    +R  F +MK L LLVFFT V++K +N SWKAI Y GPDP    K KK K    
Sbjct  163   SLSYFYLLRMLFKSMKLLTLLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKFKASTT  222

Query  1840  eddi------------eELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK-----  1718
                             +E LFGPL +GII+L+ P++ V + L+  G   SV   +     
Sbjct  223   IGSQRPNNEEQNACPHKEELFGPLNRGIINLDKPKDLVVDALSTFGIPASVLHSEKTVNC  282

Query  1717  PPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  1538
                PS  I CDAVV+GSG GGGV++GVLATAGYKV+V+EKGNY+AR NL+LLEGP+MD+M
Sbjct  283   SSNPSLTIRCDAVVIGSGSGGGVVAGVLATAGYKVVVIEKGNYHARKNLTLLEGPAMDQM  342

Query  1537  FLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQK  1358
             +L GGL+ T D+ + +LAGSTVGGGSA+NWSASI+TP +V++EWC  H LELF S +YQ+
Sbjct  343   YLSGGLIATDDMGVFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQE  402

Query  1357  AMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGR  1178
             A+D VC KMGVQ + ++E F N +LRKGC+ELGYPV NIP+N+P +HYCGWC FGCKDGR
Sbjct  403   ALDVVCEKMGVQSQIQEEGFNNAILRKGCQELGYPVNNIPRNSPPNHYCGWCCFGCKDGR  462

Query  1177  KKGTAETWLVDLVKSGNGAILPECEALQVIH-------ERNKAKGVMFTFQRDGVKQTAV  1019
             K GT ETWLVDLV SGNGAIL  CEA++V+H       +RN A GV F F+  G K+   
Sbjct  463   KGGTTETWLVDLVNSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFEFEHGGGKEIGF  522

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKK  857
             ++SKVT++A GAL TP LL  SGLKN NIG NLHLHPV  AWG+FPD+      P   KK
Sbjct  523   VESKVTIVACGALCTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGRPEREKK  582

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG IM+AMSTVV   N +GYGAVIQTPALHPG+FS +MPW SG++ K RMSR++RTAH
Sbjct  583   SYEGGIMTAMSTVVAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAH  642

Query  676   IFALARDKGSGEAFS-PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLT  500
             +FALARDKGSG   + P S++Y+++  DE NL+ GLEK LRILAAAGAE+IG +H  G  
Sbjct  643   VFALARDKGSGTVNAPPYSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKG  702

Query  499   LKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVE  320
             L VK ++ +EFERFVKEESS+ LR+  +   SAHQMGSCRMGVD K SV+N  GETWEVE
Sbjct  703   LHVKKSNLDEFERFVKEESSRPLRELSSAICSAHQMGSCRMGVDSKQSVLNQMGETWEVE  762

Query  319   GLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             GLFV D SV PTALGVNPMVT+ +++YC SQS+L+ L+
Sbjct  763   GLFVADTSVFPTALGVNPMVTVQAIAYCTSQSILQVLR  800



>ref|XP_003547818.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
 gb|KHN35528.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=828

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/760 (57%), Positives = 550/760 (72%), Gaps = 33/760 (4%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINE----ALPETTDASVTNFFQTSAASTGTP  2219
             K +    T +LSP QM++L ALC+T LP+IN           D SV NF++TSA+  GTP
Sbjct  65    KEQKKPLTNSLSPRQMKSLVALCDTLLPSINNNSNNVCGSDDDESVANFYKTSASMAGTP  124

Query  2218  HQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  2039
               +  +I+++++HP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  K++
Sbjct  125   EHLGILISEKLRHPSTWLLLLSLWLLSTWFGTFILCGMLSLSTKFPFFHSYPELSLLKQQ  184

Query  2038  RIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk  1859
             +++ SW+ S L+ +R  F  +K L LLVFFT +D+  DNPSWKAI YCGPDP    + K 
Sbjct  185   KVMQSWSLSYLRPLRMLFRTIKLLTLLVFFTQLDEAEDNPSWKAINYCGPDPEFKSQLKN  244

Query  1858  qkhhdheddieEL----------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP-  1715
                       E+           + GPLYKG+I +N P + + + L ++G SV A PK  
Sbjct  245   HFFTKERGQEEKEDEDYDDGTEDVRGPLYKGLIYINYPRDIITDSLRRVGFSVSATPKKT  304

Query  1714  -----PGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
                    PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPS
Sbjct  305   KASSLSSPSLVIQCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPS  364

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             MD+M+L  GL+ TKD+ +++LAGSTVGGGSA+NWSASI+TP +V +EWC+ H LELF S 
Sbjct  365   MDQMYLSNGLVATKDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDGHELELFESK  424

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
             +Y++A+D VC KMGVQ E +DE F N VLR+GC E+GYPV +IP+NA SDHYCGWC  GC
Sbjct  425   LYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCLEMGYPVCDIPRNASSDHYCGWCCMGC  484

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQ  1028
             KDGRKKGT ETWLVDLVKSGNGAI+P CEA+QV+H++ K      A+GV F  +  G + 
Sbjct  485   KDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRDRKIARGVAFAIEYKGKRD  544

Query  1027  TAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGE  866
               V++SKVTV+A GAL+TP+LL  SGLKN+NIGRNLHLHPV  AWG+FPD+      P +
Sbjct  545   ICVVESKVTVVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSLSPELWPEK  604

Query  865   NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYAR  686
             +KKSYEG IM+AMSTVV   + +GYGAVIQTPALHPG+FS LMPW SG++ K RM +++R
Sbjct  605   HKKSYEGGIMTAMSTVVAQFDKSGYGAVIQTPALHPGMFSILMPWTSGKDIKDRMRKFSR  664

Query  685   TAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG  506
             TAH+FALARD+GSG   SP+ ++Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G
Sbjct  665   TAHVFALARDQGSGTVNSPSHISYQLKDVDKENLKIGLEKVLRILAAAGAEEIGTHNNKG  724

Query  505   LTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE  326
              ++ VK  S  EFE+FVKEESS SL        SAHQMGSC+MG +P+ SVVN  GETWE
Sbjct  725   RSINVKQVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWE  784

Query  325   VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             VEGL++ D SV PTALGVNPMVT+ ++SYC +Q VLE L+
Sbjct  785   VEGLYLADTSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  824



>ref|XP_007156339.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
 gb|ESW28333.1| hypothetical protein PHAVU_003G278200g [Phaseolus vulgaris]
Length=814

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/759 (57%), Positives = 555/759 (73%), Gaps = 31/759 (4%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI-NEALPETTDASVTNFFQTSAASTGTPHQ  2213
             R       T +LSP QM++L ALC+T +P+I N  +  + D SV NF++TSA+  GTP  
Sbjct  52    RDKHQKPLTNSLSPRQMKSLVALCDTIIPSIDNNVVRSSDDESVANFYKTSASMAGTPQH  111

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             +  +I++++KHP    LLL LW LST  GTL+LCG  S+S++FPF   +PE+S  KR+R+
Sbjct  112   LGKLISEKVKHPSTWLLLLTLWLLSTWFGTLILCGMASVSSRFPFFHSYPEMSLLKRQRV  171

Query  2032  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI--------  1877
             + SW+ S L+ +R FF  +K L LL FFT VD+  +NPSWKAIGYCGPDP          
Sbjct  172   MQSWSLSYLRPLRMFFRTIKLLTLLTFFTQVDEAEENPSWKAIGYCGPDPEFKAQLKNNF  231

Query  1876  ---SekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-------  1727
                + K+++ +  D +DD EE   GPL+KG++ LN P + + N L + G SV+       
Sbjct  232   LHRTSKEEQHQKKDDDDDEEEEFRGPLHKGLVHLNYPRDMIKNSLRRFGFSVSTISKKHE  291

Query  1726  KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSM  1547
                   PS VI+CDAVVVGSG GGGV +GVLA AGYKVLVLEKG+Y AR NLSLLEGPSM
Sbjct  292   ASNLSSPSLVIQCDAVVVGSGSGGGVAAGVLANAGYKVLVLEKGSYCARNNLSLLEGPSM  351

Query  1546  DKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDV  1367
             D+M+L  GL+ TKD+ +++LAGSTVGGGSAVNWSASIKTP +V +EWC++H LELF S +
Sbjct  352   DQMYLSNGLVATKDMSVLILAGSTVGGGSAVNWSASIKTPQHVCKEWCDLHELELFESKL  411

Query  1366  YQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCK  1187
             Y++AMD VCGKMGVQ E E+E F N VLR+GC E+GY V NIP+NA SDHYCGWC  GCK
Sbjct  412   YREAMDAVCGKMGVQSEVEEEGFNNEVLRRGCLEMGYHVCNIPRNASSDHYCGWCCMGCK  471

Query  1186  DGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQT  1025
             DG KK T+ETWLVDLVKSGNGAI+P CEA+QV+H++ K      A+GV F  +  G K  
Sbjct  472   DGNKKSTSETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGSEKKTARGVAFAIEYKGKKDI  531

Query  1024  AVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGEN  863
              V++SKVT++A GAL+TP+LL  SGLKN+NIG+NLHLHPV  AWG+FPD+      P ++
Sbjct  532   CVVESKVTIVACGALSTPALLKKSGLKNENIGKNLHLHPVAMAWGYFPDSSSPKMWPEKH  591

Query  862   KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYART  683
             KKSYEG IM+AMSTVV   + TGYGAVIQTP+LHPG+FS LMPW SG++ K RM +++RT
Sbjct  592   KKSYEGGIMTAMSTVVAQFDKTGYGAVIQTPSLHPGMFSILMPWTSGKDMKDRMHKFSRT  651

Query  682   AHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             AH+FALARD+GSG   SP+ ++Y+L   D+ENL+ G+EK+LRILAAAGAEEIG ++  G 
Sbjct  652   AHVFALARDQGSGTVNSPSLISYELKDVDKENLETGIEKVLRILAAAGAEEIGTHNNKGR  711

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
             ++ VK  S  EFE+FVKEESS SL        SAHQMGSC+MG +P  SVVN  GETWEV
Sbjct  712   SINVKQVSYHEFEKFVKEESSMSLTDLTTPLCSAHQMGSCKMGTNPSDSVVNQMGETWEV  771

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             EGL++ D SV PTALGVNPMVT+ +++YC +Q V E L+
Sbjct  772   EGLYLADTSVFPTALGVNPMVTVQAIAYCTAQYVAEVLR  810



>ref|XP_003547733.2| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=825

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/754 (58%), Positives = 555/754 (74%), Gaps = 27/754 (4%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINE--ALPETTDASVTNFFQTSAASTGTPHQ  2213
             K +    T +LSP QM++L ALC+T LP+IN    +  + D SV NF++TSA+  GTP  
Sbjct  68    KEQRKPLTNSLSPRQMKSLVALCDTLLPSINNNNVVWGSDDESVANFYKTSASMAGTPEH  127

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             +  +I++++KHP    LLL LW LST  GT +LCG  SLST+FPF   +PE+S  KR+++
Sbjct  128   LGILISEKLKHPSTWLLLLTLWLLSTWFGTFILCGTLSLSTKFPFFHSYPELSLLKRQKV  187

Query  2032  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek-----  1868
             + SW+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIGYCGPDP    +     
Sbjct  188   MQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHF  247

Query  1867  -qkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------P  1712
               K++   + EDD  E + GPLYKG+I +N P + + + L ++G SV A PK        
Sbjct  248   FTKQRGQEEKEDDGTEDVRGPLYKGLIRINNPRDIITDSLRRVGFSVSATPKKTKASTLS  307

Query  1711  GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  1532
              PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L
Sbjct  308   SPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYL  367

Query  1531  GGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAM  1352
               GL+ T D+ +++LAGSTVGGGSA+NWSASI+TP +V +EWC+ H LELF S +Y++A+
Sbjct  368   SNGLVATNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRHELELFESMLYKEAL  427

Query  1351  DTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKK  1172
             D VC KMGVQ E +DE F N VLR+GC E+GYPV NIP+NA SDHYCGWC  GCKDGRKK
Sbjct  428   DVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHYCGWCCLGCKDGRKK  487

Query  1171  GTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTAVIKS  1010
             GT ETWLVDLVKSGNGAI+P CEA+QV+H++ K      A+GV F  +  G K   V++S
Sbjct  488   GTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRHRKIARGVAFAIEYKGKKDICVVES  547

Query  1009  KVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG------ENKKSYE  848
             KVT++A GAL+TP+LL  SGLKN+NIGRNLHLHPV  AWG+FPD+P       ++KKSYE
Sbjct  548   KVTIVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSPSPELWPEKHKKSYE  607

Query  847   GAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFA  668
             G IM+AMSTVV   + +GYG VIQTPALHPG+FS LMPW SG + K RM +++RTAH+FA
Sbjct  608   GGIMTAMSTVVAQFDKSGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTAHVFA  667

Query  667   LARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK  488
             LARD+GSG   SP+ ++Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G  + VK
Sbjct  668   LARDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVK  727

Query  487   DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
               S  EFE+FVKEESS SL        SAHQMGSC+MG +P+ SVVN  GETWEVEGL++
Sbjct  728   QVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYL  787

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              D SV PTALGVNPMVT+ ++SYC +Q VLE L+
Sbjct  788   ADSSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  821



>ref|XP_011078909.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Sesamum indicum]
Length=755

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/739 (58%), Positives = 548/739 (74%), Gaps = 23/739 (3%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S  QME LSALC+T LP+++    +   +    F+QTSA+ T TPH VA ++  +++HP
Sbjct  13    FSCGQMEALSALCDTLLPSVD-VDGQLHPSFHRQFYQTSASMTATPHHVAELLGGKIEHP  71

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
             K+    L +  LSTRIGT +LCG+ SL  +FP+   F E+  ++RE+I+ SW+TS+   +
Sbjct  72    KIYLGRLAVGLLSTRIGTFVLCGRKSLCPKFPYFQTFSEVPYEEREQILRSWSTSNFLLL  131

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh------hdhed  1835
             R  FTA+K   LL+FFT V++KG+N SWKAIGYCGPDP  ++ +  +           + 
Sbjct  132   RILFTALKFFTLLLFFTQVNEKGENLSWKAIGYCGPDPGCAKTRILKTSGPQECEEKEDG  191

Query  1834  dieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECDAvv  1676
               ++ LFGPLYKGII+L+   E   ++L  LG  V+ P           PSF+++CDAVV
Sbjct  192   ASQDELFGPLYKGIINLDQSREEALHKLQSLGFPVSTPHSRNRRLMSLNPSFIVKCDAVV  251

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSG GGGV++GVLA AG+KVLVLEKG+Y+ARTNLSLLEG +MD+M+LG G+L+T +LD+
Sbjct  252   VGSGSGGGVVAGVLANAGHKVLVLEKGSYFARTNLSLLEGEAMDQMYLGNGMLVTDNLDV  311

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             +++AGSTVGGGS +NWSASI+TP +V+REW E H LELFGS+VYQ+A+D VC KMGVQ E
Sbjct  312   LIVAGSTVGGGSTINWSASIRTPSHVMREWSEKHELELFGSEVYQQALDVVCQKMGVQSE  371

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
              E E F NM+LRKGC  LGYPV  +P NAPSDHYCGWC FGCKDGRKKGT+ETWLVDLV+
Sbjct  372   VEHEGFNNMILRKGCENLGYPVETVPCNAPSDHYCGWCCFGCKDGRKKGTSETWLVDLVE  431

Query  1135  SGNGAILPECEALQVIHE----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
             SGNGAILP CEA++VI +    + +A GV F F     ++  +++S VTV+A GA+ TP+
Sbjct  432   SGNGAILPTCEAIKVITDDINGKKRAIGVAFAFDTPFGREIGIVESDVTVVASGAICTPA  491

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVN  803
             LL  SGLKN N+G+N H+HPVV AWG+FPD      P   K+SYEG I++AMS VV N  
Sbjct  492   LLKRSGLKNPNVGKNFHIHPVVMAWGYFPDPSPDAWPAPEKRSYEGGIITAMSKVVANFE  551

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
              +GYGA+IQTP+LHPG+FS LMPW SG + K RM +++RTAH+FALARDKGSG   S T 
Sbjct  552   TSGYGAIIQTPSLHPGIFSLLMPWISGIDMKNRMVKFSRTAHVFALARDKGSGVITSETD  611

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES  443
             ++Y L+  D+ENL +GLEK +RILAAAGAEEIG +H TG  LKVK AS +EFERFVKEES
Sbjct  612   ISYKLEDFDQENLSKGLEKCMRILAAAGAEEIGTHHSTGRVLKVKQASEKEFERFVKEES  671

Query  442   SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
              + L+K     ASAHQMGSCRMGVDPK SVVNPKGETWEVEGLFV D SV PTALGVNPM
Sbjct  672   LRPLQKLSAPIASAHQMGSCRMGVDPKGSVVNPKGETWEVEGLFVADSSVFPTALGVNPM  731

Query  262   VTIMSVSYCISQSVLEFLK  206
             VT+ + +YCI+QSVL+ L+
Sbjct  732   VTVQATAYCIAQSVLQILE  750



>ref|XP_011028488.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Populus euphratica]
Length=806

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/766 (56%), Positives = 549/766 (72%), Gaps = 46/766 (6%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPA------INEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             +LS  +ME+L+ALC+T  P+      I  +  + +  S++ F+Q+SA+  GTP +V  + 
Sbjct  40    SLSSREMESLTALCDTLFPSVYNSSMIAASADDGSTNSISTFYQSSASMAGTPQRVGELF  99

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R++HPK   + L L+ LST IGT +LCG  S+S  FP+  RF +ISQ KRE+IV SWA
Sbjct  100   CERVQHPKKWLIRLTLYLLSTWIGTFILCGLPSISPSFPYFQRFSQISQSKREQIVFSWA  159

Query  2017  TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe  1838
             TS    +R  F ++K ++ LVFF+ VD+K +N +WKAIGY GPDP+  ++Q +       
Sbjct  160   TSFFYLLRMLFKSIKLVIPLVFFSQVDEKNENLTWKAIGYPGPDPAALKRQTQTCGQPET  219

Query  1837  ddie-------------ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK-------  1718
                              E LFGPLY+G++DLNLP + V + L ++G  V+  +       
Sbjct  220   LYASLKDDDDDEHDCKEEHLFGPLYRGLVDLNLPRDRVADSLRQIGFPVSILRGKNIDSS  279

Query  1717  ----PPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
                    PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNY+AR NLSLLEGPS
Sbjct  280   RDFSTSNPSLVIKCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARNNLSLLEGPS  339

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             MD+M+LGGG+L + D+ +V+LAGSTVGGGS +NWSASIKTP +V+ EW E + LELF S 
Sbjct  340   MDQMYLGGGMLASDDMGVVILAGSTVGGGSTINWSASIKTPQHVINEWSESYDLELFDSK  399

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
             +Y++A+D VC KMGVQ + ++E F + VLR+GC ELGYPV  IP+N+  DHYCGWC FGC
Sbjct  400   LYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGYPVNTIPRNSVPDHYCGWCCFGC  459

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQ  1028
             +DGRKK T ETWL D+V SGNGAILP C+A++V+HER K K      GV F F+ +G+K 
Sbjct  460   RDGRKKDTCETWLKDMVNSGNGAILPGCKAIKVLHERKKGKDRSTASGVAFGFEYNGMKD  519

Query  1027  TAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG-------  869
               V++SKVTV+AGGAL+TP+LL  SGLKN NIG++LHLHPV  AWG+FP+ P        
Sbjct  520   LCVVESKVTVVAGGALSTPALLKASGLKNANIGKHLHLHPVTMAWGYFPEAPNSTAAWPE  579

Query  868   ENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYA  689
             E KKSYEG IM+AMSTVV NVN +GYGAVIQTP+LHPG+FS L+PW SG + K RM R++
Sbjct  580   EQKKSYEGGIMTAMSTVVANVNKSGYGAVIQTPSLHPGMFSGLIPWISGADMKRRMFRFS  639

Query  688   RTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGT  509
             RTAH+FALARD+GSG   SP+S+ Y +D  DE+NLQ GLEK LRILAAAGAEEIG +H T
Sbjct  640   RTAHVFALARDRGSGTVNSPSSINYRMDAEDEKNLQEGLEKTLRILAAAGAEEIGTHHST  699

Query  508   GLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETW  329
             G  L VK  S  EFERFVKEES++ LR       SAHQMGSCRMGV+PK S VN  GE W
Sbjct  700   GKILNVKKVSYREFERFVKEESARPLRDLTGQICSAHQMGSCRMGVNPKESAVNQMGEAW  759

Query  328   EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL---KTH  200
             EVEGLFV D SV PTALGVNPMVT+ +++YC +QSV++ L   +TH
Sbjct  760   EVEGLFVADTSVFPTALGVNPMVTVQAIAYCTAQSVVQLLSRKRTH  805



>ref|XP_010275157.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Nelumbo nucifera]
Length=807

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/749 (57%), Positives = 541/749 (72%), Gaps = 28/749 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-----DASVTNFFQTSAASTGTPH  2216
             E      +LSP QME L+A  +T LP++    P+       + S+  F++TSA+  GTP 
Sbjct  52    ERKPYVNSLSPRQMEVLTAFSDTLLPSV---FPDINCSGQLEDSLFKFYRTSASMAGTPE  108

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
              V   ++ +++HP L  LLL LW LST  GT +LCG  SLSTQFP+  RF ++SQKKRE+
Sbjct  109   LVGGFLSGKIEHPMLGVLLLALWLLSTWFGTFILCGIPSLSTQFPYFQRFSQVSQKKREK  168

Query  2035  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             I+ SW++SS    R  F  +K LV  +FFT VD+  +NP+W+ I YCGPDP     + ++
Sbjct  169   ILLSWSSSSFNIYRMLFKTLKYLVFFIFFTQVDENNENPTWRGIDYCGPDPDFINNRTRE  228

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-------KPKPPGPSFV  1697
                    + EEL F PLY+GI+++  P E +   L + G  V         P P  PS  
Sbjct  229   TKTPQGHEHEEL-FEPLYRGIVNMRQPREALAETLRQSGFHVRLHPHRRYNPSPSHPSLT  287

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I CDAVVVGSG GGGV +G+LA AGYKV VLEKGNY+ R NLSLLEGPSMD+M+L GGL+
Sbjct  288   IRCDAVVVGSGSGGGVAAGILAKAGYKVAVLEKGNYFGRKNLSLLEGPSMDEMYLSGGLM  347

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
             +T D+ +++LAGSTVGGGS +NWSASI+TP +V+REWC  + LELFGS +Y++AMD VC 
Sbjct  348   VTDDMGVIMLAGSTVGGGSTINWSASIRTPQHVIREWCNEYELELFGSKLYKEAMDVVCK  407

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             +MGVQ + E+ES  N VLRKGC ELGYPV+  P+N+P +HYCGWC FGCKDGRKKGT+ET
Sbjct  408   RMGVQPDVEEESLSNTVLRKGCSELGYPVITAPRNSPPNHYCGWCCFGCKDGRKKGTSET  467

Query  1156  WLVDLVKSGNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             WLVDLV SGNG ILP CEAL+++HE      RN A GV+F F     K   V++SKVT++
Sbjct  468   WLVDLVDSGNGVILPGCEALKILHERKKGRKRNTATGVVFEFNNGWGKDFCVLESKVTIV  527

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE------NKKSYEGAIMS  833
             AGGAL TP+LL  SGL+N NIG+NLHLHPVV AWGHFP  P +      +KKSY+G I++
Sbjct  528   AGGALCTPTLLKRSGLRNSNIGKNLHLHPVVMAWGHFPSRPADSGWPEKDKKSYKGGIIT  587

Query  832   AMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             AMSTVV N  G+GYGAVIQTP LHPG+FS + PW S  + + RMS+++RTA+IFALARDK
Sbjct  588   AMSTVVANSEGSGYGAVIQTPMLHPGMFSVITPWISSVDMRERMSKFSRTAYIFALARDK  647

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSG+  SP+S++Y +D  DEE+L++GLEK+LRILAAAGAEEIG +H  G  + VK  S  
Sbjct  648   GSGQVNSPSSISYRMDAMDEEHLKQGLEKILRILAAAGAEEIGTSHCLGRKVNVKKVSSN  707

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             EFERFVK+ES ++LR       SAHQMGSCRMGVDPK+SVVN +GETWEVEGLF+ D SV
Sbjct  708   EFERFVKKESRRALRDLRTPIPSAHQMGSCRMGVDPKSSVVNHRGETWEVEGLFLADSSV  767

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              PTALGVNPMVTI S++YC +QSVLE L+
Sbjct  768   FPTALGVNPMVTIQSIAYCTAQSVLEVLR  796



>ref|XP_007158083.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
 gb|ESW30077.1| hypothetical protein PHAVU_002G122600g [Phaseolus vulgaris]
Length=807

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/748 (57%), Positives = 546/748 (73%), Gaps = 29/748 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T +LS  QM++LSALC+T LP+++   P ++D SV  F++ SA+  GTP     +I +++
Sbjct  57    TNSLSSRQMKSLSALCDTILPSLDH-FPHSSDESVNRFYRISASMAGTPQLFGGMICEKL  115

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             KHP    L L+LW LST  GTL+LCG G +ST+FPF+  +P++S +KR++I+ SW+ S +
Sbjct  116   KHPMTGLLKLVLWALSTWFGTLILCGMGCVSTKFPFIHSYPDLSVEKRQQIMRSWSLSYI  175

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek--------qkkqkh  1850
             + +R  F  +K L LL+FFT +D+  DN SWKAIGYCGPDP    +        + K+  
Sbjct  176   RHLRQLFRTIKLLTLLIFFTQLDESEDNLSWKAIGYCGPDPEFKAQLKNHFLEGKSKRGE  235

Query  1849  hdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPPGPSFVI  1694
              D ED+  E + GPLYKG++ LN P +   + L ++G  V        A      PS VI
Sbjct  236   EDKEDEDVEEVIGPLYKGLVHLNNPRDITADALRRIGFPVSVIRRKHKAAANLSSPSLVI  295

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y+AR NLSLLEG +MD+M+L GGL+ 
Sbjct  296   QCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYFARNNLSLLEGQTMDQMYLNGGLVA  355

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             + D+ M +L+GSTVGGGSA+NWSASIKTP +V +EWCE HGLELFGS++Y++A+D VC K
Sbjct  356   SDDMGMFILSGSTVGGGSAINWSASIKTPQHVRKEWCEKHGLELFGSELYREALDAVCEK  415

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ E  DE F N VLRKGC+E+GYPV  IP+N+ SDHYCGWC  GCKDG+KKGT ETW
Sbjct  416   MGVQSEIGDEGFNNAVLRKGCQEMGYPVNTIPRNSSSDHYCGWCCLGCKDGKKKGTLETW  475

Query  1153  LVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVDLVKSGNGAILP CEA++V+H      +R  A+GV F F+  G+K   V++SKVT++A
Sbjct  476   LVDLVKSGNGAILPGCEAIKVLHKKKEGKDRKVARGVAFEFEYKGIKDICVVESKVTIVA  535

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN------KKSYEGAIMSA  830
              GAL TP+LL  SGL+N+NIGR+LHLHPV  AWG+FPD P         KKSYEG IM+A
Sbjct  536   CGALCTPALLKRSGLRNQNIGRHLHLHPVTMAWGYFPDEPASEVWPEAYKKSYEGGIMTA  595

Query  829   MSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             MS+VV     +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIFALARDKG
Sbjct  596   MSSVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDKG  655

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE  470
             SG   SP  ++Y L   DEENLQ+G+EK+LRILAAAGAEEIG +H  G TL VK  S  E
Sbjct  656   SGTVESPKHISYRLAGVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHE  715

Query  469   FERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             FE+FVKEESS+ L        SAHQMGSCRMG +PK SVVN  GETWE+EGL++ D SV 
Sbjct  716   FEKFVKEESSRPLADLSTPLCSAHQMGSCRMGSNPKQSVVNQTGETWEMEGLYLADTSVF  775

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PTALGVNPMVT+ + +YCI+QSV+E L+
Sbjct  776   PTALGVNPMVTVQATAYCIAQSVVEVLR  803



>ref|XP_010054015.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Eucalyptus 
grandis]
Length=804

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/757 (57%), Positives = 546/757 (72%), Gaps = 39/757 (5%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAI-NEALPETT----DASVTNFFQTSAASTGTPHQVAWVIN  2195
             +LSP QMETL++LC+TFLP+I +   P  T    D  V  F+QTSA+  GTP ++  +++
Sbjct  42    SLSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVS  101

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE I   W  
Sbjct  102   ERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFR  161

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------------S  1880
             S    +R F   +K L  LVFFT +D+K  N SWKAIGY GPDP               S
Sbjct  162   SVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLKRMSCQVS  221

Query  1879  ISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------AKP  1721
               E+Q +++        +E + GPL++G+I +  P++ V   L + G  V          
Sbjct  222   ADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLICPSNHNVR  281

Query  1720  KPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDK  1541
             KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLLEGP+MD+
Sbjct  282   KPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLLEGPTMDQ  341

Query  1540  MFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQ  1361
             M+L GGL+ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF S +YQ
Sbjct  342   MYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFDSKLYQ  401

Query  1360  KAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG  1181
             +A+D VC +MGVQ    +E F N VLRKGC+ELGYPV NIP+N+P+DHYCGWC  GCKDG
Sbjct  402   EALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWCCLGCKDG  461

Query  1180  RKKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAKG------VMFTFQRDGVKQTAV  1019
             +KKGTAETWLVDLV+SGNGAILP CEA++V+H R   +G      V F F+ +G K+  +
Sbjct  462   KKKGTAETWLVDLVESGNGAILPGCEAIEVLHTRRSGRGRDTVTGVAFEFEHNGFKEVCI  521

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKK  857
             ++S VT++A GAL TP+LL  SGLKN NIG+NLHLHPV  AWG+FPDT      P + KK
Sbjct  522   VESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTVDLWPEKEKK  581

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG IM+AMS VV N + +GYGAVIQTPALHPG+FS LMPW SG + K RM++++RTAH
Sbjct  582   SYEGGIMTAMSPVVGNFDKSGYGAVIQTPALHPGMFSVLMPWTSGLDMKERMTKFSRTAH  641

Query  676   IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL  497
             +FALARDKGSG   S TS++Y +D TDE NLQ+GLEK+LRILAAAGAEEIG +H  G TL
Sbjct  642   LFALARDKGSGTIASSTSISYKMDDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTL  701

Query  496   KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
             KVK  S  EFERFVKEES++ ++       SAHQMGSCRMG +P++SVVNP GETWEVEG
Sbjct  702   KVKQVSYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEG  761

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             L+V D SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  762   LYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  798



>ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
Length=853

 Score =   827 bits (2135),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/784 (55%), Positives = 553/784 (71%), Gaps = 57/784 (7%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINEALP-ETTDASVTNFFQTSAASTGTPHQV  2210
             + +  T   +LS  QM++L+ALC+T LP+IN+ +P    D S   F++ SA+  GTP ++
Sbjct  65    REKQKTLKNSLSIKQMKSLTALCDTILPSINDFVPVSDDDESAATFYRISASMAGTPERL  124

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
               +I++R+ HP    L L+LWFLST +GT++LCG G LST+FPF+  FP++   KR++I+
Sbjct  125   GGIISERLIHPMTMVLKLVLWFLSTWLGTIILCGMGCLSTKFPFIHTFPDLPLHKRQQIM  184

Query  2029  HSWATSSLQFIRNFFTAMKALVLLVFFTS----------------------VDDKGDNPS  1916
              SW+ S  + +R FF  +K L LL+FFT                       VD+  DN S
Sbjct  185   QSWSLSFFRHLRMFFRTIKLLTLLIFFTQYKILFLLGNDLLYSSLHYTYFQVDESEDNCS  244

Query  1915  WKAIGYCGPDPSISekqk---------kqkhhdheddieELLFGPLYKGIIDLNLPEEHV  1763
             WKAIGYCGPDP    + K         +++  +  D+  EL  GPLYKG++ LN P + +
Sbjct  245   WKAIGYCGPDPEFKAQLKNHFLHGACKEKQDSEEGDNDAELAIGPLYKGLVHLNYPRDII  304

Query  1762  FNRLTKLGCSVA--------KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
              + L + G  V+         P    PS V++CDAVVVGSG GGGV++G+LA AGYKVLV
Sbjct  305   VDTLRRFGFPVSVSRRKQKTAPSLSSPSLVVQCDAVVVGSGSGGGVVAGILANAGYKVLV  364

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKG Y AR NLSLLEGP+MD+M+  GGL+ T D+++ +L+GSTVGGGSA+NWSA IKTP
Sbjct  365   LEKGGYSARNNLSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACIKTP  424

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
              +V +EWCE HGLELF S++YQ+AM+ VC KMGVQ E E+E F N +LRKGC+E+GYPV 
Sbjct  425   QHVCKEWCEKHGLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGYPVN  484

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK--  1073
             NIP+NA  DHYCGWC  GCKDG+KKGT+ETWLVDLVKSGNGAILP C A++V+H++ K  
Sbjct  485   NIPRNASPDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKKKKGS  544

Query  1072  ----AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPV  905
                 A+GV F F+  G K   V++SKVT++A G L TPSLL  SGLKN NIGRNLHLHPV
Sbjct  545   GEKTARGVAFEFEYRGSKDICVVESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLHLHPV  604

Query  904   VFAWGHFPDTPGEN-----------KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHP  758
             V AWG+FPDTP E            KKSYEG IM+AMS VV     +GYGAVIQTPALHP
Sbjct  605   VMAWGYFPDTPVEPTGASEVWPETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTPALHP  664

Query  757   GLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQR  578
             G FS +MPW SG + K RM +++RTAHIFALARD+GSG   SP+ ++Y+++  DEENLQ+
Sbjct  665   GTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNVHSPSRISYEMEDVDEENLQK  724

Query  577   GLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAH  398
             G++K+LRILAAAGAEEIG +H  G TL VK+AS  EFE+FVK+ESS+SL        SAH
Sbjct  725   GIDKVLRILAAAGAEEIGTHHNKGNTLNVKNASYHEFEQFVKKESSRSLTDLSTPLCSAH  784

Query  397   QMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVL  218
             QMGSCRMG +PK SVV   GETWEVE LFV D SV PTALG+NPM+T+ S++YC +QSVL
Sbjct  785   QMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITVQSIAYCTAQSVL  844

Query  217   EFLK  206
             + LK
Sbjct  845   QVLK  848



>ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
Length=809

 Score =   824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/748 (57%), Positives = 540/748 (72%), Gaps = 29/748 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T TLSP QM++L ALC+T LP+++  + +T+D SVT F+Q SA+ TGTP +   +I++++
Sbjct  58    TNTLSPRQMKSLYALCDTILPSVDHFV-DTSDESVTKFYQISASMTGTPERFGCMISEKL  116

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ SW+ S L
Sbjct  117   KHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRSWSLSYL  176

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed---  1835
             +  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    + K            
Sbjct  177   RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKARLKSHFLDGTSKGGQ  236

Query  1834  -----dieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG------PSFVI  1694
                  +  E + GPLYKG++ LN P +   + L +LG   SV + K         PS VI
Sbjct  237   EDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIRQKHKAAANLSSPSLVI  296

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y AR NLSLLEGP+MD+M+L GGL+ 
Sbjct  297   QCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYLNGGLVA  356

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             + D+ + +L+GSTVGGGSA+NWSA IKTP +V +EW + HGLELF S++Y++A++ VC K
Sbjct  357   SDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWSDKHGLELFESELYREALNAVCEK  416

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             M VQ E EDE F N +LRKGC+E+GYPV NIP+N+ SDHYCGWC  GCKDGRKKGT+ETW
Sbjct  417   MEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRNSASDHYCGWCCMGCKDGRKKGTSETW  476

Query  1153  LVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVDLVKSGNGAILP CEA++V+H      +R  A+GV F F+  G K   V++SKVT++A
Sbjct  477   LVDLVKSGNGAILPGCEAIKVLHKKKEGRDRKIARGVAFEFEYKGTKDICVVESKVTIVA  536

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN------KKSYEGAIMSA  830
              GAL+TP+LL  SGL+N+NIGRNLHLHPV  AWG+FPD P         KKSYEG IM+A
Sbjct  537   CGALSTPALLKKSGLRNQNIGRNLHLHPVAMAWGYFPDAPESEVWPEAYKKSYEGGIMTA  596

Query  829   MSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             MSTVV     +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIFALARD+G
Sbjct  597   MSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQG  656

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE  470
             SG   +P  ++Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK     E
Sbjct  657   SGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHE  716

Query  469   FERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             FE+FVKEESS+SL        SAHQMGSCRMG +PK S VN  GETWEVEGL+V D SV 
Sbjct  717   FEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVF  776

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PTALGVNPMVT+ +++YC +QSV+E L+
Sbjct  777   PTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>ref|XP_008237995.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Prunus mume]
Length=752

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/745 (58%), Positives = 548/745 (74%), Gaps = 34/745 (5%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             ME+L+ALC+TFLP+I+ +   TT+AS+  F++TSA+  GTP +V  +I++R+KHPKL  +
Sbjct  1     MESLTALCDTFLPSIDVS-DATTNASLVAFYRTSASMAGTPQRVGGLISERLKHPKLWLM  59

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
              L LWFLST IG+ +LCG+ SLS+QFP+   FP++SQ+KRE I+ SW+ S    +R  F 
Sbjct  60    RLALWFLSTWIGSFILCGRASLSSQFPYFQSFPQMSQQKREEILLSWSLSYFYLLRMLFK  119

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi---------  1829
              MK L  LVFFT V++K +N SWKAI Y GPDP    K KK K      +          
Sbjct  120   TMKLLTFLVFFTQVNEKNENLSWKAIDYTGPDPEFITKTKKFKASTTIGNQRPNNEEQNA  179

Query  1828  ---eELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPK-----PPGPSFVIECDAv  1679
                EE LFGPL + II+L+ P++ V + L+  G   SV   +     P  PS  I CDAV
Sbjct  180   CPHEEELFGPLNRCIINLDKPKDLVVDALSTFGIPASVLHSEKTVNCPSNPSLTIRCDAV  239

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             V+GSG GGGV++GVLA AGYKV+V+EKGNY+AR NL+LLEGP+MD+M+L GGL+ T D+ 
Sbjct  240   VIGSGSGGGVVAGVLAKAGYKVVVIEKGNYHARKNLTLLEGPAMDQMYLSGGLIATDDMG  299

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             + +LAGSTVGGGSA+NWSASI+TP +V++EWC  H LELF S +YQ+A+D V  KMGVQ 
Sbjct  300   VFVLAGSTVGGGSAINWSASIRTPQHVIKEWCNDHELELFDSKLYQEALDVVSEKMGVQS  359

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
             + ++E F N +LRKGC+ELGYPV NIP+N+P +HYCGWC FGCKDGRK+GT ETWLVDLV
Sbjct  360   QVQEEGFNNEILRKGCQELGYPVNNIPRNSPPNHYCGWCCFGCKDGRKRGTTETWLVDLV  419

Query  1138  KSGNGAILPECEALQVIH-------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
              SGNGAIL  CEA++V+H       +RN A GV F F+  G K+   ++SKVT++A GAL
Sbjct  420   NSGNGAILTGCEAIKVLHKRKKGRRDRNTATGVAFKFEHGGGKEIGFVESKVTIVACGAL  479

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKKSYEGAIMSAMSTV  818
              TP LL  SGLKN NIG NLHLHPV  AWG+FPD+      P   KKSYEG IM+AMSTV
Sbjct  480   CTPKLLKRSGLKNVNIGENLHLHPVAMAWGYFPDSQVFDGWPEREKKSYEGGIMTAMSTV  539

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V   N +GYGAVIQTPALHPG+FS +MPW SG++ K RMSR++RTAH+FALARDKGSG  
Sbjct  540   VAEFNKSGYGAVIQTPALHPGMFSVVMPWVSGKDIKHRMSRFSRTAHVFALARDKGSGTV  599

Query  637   FS-PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFER  461
              + P S++Y+++  DE NL+ GLEK LRILAAAGAE+IG +H  G  L VK A+ +EFER
Sbjct  600   NAPPDSISYEMEALDENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVKKANLDEFER  659

Query  460   FVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
             FVKEESS+ LR+  +   SAHQMGSCRMGVD K SVVN  GETWEVEGLFV D SV PTA
Sbjct  660   FVKEESSRPLREISSAICSAHQMGSCRMGVDSKQSVVNQMGETWEVEGLFVADTSVFPTA  719

Query  280   LGVNPMVTIMSVSYCISQSVLEFLK  206
             LGVNPMVT+ +++YC SQS+L+ L+
Sbjct  720   LGVNPMVTVQAIAYCTSQSILQVLR  744



>gb|KHN41766.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=809

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/748 (57%), Positives = 540/748 (72%), Gaps = 29/748 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T TLSP QM++L ALC+T LP+++  + +T+D SVT F+Q SA+ TGTP +   +I++++
Sbjct  58    TNTLSPRQMKSLYALCDTILPSVDHFV-DTSDESVTKFYQISASMTGTPERFGCMISEKL  116

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             KHP    L  +LW LST  GTL+ CG G  STQFPF+  +P++  +KR++I+ SW+ S L
Sbjct  117   KHPLTGLLKFVLWLLSTWFGTLIFCGMGCFSTQFPFIHTYPDLPLQKRQQIMRSWSLSYL  176

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed---  1835
             +  R  F  +K L LL+FFT +D+  DN +WKAIGYCGPDP    + K            
Sbjct  177   RHFRMLFRTIKLLTLLIFFTQIDESEDNVAWKAIGYCGPDPEFKARLKSHFLDGTSKGGQ  236

Query  1834  -----dieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG------PSFVI  1694
                  +  E + GPLYKG++ LN P +   + L +LG   SV + K         PS VI
Sbjct  237   EDKEDEDAEEVIGPLYKGLVHLNYPRDITADALKRLGFPVSVIRQKHKAAANLSSPSLVI  296

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CDAVVVGSG GGGVI+GVLA AGYKVLVLEKG Y AR NLSLLEGP+MD+M+L GGL+ 
Sbjct  297   QCDAVVVGSGSGGGVIAGVLAKAGYKVLVLEKGGYSARNNLSLLEGPTMDQMYLNGGLVA  356

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             + D+ + +L+GSTVGGGSA+NWSA IKTP +V +EW + HGLELF S++Y++A++ VC K
Sbjct  357   SDDMGVFILSGSTVGGGSAINWSACIKTPQHVCKEWSDKHGLELFESELYREALNAVCEK  416

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             M VQ E EDE F N +LRKGC+E+GYPV NIP+N+ +DHYCGWC  GCKDGRKKGT+ETW
Sbjct  417   MEVQSEIEDEGFNNAILRKGCQEMGYPVSNIPRNSAADHYCGWCCMGCKDGRKKGTSETW  476

Query  1153  LVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVDLVKSGNGAILP CEA++V+H      +R  A+GV F F+  G K   V++SKVT++A
Sbjct  477   LVDLVKSGNGAILPGCEAIKVLHKKKEGRDRKIARGVAFEFEYKGTKDICVVESKVTIVA  536

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN------KKSYEGAIMSA  830
              GAL+TP+LL  SGL+N+NIGRNLHLHPV  AWG+FPD P         KKSYEG IM+A
Sbjct  537   CGALSTPALLKKSGLRNQNIGRNLHLHPVAMAWGYFPDAPESEVWPEAYKKSYEGGIMTA  596

Query  829   MSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             MSTVV     +GYGAVIQTP+LHPG+FS + PW SG + + RM +++RTAHIFALARD+G
Sbjct  597   MSTVVAEFEQSGYGAVIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQG  656

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE  470
             SG   +P  ++Y     DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK     E
Sbjct  657   SGTVKAPDRISYKPAGVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVRYHE  716

Query  469   FERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             FE+FVKEESS+SL        SAHQMGSCRMG +PK S VN  GETWEVEGL+V D SV 
Sbjct  717   FEKFVKEESSRSLTDLTTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVF  776

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PTALGVNPMVT+ +++YC +QSV+E L+
Sbjct  777   PTALGVNPMVTVQAIAYCTAQSVVEVLR  804



>gb|KDP37816.1| hypothetical protein JCGZ_06718 [Jatropha curcas]
Length=760

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/734 (58%), Positives = 546/734 (74%), Gaps = 24/734 (3%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             +LS  +ME+LSALC+TFLP+ N+ +  +   D S+  FF +SA+  GTP ++  +I+QR+
Sbjct  30    SLSFPEMESLSALCDTFLPS-NDVVSSSAAADDSIAKFFLSSASMAGTPQRIGGLISQRL  88

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
             KHPK   + ++LW LSTR+GT +LCG  S+ST FPF L+F +I   KRE+I+HSW+ S  
Sbjct  89    KHPKKWLIRVVLWMLSTRVGTFILCGLLSISTHFPFFLKFSQIHLHKREKILHSWSLSFF  148

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh-hdheddi  1829
               +R  F  +K L LLVFF+ VD+KG+N +WKA+ Y GPDP   ++Q+       + ++ 
Sbjct  149   SLLRMLFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKKEQEAALKLVKNNEEE  208

Query  1828  eELLFGPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
             +E LFGPLYKG+ID+NLP +   N  RL+       +PK   PS VI+CDAVVVGSG GG
Sbjct  209   KEKLFGPLYKGLIDMNLPRDITANSLRLSGFPVFTYRPKINNPSLVIKCDAVVVGSGSGG  268

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV++GVLA AGYKV+V+EKGNY+AR+NLSLLEGPSMD+M+L  GL+ T D+ +V+LAGST
Sbjct  269   GVVAGVLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYLSAGLMATDDMGVVVLAGST  328

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGS +NWSASI+TP +V  EW   +GLE+F S +Y++A+D VC KMGVQ E  +E F 
Sbjct  329   VGGGSTINWSASIRTPQHVTDEWSNAYGLEIFDSKLYKEALDVVCEKMGVQSEINEEGFN  388

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N +LRKGC ELGY V  IP+N+ SDHYCGWC  GCKDG+KKGT ETWL+DLV SGNG IL
Sbjct  389   NAILRKGCEELGYNVNTIPRNSSSDHYCGWCCLGCKDGKKKGTCETWLLDLVNSGNGLIL  448

Query  1114  PECEALQVIHERNK------AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             P CEA++V+H+R +      A GV F F     K+  V++SKVT++A GAL+TP LL  S
Sbjct  449   PNCEAIKVLHKRRRRGNRRVASGVAFAFG----KEVCVVQSKVTIVACGALSTPPLLKRS  504

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVNGTGYG  788
             GLKN NIG++LHLHPV  AWG+FPD      P ++KKSY+G IM+AMS V    +   YG
Sbjct  505   GLKNSNIGKHLHLHPVTMAWGYFPDDQPLAWPEKHKKSYQGGIMTAMSLV---NSDKSYG  561

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             AVIQTP+LHPG+F++LMPW S  + KM+  R++RTAHIFALARDKGSG+  SP S++Y +
Sbjct  562   AVIQTPSLHPGMFASLMPWVSCVDMKMKRGRFSRTAHIFALARDKGSGKVNSPNSISYQM  621

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLR  428
             +  DEENLQ+GLEK+LRILAAAGAEEIG +H  G +L VK AS +EF++FVK ESS+SLR
Sbjct  622   EAPDEENLQKGLEKVLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRSLR  681

Query  427   KHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS  248
                    SAHQMGSCRMG+DP+ SVVN  GETWEVEGLF+ D SV PTALGVNPMVT+ +
Sbjct  682   DLSTQICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPTALGVNPMVTVQA  741

Query  247   VSYCISQSVLEFLK  206
             ++YC +QSVL+ LK
Sbjct  742   IAYCTAQSVLQLLK  755



>ref|XP_007040880.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
 gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma 
cacao]
Length=1140

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/756 (57%), Positives = 547/756 (72%), Gaps = 35/756 (5%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  2195
             N    ++S  +ME+L+A+C+ FLP+++ +       +V  F+Q+SA+   TP +V  +++
Sbjct  381   NCYVNSISSREMESLTAICDAFLPSLHVS--AADADAVATFYQSSASMAATPERVGGLLS  438

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +RM+HPK   + L LW LST +GT +LCG  SLST FPF   F ++SQ+KRE I+ SW+ 
Sbjct  439   ERMEHPKKWMIRLALWLLSTWLGTFVLCGPRSLSTNFPFFHTFSQLSQQKREEILLSWSL  498

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
             S    +R  F + K L LLVFF+ VD+K  N SWKAIGYCGPDP    +  + K      
Sbjct  499   SFFYHLRMLFKSTKLLTLLVFFSQVDEKNQNLSWKAIGYCGPDPEFQPQASRLKTSKQNG  558

Query  1834  dieELL--------------FGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KPK---PPG  1709
                 +               +GPL +G+I+L  P + V + L + G  V+ +PK   PP 
Sbjct  559   YGNFICKEQECKEDGEKEERYGPLCRGLINLKHPRDVVADNLLRFGLPVSVRPKKINPPN  618

Query  1708  ---PSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  1538
                PS  I+CDAV+VGSG GGGV++GVLA AGYKVLVLEKGNY+AR+NLSLLEGPSMD+M
Sbjct  619   LSHPSLTIKCDAVIVGSGSGGGVVAGVLAKAGYKVLVLEKGNYFARSNLSLLEGPSMDQM  678

Query  1537  FLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQK  1358
             ++ GG+L T D+ +V+LAGSTVGGGS +NWSASIKTP +V+ EWC+   LELF S +Y++
Sbjct  679   YMSGGMLATDDMGVVILAGSTVGGGSTINWSASIKTPQHVINEWCDRCKLELFDSKLYKE  738

Query  1357  AMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGR  1178
             AMD VC KMGVQ E  +E F N VLRKGC ELGYPV +IP+N+P DHYCGWC  GCKDGR
Sbjct  739   AMDVVCEKMGVQSEIVEEGFNNAVLRKGCEELGYPVNDIPRNSPPDHYCGWCCMGCKDGR  798

Query  1177  KKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTAVI  1016
             KKGT+ETWLVDLV SGNG ILP CEA++V+H+R K      A G+ F  +  G K   ++
Sbjct  799   KKGTSETWLVDLVNSGNGVILPGCEAIKVLHKRRKGRGRNRATGIAFQLEYVGAKDICIV  858

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTP------GENKKS  854
             +SKVT++A GAL+TP LL  SGLKN NIG+NLHLHPV  AWG+FPD P       + KKS
Sbjct  859   ESKVTIVACGALSTPPLLKRSGLKNANIGKNLHLHPVAMAWGYFPDAPLSSGWPEKEKKS  918

Query  853   YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI  674
             YEG IM+AMSTVV N++ +GYGAV+QTPALHPG+FSALMPW SG + K RM R++RTAHI
Sbjct  919   YEGGIMTAMSTVVANMDKSGYGAVLQTPALHPGMFSALMPWLSGADMKRRMLRFSRTAHI  978

Query  673   FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK  494
             FALARDKGSG+ +SP S+ Y ++ TDEENL++GL+K+LRILAAAGAEEIG +H  G ++ 
Sbjct  979   FALARDKGSGDVYSPDSIGYKMEATDEENLKKGLDKILRILAAAGAEEIGTHHCKGKSIN  1038

Query  493   VKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGL  314
             VK AS  EFERFVKEESS+ LR       SAHQMGSCRMG+DPK SVVN  GETWEVEGL
Sbjct  1039  VKQASSHEFERFVKEESSRPLRDLNTQICSAHQMGSCRMGIDPKQSVVNQMGETWEVEGL  1098

Query  313   FVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             FV D SV PTALGVNPMVTI +++YC +QSVL+ LK
Sbjct  1099  FVADSSVFPTALGVNPMVTIQAIAYCTAQSVLDVLK  1134



>ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
Length=824

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/757 (56%), Positives = 542/757 (72%), Gaps = 38/757 (5%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             T TLSP QM++L ALC+T +P+I    +  ++  SV NF++TSA+  GTP ++  +I ++
Sbjct  66    TNTLSPRQMKSLVALCDTIIPSIEGNNVVHSSHESVNNFYRTSASMAGTPQRLGILI-EK  124

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
             +KHP    L++ LW LST  GTL+LCGK SLST FPF   FP++S + R+ ++  W+ S 
Sbjct  125   LKHPSTRLLMVTLWLLSTWFGTLILCGKASLSTNFPFFRSFPDLSSETRQNVMKCWSQSY  184

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd-  1832
                +R FF  +K L LLVFFT +D++ +NPSWKAIGY GP      +QK         + 
Sbjct  185   FHHLRMFFRTIKLLTLLVFFTQLDEEENNPSWKAIGYSGPHEEFKRQQKNHILQKSSKEG  244

Query  1831  ---------------ieELLFGPLYKGIIDLNLPEEHVFNRLT--KLGCSVAKP--KPP-  1712
                              E + GPLY+G++ LN P + + + L   K   SV  P  KP  
Sbjct  245   LQKEKQEDNNDDDNDNNEEILGPLYRGLVHLNHPCDIIADSLRRFKFHVSVTPPNNKPST  304

Query  1711  --GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  1538
                PS VI+CD VVVGSG GGGV++GVLA +GYKVLVLEKG+Y+AR N+SLLEGP+MD+M
Sbjct  305   ISSPSLVIQCDVVVVGSGSGGGVVAGVLAKSGYKVLVLEKGSYFARNNVSLLEGPTMDQM  364

Query  1537  FLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQK  1358
             +L  GL+ T D+ +++LAGSTVGGGS +NWSASIKTP +V +EWC++H LELF S +Y++
Sbjct  365   YLSNGLIATTDMSVLILAGSTVGGGSTINWSASIKTPHHVCKEWCDIHELELFESTLYKE  424

Query  1357  AMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGR  1178
             AMD VC KMGVQ + E+E F N VLRKGC E+GYPV NIP+NAP +HYCGWC  GCKDG 
Sbjct  425   AMDVVCKKMGVQSDFEEEGFNNAVLRKGCHEMGYPVNNIPRNAPPNHYCGWCCMGCKDGT  484

Query  1177  KKGTAETWLVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRDGVKQTAVI  1016
             KKGT+ETWLVDLVKSGNGAILP+CEA+Q++H      +R  A GV F  + +G K   V+
Sbjct  485   KKGTSETWLVDLVKSGNGAILPKCEAIQILHREKKGSDRKTASGVAFAIEYNGNKDICVV  544

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG-------ENKK  857
             +SKVT+IA GAL+TPSLL  SGLKN+NIGRNLHLHPV  AWG+FP++P        E+KK
Sbjct  545   ESKVTIIACGALSTPSLLKRSGLKNENIGRNLHLHPVTMAWGYFPNSPSSSKLWPEEHKK  604

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG IM+AMSTVV   N +GYGAVIQTP+LHPGLFS LMPWNSG + K RM +++RTAH
Sbjct  605   SYEGGIMTAMSTVVAEFNKSGYGAVIQTPSLHPGLFSILMPWNSGMDIKDRMRKFSRTAH  664

Query  676   IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL  497
             +FALARD+GSG   SP+ ++Y +   D+ENL++G+EK+LRILAAAGAEEIG ++  G  L
Sbjct  665   VFALARDQGSGTVDSPSCISYHMKDADKENLKKGIEKVLRILAAAGAEEIGTHNNKGNRL  724

Query  496   KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
              VK  S  EFE+FVKEESS  L        SAHQMGSCRMG +PK SVVN  GETWEVE 
Sbjct  725   NVKKVSYHEFEKFVKEESSMELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWEVED  784

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             L++ D SV PTALGVNPMVTI +++YC +Q VLE L+
Sbjct  785   LYIADASVFPTALGVNPMVTIQAIAYCTAQHVLEVLR  821



>gb|EYU29124.1| hypothetical protein MIMGU_mgv1a001761mg [Erythranthe guttata]
Length=763

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/759 (57%), Positives = 540/759 (71%), Gaps = 37/759 (5%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINEA-----LPETTDASVTNFFQTSAASTGT  2222
             K    T     S   ME L+ALC+TFLPAI+ +     LP+    SV NF+QTSA+ + T
Sbjct  3     KSNKTTYKNAFSKRDMEALTALCDTFLPAIDVSDHDPHLPQ----SVANFYQTSASMSET  58

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P  VA  I +++KHPK+    + +  LST IGT +LCG+ SLS  FP+L RF  +   KR
Sbjct  59    PPLVAEFIAEKVKHPKILLAKVAVKMLSTWIGTFILCGRKSLSDDFPYLQRFSRVESLKR  118

Query  2041  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISe---  1871
             E I+ SW+ S    +R  F+A+K  +L  FFT VD+K DN SWKAIGYCGPDP       
Sbjct  119   EEILLSWSNSCFSLLRILFSALKIFILFTFFTQVDEKEDNISWKAIGYCGPDPDFKTRKP  178

Query  1870  --kqkkqkhhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPP----  1712
               ++ +QK  +    IEE LFGPL+KGII+  + P E    +L   G + A    P    
Sbjct  179   QYQECEQKEENDHKSIEEDLFGPLHKGIINFSHQPIEKSLRKLRDSGFTTAVVSKPYSEK  238

Query  1711  --------GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEG  1556
                      PSFV++CDAV+VGSG GGGV++GVLA AG+KV+VLEKG+Y AR+NLSLLEG
Sbjct  239   NTSVGSLLNPSFVLKCDAVIVGSGSGGGVVAGVLAKAGHKVVVLEKGSYLARSNLSLLEG  298

Query  1555  PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1376
              ++D+M+LG G++ + ++D++ LAGSTVGGGSAVNWSAS +TP +V +EW E HGLELFG
Sbjct  299   EALDQMYLGNGIVASDNMDVLFLAGSTVGGGSAVNWSASFRTPSHVTKEWSEKHGLELFG  358

Query  1375  SDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTF  1196
             S  Y+ A+D VC KMGVQ E +DE F NMVLRKGC  LGY V NIP+NAPSDHYCGWC  
Sbjct  359   SKNYENALDVVCEKMGVQSEFDDEGFNNMVLRKGCEGLGYQVGNIPRNAPSDHYCGWCCM  418

Query  1195  GCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVI-------HERNKAKGVMFTFQ-RD  1040
             GCKDGRKKGT ETWLVDLV+S NGAIL ECEAL+VI       + R  A GV F F+  +
Sbjct  419   GCKDGRKKGTLETWLVDLVESKNGAILSECEALKVITTEGKTVNGRKMATGVAFAFRNEE  478

Query  1039  GVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT--PGE  866
             G ++  ++++KVTV A GA+ TP LL  SGLKNKNIG+NLH+HPVV AWG+FP+   P  
Sbjct  479   GGQEIGIVEAKVTVTACGAMCTPQLLKKSGLKNKNIGKNLHVHPVVMAWGYFPEDSWPET  538

Query  865   NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYAR  686
              K+S++G IM+AMS VV N   +GYGAVIQTP+LHPGLFSA+MPW SG++FK RM +Y+R
Sbjct  539   EKRSHKGGIMTAMSKVVSNFETSGYGAVIQTPSLHPGLFSAVMPWVSGKDFKDRMVKYSR  598

Query  685   TAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG  506
             TAH+FALARDKG G   SP+ ++Y LD  D ENL+ G+E++LRILAAAGAEEIG +H  G
Sbjct  599   TAHVFALARDKGRGTIASPSDISYKLDDLDRENLREGIERVLRILAAAGAEEIGTHHRDG  658

Query  505   LTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE  326
               LKVK ASREEFE FV+ ES + LR      ASAHQMGSCRMGVD   S V+P+GETWE
Sbjct  659   GVLKVKGASREEFEGFVERESMRPLRNLSTPIASAHQMGSCRMGVDSGGSGVDPRGETWE  718

Query  325   VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             VEGLFV D SV PTALGVNPMVT+ +++YC +QSVLE L
Sbjct  719   VEGLFVADSSVFPTALGVNPMVTVQAIAYCTAQSVLEIL  757



>ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Vitis vinifera]
Length=793

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/751 (56%), Positives = 535/751 (71%), Gaps = 35/751 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             LS  +ME+L A+ +TFLP++ EA      A V  F++TSA+  GTPH V  +I++R++HP
Sbjct  35    LSSREMESLIAISDTFLPSV-EAPHNAAHAYVDKFYRTSASMAGTPHIVGGLISERLEHP  93

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
             KL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  IV SW+ S    I
Sbjct  94    KLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSLI  153

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  F ++K + LLVFFT VD+K +N +WKAIGYCGPDP      +  K          + 
Sbjct  154   RMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANKTAQPNGYGRSIY  213

Query  1816  F-------------GPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKPPGPS--FVI  1694
                           GPLY+G+I++  P E V   L   G S++    K + P  S   +I
Sbjct  214   QREQEEEDDREDFNGPLYRGLINVKRPREVVAEALRLSGFSISIHSRKHETPNSSSPLII  273

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
              CDAVV+GSG GGGV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP++D+M+L GG+L 
Sbjct  274   RCDAVVIGSGSGGGVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQMYLYGGMLA  333

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T D  +++LAGSTVGGGS +NWSASI+TP +V +EWC+ H LELF S +Y++AMD VC K
Sbjct  334   TDDTGVIILAGSTVGGGSTINWSASIRTPQHVRKEWCDQHELELFDSQLYKEAMDVVCEK  393

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ E  +E   N VLR+GC+ELGYPV +IP+N+   HYCGWC FGCKDGRKKGTAETW
Sbjct  394   MGVQSEIYEEGLNNAVLRRGCQELGYPVTDIPRNSQPKHYCGWCCFGCKDGRKKGTAETW  453

Query  1153  LVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVD++ SGNG ILP CEA++V+H R K      A GV F F+  GVK+  +++SKVT++A
Sbjct  454   LVDMMNSGNGVILPGCEAIKVLHNRKKGRARSTATGVAFEFEYKGVKEVFMVESKVTIVA  513

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD---------TPGENKKSYEGAI  839
              GA++TP LL  SGLKN NIG+NLHLHPV  AWGHFP+          PG  K+SYEG I
Sbjct  514   CGAISTPGLLKRSGLKNPNIGKNLHLHPVAMAWGHFPEPTPLSPSPGCPGLEKRSYEGEI  573

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             M+ MSTVV +  G+GYGAVIQTP+LHPG+FS LMPW SG + K RM RY+RTAHIFALAR
Sbjct  574   MTVMSTVVADFEGSGYGAVIQTPSLHPGMFSVLMPWISGPDMKDRMIRYSRTAHIFALAR  633

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             DKGSG   SP++++Y +D+TDEENL+RG+EKLLRILAAAGAEEIG ++  G ++ VK  S
Sbjct  634   DKGSGTISSPSTISYQMDETDEENLKRGMEKLLRILAAAGAEEIGTHNCNGRSINVKKVS  693

Query  478   REEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
                FE+FVKEESS++LR       SAHQMGSCRMGVDP++S VN  GETWEVEGL+V D 
Sbjct  694   SHAFEKFVKEESSRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYVADT  753

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             SV PTALGVNPMVT+ +++Y  ++SV+E L+
Sbjct  754   SVFPTALGVNPMVTVQAIAYSTAKSVVEVLR  784



>ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer 
arietinum]
Length=816

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/756 (57%), Positives = 538/756 (71%), Gaps = 36/756 (5%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T +L   QM++LS L +T LP+IN+ +    D S   F+  SA+  GTP  V  VI++R+
Sbjct  56    TNSLCRRQMKSLSVLADTILPSINDFVAIKDDESAATFYHISASMAGTPELVGGVISERL  115

Query  2185  K-HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
               HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+RI+ SW+ S 
Sbjct  116   NYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSF  175

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk----------  1859
              + +R FF  +K L LLVFFT +D+  DN SWKAIGYCGPDP    + +           
Sbjct  176   FRHLRMFFKTIKLLTLLVFFTQIDESEDNCSWKAIGYCGPDPEFKAQLRNHFLHRTCKGG  235

Query  1858  qkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG------PS  1703
             Q+  + ++D  E + GPLYKG++ LN P +   + L + G   SV + KP        PS
Sbjct  236   QESEEGDEDDAEQVIGPLYKGLVHLNCPRDITADALRRFGFPVSVTRRKPKAAANLSSPS  295

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
              VI+CDAVVVGSG GGG+++G+LA AGYKVLVLEKG Y AR+NLSLLEGP++D+M+  GG
Sbjct  296   LVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYSARSNLSLLEGPTLDQMYQSGG  355

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             +L T D+ + +L+GSTVGGGSA+NWSASIKTP +V +EWCE HGLELF S++Y++AMD V
Sbjct  356   MLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHVCKEWCEKHGLELFESELYREAMDVV  415

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C KMGVQ E E+E F N +LR+GC+ELGYPV  IP+N+PSDHYCGWC  GCKDGRKKGT+
Sbjct  416   CEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIPRNSPSDHYCGWCFMGCKDGRKKGTS  475

Query  1162  ETWLVDLVKSGNGAILPECEALQVI------HERNKAKGVMFTFQRDGVKQTAVIKSKVT  1001
             ETWLVDLVKSGNGAILP CE L+V+       ++  A+GV F F+  G K   V++SKVT
Sbjct  476   ETWLVDLVKSGNGAILPGCEVLKVLYKKKKGSDQKTARGVAFEFEYKGSKDICVVESKVT  535

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN-----------KKS  854
             ++A GAL TP+LL  SGLKN NIGRNLHLHPVV AWG+FPD+  E+           KKS
Sbjct  536   IVACGALNTPALLKRSGLKNNNIGRNLHLHPVVMAWGYFPDSSAESTGETEVWPEAWKKS  595

Query  853   YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI  674
             YEG IM+AMS VV     +GYGAVIQTPALHPG FS +MPW SG++ K RM +++RTAHI
Sbjct  596   YEGGIMTAMSPVVAEFENSGYGAVIQTPALHPGTFSIVMPWISGKDIKDRMRKFSRTAHI  655

Query  673   FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK  494
             FALARDKGSG+  SP  + Y ++  DEENLQ+G+EK+LRILAAAGAEEIG +H  G TL 
Sbjct  656   FALARDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLN  715

Query  493   VKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGL  314
             VK AS+ E E+FVKEESS+ L K      SAHQMGSCRMG +PK S V   GETWEVE L
Sbjct  716   VKQASKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDL  775

Query  313   FVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             +V D SV PTALG+NPM+TI S++YC +QSVL  LK
Sbjct  776   YVADSSVFPTALGLNPMITIQSIAYCTAQSVLHALK  811



>ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gb|EEF42542.1| electron carrier, putative [Ricinus communis]
Length=710

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/700 (59%), Positives = 511/700 (73%), Gaps = 30/700 (4%)
 Frame = -3

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             Q+  +I++R+KHPK   + L LW LST IGT +LCG  S+ST FP+   F +++  KRE+
Sbjct  7     QLGGLISERLKHPKKWLIRLALWMLSTWIGTFILCGVASISTHFPYFQSFSQLTLHKREK  66

Query  2035  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             I+HSW+ S L  +R  F AMK L+LLVFF+ VD+K +N +WKAIGY GPDP     + + 
Sbjct  67    ILHSWSLSFLYPLRMLFKAMKLLILLVFFSQVDEKNENLTWKAIGYPGPDPQFKVDKWEA  126

Query  1855  khhd-----------------------heddieELLFGPLYKGIIDLNLPEEHVFNRLTK  1745
                                         E + E  LFGPL++GI+D+NLP + V N L +
Sbjct  127   LKLSPYARFTDKQLERKEEEEEEEEEEEEGEDELKLFGPLHRGIVDMNLPRDAVANSLQR  186

Query  1744  LGCSVA--KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNL  1571
             LG S+   +PK      VI CDAVVVGSG GG V++G LA AGYKVLVLEKGNY+AR+NL
Sbjct  187   LGFSILANRPKKYYSPLVIRCDAVVVGSGSGGSVVAGALAKAGYKVLVLEKGNYFARSNL  246

Query  1570  SLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHG  1391
             SLLEGP+MD+M+L GGL+ T D+ +VLLAGSTVGGGS +NWSASIKTP +V+ EW   + 
Sbjct  247   SLLEGPTMDQMYLSGGLMATDDMGVVLLAGSTVGGGSTINWSASIKTPQHVISEWTNCYD  306

Query  1390  LELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYC  1211
             LE+FGS +Y++A+D VC KMGVQ E   E F N +LRKGC ELGYPV NIP+N+  DHYC
Sbjct  307   LEIFGSKLYKEALDVVCEKMGVQSEIHVEGFNNEILRKGCEELGYPVSNIPRNSAPDHYC  366

Query  1210  GWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK----AKGVMFTFQR  1043
             GWC  GCKDG+KKGT ETWL+DLV SGNGAILP CE ++++H+R      A GV+F F+ 
Sbjct  367   GWCCLGCKDGKKKGTCETWLLDLVNSGNGAILPRCEVIKILHKRKSNRKAATGVVFGFEY  426

Query  1042  DGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGE  866
              G K+  V++SKVT+IA GAL++P LL  SGLKN NIGRNLHLHPV  AWG+FP+  P  
Sbjct  427   KGKKELYVVESKVTIIACGALSSPPLLRRSGLKNPNIGRNLHLHPVTMAWGYFPEAWPEV  486

Query  865   NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYAR  686
              KKSYEG IM+AMSTVV N + +GYGAVIQTP+LHPG+FS+LMPW SG + KM+M RY+R
Sbjct  487   EKKSYEGGIMTAMSTVVANFDKSGYGAVIQTPSLHPGMFSSLMPWVSGADIKMQMCRYSR  546

Query  685   TAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG  506
             TAHIFAL RDKGSG   SP+S+TY +   DE+NLQ G+EK+LRILAAAGAEEIG +H  G
Sbjct  547   TAHIFALGRDKGSGTVNSPSSITYQMKAADEKNLQNGIEKILRILAAAGAEEIGTHHCIG  606

Query  505   LTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE  326
               L VK AS  EFE+FVKEE ++ +R   N   SAHQMGSCRMGV+PK SVVN  GETWE
Sbjct  607   RRLNVKTASYHEFEKFVKEERARPMRDLSNQICSAHQMGSCRMGVNPKHSVVNQTGETWE  666

Query  325   VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             +EGL++ D SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  667   IEGLYLADASVFPTALGVNPMVTVQAIAYCTAQSVLEVLR  706



>ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer 
arietinum]
Length=834

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/774 (55%), Positives = 538/774 (70%), Gaps = 54/774 (7%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T +L   QM++LS L +T LP+IN+ +    D S   F+  SA+  GTP  V  VI++R+
Sbjct  56    TNSLCRRQMKSLSVLADTILPSINDFVAIKDDESAATFYHISASMAGTPELVGGVISERL  115

Query  2185  K-HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
               HP    L  +LW LST +GT++LCG    ST+FPF+  FP +   KR+RI+ SW+ S 
Sbjct  116   NYHPMTWLLKFVLWLLSTLVGTIILCGMDCFSTKFPFIHTFPNLPLHKRQRIMQSWSLSF  175

Query  2008  LQFIRNFFTAMKALVLLVFFTSV------------------DDKGDNPSWKAIGYCGPDP  1883
              + +R FF  +K L LLVFFT +                  D+  DN SWKAIGYCGPDP
Sbjct  176   FRHLRMFFKTIKLLTLLVFFTQIFLLFGTLYSSWHGTYFQIDESEDNCSWKAIGYCGPDP  235

Query  1882  SISekqkk----------qkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--  1739
                 + +           Q+  + ++D  E + GPLYKG++ LN P +   + L + G  
Sbjct  236   EFKAQLRNHFLHRTCKGGQESEEGDEDDAEQVIGPLYKGLVHLNCPRDITADALRRFGFP  295

Query  1738  CSVAKPKPPG------PSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYART  1577
              SV + KP        PS VI+CDAVVVGSG GGG+++G+LA AGYKVLVLEKG Y AR+
Sbjct  296   VSVTRRKPKAAANLSSPSLVIQCDAVVVGSGSGGGLVAGILAKAGYKVLVLEKGGYSARS  355

Query  1576  NLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEV  1397
             NLSLLEGP++D+M+  GG+L T D+ + +L+GSTVGGGSA+NWSASIKTP +V +EWCE 
Sbjct  356   NLSLLEGPTLDQMYQSGGMLATDDMSVFVLSGSTVGGGSAINWSASIKTPQHVCKEWCEK  415

Query  1396  HGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDH  1217
             HGLELF S++Y++AMD VC KMGVQ E E+E F N +LR+GC+ELGYPV  IP+N+PSDH
Sbjct  416   HGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELGYPVSTIPRNSPSDH  475

Query  1216  YCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVI------HERNKAKGVMF  1055
             YCGWC  GCKDGRKKGT+ETWLVDLVKSGNGAILP CE L+V+       ++  A+GV F
Sbjct  476   YCGWCFMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEVLKVLYKKKKGSDQKTARGVAF  535

Query  1054  TFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT  875
              F+  G K   V++SKVT++A GAL TP+LL  SGLKN NIGRNLHLHPVV AWG+FPD+
Sbjct  536   EFEYKGSKDICVVESKVTIVACGALNTPALLKRSGLKNNNIGRNLHLHPVVMAWGYFPDS  595

Query  874   PGEN-----------KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWN  728
               E+           KKSYEG IM+AMS VV     +GYGAVIQTPALHPG FS +MPW 
Sbjct  596   SAESTGETEVWPEAWKKSYEGGIMTAMSPVVAEFENSGYGAVIQTPALHPGTFSIVMPWI  655

Query  727   SGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILA  548
             SG++ K RM +++RTAHIFALARDKGSG+  SP  + Y ++  DEENLQ+G+EK+LRILA
Sbjct  656   SGKDIKDRMRKFSRTAHIFALARDKGSGKVDSPNRINYQMEDVDEENLQKGIEKVLRILA  715

Query  547   AAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVD  368
             AAGAEEIG +H  G TL VK AS+ E E+FVKEESS+ L K      SAHQMGSCRMG +
Sbjct  716   AAGAEEIGTHHNKGRTLNVKQASKLELEKFVKEESSRPLTKLSTPLCSAHQMGSCRMGSN  775

Query  367   PKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PK S V   GETWEVE L+V D SV PTALG+NPM+TI S++YC +QSVL  LK
Sbjct  776   PKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMITIQSIAYCTAQSVLHALK  829



>ref|XP_010274418.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274419.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Nelumbo 
nucifera]
Length=775

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/756 (57%), Positives = 529/756 (70%), Gaps = 29/756 (4%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             E  T   +LS  +M +L  LC+T LP+IN +  +  D S++NF+  SA++T TP  VA +
Sbjct  13    EKTTTVNSLSSREMHSLCTLCDTLLPSINHSATDEDD-SLSNFYWASASTTATPQLVAGI  71

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             I +++  PK   L L LW LST  GT +L GK SLST+FP+  +F ++SQKKRE I+ SW
Sbjct  72    ITEKLPLPKAGILRLTLWLLSTWFGTFILTGKSSLSTKFPYFQKFSQVSQKKREEILLSW  131

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             +TSS   +R  F   K L+L VFFT VD+K +NPSWKA+GYCGPDP    + +  K    
Sbjct  132   STSSFSLLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDPDFKHQTQASKTDQD  191

Query  1840  eddieEL-----LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--------KPKPPGPSF  1700
             +   EE      LFGPLY+ +I+   P + +   L + G  V          P    PS 
Sbjct  192   DLTSEEEEKKEELFGPLYRRLINPRHPRQSIAEYLEQSGFPVTINHFHGNKTPSISSPSL  251

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              I CDAVVVGSG GG V + VLA AGYKVLVLEKG Y+AR NLSLLEGPS+++M+L GGL
Sbjct  252   TIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFARNNLSLLEGPSLEQMYLDGGL  311

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               T DL + L AG+TVGGGS VNWSASI+TP +V+ EWC  H LELF    Y +AMD VC
Sbjct  312   TATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWCYSHKLELFDRKPYNRAMDVVC  371

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              +MGVQ +  +ESF N VLR+GC ELGYPV  + QNAP DHYCGWC FGCKDG+K+GTAE
Sbjct  372   NRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPMDHYCGWCGFGCKDGKKQGTAE  431

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQR-DGVKQTAVIKSKVT  1001
             TWLVDLV SGNG ILP CEAL+V+HER +      A GV F      G     V++SKVT
Sbjct  432   TWLVDLVDSGNGVILPGCEALKVLHERKRRNDRSTAIGVAFRLDNGSGGHDICVVESKVT  491

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG--------ENKKSYEG  845
             V+A GAL TP LL  SGLKN NIG++L +HPVV AWG+F D P         ++K+SYEG
Sbjct  492   VVACGALRTPVLLKRSGLKNTNIGKHLRVHPVVLAWGYFADEPASSNGDEWVKDKRSYEG  551

Query  844   AIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFAL  665
              I+++MSTVV    G+GYGA++QTP+LHPGLFS LMPW SG +FK RMSR++RTAH+FAL
Sbjct  552   GILTSMSTVVAGFEGSGYGAILQTPSLHPGLFSVLMPWVSGADFKERMSRFSRTAHVFAL  611

Query  664   ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  485
             ARDKGSG+  S +S++Y LD  DEENL +G+EK+LRILAAAGAEEIG +H  G  L VK 
Sbjct  612   ARDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKR  671

Query  484   ASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
             AS++EFE+FVKEES + L       ASAHQMGSCRMGVD   SVV P+GETWEVEGLFV 
Sbjct  672   ASKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVA  731

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTHD  197
             D SV PTALGVNPMVT+ ++SYC + SV+EFL+ +D
Sbjct  732   DTSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  767



>gb|KDO72345.1| hypothetical protein CISIN_1g0039902mg, partial [Citrus sinensis]
Length=707

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/699 (58%), Positives = 515/699 (74%), Gaps = 33/699 (5%)
 Frame = -3

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
             ++++R+KHPK   + L LW LST IG+L+LCG+   S++FP++  F ++ QKKR+ ++ S
Sbjct  4     LMSERLKHPKKWLVRLCLWLLSTCIGSLVLCGRYCFSSKFPYMHSFTQLPQKKRDAVLVS  63

Query  2023  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
             W+ S    +R  + AMK L+LLVFFT V++K +N SWKAIGY GPDP    K  ++K   
Sbjct  64    WSLSYFYHLRMLYKAMKLLILLVFFTQVNEKNENLSWKAIGYKGPDPEFKTKSMQRKTLR  123

Query  1843  heddieEL---------------LFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------  1730
             +E   ++                L+GPLYKG+I++ LP   V + L ++G  V       
Sbjct  124   NEGLNDDDDDEGQNDDGHEEEAELYGPLYKGLINMQLPRNIVADSLRQVGFPVSVRNKRN  183

Query  1729  -AKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGP  1553
              A      PS VI+CDAVVVGSG GGG+I+GVLA AGYKVLVLEKG+Y AR+NLSLLEG 
Sbjct  184   AAPSSIASPSLVIKCDAVVVGSGSGGGLIAGVLAKAGYKVLVLEKGSYCARSNLSLLEGK  243

Query  1552  SMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGS  1373
             +MD+M+L GG+L T D+ ++LLAGSTVGGGS +NWSASIKTP +V  EWC+ + L+LF S
Sbjct  244   TMDQMYLAGGMLATDDMGVILLAGSTVGGGSTINWSASIKTPKHVANEWCDEYELKLFES  303

Query  1372  DVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFG  1193
             D+Y++AM+ VC +MGVQ E E+E F N VLR+GC+ELGYPV NIP+N+P DHYCGWC  G
Sbjct  304   DLYKEAMEVVCERMGVQSEVEEEGFNNAVLRRGCKELGYPVNNIPRNSPPDHYCGWCCLG  363

Query  1192  CKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIH----ERNKAKGVMFTFQRDGVKQT  1025
             CKDG KKGT+ETWLVDLV SGN AILP CEA++V+H    +RN A GV F FQ  G K  
Sbjct  364   CKDGSKKGTSETWLVDLVNSGNSAILPGCEAIEVLHKKRRDRNVATGVAFEFQYMGAKDI  423

Query  1024  AVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGEN  863
              V++SKVT++A GAL+TP+LL  SGLKN NIG+NLHLHPV  AWG+FP T      P E 
Sbjct  424   CVVESKVTIVACGALSTPNLLKRSGLKNANIGKNLHLHPVTMAWGYFPKTSSSGEWPEEK  483

Query  862   KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYART  683
             K SYEG IM+AMST V N   +GYGAVIQTPALHPG+FS+LMPW SG + K+RM +++RT
Sbjct  484   KTSYEGGIMTAMSTTVGNFGKSGYGAVIQTPALHPGMFSSLMPWVSGADIKLRMCKFSRT  543

Query  682   AHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             AHIF LARD+GSG   SP S++Y ++  DEENL++G+EK+LRILAAAGAEEIG +H  G 
Sbjct  544   AHIFVLARDQGSGTVNSPYSISYQMEAMDEENLKKGIEKILRILAAAGAEEIGTHHCKGK  603

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
              + VK AS EEFERFVKEESS+ LR      +SAHQMGSCRMG+DPK SVVN  GETW V
Sbjct  604   IINVKKASSEEFERFVKEESSRPLRDLSTPLSSAHQMGSCRMGIDPKTSVVNQMGETWGV  663

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             EGL++ D SV PTALGVNPMVT+ +++YC +QSVL+ L+
Sbjct  664   EGLYLADTSVFPTALGVNPMVTVQAIAYCTAQSVLDVLR  702



>ref|XP_010111511.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
 gb|EXC31034.1| Long-chain-alcohol oxidase FAO4A [Morus notabilis]
Length=838

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/759 (55%), Positives = 528/759 (70%), Gaps = 37/759 (5%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  2195
             N    +LS  QM+TL A+ + FLP+++ +   T D S+  F+ TSA+   TP ++  +I+
Sbjct  72    NIYESSLSRRQMDTLIAVSDAFLPSVDVS-DLTADESLLKFYATSASMAATPQRLGGMIS  130

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +R+KHPK   L + LW LST  GT ++CG  S+ST FP+   FP +S ++R+ I++SW+ 
Sbjct  131   ERLKHPKKWLLKVALWALSTWFGTFVMCGIASVSTTFPYFHSFPNLSHQRRQEILNSWSQ  190

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI----Sekqkkqkhh  1847
             S    +R  + ++K L  LVFFT VD K  N SWKAIGY GPDP      +      K  
Sbjct  191   SYFFLLRLLYWSLKLLTFLVFFTQVDSKDHNVSWKAIGYTGPDPDFKVQNTTTAATTKLD  250

Query  1846  dheddieELLFGPLYKGIIDLN-LPEE-HVFNRLTKLGCSVAKPKPP-------------  1712
             + +   +E+LFGPL  GI+D   LP +  + N L + G  V + +P              
Sbjct  251   EQQQQQQEILFGPLSSGIVDFKTLPHDLTLINTLKRHGFPVKRRRPCTSILPQERSTHNN  310

Query  1711  -------GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGP  1553
                     P   I CDAVVVGSG GGGV++G+LA AGYKVLVLEKGNYYAR NL+LLEGP
Sbjct  311   KVPSSIFDPFLKIRCDAVVVGSGSGGGVVAGLLARAGYKVLVLEKGNYYARNNLTLLEGP  370

Query  1552  SMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGS  1373
             ++D+M+L  GL+ T D+D++LLAGSTVGGGS +NWSASI TP +V +EWC+ + LELFGS
Sbjct  371   TLDQMYLSNGLMATADMDVLLLAGSTVGGGSTINWSASIPTPQHVRKEWCDEYELELFGS  430

Query  1372  DVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFG  1193
              +Y++A+D VC +M VQ E E+E F N VLRKGC ELGYPV NIP+NAPSDHYCGWC  G
Sbjct  431   KLYEEALDVVCKRMQVQSEIEEEGFNNAVLRKGCEELGYPVDNIPRNAPSDHYCGWCCLG  490

Query  1192  CKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQRD-GV  1034
             CKDGRKKGT+ETWL+DLV+SGNG ILP  EA++V+H      ERN A GV F F+   G 
Sbjct  491   CKDGRKKGTSETWLLDLVESGNGVILPGSEAVKVLHQRKSGRERNTATGVAFEFENSKGD  550

Query  1033  KQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE---N  863
             K+  V++S+VTV+A GAL TP+LL  SGL+N NIG+NLHLHPV  AWG+FPD        
Sbjct  551   KEICVVESRVTVVACGALRTPTLLKRSGLRNPNIGKNLHLHPVAMAWGYFPDNSSSFLAE  610

Query  862   KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYART  683
             KKSYEG IM+AMSTV  ++  +GYG VIQTPALHPG+FS LMPW SG++ K RM R++RT
Sbjct  611   KKSYEGGIMTAMSTVAADLKKSGYGTVIQTPALHPGMFSILMPWVSGKDMKDRMRRFSRT  670

Query  682   AHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             AH+FALARD+GSG   S + + Y ++  DEE L+ G+EK+LRILAAAGAEEIG +HG G 
Sbjct  671   AHVFALARDQGSGTVNSDSEIRYSVEARDEEKLRAGVEKVLRILAAAGAEEIGTHHGKGK  730

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
             ++ VK AS  E ERFVKEES + +R       SAHQMGSCRMGV    S VNP GETWEV
Sbjct  731   SINVKSASYHELERFVKEESGREMRGLRWPICSAHQMGSCRMGVAAATSAVNPMGETWEV  790

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             EGLFV D SV PTALGVNPMVT+ +++YC + SVL+ LK
Sbjct  791   EGLFVADTSVFPTALGVNPMVTVQAIAYCTALSVLQLLK  829



>ref|XP_010676697.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=816

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/780 (53%), Positives = 538/780 (69%), Gaps = 52/780 (7%)
 Frame = -3

Query  2398  SLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGT  2222
             SL  + E    T  LS  +M++L+ALC+T LPA++   PE T D S+  F++TSA+  GT
Sbjct  36    SLLMEGEIQIYTNILSAREMDSLTALCDTILPAVDP--PENTADESLVRFYKTSASMAGT  93

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P  +  +I+ R++H  +  +  LL+ LSTR+GT +  G  SLS  FPF L+F E+S +KR
Sbjct  94    PEHLGRMISHRLRH-HVFLIRFLLFMLSTRLGTFVFGGIHSLSICFPFFLKFSELSLEKR  152

Query  2041  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP-------  1883
             + I+ S +TS     R  F  +K LVLL FFT VD+  +NPSW+AIGYCGPDP       
Sbjct  153   QHILLSLSTSCFILFRMAFVGIKLLVLLAFFTQVDESEENPSWEAIGYCGPDPDFVSKKR  212

Query  1882  -------------SISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKL  1742
                          S       +     +   +  L+GPLYKGII +  P+E +   L + 
Sbjct  213   NESSQSLGYITPKSYHSSPTTEVQAQAQAQSKYDLYGPLYKGIISVKYPQEILTESLKRC  272

Query  1741  GCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTN  1574
             G  V+    K     P   I+CD VVVGSG GGGV++GVLA+AGYKV+V+EKG+YYARTN
Sbjct  273   GIHVSVNRKKKNSEKPKITIQCDVVVVGSGSGGGVVAGVLASAGYKVVVIEKGDYYARTN  332

Query  1573  LSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVH  1394
             LSLLEG ++D M+ G G++ T+DL + +LAGSTVGGGS +NWSASI+TPP+V++EW  VH
Sbjct  333   LSLLEGHTLDHMYEGAGMISTRDLGVNILAGSTVGGGSTINWSASIRTPPHVIKEWANVH  392

Query  1393  GLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHY  1214
              LE+F S +Y++A++ VC KM VQ +  DE F N VLRKGC ELGYP+V+IP+NAP DHY
Sbjct  393   ELEIFDSPLYKEALEVVCEKMEVQSDVSDEGFNNAVLRKGCLELGYPLVDIPRNAPPDHY  452

Query  1213  CGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFT  1052
             CGWC  GCKDGRKKGT ETWL D+V SGNG IL  CE  +V++ R K      AKGVMF 
Sbjct  453   CGWCCLGCKDGRKKGTCETWLKDVVNSGNGVILTGCEVAKVLYGRQKGRNRDTAKGVMFD  512

Query  1051  FQRDGVKQTAVI-KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT  875
                +  + + VI ++K T+IA GAL TP+LL  SGL NKNIG+NLHLHPVV AWG+FPD+
Sbjct  513   ITSNDHQSSCVIVEAKATIIACGALNTPALLRRSGLNNKNIGKNLHLHPVVMAWGYFPDS  572

Query  874   ----------------PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSA  743
                             P + KKSYEG IM+ MSTVV + N +GYGAVIQTP+LHPGLFSA
Sbjct  573   EPLSSLLSDNQGDQVWPQKQKKSYEGGIMTTMSTVVADFNDSGYGAVIQTPSLHPGLFSA  632

Query  742   LMPWNSGQEFKMRMSRYARTAHIFALARDKGSG-EAFSPTSVTYDLDKTDEENLQRGLEK  566
             LMPW SG   K RM++++RTAHIFAL+RD GSG  + SP  ++Y +D  DE NL++G+EK
Sbjct  633   LMPWTSGSNIKHRMTKFSRTAHIFALSRDVGSGIISTSPFDISYMMDPIDEANLKKGVEK  692

Query  565   LLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGS  386
             +LRILAAAGAEEIG +H +G ++ VK A+  EFE+FVK ESS+ ++      ASAHQMGS
Sbjct  693   MLRILAAAGAEEIGTHHNSGESINVKKATYHEFEKFVKRESSKEIQGLSTPVASAHQMGS  752

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             C+MGVDP+ SVVN  GE+W+VEGL++ D SV PTALGVNPMVT+ ++SYC +QSVLE+LK
Sbjct  753   CKMGVDPRTSVVNQMGESWDVEGLYIADSSVFPTALGVNPMVTVQAISYCTAQSVLEYLK  812



>gb|EYU37432.1| hypothetical protein MIMGU_mgv1a022390mg [Erythranthe guttata]
Length=740

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/741 (55%), Positives = 529/741 (71%), Gaps = 37/741 (5%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             ME L+A+C+TFLP+I+     +       F+QTSA+ T TPH +A ++ +++KHPK+   
Sbjct  1     MEELTAVCDTFLPSIHL----SDHHRHHQFYQTSASMTQTPHHLAELLGEKIKHPKIYLS  56

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
              L L+ LSTR+GT +LCG+ SLS +FP+L RF  +   KRE+I+ SW+ S    +R  + 
Sbjct  57    RLALFSLSTRLGTFILCGRKSLSEKFPYLQRFSRVLPHKREQILLSWSESCFSLLRILYA  116

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPD-----PSI-SekqkkqkhhdheddieEL  1820
              +K   LLVFFT V+DK +N SWKAIGY  PD     P + +   +K +    E   E+ 
Sbjct  117   GLKIFTLLVFFTLVNDKDENVSWKAIGYTRPDHKARKPVVHNTPHEKAREKGEECISEKE  176

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECDAvvvgsgc  1661
              FGPLY GI++LN   E    +L K G  V+ P   G       PSF+++CD VVVGSG 
Sbjct  177   RFGPLYNGIVNLNQSREIALCKLEKSGFPVSIPHSNGAKIKSSDPSFIVKCDVVVVGSGS  236

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV++GVLA AGYKVLVLEKG Y AR+NLSLLEG ++D+M+LG G+L T ++D++LLAG
Sbjct  237   GGGVVAGVLAEAGYKVLVLEKGCYIARSNLSLLEGQTIDQMYLGNGVLGTDNMDVLLLAG  296

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGS +NWSASI+TPP+V ++W E H LE+F  ++Y+ A+D VC KMGVQ E + E 
Sbjct  297   STVGGGSTINWSASIRTPPHVRKDWSENHKLEMFDGEIYENALDVVCEKMGVQSEFKQEG  356

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             F + +LRKGC +LGYPV +IP+NA  DH+CGWC  GC+DG+KKG +ETWLVDLV+SGNGA
Sbjct  357   FNSTILRKGCEKLGYPVESIPRNAGPDHHCGWCNLGCRDGKKKGVSETWLVDLVESGNGA  416

Query  1120  ILPECEALQVI----HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             IL ECEAL+VI      + +A GV F F  D VK+ AVI+SK+TV+A GA+ TP LL  S
Sbjct  417   ILTECEALKVIVDQKDRKKRACGVSFMFGSDEVKEIAVIESKITVVACGAICTPPLLKRS  476

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----------KKSYEGAIMSAMSTVVLNVN  803
             GLKN+NIGRNLHLHPVV AWG+FPD+P  +          K+SYEGAIM+AMS VV   +
Sbjct  477   GLKNRNIGRNLHLHPVVNAWGYFPDSPSSSNCNYVWPEAEKRSYEGAIMTAMSKVVEEHS  536

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
             G    A+IQTPALHPG+FSALMPW SG++ K RM +Y+RTAH+FAL RD+GSG   SP  
Sbjct  537   GYS-AAIIQTPALHPGMFSALMPWLSGRDIKDRMVKYSRTAHLFALVRDRGSGFVASPDH  595

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES  443
             V Y +D  D ENL++G+E++LR+LAAAGAEEIG +H  G  LKVK+A  EE ERFV EES
Sbjct  596   VGYKMDGADRENLRKGIERVLRVLAAAGAEEIGTHHRNGRVLKVKEAGEEELERFVVEES  655

Query  442   SQSLRKHPNLK---ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  272
             S+ L +  NL    +SAHQMGSCRMGV P+ S V P GE+WEV  LFV D SV PTALGV
Sbjct  656   SRVLEE--NLSWPISSAHQMGSCRMGVGPRGSAVGPTGESWEVGALFVADASVFPTALGV  713

Query  271   NPMVTIMSVSYCISQSVLEFL  209
             NPMVT+ +++YC++Q V++ L
Sbjct  714   NPMVTVQAIAYCVAQCVVQSL  734



>ref|XP_008444238.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Cucumis 
melo]
Length=821

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/747 (56%), Positives = 529/747 (71%), Gaps = 32/747 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             LS ++ME+L+ALC+TFLP++  A     D S   FF+TSA++ GTP +V  +I +R++HP
Sbjct  73    LSAAEMESLAALCDTFLPSVAPAT--AADRSTAVFFETSASAVGTPERVGEMIMERVRHP  130

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
             K   + + LW LST  GT +LCG  SLS  FP+  RF ++SQKKRE+I  SW+ S    +
Sbjct  131   KKWLVRVSLWMLSTWYGTYILCGNESLSNHFPYFKRFSKVSQKKREQIALSWSLSYFFLL  190

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI----------Sekqkkqkhh  1847
             R FF  +K L LL FFT VD++ +N SWKAI Y G DP            S+ ++  +  
Sbjct  191   RMFFRTIKILCLLAFFTQVDEEMNNISWKAIDYPGSDPQFKPPSNLKEKDSKSREVDEEG  250

Query  1846  dheddieELLFGPLYKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECD  1685
             D E++  E L+GPL+KGI++L   ++       L K G  V       KPP PS +I+CD
Sbjct  251   DEEEEEAEELYGPLFKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCD  310

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AVVVGSG GGGV++GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T +
Sbjct  311   AVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDN  370

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
             +++++LAGSTVGGGS VNWSASIKTP +V +EW + + LELF S++Y++A+D VC KMGV
Sbjct  371   MNVLILAGSTVGGGSTVNWSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGV  430

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
             Q + ++E F N VLRKGC ELG   +NIP+N+ SDHYCGWC  GC+DGRKKGTAETWLVD
Sbjct  431   QSKIDNEGFNNAVLRKGCEELGGHAINIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVD  490

Query  1144  LVKSGNGAILPECEALQVIH------ERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGG  986
             LV+SGNG ILP CEA+++        ER  AKGV F F      KQ  +++SKVT++A G
Sbjct  491   LVRSGNGVILPGCEAIKIRQEKKQGRERKMAKGVAFEFWCGSAAKQMCLVESKVTIVACG  550

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMST  821
             AL TP LL  SGL+N NIG+NLHLHPV  AWG+FP       P ++KKSYEG IM+AM  
Sbjct  551   ALNTPPLLKRSGLRNPNIGKNLHLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCN  610

Query  820   VVLNVNGT-GY-GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
             +    N   GY GAVIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGS
Sbjct  611   IGPEPNQEPGYGGAVIQTPALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGS  670

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             G   SP+S++Y +D  DE+NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+
Sbjct  671   GTVKSPSSLSYKMDNVDEQNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREY  730

Query  466   ERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
             E+FVKEESS+ L+       SAHQMGSCRMG   K SVVN +GETWEVEGLF+ D SV P
Sbjct  731   EKFVKEESSRPLKDLLTPICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFP  790

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             TALGVNPMVT+ +++YC +QSVLE LK
Sbjct  791   TALGVNPMVTVQAIAYCTAQSVLETLK  817



>ref|XP_010676700.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Beta vulgaris 
subsp. vulgaris]
Length=808

 Score =   766 bits (1979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/770 (54%), Positives = 543/770 (71%), Gaps = 48/770 (6%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPE-TTDASVTNFFQTSAASTGTPHQVAW  2204
             E  T T  LS  +ME+L+ALC+T LPA++   PE TTD SV  F++TSA+  GTP  V  
Sbjct  37    EKQTYTNKLSSWEMESLTALCDTLLPAVDP--PESTTDESVVRFYRTSASMNGTPEHVGR  94

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKG----SLSTQFPFLLRFPEISQKKRER  2036
             +I+QR++   +    ++L  L+TR+GT +L   G    +LS ++PFLL+  E+S +KR++
Sbjct  95    MISQRLRQ-HVLLGRIILVLLATRLGTFVLGLLGGGLPNLSPRYPFLLKCSEMSLEKRQQ  153

Query  2035  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGD-NPSWKAIGYCGPDPS-ISekqk  1862
             +V SW TS    +R  F  MK L+ +V+FT VDD  D NP W+AIGYCGPDP  IS+K  
Sbjct  154   LVLSWRTSWFYLVRMIFFGMKRLISVVYFTQVDDNEDYNPIWEAIGYCGPDPYFISKKAS  213

Query  1861  kqkhhdheddieEL-------LFGPLYKGIIDLNLPEEHVFNRL--TKLGCSVAKPKPPG  1709
             +          + L       L GPLYKGII++   +E +   L  +    S+ + K   
Sbjct  214   ESNKQSAYLTPKSLHNQPKEDLCGPLYKGIINVKCTQEILIESLKHSNFQVSINRKKKDC  273

Query  1708  PSFVI--ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  1535
                VI  +CD VVVGSG GGGV +GVLA+ GYKVLV++KG+YYARTNLSLLEGP++D+M+
Sbjct  274   QMQVITIKCDVVVVGSGSGGGVAAGVLASLGYKVLVIDKGDYYARTNLSLLEGPTLDQMY  333

Query  1534  LGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKA  1355
              G GLL TKDL + +LAGSTVGGGS +NWSASI+TPP+V++EW +VH LE+F S +Y++A
Sbjct  334   EGAGLLSTKDLGVNILAGSTVGGGSTINWSASIRTPPHVIKEWADVHELEIFDSPLYKEA  393

Query  1354  MDTVCGKMGVQRECE--DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG  1181
             +D VC KM VQ + +  DE F N VLRKGC ELGYPVVNIPQNAP +H CGWC  GCKDG
Sbjct  394   LDVVCEKMEVQSDIDVSDEGFNNAVLRKGCLELGYPVVNIPQNAPKNHNCGWCCLGCKDG  453

Query  1180  RKKGTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTA-  1022
             +KK T ETWL D+V SGNGAIL  CE  +V++ R K      AKGVMF       +Q++ 
Sbjct  454   KKKSTCETWLKDVVNSGNGAILTGCEVAKVLYGRQKGRNRDTAKGVMFDITSSNDRQSSC  513

Query  1021  -VIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT----------  875
              ++++K T+IA GAL TP+LL  SGL NKNIG+NLHLHPVV AWG+FPD+          
Sbjct  514   VIVEAKATIIACGALNTPALLRRSGLNNKNIGKNLHLHPVVMAWGYFPDSEPLSSLLSDN  573

Query  874   ------PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEF  713
                   P + KKSYEG IM+ MSTVV + N +GYG VIQTP+LHPGLFSA+MPW SG   
Sbjct  574   QGDQVWPEKQKKSYEGGIMTTMSTVVADFNDSGYGTVIQTPSLHPGLFSAMMPWTSGLNI  633

Query  712   KMRMSRYARTAHIFALARDKGSGE-AFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGA  536
             K RM++++RT+H+FALARD GSG  + SP  + Y +   DE NLQ+G+EK+LRILAAAGA
Sbjct  634   KHRMTKFSRTSHMFALARDMGSGVISTSPFDIKYKMHPIDEANLQKGIEKMLRILAAAGA  693

Query  535   EEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKAS  356
             EEIG +H +G ++ VK AS  EFE+FVK+ESS++++      ASAHQMGSCRMG++P+ S
Sbjct  694   EEIGTHHYSGSSINVKKASFHEFEKFVKKESSKAIQGLSMPIASAHQMGSCRMGINPRTS  753

Query  355   VVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             VVN +GE+WEVEGL++ D SV PTALGVNPMVT+ ++SYC +QSVLEFL+
Sbjct  754   VVNQRGESWEVEGLYLADSSVFPTALGVNPMVTVQAISYCTTQSVLEFLR  803



>ref|XP_010538590.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X1 [Tarenaya 
hassleriana]
Length=782

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/749 (55%), Positives = 521/749 (70%), Gaps = 31/749 (4%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             +L+  +ME+L A+C+T +P+IN +     D  V  FF  SA+  GTP +VA  I+  + H
Sbjct  32    SLTAREMESLWAICDTLIPSINGSEVCHVDDHVAGFFAASASQMGTPDRVARKISGTLDH  91

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             PK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE I+ SWA+S    
Sbjct  92    PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-----DPSISekqkkqkhhdhed  1835
             +R FF AMK +  LVFFT VD+KG N +W+AI Y GP     D    ++   ++H +   
Sbjct  152   LRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDSEDSDQEDQTIHREHQEKTK  211

Query  1834  dieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPKPPG-----PSFV  1697
                E +FGP+Y GI+DL  P E V   L + G  V+         + + PG     P   
Sbjct  212   KEPEQIFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDRRPGSSISDPVMK  271

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG +M++M+L  GL+
Sbjct  272   IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQAMEQMYLSSGLV  331

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D++ V+LAGS+VGGGS VNWSASI+TP  V++EW E  GL+LF S  Y++AMD VC 
Sbjct  332   ATADMNTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKLFESGFYREAMDVVCE  391

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             +MGVQ    +E F N +LRKGC  LG+PV +IP+N+ +DHYCG+C FGCK GRKKGTAET
Sbjct  392   RMGVQSGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFCCFGCKKGRKKGTAET  451

Query  1156  WLVDLVKSGNGAILPECEALQVIHERNKAK----GVMFTFQR--DGVKQTAVIKSKVTVI  995
             WLVDLV SGNG ILP CEALQV+  R + K    GV F F+   +  K+  V++SKVT++
Sbjct  452   WLVDLVDSGNGVILPGCEALQVLQRRERGKKTAAGVAFLFENIDEARKEIYVVESKVTIV  511

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT--PGENKKSYEGAIMSAMST  821
             A GAL TP LL NSGLKN NIGRNL LHPV  AWG FP+   PG+ KKSYEG IM+ MST
Sbjct  512   ACGALRTPILLRNSGLKNPNIGRNLCLHPVAMAWGWFPEEKWPGKGKKSYEGGIMTTMST  571

Query  820   VVLNV---NGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             V  +    +   YG  +IQTPALHPG+FS ++PW SG+++K RM +++RTAH+FAL RDK
Sbjct  572   VSADAEVESPNSYGTTIIQTPALHPGMFSGIIPWTSGKDYKNRMLKFSRTAHVFALTRDK  631

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSGE  S  S+TY L+ TDEENL++G+E++LRIL AAGAEEIG ++  G +L VK AS E
Sbjct  632   GSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAASSE  691

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             E+ERFV+EESS+ L+       SAHQMGSCRMGV  + S V P GETWEVEGLFV D SV
Sbjct  692   EYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSV  751

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              PTALGVNPMVT+ +++YC+   V++ LK
Sbjct  752   FPTALGVNPMVTVQAIAYCVGSYVIDVLK  780



>ref|XP_006283177.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=761

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/753 (54%), Positives = 532/753 (71%), Gaps = 27/753 (4%)
 Frame = -3

Query  2389  RKMENNTA---TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGT  2222
             R+  N T      +L+  +METL A C+T +P+I+   +    D SV  +F  SA+ TGT
Sbjct  14    RRQTNETKPFYANSLTQREMETLVAFCDTLIPSIDGSGVGGHVDDSVAEYFAASASQTGT  73

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA ++++R+ HPK   L + LW LST IG+L+LCG+ S + +FP+  RF  +  K+R
Sbjct  74    PDRVARLMSERLDHPKKWILRVALWLLSTWIGSLVLCGRRSFTGEFPYFRRFCRLPTKQR  133

Query  2041  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             E I+ +W+ S    +R FF  +K +   VFFT VD+KG N +WKAIGY GP    S+   
Sbjct  134   EAILLNWSESYFSLLRMFFRCIKLITAFVFFTQVDEKGRNLAWKAIGYNGPSLDDSDHDL  193

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--KPKPPG-----PS  1703
             +++ ++ +   EE+ FGPLY GI+DLN P E V  +LT  G +V+  K K  G     P 
Sbjct  194   EEELNEKKKKPEEI-FGPLYNGIVDLNCPREAVTKKLTGRGFTVSSQKNKSKGSSLSNPV  252

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I CDAVVVGSG GGGV++GVLA AGYKVLV+E GNYYAR+NLSLLEG +M+ M+L GG
Sbjct  253   MTIRCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSNLSLLEGQAMEDMYLSGG  312

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             LL T D ++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGSD+Y++AMD V
Sbjct  313   LLATSDTNVVILAGSTVGGGSTINWSASIKTPEHVMKEWTEKSKLEMFGSDLYREAMDVV  372

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C +MGVQ    +E F N +LRKGC ELG PV NIP+NAPSDHYCG C  GCK G+K+GT+
Sbjct  373   CERMGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGHCCLGCKKGQKQGTS  432

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKV  1004
             ETWLVDLV+SGNG ILP C+A++V++E       + KA GV F F     ++  V++S+ 
Sbjct  433   ETWLVDLVQSGNGLILPGCKAMEVLYECEQGKKNKKKATGVAFAFG----EEIYVVESRA  488

Query  1003  TVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMS  833
             TV+A GAL TP LL  SGLKN NIGRNL LHPVV AWG FP+    P + K SYEG IM+
Sbjct  489   TVVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPEGEKWPEKKKMSYEGGIMT  548

Query  832   AMSTVVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             AMS+VV     + YG  VIQTPALHPG+FS + PW S ++FK RM +++RTAHIFAL RD
Sbjct  549   AMSSVVNAETQSSYGETVIQTPALHPGMFSGVTPWASSKDFKTRMLKFSRTAHIFALLRD  608

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
             KG+G   S + + Y+L+  DEE+L++GLE++L+I+AAAGAEEIG ++  G +L V+ AS 
Sbjct  609   KGTGTINSKSYIDYNLNDEDEESLKKGLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRASA  668

Query  475   EEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS  296
              EFERFV+EESS+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D S
Sbjct  669   VEFERFVREESSKPLKNLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTS  728

Query  295   VLPTALGVNPMVTIMSVSYCISQSVLEFLKTHD  197
             V PTALGVNPMVT+ S++YCI  +V++ LK ++
Sbjct  729   VFPTALGVNPMVTVQSIAYCIGLNVVDVLKRNN  761



>ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName: Full=Long-chain 
fatty alcohol oxidase 4A [Arabidopsis thaliana]
 gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
Length=726

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/728 (55%), Positives = 516/728 (71%), Gaps = 21/728 (3%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             ME+L A+C+TF+ +I+++     D  V  +F  SA+ TGTP +VA ++++R+ HPK   L
Sbjct  1     MESLVAICDTFISSIDDSGVGHVDDCVAGYFSASASQTGTPDRVARLMSERLHHPKKWIL  60

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
                LW LST IG+L+LCG  S + +FP+  RF  + +K+RE I+ +W++S    +R  F 
Sbjct  61    RAGLWLLSTWIGSLVLCGWRSFTGEFPYFRRFCRLPEKRREEILLNWSSSYFSLLRMLFR  120

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
              +K +  LVFFT VD+KG N +WKAIGY GP P  S+ + +      +   EE+ FGPLY
Sbjct  121   TIKLISALVFFTQVDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEKKKKKPEEI-FGPLY  179

Query  1801  KGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvis  1643
              GI+DL  P E V  +L   G +V+  K          P   I+CDAVVVGSG GGGV +
Sbjct  180   NGIVDLKSPREAVEKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSGSGGGVAA  239

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
             GVLA AGYKVLV+E GNYYAR+ LSLLEG +MD M+L GGLL T D ++V+LAGSTVGGG
Sbjct  240   GVLAKAGYKVLVIESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGGG  299

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             S +NWSASIKTP +V++EW E   LE+FGSD+Y++AMD VC +MGVQ    +E F N VL
Sbjct  300   STINWSASIKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEEGFNNEVL  359

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC +LG PV NIP+NAPSDHYCG+C  GCK G+K+GT+ETWLVDLV+S NG ILP C+
Sbjct  360   RKGCEKLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESDNGLILPGCQ  419

Query  1102  ALQVIHE-----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNK  938
             A +V+++     + KA GV F F     ++  V++S+VT++A GAL TP LL  SGLKN 
Sbjct  420   ATEVMYDCEQGKKKKATGVAFAFG----EEIYVVESRVTIVACGALRTPHLLKRSGLKNS  475

Query  937   NIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYGA-VIQTP  770
             NIGRNL LHPVV AWG FP+    P + KKSYEG IM+AMS+VV+    + YG  VIQTP
Sbjct  476   NIGRNLCLHPVVMAWGWFPEEDKWPEKKKKSYEGGIMTAMSSVVIEETHSSYGEMVIQTP  535

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             ALHPG+FS ++PW S ++FK RM +++RTAHIFAL RDKG+G   S T + Y+L+  DEE
Sbjct  536   ALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTYIDYNLNDEDEE  595

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLK  410
             +L+ GLE++L+ILAAAGAEEIG +H  G +L V+ AS  E ERFV+EESS+ L+      
Sbjct  596   SLKNGLERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKDLSGQI  655

Query  409   ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCIS  230
              SAHQMGSCRMG+ P+ S V P GETWEVE LFV D SV PTALGVNPMVT+ S++YCI 
Sbjct  656   CSAHQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIG  715

Query  229   QSVLEFLK  206
              +V++ LK
Sbjct  716   LNVVDVLK  723



>ref|XP_010274420.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Nelumbo 
nucifera]
Length=728

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/756 (54%), Positives = 500/756 (66%), Gaps = 76/756 (10%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             E  T   +LS  +M +L  LC+T LP+IN +  +  D S++NF+  SA++T TP      
Sbjct  13    EKTTTVNSLSSREMHSLCTLCDTLLPSINHSATDEDD-SLSNFYWASASTTATPQ-----  66

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
                                                       L+F ++SQKKRE I+ SW
Sbjct  67    ------------------------------------------LKFSQVSQKKREEILLSW  84

Query  2020  ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
             +TSS   +R  F   K L+L VFFT VD+K +NPSWKA+GYCGPDP    + +  K    
Sbjct  85    STSSFSLLRMLFKIFKLLLLFVFFTQVDEKNENPSWKALGYCGPDPDFKHQTQASKTDQD  144

Query  1840  eddieEL-----LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA--------KPKPPGPSF  1700
             +   EE      LFGPLY+ +I+   P + +   L + G  V          P    PS 
Sbjct  145   DLTSEEEEKKEELFGPLYRRLINPRHPRQSIAEYLEQSGFPVTINHFHGNKTPSISSPSL  204

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              I CDAVVVGSG GG V + VLA AGYKVLVLEKG Y+AR NLSLLEGPS+++M+L GGL
Sbjct  205   TIRCDAVVVGSGSGGSVAAAVLAKAGYKVLVLEKGKYFARNNLSLLEGPSLEQMYLDGGL  264

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               T DL + L AG+TVGGGS VNWSASI+TP +V+ EWC  H LELF    Y +AMD VC
Sbjct  265   TATDDLGVFLFAGATVGGGSTVNWSASIRTPGHVMEEWCYSHKLELFDRKPYNRAMDVVC  324

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              +MGVQ +  +ESF N VLR+GC ELGYPV  + QNAP DHYCGWC FGCKDG+K+GTAE
Sbjct  325   NRMGVQVDTREESFNNAVLRRGCLELGYPVSRVSQNAPMDHYCGWCGFGCKDGKKQGTAE  384

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQR-DGVKQTAVIKSKVT  1001
             TWLVDLV SGNG ILP CEAL+V+HER +      A GV F      G     V++SKVT
Sbjct  385   TWLVDLVDSGNGVILPGCEALKVLHERKRRNDRSTAIGVAFRLDNGSGGHDICVVESKVT  444

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG--------ENKKSYEG  845
             V+A GAL TP LL  SGLKN NIG++L +HPVV AWG+F D P         ++K+SYEG
Sbjct  445   VVACGALRTPVLLKRSGLKNTNIGKHLRVHPVVLAWGYFADEPASSNGDEWVKDKRSYEG  504

Query  844   AIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFAL  665
              I+++MSTVV    G+GYGA++QTP+LHPGLFS LMPW SG +FK RMSR++RTAH+FAL
Sbjct  505   GILTSMSTVVAGFEGSGYGAILQTPSLHPGLFSVLMPWVSGADFKERMSRFSRTAHVFAL  564

Query  664   ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  485
             ARDKGSG+  S +S++Y LD  DEENL +G+EK+LRILAAAGAEEIG +H  G  L VK 
Sbjct  565   ARDKGSGQVNSESSLSYRLDAIDEENLSKGVEKMLRILAAAGAEEIGTHHCEGRKLNVKR  624

Query  484   ASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
             AS++EFE+FVKEES + L       ASAHQMGSCRMGVD   SVV P+GETWEVEGLFV 
Sbjct  625   ASKDEFEKFVKEESGRKLGGLSTPVASAHQMGSCRMGVDRDKSVVCPRGETWEVEGLFVA  684

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTHD  197
             D SV PTALGVNPMVT+ ++SYC + SV+EFL+ +D
Sbjct  685   DTSVFPTALGVNPMVTVQAISYCTAHSVIEFLERND  720



>ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/728 (55%), Positives = 514/728 (71%), Gaps = 22/728 (3%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             ME+L A+C+TF+ +I+ +     D  V  +F  SA+ TGTP + A ++++R+ HPK   L
Sbjct  1     MESLVAICDTFISSIDGSGVGHVDDCVAGYFSASASQTGTPDRAARLMSERLHHPKKWIL  60

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
                LW LST IGTL+LCG+ S + QFP+  RF  + +K+RE I+ +W++S    +R FF 
Sbjct  61    RAGLWLLSTWIGTLILCGRRSFTGQFPYFRRFCRLPEKQREEILLNWSSSYFSLLRMFFR  120

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
             ++K +   VFFT VD+ G N +WKAIGY GP    S+ + +      +   E  +FGPLY
Sbjct  121   SIKLITAFVFFTQVDENGRNLAWKAIGYDGPSSDHSDHEVELNEKMQKKPEE--IFGPLY  178

Query  1801  KGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECDAvvvgsgcgggvis  1643
              GIIDL  P E V  +LT  G +V+  K    G S       I CDAVVVGSG GGGV++
Sbjct  179   NGIIDLQSPREAVAKKLTGHGFTVSTQKRNTNGSSISDLVMTIRCDAVVVGSGSGGGVVA  238

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
             GVLA AGYKVLV+E G YYAR+ LSLLEG +MD M+L GGLL T D ++V+LAGSTVGGG
Sbjct  239   GVLAKAGYKVLVVESGTYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGGG  298

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             S +NWSASIKTP +V++EW E   LE+FGSD+Y++AMD VC +MGVQ    +E F N +L
Sbjct  299   STINWSASIKTPEHVIKEWAEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEIL  358

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC ELG PV NIP+NA SDHYCG+C  GCK G+K+GT+ETWLVDLV+SGNG ILP CE
Sbjct  359   RKGCEELGLPVKNIPRNAASDHYCGFCCLGCKKGQKQGTSETWLVDLVESGNGLILPGCE  418

Query  1102  ALQVIHE-----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNK  938
             A++V+++     + KA GV F +     ++  V++SK TV+A GAL TP LL  SGL+N 
Sbjct  419   AMEVLYDCGRGKKKKATGVAFAYG----EEIYVVESKTTVVACGALRTPHLLKRSGLRNG  474

Query  937   NIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYGA-VIQTP  770
             NIGRNL LHPVV AWG FPD    P + KKSYEG IM+AMS+VV     + YG  VIQTP
Sbjct  475   NIGRNLCLHPVVMAWGWFPDEDKWPEKKKKSYEGGIMTAMSSVVNAETHSSYGEMVIQTP  534

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             ALHPG+FS ++PW S ++FK RM +++RTAHIFAL RDKG+G   S + + Y+L+  DEE
Sbjct  535   ALHPGMFSGIIPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSYIDYNLNDEDEE  594

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLK  410
             +L+ GL+++L+ILAAAGAEEIG +H  G +L V+ AS  E ERFV+EESS+ L+      
Sbjct  595   SLKSGLDRVLKILAAAGAEEIGTHHSEGRSLNVRTASTLEIERFVREESSKPLKDLSGQI  654

Query  409   ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCIS  230
              SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMVT+ S++YCI 
Sbjct  655   CSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIG  714

Query  229   QSVLEFLK  206
              +V++ LK
Sbjct  715   LNVVDVLK  722



>ref|XP_006413983.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
 gb|ESQ55436.1| hypothetical protein EUTSA_v10024528mg [Eutrema salsugineum]
Length=728

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/729 (54%), Positives = 513/729 (70%), Gaps = 21/729 (3%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             ME+L A+C+T +P+I+ +     D  V  ++  SA+ TG P +VA +I++R+ HPK   L
Sbjct  1     MESLVAICDTLIPSIDGSEVGHVDDGVAGYYSASASQTGAPDRVARLISERLDHPKKWIL  60

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
                +W LST IG+L+LCG+ S +++FP+  RF  + +K+RE I+ +WA+S    +R  F 
Sbjct  61    RAAMWSLSTWIGSLVLCGRRSFTSEFPYFQRFCRLPEKQREEILLNWASSYFLLLRMLFR  120

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
             ++K +  LVFFT VD+KG N +WKAIGY GP    S+  ++      +    E +FGPLY
Sbjct  121   SIKLITSLVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHDEELNEKKTKKKKPEEIFGPLY  180

Query  1801  KGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvis  1643
              GIIDL  P E V  +LT  G  V   K          P   I+CDAVVVGSG GGGV++
Sbjct  181   NGIIDLKNPREAVVKKLTGHGFRVLTQKRNKNGSSISDPVMTIQCDAVVVGSGSGGGVVA  240

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
             GVLA AGYKVLV+EKGNYYAR  LSLLEG +MD+M+L GGLL T D+++V+LAGSTVGGG
Sbjct  241   GVLAKAGYKVLVVEKGNYYARNKLSLLEGQAMDEMYLSGGLLATSDMNVVILAGSTVGGG  300

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             S +NWSASIKTP +V++EW E   LE+FGSD+Y+KAMD VC +MGVQ    +E F N +L
Sbjct  301   STINWSASIKTPEHVMKEWSENSELEMFGSDLYRKAMDVVCERMGVQCGFVEEGFNNEIL  360

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC ELG  V NIP+N+PSDHYCG+C  GCK G+K+GT+ETWLVDLVKSGNG ILP CE
Sbjct  361   RKGCEELGLTVKNIPRNSPSDHYCGFCCLGCKKGQKQGTSETWLVDLVKSGNGLILPGCE  420

Query  1102  ALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKN  941
             A++V++E      +  A G+ F F+    ++  V++SK T++A GAL TP LL  SGLKN
Sbjct  421   AMEVLYECQNGKKKKTATGLAFAFE----EEVYVVESKATIVACGALRTPHLLKRSGLKN  476

Query  940   KNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMSTVVLNVNGTGYG-AVIQT  773
             +NIGRNL LHPVV AWG F      P + KKSYEG IM+AMS VV     T YG  VIQT
Sbjct  477   RNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSGVVNTETKTSYGETVIQT  536

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PALHPG+FS ++PW SG+EFK RM +++RTAH+F L RDKG+G   S + + Y+L+  DE
Sbjct  537   PALHPGMFSGIIPWTSGEEFKSRMLKFSRTAHVFTLLRDKGTGTVNSKSCIDYNLNDEDE  596

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNL  413
             E+L++GLE++L IL AAGAEEIG ++  G +L V+ AS  E ERFV+EESS+ L+     
Sbjct  597   ESLKKGLERVLNILIAAGAEEIGTHNSEGKSLNVRTASEAEIERFVREESSKGLKDLAGQ  656

Query  412   KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI  233
               SAHQMGSCRMG+ P+ S V P GETWEV GL+V D SV PTALGVNPMVT+ S++YCI
Sbjct  657   ICSAHQMGSCRMGIRPEESAVRPTGETWEVGGLYVADTSVFPTALGVNPMVTVQSIAYCI  716

Query  232   SQSVLEFLK  206
               +V++ L+
Sbjct  717   GLNVVDVLR  725



>ref|XP_010449364.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Camelina sativa]
Length=768

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/746 (54%), Positives = 520/746 (70%), Gaps = 24/746 (3%)
 Frame = -3

Query  2392  HRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQ  2213
              RK        +L+  +ME+L A+C+T +P+I+ +     D SV  +F  SA+ TGTP +
Sbjct  28    QRKETKPFYANSLTQREMESLVAICDTLIPSIDGSGVGHVDDSVAEYFSASASQTGTPDR  87

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA +I++R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE +
Sbjct  88    VAKLISERLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDV  147

Query  2032  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  1853
             + +W+ S    +R FF  +K +  LVFFT VD KG N +WKAIGY GP    S+ Q++  
Sbjct  148   LLNWSASYFSLLRMFFKCIKLITGLVFFTQVDGKGRNLAWKAIGYNGPSLDDSDLQEELN  207

Query  1852  hhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP--PGPSF-----VI  1694
                 + D    +FGPLY GI+DL  P E V  +LT  G +V+ PK    G S       I
Sbjct  208   EKKKKPDE---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKIQKGSSLSNRVMTI  264

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
              CDAVVVGSG GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L GGLL 
Sbjct  265   RCDAVVVGSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLA  324

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T D+++V+LAGSTVGGGS +NWSASIKTP +V+ EW E   LE+FGSD Y++AMD VC +
Sbjct  325   TSDMNVVVLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKR  384

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGVQ    +E F N +LRKGC ELG PV NIP+NAPSDHYCG+C  GCK G+K+GT+ETW
Sbjct  385   MGVQCGFVEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETW  444

Query  1153  LVDLVKSGNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             LVDLV+SGNG ILP CE ++V++E      + KA GV F F     ++  V++S+ TV+A
Sbjct  445   LVDLVESGNGLILPGCEVMEVLYECEQGKKKKKASGVSFAFG----EEIYVVESRATVVA  500

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMST  821
              GAL TP LL  SGLKN NIGRNL LHPVV AWG FP     P + K SYEG IM+AMS+
Sbjct  501   CGALKTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPKEDKWPEKKKMSYEGGIMTAMSS  560

Query  820   VVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG  644
             VV     + YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIFAL RDKG+G
Sbjct  561   VVNAKTQSSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTG  620

Query  643   EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE  464
                S + + Y+L+  DEE+LQ+GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E E
Sbjct  621   TVNSTSCIDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIE  680

Query  463   RFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT  284
             RFV+EESS+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PT
Sbjct  681   RFVREESSKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPT  740

Query  283   ALGVNPMVTIMSVSYCISQSVLEFLK  206
             ALGVNPMVT+ S++YCI  +V++ LK
Sbjct  741   ALGVNPMVTVQSIAYCIGLNVVDVLK  766



>gb|KHN27504.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=638

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/634 (61%), Positives = 475/634 (75%), Gaps = 25/634 (4%)
 Frame = -3

Query  2032  VHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek-----  1868
             + SW+ S L+ +R FF  +K L LLVFFT +D+  DNPSWKAIGYCGPDP    +     
Sbjct  1     MQSWSLSYLRPLRMFFRTIKLLTLLVFFTQLDEAEDNPSWKAIGYCGPDPEFKSQLKNHF  60

Query  1867  -qkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-AKPKP------P  1712
               K++   + EDD  E + GPLYKG+I +N P + + + L ++G SV A PK        
Sbjct  61    FTKQRGQEEKEDDGTEDVRGPLYKGLIRINNPRDIITDSLRRVGFSVSATPKKTKASTLS  120

Query  1711  GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  1532
              PS VI+CDAVVVGSG GGGV++GVLA AGYKVLVLEKG+Y AR NLSLLEGPSMD+M+L
Sbjct  121   SPSLVIKCDAVVVGSGSGGGVVAGVLANAGYKVLVLEKGSYSARNNLSLLEGPSMDQMYL  180

Query  1531  GGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAM  1352
               GL+ T D+ +++LAGSTVGGGSA+NWSASI+TP +V +EWC+ H LELF S +Y++A+
Sbjct  181   SNGLVATNDMSVLILAGSTVGGGSAINWSASIRTPQHVCKEWCDRHELELFESMLYKEAL  240

Query  1351  DTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKK  1172
             D VC KMGVQ E +DE F N VLR+GC E+GYPV NIP+NA SDHYCGWC  GCKDGRKK
Sbjct  241   DVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGYPVCNIPRNATSDHYCGWCCLGCKDGRKK  300

Query  1171  GTAETWLVDLVKSGNGAILPECEALQVIHERNK------AKGVMFTFQRDGVKQTAVIKS  1010
             GT ETWLVDLVKSGNGAI+P CEA+QV+H++ K      A+GV F  +  G K   V++S
Sbjct  301   GTLETWLVDLVKSGNGAIIPSCEAIQVLHKKKKGRHRKIARGVAFAIEYKGKKDICVVES  360

Query  1009  KVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG------ENKKSYE  848
             KVT++A GAL+TP+LL  SGLKN+NIGRNLHLHPV  AWG+FPD+P       ++KKSYE
Sbjct  361   KVTIVACGALSTPALLKRSGLKNENIGRNLHLHPVAMAWGYFPDSPSPELWPEKHKKSYE  420

Query  847   GAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFA  668
             G IM+AMSTVV   + +GYG VIQTPALHPG+FS LMPW SG + K RM +++RTAH+FA
Sbjct  421   GGIMTAMSTVVAQFDKSGYGTVIQTPALHPGMFSILMPWTSGADIKDRMRKFSRTAHVFA  480

Query  667   LARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK  488
             LARD+GSG   SP+ ++Y L   D+ENL+ GLEK+LRILAAAGAEEIG ++  G  + VK
Sbjct  481   LARDQGSGTVNSPSCISYQLKDIDKENLKVGLEKVLRILAAAGAEEIGTHNNKGRRINVK  540

Query  487   DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
               S  EFE+FVKEESS SL        SAHQMGSC+MG +P+ SVVN  GETWEVEGL++
Sbjct  541   QVSYHEFEKFVKEESSMSLTDISTPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYL  600

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              D SV PTALGVNPMVT+ ++SYC +Q VLE L+
Sbjct  601   ADSSVFPTALGVNPMVTVQAISYCTAQYVLEVLR  634



>ref|XP_010538591.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Tarenaya 
hassleriana]
Length=765

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/732 (55%), Positives = 509/732 (70%), Gaps = 31/732 (4%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             +L+  +ME+L A+C+T +P+IN +     D  V  FF  SA+  GTP +VA  I+  + H
Sbjct  32    SLTAREMESLWAICDTLIPSINGSEVCHVDDHVAGFFAASASQMGTPDRVARKISGTLDH  91

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             PK   L   LW LST IG+L+LCG+ S S +FP+  RF  + QK+RE I+ SWA+S    
Sbjct  92    PKKWLLRAALWLLSTHIGSLVLCGRKSFSGEFPYCRRFCRLPQKQREEIMLSWASSFFSL  151

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-----DPSISekqkkqkhhdhed  1835
             +R FF AMK +  LVFFT VD+KG N +W+AI Y GP     D    ++   ++H +   
Sbjct  152   LRMFFKAMKLITALVFFTQVDEKGKNLAWEAIRYTGPISDSEDSDQEDQTIHREHQEKTK  211

Query  1834  dieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA---------KPKPPG-----PSFV  1697
                E +FGP+Y GI+DL  P E V   L + G  V+         + + PG     P   
Sbjct  212   KEPEQIFGPIYNGIVDLMNPREVVIETLNRHGFQVSTRTGKNSHGRDRRPGSSISDPVMK  271

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I CDAVVVGSG GGGV++GVLA AGYKVLVLEKGNYYAR NLSLLEG +M++M+L  GL+
Sbjct  272   IRCDAVVVGSGSGGGVVAGVLAKAGYKVLVLEKGNYYARNNLSLLEGQAMEQMYLSSGLV  331

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D++ V+LAGS+VGGGS VNWSASI+TP  V++EW E  GL+LF S  Y++AMD VC 
Sbjct  332   ATADMNTVILAGSSVGGGSTVNWSASIRTPENVIKEWSEKCGLKLFESGFYREAMDVVCE  391

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             +MGVQ    +E F N +LRKGC  LG+PV +IP+N+ +DHYCG+C FGCK GRKKGTAET
Sbjct  392   RMGVQSGFVEEGFNNEILRKGCEALGFPVKSIPRNSLADHYCGFCCFGCKKGRKKGTAET  451

Query  1156  WLVDLVKSGNGAILPECEALQVIHERNKAK----GVMFTFQR--DGVKQTAVIKSKVTVI  995
             WLVDLV SGNG ILP CEALQV+  R + K    GV F F+   +  K+  V++SKVT++
Sbjct  452   WLVDLVDSGNGVILPGCEALQVLQRRERGKKTAAGVAFLFENIDEARKEIYVVESKVTIV  511

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT--PGENKKSYEGAIMSAMST  821
             A GAL TP LL NSGLKN NIGRNL LHPV  AWG FP+   PG+ KKSYEG IM+ MST
Sbjct  512   ACGALRTPILLRNSGLKNPNIGRNLCLHPVAMAWGWFPEEKWPGKGKKSYEGGIMTTMST  571

Query  820   VVLNV---NGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             V  +    +   YG  +IQTPALHPG+FS ++PW SG+++K RM +++RTAH+FAL RDK
Sbjct  572   VSADAEVESPNSYGTTIIQTPALHPGMFSGIIPWTSGKDYKNRMLKFSRTAHVFALTRDK  631

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSGE  S  S+TY L+ TDEENL++G+E++LRIL AAGAEEIG ++  G +L VK AS E
Sbjct  632   GSGEIRSLNSITYTLNGTDEENLKKGIERILRILTAAGAEEIGTHNLEGKSLNVKAASSE  691

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             E+ERFV+EESS+ L+       SAHQMGSCRMGV  + S V P GETWEVEGLFV D SV
Sbjct  692   EYERFVREESSKPLKGLSGQICSAHQMGSCRMGVAAEKSAVRPTGETWEVEGLFVADTSV  751

Query  292   LPTALGVNPMVT  257
              PTALGVNPMVT
Sbjct  752   FPTALGVNPMVT  763



>ref|XP_011072475.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Sesamum 
indicum]
Length=671

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/606 (62%), Positives = 460/606 (76%), Gaps = 28/606 (5%)
 Frame = -3

Query  1942  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe-----------ddieELLFGPLYKG  1796
             V++KG+N SWKAIGYCGPDP  ++ ++    +  +              +E LFG LYKG
Sbjct  60    VNEKGENLSWKAIGYCGPDPGCTKTRRLNAENTQQPPEECEEKLADGASKEELFGSLYKG  119

Query  1795  IIDLNLPEEHVFNRLTKLGCSVAKP-------KPPGPSFVIECDAvvvgsgcgggvisgV  1637
             II+L+ P E   ++L  LG SV+ P       K   PSF+++CDAVVVGSG GGGV++GV
Sbjct  120   IINLSQPREDPLSKLQNLGFSVSIPHSRNRRMKSLNPSFIVKCDAVVVGSGSGGGVMAGV  179

Query  1636  LATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSA  1457
             LA AG+KVLVLEKG+Y+AR NLSLLEG +MD+M+LG G+  T +LD++LLAGSTVGGGS 
Sbjct  180   LANAGHKVLVLEKGSYFARANLSLLEGEAMDQMYLGKGMATTDNLDVLLLAGSTVGGGST  239

Query  1456  VNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRK  1277
             +NWSASI TPP+V+REW E H L+LF S VYQ+A+D VC KMGVQ E E E F NM+LRK
Sbjct  240   INWSASIHTPPHVIREWSEKHKLKLFESKVYQQALDVVCQKMGVQSEVEHEGFNNMILRK  299

Query  1276  GCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEAL  1097
             GC +LGYPV  +P+NAPSDHYCGWC FGCKDGRKKGT+ETWLVDLV+SGNGAILP CEAL
Sbjct  300   GCEKLGYPVETVPRNAPSDHYCGWCCFGCKDGRKKGTSETWLVDLVESGNGAILPACEAL  359

Query  1096  QVIHE----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIG  929
             +VI E    + +A GV F F     ++  +++S VTV A GA+ TP LL  SGLKN+NIG
Sbjct  360   RVITEESNGKKRAIGVAFAFYTPFGREIGIVESDVTVAASGAICTPPLLKRSGLKNRNIG  419

Query  928   RNLHLHPVVFAWGHFPDT------PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPA  767
             +NLH+HPVV AWG+FPD+      P   K+SYEG I++AMSTV+ N   +GYG VIQTP 
Sbjct  420   KNLHIHPVVMAWGYFPDSASPDAWPAAEKRSYEGGIITAMSTVIANTETSGYGTVIQTPI  479

Query  766   LHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEEN  587
             LHPG+FS LMPW SG + K RM +++RT HIFALARDKGSG+  S T+V+Y L+ +D+EN
Sbjct  480   LHPGMFSLLMPWISGTDMKNRMVKFSRTTHIFALARDKGSGKITSETNVSYKLEYSDQEN  539

Query  586   LQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKA  407
             L +GLEK++RI+AAAGAEEIG  H TG  LKVK AS EEFERFVKEES + L+K  +   
Sbjct  540   LSKGLEKVMRIMAAAGAEEIGTQHTTGRVLKVKQASEEEFERFVKEESLRPLQKLSSPIG  599

Query  406   SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ  227
             SAHQMGSCRMGVDPK+S VNPKGETWEVEGLFV D SV PTALGVNPMVTI +++YC +Q
Sbjct  600   SAHQMGSCRMGVDPKSSAVNPKGETWEVEGLFVADSSVFPTALGVNPMVTIQAIAYCTAQ  659

Query  226   SVLEFL  209
             SVLE L
Sbjct  660   SVLEVL  665



>ref|XP_009132755.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Brassica rapa]
Length=771

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/747 (52%), Positives = 526/747 (70%), Gaps = 24/747 (3%)
 Frame = -3

Query  2386  KMENNTAT---KTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPH  2216
             + E+ T T    +++  +ME+L A+C+T +P+ + +     D  V  ++  SA+ TGTP 
Sbjct  26    RQEDETKTVYANSMTAREMESLVAICDTLIPSRDASEVGHLDDGVAGYYSASASHTGTPD  85

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             +VA ++++R+ HPK   L + LW LST IG+L++CG+ S + ++P+  RF  + + +RE 
Sbjct  86    RVARLMSERLHHPKKWILRVGLWSLSTWIGSLVMCGRRSFTGEYPYFRRFCWLPETQREE  145

Query  2035  IVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             I+ +WA+S    +R FF ++K +   VFFT VD+KG+N +WKAIGY GP    S+ +++ 
Sbjct  146   ILLNWASSYFILLRMFFRSIKLITAFVFFTQVDEKGNNVAWKAIGYNGPSSDHSDHEEEI  205

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFV  1697
                  + +  + +FGPLY GIIDL  P E V  +LT  G +V+  K          P   
Sbjct  206   NEKTTKKNKHDEIFGPLYNGIIDLKNPREAVTKKLTGHGFTVSTHKRTKNGSSISDPVMT  265

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG ++D+M+L GGLL
Sbjct  266   IQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGGLL  325

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D+D+V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y++AMD VC 
Sbjct  326   ATTDMDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVVCE  385

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             +MGVQ E  +E F N +LRKGC  LG PV NIP+NAPSDHYCG+C  GCK G+K+GT+ET
Sbjct  386   RMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSET  445

Query  1156  WLVDLVKSGNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVTVI  995
             WLVDLV+SGNG ILP CEA++V++E    K      G+ F F +D      +++S+ T++
Sbjct  446   WLVDLVESGNGLILPGCEAMEVLYECKGGKKTKTSTGIAFAFGKD----IYMVESRATIV  501

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMS  824
             A GAL TP LL +SGLKN +IGRNL LHPVV AWG F    + P + K+SY+G IM+AMS
Sbjct  502   ACGALRTPHLLKHSGLKNGSIGRNLCLHPVVMAWGWFPEEEEWPEKKKRSYQGGIMTAMS  561

Query  823   TVVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
             +VV       YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDKG+
Sbjct  562   SVVNEETKNSYGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLLRDKGT  621

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             G   S +S+ Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L VK  S  E 
Sbjct  622   GTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTTSAVEI  681

Query  466   ERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
             ERFV+EESS+SL+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV P
Sbjct  682   ERFVREESSKSLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSVFP  741

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             TALGVNPMVT+ S++YCI  +V++ LK
Sbjct  742   TALGVNPMVTVQSIAYCIGLNVVDALK  768



>ref|XP_010439724.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Camelina 
sativa]
 ref|XP_010439725.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Camelina 
sativa]
Length=771

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/739 (53%), Positives = 519/739 (70%), Gaps = 25/739 (3%)
 Frame = -3

Query  2368  ATKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             A  +L+  +ME+L A+C+T +P+I+   +    D SV  +F  SA+ TGTP +VA ++++
Sbjct  38    ANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSE  97

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE ++ +W+ S
Sbjct  98    RLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSAS  157

Query  2011  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
                 +R FF ++K +  LVFFT VD KG N SWKAIGY GP    S+ Q++      + +
Sbjct  158   YFSLLRMFFKSIKLITALVFFTQVDGKGRNLSWKAIGYNGPSLDDSDLQEELNEKKKKPE  217

Query  1831  ieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECDAvvv  1673
                 +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       I CDAVVV
Sbjct  218   E---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVV  274

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV++GVLA AGYKVLV+E GNYYAR+ LSLLEG +M++M+L GGLL T D+++V
Sbjct  275   GSGSGGGVVAGVLAKAGYKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVV  334

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAGSTVGGGS +NWSASIKTP +V+ EW E   L++F SD Y++AMD VC +MGVQ   
Sbjct  335   VLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLKMFRSDSYREAMDVVCKRMGVQCGF  394

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
              +E F N +LRKGC ELG PV NIP+NAPSDHYCG+C  GCK G+K+GT+ETWLVDLV+S
Sbjct  395   VEEGFNNEILRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVES  454

Query  1132  GNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
             GNG ILP CE ++V+++      + KA GV F F     ++  V++S+ TV+A GAL TP
Sbjct  455   GNGLILPGCEVMEVLYDCEQGKKKKKASGVSFAFG----EEIYVVESRSTVVACGALRTP  510

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNG  800
              LL  SGL N NIGRNL LHPVV AWG FP+    P + K SYEG IM+AMS++V     
Sbjct  511   HLLKRSGLTNANIGRNLSLHPVVMAWGWFPEEDKWPEKKKMSYEGGIMTAMSSLVNAQTQ  570

Query  799   TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
               YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIFAL RDKG+G   S + 
Sbjct  571   RSYGETVIQTPALHPGMFSGITPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSC  630

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES  443
             + Y+L+  DEE+L++GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E ERFV+EES
Sbjct  631   IDYNLNDEDEESLKKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREES  690

Query  442   SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
             S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  691   SKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  750

Query  262   VTIMSVSYCISQSVLEFLK  206
             VT+ S++YCI  +V++ LK
Sbjct  751   VTVQSIAYCIGLNVVDVLK  769



>gb|KFK28594.1| hypothetical protein AALP_AA7G017800 [Arabis alpina]
Length=752

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/738 (53%), Positives = 522/738 (71%), Gaps = 23/738 (3%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             T +L+  +ME+L A+C+T +P+I+   L    D  V  ++  SA+ TGTP +VA ++++R
Sbjct  17    TNSLTAREMESLVAICDTLIPSIDGSKLGHVEDDGVARYYSASASQTGTPDRVARLMSER  76

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
             + HPK   L + LWFLST IG+L+LCG+ S S +FP+  RF ++ +K+RE I+ +W++S 
Sbjct  77    LDHPKKWILRVGLWFLSTWIGSLILCGRKSFSGEFPYFRRFCKLPEKQREEILLNWSSSY  136

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
             +  IR  F ++K +  LVFFT +D++G N +WKAIGY GP  S     +++ +   +   
Sbjct  137   IVLIRMLFRSLKLITALVFFTQLDEQGQNLAWKAIGYNGP-TSDDSDHEEELNEKKKKKK  195

Query  1828  eELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvg  1670
              E +FGPLY GIIDL  P + V  +LT  G +V+ PK          P   I CDAVVVG
Sbjct  196   PEEIFGPLYNGIIDLTNPRDAVAKKLTGRGFTVSTPKSNKNGSFISDPVMTIRCDAVVVG  255

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GGGV++GVLA AGYKVLV+EKGNYYAR+NLSLLEG ++D+M+L  GLL T D+++V+
Sbjct  256   SGSGGGVVAGVLAKAGYKVLVVEKGNYYARSNLSLLEGQALDEMYLSAGLLATSDMNVVI  315

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAGSTVGGGS +NWSASIKTP +V++EW +   LE+FGSD+Y++AMD VC +MGVQ    
Sbjct  316   LAGSTVGGGSTINWSASIKTPEHVMKEWADKSKLEMFGSDLYREAMDVVCERMGVQCGFV  375

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E F N +LRKGC ELG  V NIP+N+PSDHYCG+C  GCK G+K+GT+ETWLVDLV+SG
Sbjct  376   EEGFNNEILRKGCEELGLQVKNIPRNSPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESG  435

Query  1129  NGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
             NG ILP CEA++V++ER   K      GV F F     ++  V++SK  ++A GAL TP 
Sbjct  436   NGLILPGCEAMEVLYEREPGKKKKIATGVAFAFG----EEVYVVESKAAIVACGALRTPD  491

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMSTVVLNVNGT  797
             LL  SGLKN NIGRNL LHPVV AWG F      P + KKSYEG IM+AMS+VV     +
Sbjct  492   LLKRSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSSVVNAETRS  551

Query  796   GYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
              YG  VIQTP+LHPG+FS ++PW S ++FK RM +++RTAH+FAL RD+G+G   S + +
Sbjct  552   SYGETVIQTPSLHPGMFSGIIPWTSSKDFKTRMLKFSRTAHVFALLRDRGTGTISSKSCI  611

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS  440
              Y+L   DEE+L++GLE++L IL AAGAEEIG ++  G +L +  A+  +  RFV+EESS
Sbjct  612   DYNLQDEDEESLKKGLERVLEILIAAGAEEIGTHNSEGKSLNITTANALQIARFVREESS  671

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
             + L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMV
Sbjct  672   KGLKDLSGQICSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMV  731

Query  259   TIMSVSYCISQSVLEFLK  206
             T+ S++YCI  +VLE LK
Sbjct  732   TVQSIAYCIGLNVLEVLK  749



>ref|XP_009384756.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Musa acuminata 
subsp. malaccensis]
Length=787

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/740 (53%), Positives = 514/740 (69%), Gaps = 33/740 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             LS  + ++L+A+C+ FLP+I+  +P     S+  ++  SA+  GTP  V   +++R++HP
Sbjct  47    LSSREKDSLAAVCDAFLPSIH--VPHAPHQSLRTYYANSASMIGTPEVVGGYLSERIQHP  104

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
             +L  L L LW LST  GT +LCG  SLS +FPF   FPE+    RE I+ SW+ S +  +
Sbjct  105   RLWQLRLALWLLSTWFGTFILCGTNSLSCRFPFFRSFPEVEAAGREDIIRSWSMSCIFLL  164

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  +   KALV+L +FT +++K +NP+W+AIGY GPDP  + K   ++     D      
Sbjct  165   RVLYKGFKALVVLFYFTQLNEKNENPAWEAIGYVGPDPRRAIKSSSEEEEGARD------  218

Query  1816  FGPLYKGIIDLNLPEEHVFNRLTKLGCSV--AKPKPPG----PSFVIECDAvvvgsgcgg  1655
              GPLYK ++ +  P + +   L++ G S+  ++ +P G    P   I CDAVVVGSG GG
Sbjct  219   -GPLYKALVHMAGPMDVLCTSLSRAGLSLVTSQSQPDGLKSKPLPTIYCDAVVVGSGSGG  277

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV++GVLA AG+KV+VLEKG Y+AR NL+LLE  ++D M+ G G+L T+DL + +L+GST
Sbjct  278   GVVAGVLAKAGFKVVVLEKGGYHARNNLTLLERHTLDHMYEGCGVLTTEDLGVFVLSGST  337

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSASI+TP +V+ EW   HGLELF SDVY +A+D V G+MGVQ E   ES  
Sbjct  338   VGGGSAVNWSASIRTPDHVISEWRHEHGLELFDSDVYAEALDAVSGRMGVQCEVRHESLA  397

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLR+GC ELGYPV  + QNAP DH CGWC FGC+DG KKGT+ETWLVD+ +SGNG I+
Sbjct  398   NAVLRRGCAELGYPVQTVGQNAPPDHDCGWCCFGCRDGSKKGTSETWLVDMAESGNGVII  457

Query  1114  PECEALQVIH-----ERNKAKGVMFTFQRDG---VKQTAVIKSKVTVIAGGALTTPSLLI  959
             P   AL+V+H      +N A GV+F F RDG    K+  +I+SKVTV+A GAL TP LL 
Sbjct  458   PGSRALRVLHADAGRNKNVAAGVVFEF-RDGWRGKKERCIIRSKVTVVACGALNTPVLLK  516

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHFPDTPG------ENKK---SYEGAIMSAMSTVVLNV  806
              SGL+N NIGR+LHLHPVV +WG+FP++        EN++   SYEGAI++ MSTVV N 
Sbjct  517   KSGLRNANIGRHLHLHPVVMSWGYFPESDSRWQPSKENQEKITSYEGAILTTMSTVVSNF  576

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
               +GYGAVIQTPALHPGLFS   PW SG ++K RM+R++RT HIFALARD+GSG   +  
Sbjct  577   ATSGYGAVIQTPALHPGLFSVATPWLSGADYKDRMARFSRTTHIFALARDRGSGTVDASG  636

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEE  446
              + Y +   DE+NLQRGLEK+LRI+AAAGAEEIG  H  G  L V+ AS  +FERFVK  
Sbjct  637   CIRYRMGAADEKNLQRGLEKILRIMAAAGAEEIGTQHCHGDRLNVRSASSHQFERFVKAT  696

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
             S + L        SAHQMGSCRMG+ P+ S VN +GETWEVEGLFV D SVLPTALGVNP
Sbjct  697   SGKGLMDLLTPVYSAHQMGSCRMGIHPRTSAVNSRGETWEVEGLFVADASVLPTALGVNP  756

Query  265   MVTIMSVSYCISQSVLEFLK  206
             MVT+ +++YC + SVLE L+
Sbjct  757   MVTVQAIAYCTAHSVLEELR  776



>ref|XP_010434428.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Camelina sativa]
Length=771

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/739 (53%), Positives = 515/739 (70%), Gaps = 25/739 (3%)
 Frame = -3

Query  2368  ATKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             A  +L+  +ME+L A+C+T +P+I+   +    D SV  +F  SA+ TGTP +VA ++++
Sbjct  38    ANSSLTQREMESLVAICDTLIPSIDGSGVGHVDDDSVAEYFSASASQTGTPDRVAKLMSE  97

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R+ HPK   L + LWFLST IG+ +LCG+ S + +FP+   F  +  K+RE ++ +W+ S
Sbjct  98    RLDHPKKWILRVALWFLSTWIGSFILCGRRSFTGEFPYFRIFCRLPAKQREDVLLNWSAS  157

Query  2011  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
                 +R FF  +K +  LVFFT VD KG N SWKAIGY GP+   S+ Q++      + +
Sbjct  158   YFSLLRMFFRCIKLISALVFFTQVDGKGRNLSWKAIGYNGPNLDNSDLQEELNEKKKKPE  217

Query  1831  ieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPK--PPGPSF-----VIECDAvvv  1673
                 +FGPLY GI+DL  P E V  +LT  G +V+ PK  P G S       I CDAVVV
Sbjct  218   E---IFGPLYNGIVDLKSPREVVTKKLTDRGFTVSTPKKNPKGSSLSNRVMTIRCDAVVV  274

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV++GVLA AG+KVLV+E GNYYAR+ LSLLEG +M++M+L GGLL T D+++V
Sbjct  275   GSGSGGGVVAGVLANAGHKVLVVESGNYYARSTLSLLEGQAMEEMYLSGGLLATSDMNVV  334

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAGSTVGGGS +NWSASIKTP +V+ EW E   LE+FGSD Y++AMD VC +MGV    
Sbjct  335   VLAGSTVGGGSTINWSASIKTPEHVMNEWAEKSKLEMFGSDSYREAMDVVCKRMGVXXXX  394

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
                      LRKGC ELG PV NIP+NAPSDHYCG+C  GCK G+K+GT+ETWLVDLV+S
Sbjct  395   XXXXXXXXXLRKGCEELGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVES  454

Query  1132  GNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
             GNG ILP CE ++V+++      + KA GV F F     ++  V++S+ TV+A GAL TP
Sbjct  455   GNGLILPGCEVMEVLYDCEQGKKKKKASGVSFAFG----EEIYVVESRATVVACGALRTP  510

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNG  800
              LL  SGL N NIGRNL LHPVV AWG FP+    P + K SYEG IM+ MS+V+ +   
Sbjct  511   HLLKRSGLTNGNIGRNLCLHPVVMAWGWFPEEDRWPEKKKMSYEGGIMTVMSSVINSETQ  570

Query  799   TGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
             + YG  VIQTPALHPG+FS + PW S  +FK RM +++RTAHIFAL RDKG+G   S + 
Sbjct  571   SSYGETVIQTPALHPGMFSGVTPWTSSNDFKTRMLKFSRTAHIFALLRDKGTGTVNSTSC  630

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES  443
             + Y+L+  DEE+LQ+GLE++L+ILAA+GAEEIG ++  G +L ++ AS  E ERFV+EES
Sbjct  631   IDYNLNDEDEESLQKGLERVLKILAASGAEEIGTHNLEGKSLNLRTASAVEIERFVREES  690

Query  442   SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
             S+ L+       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPM
Sbjct  691   SKPLKDLSGQLCSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM  750

Query  262   VTIMSVSYCISQSVLEFLK  206
             VT+ S++YCI  +V++ LK
Sbjct  751   VTVQSIAYCIGLNVVDVLK  769



>ref|XP_009137007.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Brassica rapa]
Length=770

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/735 (53%), Positives = 515/735 (70%), Gaps = 21/735 (3%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             +L+  +ME+L A+C+T +P+I+ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38    SLTAREMESLVAICDTLIPSIDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             P+   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE  + +WA+S    
Sbjct  98    PRKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++        ++ + 
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETKTNKEMPKE  217

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECDAvvvgsgc  1661
             +FGPLY GII+L  P E V  +LT  G +V+  K          P   I CDAVVVGSG 
Sbjct  218   IFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMTIRCDAVVVGSGS  277

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV++G+LA AG+KVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D+++V+LAG
Sbjct  278   GGGVVAGLLAKAGFKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSDMNVVILAG  337

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGS +NWSASIKTP +V++EW E   LELF SD+Y++AMD VC +MGVQ    +E 
Sbjct  338   STVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYREAMDVVCERMGVQCGFVEEG  397

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             F N VLRKGC ELG  V NIP+NA  DHYCG+C+ GCK G+K+GT+ETWLVDLV+SGNG+
Sbjct  398   FNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSLGCKKGQKQGTSETWLVDLVESGNGS  457

Query  1120  ILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLI  959
             ILP C+A++V++E      +  + G+ F F  D      V++S+ TV+A GAL TP LL 
Sbjct  458   ILPGCKAMEVLYECEGGNKKKTSTGIAFAFGED----IYVVESRATVVACGALRTPHLLK  513

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMSTVVLNVNGTGYG  788
              SGLKN NIGRNL LHPVV AWG F      P + KKSYEG IM+AMS+V+     T YG
Sbjct  514   RSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSSVLNAEAKTTYG  573

Query  787   -AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
               VIQTP+LHPG+FS ++PW S  +FK RM +++RTAH+F L RDKG+G   S + + Y+
Sbjct  574   ETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAHVFTLLRDKGTGTINSKSYIDYN  633

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSL  431
             L+  DEE+L++GLE +L IL AAGAEEIG ++  G +L V+ AS  E ERFV+EESS+SL
Sbjct  634   LNDEDEESLKKGLESVLNILIAAGAEEIGTHNSKGKSLNVRTASAVEIERFVREESSKSL  693

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
             +       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMVT+ 
Sbjct  694   KDLSGQICSAHQMGSCRMGIRPEESAVRPMGETWEVEGLFVADTSVFPTALGVNPMVTVQ  753

Query  250   SVSYCISQSVLEFLK  206
             S++YCI  +V+  LK
Sbjct  754   SIAYCIGLNVVGALK  768



>gb|EPS61567.1| hypothetical protein M569_13229, partial [Genlisea aurea]
Length=735

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/729 (53%), Positives = 499/729 (68%), Gaps = 21/729 (3%)
 Frame = -3

Query  2353  SPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPK  2174
             S  QME+L+ALC+TFLP +        D  ++ FF+TSA++  TPHQVA ++  +++H +
Sbjct  14    SRRQMESLAALCDTFLPEMEPPSGADDDKDISRFFRTSASTANTPHQVAILMGHKIRHRR  73

Query  2173  lnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIR  1994
             L    L LW LST IGT +LCG+ SLS +FP+L +F  +S + R+ I+HSWA S    +R
Sbjct  74    LFLAPLALWVLSTAIGTWVLCGRKSLSRRFPYLQKFSRVSTENRKEIMHSWANSHFFVLR  133

Query  1993  NFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLF  1814
               F A+K  + L+FF+ VD+KGDN SW+AI Y       +   ++  +     +      
Sbjct  134   LLFNALKIFITLIFFSQVDEKGDNVSWQAIRYRSKTGGAAMNVQQLGNMITAQENSNPEL  193

Query  1813  GPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KP----KPPGPSFVIECDAvvvgsgcgggv  1649
             GPL +GIIDL   EE +  +L+ LG  V+  P    +  G S+ +E D VV+GSGCGGGV
Sbjct  194   GPLREGIIDLKSKEESL-QKLSDLGFPVSLNPNRIRRRGGASYAVESDVVVIGSGCGGGV  252

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
             ++GVLA  GYK +VLEKG Y+    L LLEG +MD+M+LG G++ T ++D+++LAGSTVG
Sbjct  253   VAGVLAQQGYKTIVLEKGKYFPTARLPLLEGQAMDQMYLGNGIIGTDNMDILILAGSTVG  312

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGS +NWSASI+TPP+V +EW E H L+LF S  Y  AMD VCGK+GVQ    +E F NM
Sbjct  313   GGSTINWSASIRTPPHVRKEWSENHELKLFESSAYDDAMDAVCGKIGVQANVAEEGFNNM  372

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC EL  P   IP+NA SDHYCG C FGC++G K+G AETWL+DLV SGNGAILPE
Sbjct  373   VLRKGCDELRIPAETIPRNASSDHYCGSCCFGCENGGKRGVAETWLMDLVSSGNGAILPE  432

Query  1108  CEALQVIHE----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKN  941
             CEA+++I      R  A GV F  +     + AV++SK+TV++ GA+ TP+LL  S LKN
Sbjct  433   CEAVKIITSKRGGRKHAGGVSFRLKNG---EFAVVESKITVVSCGAIGTPALLKKSRLKN  489

Query  940   KNIGRNLHLHPVVFAWGHFPDTPGE----NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             ++IGRNLHLHPVV  WG+FPD P       K SYEGAIM+AMS  ++  N     A+IQT
Sbjct  490   RHIGRNLHLHPVVMGWGYFPDGPESWPETEKVSYEGAIMTAMSKSLMISN----RAIIQT  545

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PALHPG+FSALMPW SG   K +M ++ RTA++F L RD G+GE  SPT ++Y +D  DE
Sbjct  546   PALHPGMFSALMPWISGDAHKKKMLKFPRTANLFTLVRDLGTGEVNSPTDISYRVDDRDE  605

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNL  413
             ENL+RG+E +LRILAAAGAEEIG  H  G  L VK A+ EE E+FVKEES +  R   + 
Sbjct  606   ENLRRGMEMVLRILAAAGAEEIGTQHKQGRVLNVKRATEEELEKFVKEESERGFRNLSSP  665

Query  412   KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI  233
               SAHQMGSCRMG  P  S V P GE+WEVEGL+V D SV PTALGVNPMVTI +++YC 
Sbjct  666   MCSAHQMGSCRMGASPAESAVAPDGESWEVEGLYVADSSVFPTALGVNPMVTIQAIAYCT  725

Query  232   SQSVLEFLK  206
             +QS+L  L+
Sbjct  726   AQSILTRLR  734



>emb|CDY01593.1| BnaC07g35830D [Brassica napus]
Length=770

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/735 (53%), Positives = 514/735 (70%), Gaps = 21/735 (3%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             +L+  +ME+L A+C+T +P+++ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38    SLTAREMESLVAICDTLIPSLDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             PK   L + LW LST IG+L+LCG+ S    FP+  RF  + +K+RE  + +WA+S    
Sbjct  98    PKKWILRVGLWSLSTWIGSLVLCGQRSFIGGFPYFQRFCRLPKKQREETLLNWASSYFLL  157

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++        ++ + 
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETKTNKNMPKE  217

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgc  1661
             +FGPLY GII+L  P E V  +LT  G +++  K          P   I CDAVVVGSG 
Sbjct  218   IFGPLYNGIINLKKPREAVTKKLTGHGFTISTQKSNKKRSSISNPVMTIRCDAVVVGSGS  277

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D+++V+LAG
Sbjct  278   GGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSDMNVVILAG  337

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGS +NWSASIKTP +V++EW E   LELF S++Y++AMD VC +MGVQ    +E 
Sbjct  338   STVGGGSTINWSASIKTPEHVMKEWAEKSELELFESNLYREAMDVVCERMGVQCGFVEEG  397

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             F N VLRKGC ELG  V NIP+NA  DHYCG+C+ GCK G+K+GT+ETWLVDLV+SGNG 
Sbjct  398   FNNEVLRKGCEELGLQVKNIPRNASKDHYCGFCSLGCKKGQKQGTSETWLVDLVESGNGL  457

Query  1120  ILPECEALQVIHER---NKAK---GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLI  959
             ILP C+A++V++E    NK K   G+ F F  D      V++S+ TV+A GAL TP LL 
Sbjct  458   ILPGCKAMEVLYESEGGNKKKTSTGIAFAFGED----IYVVESRATVVACGALRTPHLLK  513

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMSTVVLNVNGTGYG  788
              SGLKN NIGRNL LHPVV AWG F      P + KKSYEG IM+AMS+VV     T YG
Sbjct  514   RSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSSVVNAEAKTTYG  573

Query  787   -AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
               VIQTP+LHPG+FS ++PW S  +FK RM +++RTAH+F L RDKG+G   S + + Y+
Sbjct  574   ETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAHVFTLLRDKGTGTINSKSYIDYN  633

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSL  431
             L+  DEE+L++GL  +L IL AAGAEEIG ++  G +L V+ AS  E +RFV+EESS+SL
Sbjct  634   LNDEDEESLKKGLGSVLNILIAAGAEEIGTHNSEGKSLNVRTASAVEIKRFVREESSKSL  693

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
             +       SAHQMGSCRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMVT+ 
Sbjct  694   KDLSGQICSAHQMGSCRMGIRPEESAVKPTGETWEVEGLFVADTSVFPTALGVNPMVTVQ  753

Query  250   SVSYCISQSVLEFLK  206
             S++YCI  +V+  LK
Sbjct  754   SIAYCIGLNVVGALK  768



>gb|KHN11789.1| Long-chain-alcohol oxidase FAO4A [Glycine soja]
Length=622

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/613 (60%), Positives = 455/613 (74%), Gaps = 31/613 (5%)
 Frame = -3

Query  1951  FTSVDDKGDNPSWKAIGYCGPDPSISekqkkq----------khhdheddieELLFGPLY  1802
             +  +D+  DN +WKAIGYCGPDP    + K            +    ED+  E + GPLY
Sbjct  5     YFQIDESEDNVAWKAIGYCGPDPEFKAQLKNHFLDGTSKGGGQEDKEEDEDAEEMIGPLY  64

Query  1801  KGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPG-------PSFVIECDAvvvgsgcgggv  1649
             KG++ LN P++   + L + G   SV + K          PS VI+CDAVVVGSG GGGV
Sbjct  65    KGLVHLNYPQDITADALRRFGFPVSVIRRKHKAAAANLSCPSLVIQCDAVVVGSGSGGGV  124

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
             I+GVLA AGYKVLVLEKG Y A+ NLSLLEGP+MD+M+L GGL+ + D+ + +L+GSTVG
Sbjct  125   IAGVLAKAGYKVLVLEKGGYSAKNNLSLLEGPTMDQMYLNGGLVASDDMGVFILSGSTVG  184

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSA+NWSA IKTP +V +EWC+ HGLELF S++Y++A+D VCGKMGVQ E EDE F N 
Sbjct  185   GGSAINWSACIKTPQHVCKEWCDKHGLELFESELYREALDAVCGKMGVQSEIEDEGFNNA  244

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             +LRKGC+E+GYPV NIP+N+PS+HYCGWC  GCKDGRKKGT+ETWLVDLVKSGNGAILP 
Sbjct  245   ILRKGCQEMGYPVNNIPRNSPSNHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPG  304

Query  1108  CEALQVIH------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             CEA++V+H      +R  A+GV F F+  G K   V++SKVT++A GAL+TP+LL  SGL
Sbjct  305   CEAIKVLHKKKEGKDRKIARGVAFEFEYKGTKDVCVVESKVTIVACGALSTPALLKRSGL  364

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGEN------KKSYEGAIMSAMSTVVLNVNGTGYGA  785
             +N+NIG+NLHLHPVV AWG+FPD P         KKSYEG IM+AMSTVV     +GYGA
Sbjct  365   RNQNIGKNLHLHPVVMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGA  424

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             VIQTP+LHPG+FS + PW SG + + RM +++RTAHIFALARD+GSG   +P  ++Y   
Sbjct  425   VIQTPSLHPGMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPDRISYKPA  484

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRK  425
               DEENL++G+EK+LRILAAAGAEEIG +H  G TL VK  S  EFE+FVKEESS+SL  
Sbjct  485   DVDEENLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQVSYHEFEKFVKEESSRSLTD  544

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
                   SAHQMGSCRMG +PK SVVNP GETWEVEGL+V D SV PTALGVNPMVT+ ++
Sbjct  545   LTTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAI  604

Query  244   SYCISQSVLEFLK  206
             +YC +QSV+E LK
Sbjct  605   AYCTAQSVVEVLK  617



>gb|KCW78402.1| hypothetical protein EUGRSUZ_D02568 [Eucalyptus grandis]
Length=758

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/761 (52%), Positives = 505/761 (66%), Gaps = 99/761 (13%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAI-NEALPETTDA--------SVTNFFQTSAASTGTPHQVA  2207
             +LSP QM+TL+ALC+TFLP+I +   P  TD+         V  F++TSA+  GTP ++ 
Sbjct  48    SLSPRQMDTLTALCDTFLPSIAHPHHPSYTDSGGDGDCDEEVAKFYRTSASMAGTPEKLG  107

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              +I++R+KHPKL  L L LWFLST IGT +LCG+   S+ FP++ RFPEI Q++RE IV 
Sbjct  108   GLISERIKHPKLWLLRLTLWFLSTCIGTFILCGQKCFSSHFPYVQRFPEIPQRRREEIVR  167

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP------------  1883
              W+ S    +R F   +K L  LVFFT VD+K  N SWKAIGY GPDP            
Sbjct  168   RWSRSVFPLLRIFARTVKLLTFLVFFTQVDEKDHNVSWKAIGYAGPDPEFENSKKLKRTS  227

Query  1882  ---SISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-----  1727
                S  E+Q K++        +E  FGPL++G+I +  P + V   L + G  V      
Sbjct  228   CQISADEQQGKEQATAKNGYEDEAFFGPLHQGLIHMVHPRDIVTKSLRQFGFPVLICPSN  287

Query  1726  --KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGP  1553
                 KP  PS  I+CDAVV+GSG GGGV++GVLA AGYKVLVLEKG+Y AR+NLSLLEGP
Sbjct  288   HNVRKPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGYKVLVLEKGSYCARSNLSLLEGP  347

Query  1552  SMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGS  1373
             +MD+M+L GG++ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF S
Sbjct  348   TMDQMYLSGGVVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFDS  407

Query  1372  DVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFG  1193
              +Y++A+D VC +MGVQ    +E F N VLRKGC+ELGYPV NIP+N+P+DHYCGWC  G
Sbjct  408   KLYREALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWCCLG  467

Query  1192  CKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVK  1031
             CKDG+KKGTAETWLVDLV+SGNGAILP CEA++V+H       R+ A GV F F+ +GVK
Sbjct  468   CKDGKKKGTAETWLVDLVESGNGAILPGCEAIEVLHSRQSRRGRDTATGVTFEFEHNGVK  527

Query  1030  QTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PG  869
             +  +I+SKVT++A GAL+TP+LL  SGLKN NIG+NLHLHPV  AWG+FPDT      P 
Sbjct  528   EVCIIESKVTIVACGALSTPALLKRSGLKNPNIGKNLHLHPVTMAWGYFPDTEMADLWPE  587

Query  868   ENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYA  689
             + KKSYEG IM+AM          G G +  + ++                         
Sbjct  588   KEKKSYEGGIMTAMD--------KGSGTITSSTSI-------------------------  614

Query  688   RTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGT  509
                                    +Y +D  DE+NLQ+GLEK+LRILAAAGAEEIG +HG 
Sbjct  615   -----------------------SYKMDDADEQNLQKGLEKVLRILAAAGAEEIGSHHGE  651

Query  508   GLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETW  329
             G TLKVK  S  EFE+FVKEES++S++       SAHQMGSCRMG DP++S VNP GETW
Sbjct  652   GKTLKVKQVSYHEFEQFVKEESARSIKGLSTPICSAHQMGSCRMGPDPRSSAVNPMGETW  711

Query  328   EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             EVEGL+V D SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  712   EVEGLYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  752



>ref|XP_008805948.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=793

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/737 (51%), Positives = 507/737 (69%), Gaps = 33/737 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             L+  +M++L+A+ +TFLP+I+  LP   + S+  F+  SA+  GTP  V   +++R++H 
Sbjct  51    LTAREMDSLTAISDTFLPSID--LPGARNESIRAFYLASASMIGTPEIVGGYVSRRLRHA  108

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
              L  L L LW LST  GT + CG   +S +FPF  +F +I   +RE I+ SW++S +   
Sbjct  109   LLGLLRLSLWLLSTWYGTFIFCGTRCVSCRFPFFHKFSDIDPTRREEILSSWSSSPIYLY  168

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  F AMK L+   +FT V+DK +NP+W+A+ YCGPDP+ +++ K       EDD     
Sbjct  169   RKLFRAMKFLIPFFYFTQVNDKYENPTWRALEYCGPDPAFADQVKASVDQCSEDDR----  224

Query  1816  FGPLYKGIIDLNLPEEHVFNRLTKLGCSVA-KPKPPG----PSFVIECDAvvvgsgcggg  1652
             FGPL++ ++ +  P       L++ G S+A +P P G    P   I CDAVVVGSG GGG
Sbjct  225   FGPLHRALVHMGSPGA----ALSRAGLSLATRPFPGGRRKKPLRTILCDAVVVGSGSGGG  280

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V++G LA AGYKV+VLEKG Y+AR+NLSL EGP++D M+ GGGLL T D  +V+L+G+TV
Sbjct  281   VVAGFLARAGYKVVVLEKGGYHARSNLSLCEGPTLDLMYEGGGLLSTTDTGVVVLSGATV  340

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED--ESF  1298
             GGGSA+NW+A+++TP +V  EW   HGL+LFGSD Y +A+D VC +MGVQ +  +  ES 
Sbjct  341   GGGSAINWAAALRTPDHVAAEWRRDHGLQLFGSDAYAEALDAVCERMGVQSDVHEMKESL  400

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
              N  LR+GC ELGYPV NI +NAP DH+CGWC FGCKDGRKK T+ETWLVD+ +S NG I
Sbjct  401   NNAALRRGCHELGYPVSNISRNAPPDHHCGWCCFGCKDGRKKATSETWLVDMAESRNGVI  460

Query  1117  LPECEALQVIHERNK------AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
             LP C A++V+H          A GV+F  +     +T +++SKVTV+A GAL TP LL  
Sbjct  461   LPGCRAVRVLHRDRGRRRRKVATGVLFETESG---ETCIVESKVTVVACGALNTPVLLKR  517

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFP-------DTPGENKKSYEGAIMSAMSTVVLNVNGT  797
             SGL+N NIG++LHLHPVV  WGHFP       D   E K+SYEG IM+AMSTV  N   T
Sbjct  518   SGLRNPNIGKHLHLHPVVMVWGHFPESGSRRPDYKEEEKRSYEGDIMTAMSTVAANWGTT  577

Query  796   GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVT  617
             GYG VIQTPALHPG+FS + PW SG +FK RM+R+ARTAH+FAL RD+GSG      +++
Sbjct  578   GYGVVIQTPALHPGMFSVVTPWTSGADFKDRMTRFARTAHVFALVRDRGSGTVDGEGNIS  637

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ  437
             Y ++K DEE+L+ G+EK+LRI+AAAGAEE+G  H  G   +VK AS  E++ FVKE S +
Sbjct  638   YRMEKGDEESLKNGVEKMLRIMAAAGAEEVGTQHCKGERFEVKRASAREWDSFVKEASRR  697

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
              +        SAHQMGSCRMGV+   S V+  GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  698   GVGSLTTPVCSAHQMGSCRMGVEASTSAVDEGGETWEVEGLFVADTSVFPTALGVNPMVT  757

Query  256   IMSVSYCISQSVLEFLK  206
             + +++YC ++S+++ L+
Sbjct  758   VQAIAYCTARSIVQVLR  774



>gb|KDP37817.1| hypothetical protein JCGZ_06719 [Jatropha curcas]
Length=608

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/609 (60%), Positives = 457/609 (75%), Gaps = 21/609 (3%)
 Frame = -3

Query  1990  FFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh-hdheddieELLF  1814
              F  +K L LLVFF+ VD+KG+N +WKA+ Y GPDP   ++Q+       + ++ +E LF
Sbjct  2     LFKTVKLLCLLVFFSQVDEKGENLAWKAMDYPGPDPEFKKEQEAALKLVKNNEEEKEKLF  61

Query  1813  GPLYKGIIDLNLPEEHVFN--RLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  1640
             GPLYKG+ID+NLP +   N  RL+       +PK   PS VI+CDAVVVGSG GG V++G
Sbjct  62    GPLYKGLIDMNLPRDITANSLRLSGFPVFTYRPKINNPSLVIKCDAVVVGSGSGGSVVAG  121

Query  1639  VLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  1460
             VLA AGYKV+V+EKGNY+AR+NLSLLEGPSMD+M+L  GL+ T D+ +V+LAGSTVGGGS
Sbjct  122   VLAKAGYKVVVIEKGNYFARSNLSLLEGPSMDQMYLSAGLMATDDMGVVVLAGSTVGGGS  181

Query  1459  AVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLR  1280
              +NWSASI+TP +V  EW   +GLE+F S +Y++A+D VC KMGVQ E  +E F N +LR
Sbjct  182   TINWSASIRTPQHVTDEWSNAYGLEIFDSKLYKEALDVVCEKMGVQSEINEEGFNNAILR  241

Query  1279  KGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEA  1100
             KGC ELGY V  IP+N+ SDHYCGWC  GCKDG+KKGT ETWL+DLV SGNG ILP CEA
Sbjct  242   KGCEELGYNVNTIPRNSSSDHYCGWCCLGCKDGKKKGTCETWLLDLVNSGNGLILPNCEA  301

Query  1099  LQVIHERNK------AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNK  938
             ++V+H+R +      A GV F F     K+  V++SKVT++A GAL+TP LL  SGLKN 
Sbjct  302   IKVLHKRRRRGNRRVASGVAFAFG----KEVCVVQSKVTIVACGALSTPPLLKRSGLKNP  357

Query  937   NIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             NIG++LHLHPV  AWG+FPD      P ++KKSY+G IM+AMS V    +   YGAVIQT
Sbjct  358   NIGKHLHLHPVTMAWGYFPDDQPLAWPEKHKKSYQGGIMTAMSLV---TSDKLYGAVIQT  414

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             P+LHPG+F++LMPW SG + K +M R++RTAHIFALARDKGSG+  SP S++Y ++  DE
Sbjct  415   PSLHPGMFASLMPWGSGVDMKRKMGRFSRTAHIFALARDKGSGKVNSPNSISYQMEAADE  474

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNL  413
             ENLQ+GLEK LRILAAAGAEEIG +H  G +L VK AS +EF++FVK ESS+SLR     
Sbjct  475   ENLQKGLEKGLRILAAAGAEEIGTHHSKGRSLNVKKASYKEFDKFVKRESSRSLRDLSTQ  534

Query  412   KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI  233
               SAHQMGSCRMG+DP+ SVVN  GETWEVEGLF+ D SV P ALGVNPMVT+ +++YC 
Sbjct  535   ICSAHQMGSCRMGIDPRNSVVNEMGETWEVEGLFIADTSVFPAALGVNPMVTVQAIAYCT  594

Query  232   SQSVLEFLK  206
             +QSVL+ LK
Sbjct  595   AQSVLQLLK  603



>ref|XP_010942998.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Elaeis guineensis]
Length=787

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/737 (51%), Positives = 509/737 (69%), Gaps = 29/737 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             L+  +M++L+A+ +TFLP+I+  LP   + S+  F+ TSA+  GTP  V   ++ R++H 
Sbjct  51    LTAREMDSLTAISDTFLPSID--LPGARNESIRAFYLTSASMIGTPEIVGGYMSGRLRHA  108

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
              L  L L LW LST  GT + CG   +S +FPF  +F +I  K+RE+I+ SW++S +   
Sbjct  109   SLWLLRLSLWLLSTWYGTFIFCGTRCMSCRFPFFHKFSDIDPKRREQILSSWSSSPIYLY  168

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  F A+K L++L +FT V++K +NP+W A+ YCGP+P ++++ K       EDD     
Sbjct  169   RQLFRALKFLIMLFYFTQVNEKNENPAWTALDYCGPEPELADQVKASVDQSSEDDR----  224

Query  1816  FGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-----PSFVIECDAvvvgsgcggg  1652
             FGPL+  ++ +  P + +   L++ G  +A     G     P   I CDAVVVGSG GGG
Sbjct  225   FGPLHCAMVHMESPGDDLAAALSRAGLYLATRPFSGDRRKKPLRTIHCDAVVVGSGSGGG  284

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V++GVLA AGYKV+VLEKG Y+AR+NLSL EGP+MD M+ GGGLL T D  +V+L+G+TV
Sbjct  285   VVAGVLAQAGYKVVVLEKGGYHARSNLSLHEGPAMDLMYEGGGLLATTDTGVVVLSGATV  344

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE--DESF  1298
             GGGSA+NW+A+++TP +V  EW   HGLELFGSD Y +A+D VC +MGVQ + +  +E+ 
Sbjct  345   GGGSAINWAAALRTPDHVAAEWRRDHGLELFGSDAYAEALDAVCERMGVQSDVDKMEENL  404

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
              N  LR+GC ELGYPV NI +NAP DH+CGWC FGCKDGRKK T+ETWLVD+ +S NG I
Sbjct  405   NNAALRRGCLELGYPVANISRNAPPDHHCGWCCFGCKDGRKKATSETWLVDMAESRNGVI  464

Query  1117  LPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
             LP C A++V+H       R  A GV+F  +     +  +++SKVTV+A GAL TP LL  
Sbjct  465   LPGCRAVRVLHRNRGGRRRKVATGVLFESESG---EACIVESKVTVVACGALNTPVLLKR  521

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFP-------DTPGENKKSYEGAIMSAMSTVVLNVNGT  797
             SGL+N NIG++LHLHPVV  WG+FP       D   E K+SYEG IM+AMSTV  N   T
Sbjct  522   SGLRNPNIGKHLHLHPVVMVWGYFPESGSRRPDYREEEKRSYEGGIMTAMSTVTANWGTT  581

Query  796   GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVT  617
             GYG VIQTPALHPG+FS + PW SG +FK RM+R+ARTAH+FALARD+GSG      +++
Sbjct  582   GYGTVIQTPALHPGMFSVVTPWTSGADFKDRMTRFARTAHVFALARDRGSGTVDGEGNIS  641

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ  437
             Y +++ DEE+L++G+EK+L I+A AGAEE+G  H  G   +VK AS  E+ERFV + S +
Sbjct  642   YRMERGDEESLKKGVEKMLWIMAGAGAEEVGTQHCKGERFEVKRASAREWERFVIKASRR  701

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
              +        SAHQMGSCRMGV+   S V+ +GETWEVEGLFV D SV PTALGVNPMVT
Sbjct  702   VVGWLTTPVCSAHQMGSCRMGVEDTTSAVDERGETWEVEGLFVADASVFPTALGVNPMVT  761

Query  256   IMSVSYCISQSVLEFLK  206
             + +++YC + S+++ L+
Sbjct  762   VQAIAYCTAHSIVQVLR  778



>gb|EPS64229.1| hypothetical protein M569_10552, partial [Genlisea aurea]
Length=725

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/734 (53%), Positives = 511/734 (70%), Gaps = 44/734 (6%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             +ETLSA+C+ FLP+I++      D S  +F++TSA+ + TP  V  ++  + +HPK++  
Sbjct  9     LETLSAVCDAFLPSIDDGGGIDIDPSAADFYRTSASMSETPRGVMEML-AKARHPKISLA  67

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
             +  LWFLSTRIG+++LCG+  +      + RF E+  ++RE I+  W+   L  +R F+ 
Sbjct  68    VPALWFLSTRIGSVVLCGRRCVGGG-KLVKRFSELPVEEREEILAYWSRHFLPHLRIFYH  126

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
             ++K   LL FFT VD+ G+N SWKAIGYCGPDP+               +      GPL+
Sbjct  127   SLKFFTLLRFFTHVDENGENVSWKAIGYCGPDPT--------------RNGGPFEVGPLH  172

Query  1801  KGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATA  1625
             +GII+L+   E   +R L+  G  V+K    G SF IECDAVVVGSG GGGV++GVLA +
Sbjct  173   RGIINLDREREPPPSRALSLYGFPVSKGGEGGVSFTIECDAVVVGSGSGGGVVAGVLAKS  232

Query  1624  GYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWS  1445
             G+KVLV+EKG+Y AR++L+LLEG SM++M+L  GLL + D+ ++ +AGSTVGGGS +NWS
Sbjct  233   GHKVLVIEKGSYSARSDLTLLEGQSMERMYLEKGLLASDDMSVLFVAGSTVGGGSTINWS  292

Query  1444  ASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRE  1265
             ASI+TPP+V REW +  GL LF S+ Y  A+D V  +M VQ+E EDE   NMVLR+GC  
Sbjct  293   ASIRTPPHVRREWSDECGLRLFQSEDYDDALDVVSERMSVQKEVEDEGLANMVLRRGCET  352

Query  1264  LGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIH  1085
             LGY V NIP+NAPSDHYCGWC+FGC+DGRK GT+ETWLVDLV+SGNGAILP CEA++VI 
Sbjct  353   LGYAVENIPRNAPSDHYCGWCSFGCRDGRKHGTSETWLVDLVESGNGAILPNCEAIKVIT  412

Query  1084  E-----------RNKAKGVMFTFQR-DGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKN  941
             +             KA G+ F F+  +G ++ A ++++  V + GA+ TP LL  SGLKN
Sbjct  413   QMKKTTTINDGRSKKAVGITFRFRNPNGDEEIAAVRARAVVSSCGAICTPPLLKRSGLKN  472

Query  940   KNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
              NIGRNLH+HPVV AWG+FP T   P  +K+SYEG IM+AM+      + TG   +IQTP
Sbjct  473   PNIGRNLHIHPVVMAWGYFPATNPWPEADKRSYEGGIMTAMAK-----SRTG-DTIIQTP  526

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             +LHPG+FSAL PW SG++ K RM +++RTAHIF+LARD GSG   S ++++Y LD  D E
Sbjct  527   SLHPGMFSALTPWISGRDIKNRMLKFSRTAHIFSLARDAGSGTVTSESNISYRLDDADRE  586

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE----FERFVKEESSQSLRKH  422
             NL  GLE++LR+LAAAGAEEIG +H  G +LKVK   R++     ERF+KEES + L K 
Sbjct  587   NLGSGLEEVLRVLAAAGAEEIGTHHRDGRSLKVKKKDRDDQAALLERFIKEESRKPLEKE  646

Query  421   --PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS  248
                +   SAHQMGSCRMG DP  S V+P GETWEV GLFV D SV PTALGVNPM+T+ +
Sbjct  647   SLSSPICSAHQMGSCRMGTDPLRSAVDPNGETWEVGGLFVADTSVFPTALGVNPMLTVQA  706

Query  247   VSYCISQSVLEFLK  206
             +SYCIS+SVL  LK
Sbjct  707   ISYCISKSVLNHLK  720



>gb|KCW78401.1| hypothetical protein EUGRSUZ_D02566 [Eucalyptus grandis]
Length=748

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/757 (51%), Positives = 496/757 (66%), Gaps = 95/757 (13%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAI-NEALPETT----DASVTNFFQTSAASTGTPHQVAWVIN  2195
             +LSP QMETL++LC+TFLP+I +   P  T    D  V  F+QTSA+  GTP ++  +++
Sbjct  42    SLSPRQMETLTSLCDTFLPSIAHPHHPSDTEGEGDEEVAKFYQTSASMAGTPEKIGGLVS  101

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +RMKHPKL  L L LW LST IGT +LCG+   S+ FP++ RF EI Q++RE I   W  
Sbjct  102   ERMKHPKLWLLPLTLWLLSTCIGTFILCGRKCFSSHFPYVQRFSEIPQRRREEIARRWFR  161

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP---------------S  1880
             S    +R F   +K L  LVFFT +D+K  N SWKAIGY GPDP               S
Sbjct  162   SVFPVLRMFARTIKLLTFLVFFTQLDEKDRNLSWKAIGYAGPDPDFENSKKLKRMSCQVS  221

Query  1879  ISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSV-------AKP  1721
               E+Q +++        +E + GPL++G+I +  P++ V   L + G  V          
Sbjct  222   ADEQQGQEQAKAKNCYEDEAISGPLHQGLIQMVHPQDIVTKSLRQFGFPVLICPSNHNVR  281

Query  1720  KPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDK  1541
             KP  PS  I+CDAVV+GSG GGGV++GVLA AG+KVLVLEKG+Y AR+NLSLLEGP+MD+
Sbjct  282   KPRFPSLSIQCDAVVIGSGAGGGVVAGVLAKAGHKVLVLEKGSYCARSNLSLLEGPTMDQ  341

Query  1540  MFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQ  1361
             M+L GGL+ T+D+  ++LAGSTVGGGS +NWSAS++TP +V+ EW   + LELF S +YQ
Sbjct  342   MYLSGGLVATEDMSTLVLAGSTVGGGSTINWSASLRTPQHVMNEWSNKYDLELFDSKLYQ  401

Query  1360  KAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG  1181
             +A+D VC +MGVQ    +E F N VLRKGC+ELGYPV NIP+N+P+DHYCGWC  GCKDG
Sbjct  402   EALDVVCKRMGVQSAISEEGFNNAVLRKGCQELGYPVSNIPRNSPADHYCGWCCLGCKDG  461

Query  1180  RKKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAV  1019
             +KKGTAETWLVDLV+SGNGAILP CEA++V+H R   +      GV F F+ +G K+  +
Sbjct  462   KKKGTAETWLVDLVESGNGAILPGCEAIEVLHTRRSGRGRDTVTGVAFEFEHNGFKEVCI  521

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT------PGENKK  857
             ++S VT++A GAL TP+LL  SGLKN NIG+NLHLHPV  AWG+FPDT      P + KK
Sbjct  522   VESNVTIVACGALGTPALLKRSGLKNPNIGKNLHLHPVAMAWGYFPDTKTVDLWPEKEKK  581

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG IM+AM          G G +  + ++                +KM          
Sbjct  582   SYEGGIMTAMD--------KGSGTIASSTSI---------------SYKM----------  608

Query  676   IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL  497
                                    D TDE NLQ+GLEK+LRILAAAGAEEIG +H  G TL
Sbjct  609   -----------------------DDTDEHNLQKGLEKVLRILAAAGAEEIGTHHNEGKTL  645

Query  496   KVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
             KVK  S  EFERFVKEES++ ++       SAHQMGSCRMG +P++SVVNP GETWEVEG
Sbjct  646   KVKQVSYHEFERFVKEESARPIKGQSTPICSAHQMGSCRMGPNPRSSVVNPMGETWEVEG  705

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             L+V D SV PTALGVNPMVT+ +++YC +QSVLE L+
Sbjct  706   LYVADTSVFPTALGVNPMVTVQAIAYCTAQSVLEALR  742



>ref|XP_006878629.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
 gb|ERM94774.1| hypothetical protein AMTR_s00011p00262370 [Amborella trichopoda]
Length=814

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/758 (49%), Positives = 498/758 (66%), Gaps = 53/758 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN------------------------------EALPETTDA  2267
             LSP QME+L+ALC+T +P+I+                              +      D 
Sbjct  57    LSPRQMESLTALCDTLIPSIDVDFHGQQPRNAGDDAIRSFATSAFMSDFHGQQQQNAGDD  116

Query  2266  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ  2087
             ++ +FF TSA+ +GTP  VA +++ ++KH     L L LW LST  GT ++CG  SLS+ 
Sbjct  117   AIRSFFATSASMSGTPDHVAGLVSGKVKHALSGVLRLCLWLLSTWYGTFIICGTLSLSSH  176

Query  2086  FPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKA  1907
             FP+   FP+I Q KRE I+ SW+TSS+  +R  F  +K  V L+F++ VD+   N +W+A
Sbjct  177   FPYFQSFPQIIQPKREEIMLSWSTSSIYLLRALFQCIKFFVHLIFYSKVDENNHNSTWQA  236

Query  1906  IGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKL-GCSV  1730
             IGYCGPDP         +             GPL  G+IDL+  + H F  + +  G +V
Sbjct  237   IGYCGPDPQKESGCPHGQQESK---------GPLQHGVIDLDSMDHHTFAHVLRASGFTV  287

Query  1729  AKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
             ++PK    +F I+CDAVVVGSG GGGV +GVLA AG+KV+VLEKG+Y+AR+ LSLLEGP+
Sbjct  288   SQPKEKFSNFTIKCDAVVVGSGSGGGVAAGVLAVAGHKVVVLEKGHYFARSQLSLLEGPT  347

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             MD+M+   GL+ T DL  ++LAGSTVGGGSA+NWSA+I+TP +VL EW +VHGLELF S 
Sbjct  348   MDQMYDRHGLIATDDLSAIILAGSTVGGGSAINWSAAIRTPDHVLNEWNQVHGLELFESK  407

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
              Y +AMD V   MGVQ +  DE      LRKGC+ELG+PVVN+P+N+P DHYCGWC FGC
Sbjct  408   AYHQAMDVVARDMGVQTQVSDEGLACSALRKGCQELGFPVVNVPRNSPDDHYCGWCCFGC  467

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE-----RNKAKGVMFTFQ--RDGVK  1031
             KDG+KKGT ETWL+D+V SGNG ++     ++V+       RN A GV+F  +  R G +
Sbjct  468   KDGKKKGTGETWLLDMVNSGNGVVVSGARVVEVVQRKRKGMRNLAVGVVFERENKRLGCR  527

Query  1030  QTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG--ENKK  857
             +  +I SKVTV+A GAL TP LL  SGL+++ IGRNLH+HP   AWG+FP+     + K+
Sbjct  528   ERFMIVSKVTVVACGALGTPVLLKKSGLRSQEIGRNLHIHPTNMAWGYFPENRDFEKEKR  587

Query  856   SYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAH  677
             SYEG I++AM  V      +GYG +IQ PALHPG+FS +MPW S  + K RM+R++RT H
Sbjct  588   SYEGGILTAMLPVPGKSKDSGYGGLIQNPALHPGMFSVVMPWMSSLDMKERMTRFSRTVH  647

Query  676   IFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTL  497
             +FAL RDKGSG   SP  ++Y +  +D+E +   +EK+LRILAAAGAEEIG +   G  +
Sbjct  648   LFALVRDKGSGVVSSPPYLSYKMSHSDKETMSNCMEKMLRILAAAGAEEIGTHGSNGERI  707

Query  496   KVKDASREEFERFVKEESSQSLRKHPNLK----ASAHQMGSCRMGVDPKASVVNPKGETW  329
              VK AS  EFERFV+E S + L++  N       SAHQMG+CRMG  P  SVV+ KGE W
Sbjct  708   NVKVASSHEFERFVREVSRKPLQRFSNGYWRPICSAHQMGTCRMGAHPNDSVVDQKGECW  767

Query  328   EVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE  215
             EVEGL++ D SV PTALGVNPM+T+ +++YC + + L+
Sbjct  768   EVEGLYIADSSVFPTALGVNPMLTVQAIAYCTAHAALD  805



>ref|XP_008776965.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Phoenix dactylifera]
Length=766

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/737 (49%), Positives = 499/737 (68%), Gaps = 27/737 (4%)
 Frame = -3

Query  2371  TATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             T    LS  +M++L+A C+ FLP+++  + +T D  +  F+ TSA+  GTP ++  +++ 
Sbjct  37    THPNLLSKREMDSLTAACDAFLPSVD--VSDTGDEGLIAFYGTSASMAGTPERIGGLLSG  94

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
              M+HP +  L L LW LST  GT +LCG+ SLS QFP+L +FP++ ++K+E I+ SW+ S
Sbjct  95    GMQHPAIGLLRLALWLLSTWYGTFILCGRASLSNQFPYLQKFPQVRREKQEEILLSWSRS  154

Query  2011  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh----hd  1844
             SL  ++  +  +K L +  +F+ ++DK  NPSW A+GYCGPDP ++++ +  +      D
Sbjct  155   SLCPLKMLYKCLKYLTMKEYFSQINDKETNPSWDALGYCGPDPELADQSQHFRTPPLEED  214

Query  1843  heddieELLFGPLYKGIIDLNLPEEHVFNRLTKLG--CSVAKPKPPGPSFVIECDAvvvg  1670
                   +   GPL   ++ ++ P + +  +L   G     +    P     + CD VVVG
Sbjct  215   SVSQEADSCPGPLDSALLYMDSPRDVITRKLQIAGFPTPTSGTNSPSSPLTLHCDVVVVG  274

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GG V++GVLA AG++V+V+EKG+YY R+ LSLLEGP++ +M+ GGG++ T D+ ++L
Sbjct  275   SGSGGSVVAGVLAKAGHRVIVVEKGHYYHRSELSLLEGPTIAEMYEGGGIISTDDIGVIL  334

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAGSTVGGGS VNWSA I+TP +V  EWC   GL LFGS+ Y  A+D VCG+MGVQ + E
Sbjct  335   LAGSTVGGGSTVNWSACIRTPDHVRNEWCNKLGLRLFGSEAYDHALDVVCGRMGVQSDVE  394

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E F N +LRKGC ELGYPV N+P+NAP DH CGWC  GCK  RKK T ETWLVDL  SG
Sbjct  395   EEGFNNAILRKGCVELGYPVSNVPRNAPPDHCCGWCHLGCKSARKKSTQETWLVDLAGSG  454

Query  1129  NGAILPECEALQVIH-------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
             NG ILP C+AL+V+H       +R+ A GV+  F   G ++  +I+SKVTV+A GAL TP
Sbjct  455   NGLILPRCKALKVLHRKKKKGVDRSTANGVIVRF---GSREDFIIESKVTVVACGALNTP  511

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT--PGENKKSYEGAIMSAMSTVVLNVNGT  797
              LL  SGL+N N+G+NLHLHP V AWG+FP    P E KKSYEG I++AMST + +    
Sbjct  512   GLLKRSGLRNANVGKNLHLHPAVLAWGYFPPARWPEEPKKSYEGGILTAMSTALAS----  567

Query  796   GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVT  617
              Y  +++TPALHPG+F+   PW S  +F+ RM+R++RTAH+FAL RDKGSG    P S+T
Sbjct  568   -YDILLETPALHPGMFAVATPWISAADFRERMTRFSRTAHVFALVRDKGSGTTDYPHSLT  626

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ  437
             Y +D  DEE L++G+E ++RILAAAGAEE+G  H  G  ++V +    E+   VKE   +
Sbjct  627   YGMDAEDEEKLKKGVEAMVRILAAAGAEEVGTLHCKGERVRVGEEGGVEW--LVKEVRRR  684

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
              LR      ++AHQMGSCRMG D +A  V+P GE WEVEGLFV D SV PTALGVNPMVT
Sbjct  685   GLRDGGTPVSTAHQMGSCRMGTDARAGAVSPTGEVWEVEGLFVADTSVFPTALGVNPMVT  744

Query  256   IMSVSYCISQSVLEFLK  206
               +++YC +QS+LEFL+
Sbjct  745   AQAIAYCTAQSILEFLE  761



>ref|XP_009396212.1| PREDICTED: long-chain-alcohol oxidase FAO4A [Musa acuminata subsp. 
malaccensis]
Length=745

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/731 (49%), Positives = 482/731 (66%), Gaps = 27/731 (4%)
 Frame = -3

Query  2356  LSPSQM-ETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             L P ++ E+L+A+C+T LP ++  +    D  +  F+ TSA+  GT   +  +++  +KH
Sbjct  21    LIPERLKESLAAVCDTLLPQVD--VSSVGDEGLVEFYGTSASMVGTSEHIGGLLSGGLKH  78

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             P    L L LW LST  GT  +CG  SLS QFP+  RF ++ + KRE+I+ SW+  S   
Sbjct  79    PAAGLLYLALWLLSTWYGTFAMCGTRSLSKQFPYFHRFAKVERTKREQILLSWSLGSFPL  138

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk----qkhhdhedd  1832
                 F  +K L + ++FT ++D   NP+WKA+GYCGPDP + ++ +     Q       D
Sbjct  139   YAMLFRCLKYLTMRLYFTQLNDDRTNPAWKAMGYCGPDPDLVDQSQHLGTPQHQEKDPVD  198

Query  1831  ieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcggg  1652
              E+ +FGPL+  ++ +  P + +   L K G       P  P   + CDA V+GSG GG 
Sbjct  199   QEDDVFGPLHSALLHMEKPRDVITRMLHKAGFPAPATFPSSP-LTLSCDAAVIGSGSGGS  257

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V++GVLA AGYKV+V+EKG+YY  + LSLLEGP++  M+ GGGL+ T D+  +LLAGSTV
Sbjct  258   VVAGVLAKAGYKVIVIEKGDYYPSSRLSLLEGPALGAMYEGGGLVATDDVGALLLAGSTV  317

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGS VNWSASI+TP +V REWC+ HGLELF S  Y +A+D VC +MGVQ + ++E F N
Sbjct  318   GGGSTVNWSASIRTPGHVRREWCDEHGLELFSSKAYDEALDVVCERMGVQSDVKEEGFNN  377

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
             M+LR+GC +LGYPV N+P NAP DHYCGWC  GCK+G+K+ T ETWL DL  SGNG ILP
Sbjct  378   MILRRGCEKLGYPVANVPCNAPPDHYCGWCHLGCKNGKKQSTKETWLADLADSGNGFILP  437

Query  1111  ECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
              C+A+++++       R+ A GV+  F      +   ++SKVTV+A GAL TPSLL  SG
Sbjct  438   CCKAVRILYRKGRGIGRSVANGVVVAFG----NEEFTVESKVTVVASGALNTPSLLKRSG  493

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDT--PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQ  776
             LKN +IG++LH+HP V AWG FP T  P E +KSYEG I+++M  +      + Y  ++Q
Sbjct  494   LKNVHIGKHLHIHPAVMAWGFFPSTRWPEECRKSYEGGILTSMCPL------SSYCTLLQ  547

Query  775   TPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTD  596
             TPALHPG+F+ + PW S  +F+ RM+R++RTAHIFAL RDKGSG A  P SV Y +D+ D
Sbjct  548   TPALHPGMFATVTPWLSAADFRERMTRFSRTAHIFALVRDKGSGTADYPESVVYRMDEED  607

Query  595   EENLQRGLEKLLRILAAAGAEEIGCNHGTG-LTLKVKDASREEFERFVKEESSQSLRKHP  419
             EE L+R LE  +RILAAAGAEE+G +HG G           E  E  V E   + LR   
Sbjct  608   EEKLKRSLEAAVRILAAAGAEEVGTHHGKGERVKVGGRGGGEGVEELVTEVVRRGLRDGK  667

Query  418   NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY  239
                ++AHQMGSCRM  D K   V+P+GETWEVEGL+V D SV PTALGVNPMVT+ +++Y
Sbjct  668   TPISTAHQMGSCRMAADAKEGAVSPRGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAY  727

Query  238   CISQSVLEFLK  206
             C +QS+L+ L+
Sbjct  728   CTAQSILQVLQ  738



>ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
Length=617

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/613 (57%), Positives = 441/613 (72%), Gaps = 25/613 (4%)
 Frame = -3

Query  1969  LVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS-----ekqkkqkhhdheddieELLFGPL  1805
             ++L++ +  VD++ +N SWKAI Y G DP        +++  +     E +  E L+GPL
Sbjct  1     MLLVLSYVWVDEELNNISWKAIDYPGSDPQFKPPSNLKEKDSKSKEVDEGEEAEELYGPL  60

Query  1804  YKGIIDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvis  1643
             +KGI++L   ++       L K G  V       KPP PS +I+CDAVVVGSG GGGVI+
Sbjct  61    FKGIVNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVIA  120

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
             GVLA AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGSTVGGG
Sbjct  121   GVLANAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGG  180

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             S VNWSASI+TP ++ REW + + LELF S++Y++A+D VC KMGVQ + ++E F N VL
Sbjct  181   STVNWSASIETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVL  240

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC ELG   + IP+N+ SDHYCGWC  GC+DGRKKGTAETWLVDLV+SGNG ILP CE
Sbjct  241   RKGCEELGGHAITIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCE  300

Query  1102  ALQVIH------ERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLK  944
             A+++        ER +AKGV F F      KQ  +++SKVT++A GAL TP LL  SGL+
Sbjct  301   AIKIRQEKEHGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLR  360

Query  943   NKNIGRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVNGT-GY-GA  785
             N NIG+NLHLHPV  AWG+FP       P ++KKSYEG IM+AM  +    N   GY GA
Sbjct  361   NPNIGKNLHLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCNIGSEPNQEPGYGGA  420

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             VIQTPALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S++Y +D
Sbjct  421   VIQTPALHPGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSSLSYKMD  480

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRK  425
               DE NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS+ L+ 
Sbjct  481   DVDEHNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPLKD  540

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
                   SAHQMGSCRMG+  K SVVN +GETWEVEGLF+ D SV PTALGVNPMVT+ ++
Sbjct  541   LLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAI  600

Query  244   SYCISQSVLEFLK  206
             +YC +QSVLE LK
Sbjct  601   AYCTAQSVLETLK  613



>ref|XP_006283178.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
 gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
Length=598

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/603 (58%), Positives = 441/603 (73%), Gaps = 23/603 (4%)
 Frame = -3

Query  1951  FTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPE  1772
               SVD+KG N +WKAIGY GP    S+   +++ ++ +   EE+ FGPLY GI+DLN P 
Sbjct  1     MNSVDEKGRNLAWKAIGYNGPSLDDSDHDLEEELNEKKKKPEEI-FGPLYNGIVDLNCPR  59

Query  1771  EHVFNRLTKLGCSVA--KPKPPG-----PSFVIECDAvvvgsgcgggvisgVLATAGYKV  1613
             E V  +LT  G +V+  K K  G     P   I CDAVVVGSG GGGV++GVLA AGYKV
Sbjct  60    EAVTKKLTGRGFTVSSQKNKSKGSSLSNPVMTIRCDAVVVGSGSGGGVVAGVLAKAGYKV  119

Query  1612  LVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIK  1433
             LV+E GNYYAR+NLSLLEG +M+ M+L GGLL T D ++V+LAGSTVGGGS +NWSASIK
Sbjct  120   LVVESGNYYARSNLSLLEGQAMEDMYLSGGLLATSDTNVVILAGSTVGGGSTINWSASIK  179

Query  1432  TPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYP  1253
             TP +V++EW E   LE+FGSD+Y++AMD VC +MGVQ    +E F N +LRKGC ELG P
Sbjct  180   TPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEILRKGCEELGLP  239

Query  1252  VVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE---  1082
             V NIP+NAPSDHYCG C  GCK G+K+GT+ETWLVDLV+SGNG ILP C+A++V++E   
Sbjct  240   VKNIPRNAPSDHYCGHCCLGCKKGQKQGTSETWLVDLVQSGNGLILPGCKAMEVLYECEQ  299

Query  1081  ----RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHL  914
                 + KA GV F F     ++  V++S+ TV+A GAL TP LL  SGLKN NIGRNL L
Sbjct  300   GKKNKKKATGVAFAFG----EEIYVVESRATVVACGALRTPHLLKRSGLKNGNIGRNLCL  355

Query  913   HPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYG-AVIQTPALHPGLFS  746
             HPVV AWG FP+    P + K SYEG IM+AMS+VV     + YG  VIQTPALHPG+FS
Sbjct  356   HPVVMAWGWFPEGEKWPEKKKMSYEGGIMTAMSSVVNAETQSSYGETVIQTPALHPGMFS  415

Query  745   ALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEK  566
              + PW S ++FK RM +++RTAHIFAL RDKG+G   S + + Y+L+  DEE+L++GLE+
Sbjct  416   GVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTINSKSYIDYNLNDEDEESLKKGLEE  475

Query  565   LLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGS  386
             +L+I+AAAGAEEIG ++  G +L V+ AS  EFERFV+EESS+ L+       SAHQMGS
Sbjct  476   VLKIMAAAGAEEIGTHNSEGKSLNVRRASAVEFERFVREESSKPLKNLSGQICSAHQMGS  535

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             CRMG+ P+ S V P GETWEVEGLFV D SV PTALGVNPMVT+ S++YCI  +V++ LK
Sbjct  536   CRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  595

Query  205   THD  197
              ++
Sbjct  596   RNN  598



>emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 emb|CAB78940.1| putative protein [Arabidopsis thaliana]
Length=678

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/595 (58%), Positives = 431/595 (72%), Gaps = 21/595 (4%)
 Frame = -3

Query  1942  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHV  1763
             VD+KG N +WKAIGY GP P  S+ + +      +   EE+ FGPLY GI+DL  P E V
Sbjct  86    VDEKGRNLAWKAIGYNGPSPDHSDHEVELNEEKKKKKPEEI-FGPLYNGIVDLKSPREAV  144

Query  1762  FNRLTKLGCSVAKPKP-------PGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVL  1604
               +L   G +V+  K          P   I+CDAVVVGSG GGGV +GVLA AGYKVLV+
Sbjct  145   EKKLAGRGFAVSNQKRNTNGSSISDPVMKIQCDAVVVGSGSGGGVAAGVLAKAGYKVLVI  204

Query  1603  EKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPP  1424
             E GNYYAR+ LSLLEG +MD M+L GGLL T D ++V+LAGSTVGGGS +NWSASIKTP 
Sbjct  205   ESGNYYARSKLSLLEGQAMDDMYLSGGLLATSDTNVVILAGSTVGGGSTINWSASIKTPE  264

Query  1423  YVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVN  1244
             +V++EW E   LE+FGSD+Y++AMD VC +MGVQ    +E F N VLRKGC +LG PV N
Sbjct  265   HVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEEGFNNEVLRKGCEKLGLPVKN  324

Query  1243  IPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE-----R  1079
             IP+NAPSDHYCG+C  GCK G+K+GT+ETWLVDLV+S NG ILP C+A +V+++     +
Sbjct  325   IPRNAPSDHYCGFCCLGCKKGQKQGTSETWLVDLVESDNGLILPGCQATEVMYDCEQGKK  384

Query  1078  NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVF  899
              KA GV F F     ++  V++S+VT++A GAL TP LL  SGLKN NIGRNL LHPVV 
Sbjct  385   KKATGVAFAFG----EEIYVVESRVTIVACGALRTPHLLKRSGLKNSNIGRNLCLHPVVM  440

Query  898   AWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYGA-VIQTPALHPGLFSALMPW  731
             AWG FP+    P + KKSYEG IM+AMS+VV+    + YG  VIQTPALHPG+FS ++PW
Sbjct  441   AWGWFPEEDKWPEKKKKSYEGGIMTAMSSVVIEETHSSYGEMVIQTPALHPGMFSGIIPW  500

Query  730   NSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRIL  551
              S ++FK RM +++RTAHIFAL RDKG+G   S T + Y+L+  DEE+L+ GLE++L+IL
Sbjct  501   TSSKDFKTRMLKFSRTAHIFALLRDKGTGTIDSKTYIDYNLNDEDEESLKNGLERVLKIL  560

Query  550   AAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGV  371
             AAAGAEEIG +H  G +L V+ AS  E ERFV+EESS+ L+       SAHQMGSCRMG+
Sbjct  561   AAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKDLSGQICSAHQMGSCRMGI  620

Query  370   DPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              P+ S V P GETWEVE LFV D SV PTALGVNPMVT+ S++YCI  +V++ LK
Sbjct  621   RPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVDVLK  675



>ref|XP_008444239.1| PREDICTED: long-chain-alcohol oxidase FAO4A isoform X2 [Cucumis 
melo]
Length=731

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/609 (57%), Positives = 438/609 (72%), Gaps = 30/609 (5%)
 Frame = -3

Query  1942  VDDKGDNPSWKAIGYCGPDPSI----------SekqkkqkhhdheddieELLFGPLYKGI  1793
             VD++ +N SWKAI Y G DP            S+ ++  +  D E++  E L+GPL+KGI
Sbjct  119   VDEEMNNISWKAIDYPGSDPQFKPPSNLKEKDSKSREVDEEGDEEEEEAEELYGPLFKGI  178

Query  1792  IDLNLPEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgVLA  1631
             ++L   ++       L K G  V       KPP PS +I+CDAVVVGSG GGGV++GVLA
Sbjct  179   VNLQHQQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVVAGVLA  238

Query  1630  TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  1451
              AGYKVLVLEKG+Y ARTNLSLLEGP+M++M+   GL+ T ++++++LAGSTVGGGS VN
Sbjct  239   NAGYKVLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGGSTVN  298

Query  1450  WSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1271
             WSASIKTP +V +EW + + LELF S++Y++A+D VC KMGVQ + ++E F N VLRKGC
Sbjct  299   WSASIKTPSHVTKEWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVLRKGC  358

Query  1270  RELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQV  1091
              ELG   +NIP+N+ SDHYCGWC  GC+DGRKKGTAETWLVDLV+SGNG ILP CEA+++
Sbjct  359   EELGGHAINIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCEAIKI  418

Query  1090  IH------ERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNI  932
                     ER  AKGV F F      KQ  +++SKVT++A GAL TP LL  SGL+N NI
Sbjct  419   RQEKKQGRERKMAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLRNPNI  478

Query  931   GRNLHLHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVNGT-GY-GAVIQT  773
             G+NLHLHPV  AWG+FP       P ++KKSYEG IM+AM  +    N   GY GAVIQT
Sbjct  479   GKNLHLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCNIGPEPNQEPGYGGAVIQT  538

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PALHPGLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S++Y +D  DE
Sbjct  539   PALHPGLFSILMPWVSGTNIKQRMCKFSRTAHVFVLARDKGSGTVKSPSSLSYKMDNVDE  598

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNL  413
             +NLQ+GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS+ L+     
Sbjct  599   QNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKKVSYREYEKFVKEESSRPLKDLLTP  658

Query  412   KASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCI  233
               SAHQMGSCRMG   K SVVN +GETWEVEGLF+ D SV PTALGVNPMVT+ +++YC 
Sbjct  659   ICSAHQMGSCRMGSGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCT  718

Query  232   SQSVLEFLK  206
             +QSVLE LK
Sbjct  719   AQSVLETLK  727



>ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A-like, 
partial [Cucumis sativus]
Length=608

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/604 (57%), Positives = 434/604 (72%), Gaps = 25/604 (4%)
 Frame = -3

Query  1942  VDDKGDNPSWKAIGYCGPDPSIS-----ekqkkqkhhdheddieELLFGPLYKGIIDLNL  1778
             VD++ +N SWKAI Y G DP        +++  +     E +  E L+GPL+KGI++L  
Sbjct  1     VDEELNNISWKAIDYPGSDPQFKPPSNLKEKDSKSKEVDEGEEAEELYGPLFKGIVNLQH  60

Query  1777  PEEH--VFNRLTKLGCSVA----KPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYK  1616
              ++       L K G  V       KPP PS +I+CDAVVVGSG GGGVI+GVLA AGYK
Sbjct  61    QQQIQVAVGALRKFGFPVTLLSPTTKPPNPSMIIKCDAVVVGSGSGGGVIAGVLANAGYK  120

Query  1615  VLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASI  1436
             VLVLEKG+Y AR NLSLLEGP+M++M+   GL+ T ++++++LAGSTVGGGS VNWSASI
Sbjct  121   VLVLEKGSYCARXNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGGSTVNWSASI  180

Query  1435  KTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGY  1256
             +TP ++ REW + + LELF S++Y++A+D VC KMGVQ + ++E F N VLRKGC ELG 
Sbjct  181   ETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVLRKGCEELGG  240

Query  1255  PVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIH---  1085
               + IP+N+ SDHYCGWC  GC+DGRKKGTAETWLVDLV+SGNG ILP CEA+++     
Sbjct  241   HAITIPRNSTSDHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCEAIKIRQEKE  300

Query  1084  ---ERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLH  917
                ER +AKGV F F      KQ  +++SKVT++A GAL TP LL  SGL+N NIG+NLH
Sbjct  301   HGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLRNPNIGKNLH  360

Query  916   LHPVVFAWGHFPDT-----PGENKKSYEGAIMSAMSTVVLNVNGT-GY-GAVIQTPALHP  758
             LHPV  AWG+FP       P ++KKSYEG IM+AM  +    N   GY GAVIQTPALHP
Sbjct  361   LHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCNIGSEPNQEPGYGGAVIQTPALHP  420

Query  757   GLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQR  578
             GLFS LMPW SG   K RM +++RTAH+F LARDKGSG   SP+S++Y +D  DE NLQ+
Sbjct  421   GLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSSLSYKMDDVDEHNLQK  480

Query  577   GLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAH  398
             GLEK L+ILAAAGA EIG +H  G ++ VK  S  E+E+FVKEESS+ L+       SAH
Sbjct  481   GLEKALKILAAAGAVEIGTHHNKGRSINVKKVSFREYEKFVKEESSRPLKDLLTPICSAH  540

Query  397   QMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVL  218
             QMGSCRMG+  K SVVN +GETWEVEGLF+ D SV PTALGVNPMVT+ +++YC +QSVL
Sbjct  541   QMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAIAYCTAQSVL  600

Query  217   EFLK  206
             E LK
Sbjct  601   ETLK  604



>ref|XP_008382148.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO4A 
[Malus domestica]
Length=768

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/553 (59%), Positives = 408/553 (74%), Gaps = 21/553 (4%)
 Frame = -3

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  1640
             LFGPL++GII++    + V + +++ G     P     S  I CDAVV+G+G GGGV++G
Sbjct  215   LFGPLFRGIINMKXTNDLVAD-ISRFGV----PAFVHHSLTIRCDAVVIGTGLGGGVVAG  269

Query  1639  VLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  1460
             VLA  GYKV+VLEKG+Y+AR NL+LLEGP+MD+M+L GGL+ T D  + +LAGSTVGGGS
Sbjct  270   VLAKDGYKVVVLEKGHYHARHNLTLLEGPTMDQMYLSGGLIATDDTXVFVLAGSTVGGGS  329

Query  1459  AVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLR  1280
              VN SAS++TP +VL+EWC  H LELF S +YQ A+D VC +MGVQ E ++E F N VLR
Sbjct  330   TVNRSASVRTPVHVLKEWCNAHKLELFDSKLYQLALDVVCERMGVQSEIQEEGFNNAVLR  389

Query  1279  KGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEA  1100
             KGC+EL YP+ NIP+N+   HYCGWC  G KDGRK+G  ETW VDLV SGNGAI   CEA
Sbjct  390   KGCQELRYPMENIPRNSTPGHYCGWCCLGYKDGRKRGATETWFVDLVNSGNGAIFSGCEA  449

Query  1099  LQVIHERNK-------AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKN  941
             ++ +H+RNK       A GV F F+ +G +    ++SKVT++A GAL+TP LL  S LKN
Sbjct  450   VKALHKRNKGRGHRNTATGVAFKFEHEGGRNIGFVESKVTIVACGALSTPKLLKRSELKN  509

Query  940   KNIGRNLHLHPVVFAWGHFPDT-------PGENKKSYEGAIMSAMSTVVLNVNGTGYGAV  782
              NIG+NLHLH V   WGHFPD+       P E KKS+EG I++AMSTVV + +G+GYGAV
Sbjct  510   GNIGKNLHLHSVAMTWGHFPDSXVFDGRLPRE-KKSFEGGILTAMSTVVADFDGSGYGAV  568

Query  781   IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS-PTSVTYDLD  605
             IQTP LHPG+ S ++PW SG++ K RMS ++RTAH+FAL RDKGSG   + P SV+Y+++
Sbjct  569   IQTPTLHPGMLSIVIPWVSGKDTKRRMSMFSRTAHVFALVRDKGSGTVNAPPNSVSYEME  628

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRK  425
               DE NL  GLEK LRILAAAGAEEIG +H  G +L VK AS +EFERFVKEESS+SLR 
Sbjct  629   AIDEHNLNTGLEKSLRILAAAGAEEIGTHHFKGKSLAVKKASLDEFERFVKEESSRSLRD  688

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
               +    A+QMGSCRMGVD K SVVN  GETWEVE LF+ D SV PTALGVNPMVT+ ++
Sbjct  689   LSSAICLAYQMGSCRMGVDAKGSVVNQMGETWEVERLFLADTSVFPTALGVNPMVTVQAI  748

Query  244   SYCISQSVLEFLK  206
             +YC +QSVLE L+
Sbjct  749   AYCTAQSVLEVLR  761



>emb|CBI29206.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/722 (48%), Positives = 448/722 (62%), Gaps = 118/722 (16%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             LS  +ME+L A+ +TFLP++ EA      A V  F++TSA+  GTPH V  +I++R++HP
Sbjct  35    LSSREMESLIAISDTFLPSV-EAPHNAAHAYVDKFYRTSASMAGTPHIVGGLISERLEHP  93

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
             KL    ++LW LST  GT ++CG  S+S+ FP+   FP++S  KR  IV SW+ S    I
Sbjct  94    KLWLSRVVLWLLSTWFGTFIICGLASMSSHFPYFQSFPQVSPHKRHEIVLSWSLSYFSLI  153

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  F ++K + LLVFFT VD+K +N +WKAIGYCGPDP      +  K            
Sbjct  154   RMLFRSLKLVTLLVFFTQVDEKNENLTWKAIGYCGPDPDFKTLYRANKTAQPNG------  207

Query  1816  FGPLYKGIIDLNLPEEHVFNRLTKLGCSVA----KPKPPGPS--FVIECDAvvvgsgcgg  1655
             +G   +G+I++  P E V   L   G S++    K + P  S   +I CDAVV+GSG GG
Sbjct  208   YG---RGLINVKRPREVVAEALRLSGFSISIHSRKHETPNSSSPLIIRCDAVVIGSGSGG  264

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV +GVLA AGYKVLVLEKGNY AR+NLSLLEGP++D+M+L GG+L T D  +++LAGST
Sbjct  265   GVAAGVLAKAGYKVLVLEKGNYCARSNLSLLEGPTLDQMYLYGGMLATDDTGVIILAGST  324

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGS +NWSASI+TP +V +EWC+ H LELF S +Y++AMD VC KMGVQ E  +E   
Sbjct  325   VGGGSTINWSASIRTPQHVRKEWCDQHELELFDSQLYKEAMDVVCEKMGVQSEIYEEGLN  384

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLR+GC+ELGYP                               TWLVD++ SGN    
Sbjct  385   NAVLRRGCQELGYP-------------------------------TWLVDMMNSGN----  409

Query  1114  PECEALQVIHERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKN  935
                                            +++SKVT++A GA++TP LL  SGLKN N
Sbjct  410   -----------------------------VFMVESKVTIVACGAISTPGLLKRSGLKNPN  440

Query  934   IGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPG  755
             IG+NLHLHPV  AWGHFP+                                  TP     
Sbjct  441   IGKNLHLHPVAMAWGHFPEP---------------------------------TP-----  462

Query  754   LFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRG  575
             L   LMPW SG + K RM RY+RTAHIFALARDKGSG   SP++++Y +D+TDEENL+RG
Sbjct  463   LSPILMPWISGPDMKDRMIRYSRTAHIFALARDKGSGTISSPSTISYQMDETDEENLKRG  522

Query  574   LEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQ  395
             +EKLLRILAAAGAEEIG ++  G ++ VK  S   FE+FVKEESS++LR       SAHQ
Sbjct  523   MEKLLRILAAAGAEEIGTHNCNGRSINVKKVSSHAFEKFVKEESSRALRDLSTPVCSAHQ  582

Query  394   MGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLE  215
             MGSCRMGVDP++S VN  GETWEVEGL+V D SV PTALGVNPMVT+ +++Y  ++SV+E
Sbjct  583   MGSCRMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPMVTVQAIAYSTAKSVVE  642

Query  214   FL  209
              L
Sbjct  643   ML  644



>gb|ABR17814.1| unknown [Picea sitchensis]
Length=743

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/746 (45%), Positives = 474/746 (64%), Gaps = 33/746 (4%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             + L R     + +  LS SQ+++L+A+C+ F+P+I     +  D  V +F++ S +  G 
Sbjct  10    HPLLRGGRRTSHSHGLSASQIKSLAAICDAFIPSI-PPTNDLQDPEVESFYRLSGSQNGI  68

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P QVA +I +R+K         LLW LSTR+GT LLCG  SL  +FP+L  F ++ Q  R
Sbjct  69    PEQVAELIARRVKPIAFLMARWLLWLLSTRLGTWLLCGSASLKKEFPYLQPFSDVQQVSR  128

Query  2041  ERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  1865
             E+I+  W+    + F++  F   K   L  F+T  D+  +NP+WK IGY  P P      
Sbjct  129   EQILLDWSRGRRITFLKFAFKLFKICCLFTFYTVADENAENPAWKGIGYSPPKPETDRVA  188

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTK-LGCSVAKPKP---PGPSFV  1697
               +               PL KG+IDL+   E    +L +  G +V + +       ++ 
Sbjct  189   SGR---------------PLEKGVIDLSSASEQDLPKLFQDRGFTVTEEENLSGKEKAWK  233

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             +ECDAVVVGSG GGGV +GVLA AGY+V+VLEKG YYAR +L+LLEGPS D+M+  GG+L
Sbjct  234   VECDAVVVGSGSGGGVAAGVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQMYESGGIL  293

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D  ++++AG+TVGGGSA+NWSASI+TPP+VL+EW + HGL LF S  YQ AM+ VCG
Sbjct  294   PTNDGKVLVMAGATVGGGSAINWSASIRTPPHVLKEWSKQHGLPLFESHDYQDAMNAVCG  353

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GVQ  C  ESFQN VL  GC +LG+    +P+N+  DH+CG C FGC+ G KKG  ET
Sbjct  354   RLGVQDGCSKESFQNSVLSTGCAKLGFRFEKVPRNSTEDHFCGSCCFGCRKGNKKGADET  413

Query  1156  WLVDLVKSGNGAILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAV-IKSKVTV  998
             WLVD + SG+  IL  C+A +V+ +      + +A GV+  F   G K+ ++ +++KVTV
Sbjct  414   WLVDAMNSGS-LILAGCKAEKVLCQEIPGSWKQRAAGVVAAF---GPKRRSIFVQAKVTV  469

Query  997   IAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIMSAMSTV  818
              A G+L TP LL +SGL+N NIGRNLHLHPV  AWG FP+      K +EG I++ +   
Sbjct  470   AACGSLLTPLLLRSSGLRNPNIGRNLHLHPVQMAWGFFPENKEPAGKPHEGGIITTICKE  529

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
                   +GYG +IQTPA+ PG F++++PW SG + K RM +Y RTAH+F LARD+GSG  
Sbjct  530   GAKWEQSGYGTIIQTPAIAPGSFASMIPWTSGLDMKERMQKYHRTAHVFCLARDRGSGSV  589

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  + Y   ++D++NL+ GL + ++IL AAGA E+G +   G  L VK A+ +E E F
Sbjct  590   GGEKDLDYRFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLAVKGATDDEIEEF  649

Query  457   VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
             +  +        P    SAHQMGSCRMG D ++  V+ KGE+WEVEGLFV DGS+LPT++
Sbjct  650   LNNKGKGRRGVWPTF-FSAHQMGSCRMGKDEESGGVDWKGESWEVEGLFVCDGSLLPTSV  708

Query  277   GVNPMVTIMSVSYCISQSVLEFLKTH  200
             GVNPM+TI S+++C++  +L+FL+T+
Sbjct  709   GVNPMITIQSLAFCVANYILQFLRTN  734



>emb|CDY66156.1| BnaA01g34950D [Brassica napus]
Length=508

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/509 (60%), Positives = 386/509 (76%), Gaps = 14/509 (3%)
 Frame = -3

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG ++D+M+L GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQALDEMYLSGG  60

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             LL T D+D+V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y++AMD V
Sbjct  61    LLATTDMDVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C +MGVQ E  +E F N +LRKGC  LG PV NIP+NAPSDHYCG+C  GCK G+K+GT+
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTS  180

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVT  1001
             ETWLVDLV+SGNG ILP CEA++V++E    K      G+ F F +D      +++S+ T
Sbjct  181   ETWLVDLVESGNGLILPGCEAMEVLYECKGGKKTKTSTGIAFAFGKD----IYMVESRAT  236

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSA  830
             ++A GAL TP LL +SGLKN +IGRNL LHPVV AWG F    + P + K+SY+G IM+A
Sbjct  237   IVACGALRTPHLLKHSGLKNGSIGRNLCLHPVVMAWGWFPEEEEWPEKKKRSYQGGIMTA  296

Query  829   MSTVVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             MS+VV       YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDK
Sbjct  297   MSSVVNEETKNSYGETVIQTPSLHPGLFSGVIPWTSSKEFKSRMLKFSRTAHVFTLLRDK  356

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             G+G   S +S+ Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L VK AS  
Sbjct  357   GTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVKTASAV  416

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             E ERFV+EESS+SL+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV
Sbjct  417   EIERFVREESSKSLKDLSGQICSAHQMGSCRMGTSPEVSAVKPTGETWEVEGLFVADTSV  476

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              PTALGVNPMVTI S++YCI  +V++ LK
Sbjct  477   FPTALGVNPMVTIQSIAYCIGLNVVDALK  505



>emb|CDX98615.1| BnaA03g44000D [Brassica napus]
Length=663

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/626 (52%), Positives = 432/626 (69%), Gaps = 21/626 (3%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             +L+  +ME+L A+C+T +P+++ A     D  V  ++  SA+ TGTP +VA +++QR+ H
Sbjct  38    SLTAREMESLVAICDTLIPSLDGAEVGHLDDGVAGYYSASASHTGTPDRVARLMSQRLHH  97

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             PK   L + LW LST IG+L+LCG+ S    FPF  RF  + +K+RE  + +WA+S    
Sbjct  98    PKKWILRVGLWSLSTWIGSLVLCGRRSFIGGFPFFQRFCRLPKKQREETLLNWASSYFLL  157

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R FF ++K +  LVFFT VD+KG N +WKAIGY GP    S+ +++         + + 
Sbjct  158   LRMFFRSIKLITALVFFTQVDEKGKNLAWKAIGYNGPSSDHSDHEEELNETKTNKKMPKE  217

Query  1819  LFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPG-------PSFVIECDAvvvgsgc  1661
             +FGPLY GII+L  P E V  +LT  G +V+  K          P   I CDAVVVGSG 
Sbjct  218   IFGPLYNGIINLKKPREAVTKKLTDHGFTVSTQKSNNNRSSISNPVMTIRCDAVVVGSGS  277

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV++G+LA AGYKVLV+EKGNYYAR+NLS LEG +MD+M+L GGLL T D+++V+LAG
Sbjct  278   GGGVVAGLLAKAGYKVLVVEKGNYYARSNLSQLEGQAMDEMYLSGGLLATSDMNVVILAG  337

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGS +NWSASIKTP +V++EW E   LELF SD+Y++AMD VC +MGVQ    +E 
Sbjct  338   STVGGGSTINWSASIKTPEHVMKEWAEKSELELFESDLYREAMDVVCERMGVQCGFVEEG  397

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             F N VLRKGC ELG  V NIP+NA  DHYCG+C+ GCK G+K+GT+ETWLVDLV+SGNG 
Sbjct  398   FNNEVLRKGCEELGLKVKNIPRNASKDHYCGFCSLGCKKGQKQGTSETWLVDLVESGNGL  457

Query  1120  ILPECEALQVIHE------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLI  959
             ILP C A++V++E      +  + G+ F F  D      V++S+ TV+A GAL TP LL 
Sbjct  458   ILPGCRAMEVLYECESGNKKKTSTGIAFAFGED----IYVVESRATVVACGALRTPHLLK  513

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHF---PDTPGENKKSYEGAIMSAMSTVVLNVNGTGYG  788
              SGLKN NIGRNL LHPVV AWG F      P + KKSYEG IM+AMS+V+     T YG
Sbjct  514   RSGLKNGNIGRNLCLHPVVMAWGWFPEEEKWPEKKKKSYEGGIMTAMSSVLNAEAKTTYG  573

Query  787   -AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
               VIQTP+LHPG+FS ++PW S  +FK RM +++RTAH+F L RDKG+G   S + + Y+
Sbjct  574   ETVIQTPSLHPGMFSGVIPWTSSNDFKTRMLKFSRTAHVFTLLRDKGTGTINSKSYIDYN  633

Query  610   LDKTDEENLQRGLEKLLRILAAAGAE  533
             L+  DEE+L++GLE +L IL AAGA+
Sbjct  634   LNDEDEESLKKGLESVLNILIAAGAD  659



>emb|CDX99382.1| BnaC01g11700D [Brassica napus]
Length=508

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/509 (60%), Positives = 382/509 (75%), Gaps = 14/509 (3%)
 Frame = -3

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I+CDAVVVGSG GGGV++G+LA AGYKVLV+EKGNYYAR+NLSL EG + D+M+L GG
Sbjct  1     MTIQCDAVVVGSGSGGGVVAGMLAKAGYKVLVVEKGNYYARSNLSLHEGQAFDEMYLSGG  60

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             LL T D+++V+LAGSTVGGGS +NWSASIKTP +V++EW E   LE+FGS +Y++AMD V
Sbjct  61    LLATTDMNVVILAGSTVGGGSTINWSASIKTPEHVMKEWSEKSELEMFGSHLYREAMDVV  120

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C +MGVQ E  +E F N +LRKGC  LG PV NIP+NAPSDHYCG+C  GCK G+K+GT+
Sbjct  121   CERMGVQCEFLEEGFNNEILRKGCENLGLPVKNIPRNAPSDHYCGFCCLGCKKGQKQGTS  180

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVT  1001
             ETWLVDLV+SGNG ILP CEA++V++E    K      GV F F  D      V+++K T
Sbjct  181   ETWLVDLVESGNGLILPGCEAMEVLYECKGGKKTKTSTGVAFAFGDD----IYVVEAKTT  236

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD---TPGENKKSYEGAIMSA  830
             ++A GAL TP LL  SGLKN NIGRNL LHPVV AWG FP     P + KKSYEG IM+A
Sbjct  237   IVACGALRTPHLLKRSGLKNGNIGRNLCLHPVVMAWGWFPQEEEWPEKKKKSYEGGIMTA  296

Query  829   MSTVVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             MS+VV       YG  VIQTP+LHPGLFS ++PW S +EFK RM +++RTAH+F L RDK
Sbjct  297   MSSVVNAETKRSYGETVIQTPSLHPGLFSGVIPWTSSKEFKTRMLKFSRTAHVFTLLRDK  356

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             G+G   S +S+ Y+L+  DEE+L++GLE++L IL AAGAEEIG ++  G +L V+ AS  
Sbjct  357   GTGTINSKSSIEYNLNNEDEESLKKGLERVLNILTAAGAEEIGTHNSEGKSLNVRTASAV  416

Query  472   EFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             E ERFV+EESS+ L+       SAHQMGSCRMG  P+ S V P GETWEVEGLFV D SV
Sbjct  417   EIERFVREESSKGLKDLSGQICSAHQMGSCRMGTRPEVSAVKPTGETWEVEGLFVADTSV  476

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              PTALGVNPMV++ S++YCI  +V++ LK
Sbjct  477   FPTALGVNPMVSVQSIAYCIGLNVVDALK  505



>ref|XP_006368110.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like, partial [Solanum 
tuberosum]
Length=389

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/389 (72%), Positives = 317/389 (81%), Gaps = 16/389 (4%)
 Frame = -3

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             KMGVQ E EDE FQNM+LRKGC+ELGYPV  IP NAPSDHYCGWC+ GCKDG+KKGTAET
Sbjct  1     KMGVQSEIEDEGFQNMILRKGCQELGYPVETIPTNAPSDHYCGWCSMGCKDGKKKGTAET  60

Query  1156  WLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQR-DGVKQTAVIKSKVT  1001
             WLVDLVKSGNGAILPECEAL+VIHE       + KA GV F FQ  +G+++  ++KSKVT
Sbjct  61    WLVDLVKSGNGAILPECEALEVIHEEKNDNSGKRKAIGVAFAFQNIEGMREICMVKSKVT  120

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--------KKSYEG  845
             ++A GAL+TPSLL  SGLKN NIGRNLHLHPVV AWG+FPD+P  +        KKSYEG
Sbjct  121   IVACGALSTPSLLKRSGLKNPNIGRNLHLHPVVIAWGYFPDSPSTSNEIWPKAEKKSYEG  180

Query  844   AIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFAL  665
              IM+AMS VV N  G+GYGAVIQTP LHPG+FSALMPW SG +FKMRMS+Y+RTA+IFAL
Sbjct  181   GIMTAMSKVVANFEGSGYGAVIQTPGLHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFAL  240

Query  664   ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  485
             ARDKGSGEA SP S++Y LD+TDEENL+ GLEK LRILAAAGAEEIG     G +LKV +
Sbjct  241   ARDKGSGEALSPYSISYKLDQTDEENLKAGLEKTLRILAAAGAEEIGTQQEKGRSLKVNE  300

Query  484   ASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
             AS +EFERFVKEESS  + KH     SAHQMGSCRMGVDPK SVVN KGETWEVEGLF+G
Sbjct  301   ASLKEFERFVKEESSIEIGKHSVPICSAHQMGSCRMGVDPKTSVVNSKGETWEVEGLFLG  360

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVL  218
             D SV PTA+GVNPMVTI ++SYC +QSVL
Sbjct  361   DSSVCPTAIGVNPMVTIQAISYCTAQSVL  389



>ref|XP_008438494.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Cucumis melo]
Length=737

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/747 (44%), Positives = 458/747 (61%), Gaps = 32/747 (4%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             + L R       T   S ++ME+L+++C+T LP +    P T+ A+   F+  S A +  
Sbjct  7     HPLLRGTRTGKFTHEFSTAEMESLTSICDTVLPPLPFNSPTTSTAAERAFYAVSGAQSPI  66

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA +  +R     +  + ++LW L+TR+GTLLLCG      ++PF+ +F E+  K R
Sbjct  67    PDEVAEMARKRGLVEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVWKFSEMPLKNR  126

Query  2041  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  1865
             E  +  W  + +   IR     +K + L +FF+ VD  GDNPSW+AI Y    P I E  
Sbjct  127   EEALRRWFKNKVFTPIRAALALIKLVSLYIFFSRVDVNGDNPSWEAIKYV---PEIDEHP  183

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIEC  1688
              K                PL KGII+ N   E  F + L + G  +A     G +  +EC
Sbjct  184   SKSSDVR-----------PLQKGIIEPNNETESSFKKSLLQKGIRIAGDD--GHTLSVEC  230

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             D VVVGSGCGGGV + +LA++G KV+VLEKGNY+  ++ S LEGPS+++++  GG+  T 
Sbjct  231   DVVVVGSGCGGGVAAAILASSGQKVMVLEKGNYFTASDYSSLEGPSLEQLYEAGGIFATD  290

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             D  M++LAGSTVGGGSAVNWSASI+TP +VL+EW E H +  FG+  YQ AMD VC ++G
Sbjct  291   DGKMLILAGSTVGGGSAVNWSASIRTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIG  350

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V  +CE+E FQN VLRKGC  LG  V  + +N+P+ HYCG C +GC+ G K+GT  TWLV
Sbjct  351   VSEDCEEEGFQNQVLRKGCENLGLKVEKVARNSPTGHYCGSCGYGCRKGEKQGTDSTWLV  410

Query  1147  DLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             D V  G   I+  C+A + I  RN        K  GV+     D + +   IK+K T+ A
Sbjct  411   DSVNHG-AVIITNCKAERFILARNKNGSMRKSKCLGVIANVWSDNITKKLHIKAKATISA  469

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVV  815
              GAL TP L+I+SGL+NK+IGRNLHLHPV+  WG+FP++  G   KSYEG I++++  VV
Sbjct  470   CGALLTPPLMISSGLRNKHIGRNLHLHPVLMTWGYFPESDSGFKGKSYEGGIITSVHKVV  529

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                + +    +I+TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   
Sbjct  530   SEESKSNPKTIIETPLLGPGSCAVLVPWVSGLDTKQRMLKYSRTAHFITIVRDSGSGAVR  589

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
             S   V+Y+L + D ENL++GL + LRIL AAGA E+G +   G  L+ K   +EE E F+
Sbjct  590   SEGRVSYNLSEEDRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFL  649

Query  454   KEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
                S++    SL ++ N+  SAHQMGSC++GV  K   V+  GE+WE EGLFV D SVLP
Sbjct  650   DNVSAEGGLLSLSRNWNVYTSAHQMGSCKIGVSEKEGAVDENGESWEAEGLFVCDASVLP  709

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             TA+GVNPM+TI S +YCIS  +   L+
Sbjct  710   TAVGVNPMITIQSTAYCISNRIAALLR  736



>ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
Length=738

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/735 (44%), Positives = 453/735 (62%), Gaps = 32/735 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
             T   S ++M+TL+++C+T LP +    P TT  +   F+Q S A +  P +VA    +R 
Sbjct  20    THGFSTAEMDTLTSICDTLLPPLPFNSPTTTTPAEKAFYQVSGAQSPIPEEVAETARKRG  79

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
                 +  + ++LW L+TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +
Sbjct  80    LIEIVLLVRVVLWILATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKV  139

Query  2005  -QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
                +R     +K + L VFF+ VD  GDNPSW+AI Y    P I E   K          
Sbjct  140   FTPVRAALALIKLVFLYVFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDAR-----  191

Query  1828  eELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcggg  1652
                   PL KGII+ N   E  F + L + G  +A     G +  +ECD VVVGSGCGGG
Sbjct  192   ------PLEKGIIEPNNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGG  243

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V + +LA++G KV++LEKGNY+  ++ S LEGPS+++++  G +  T D  +++LAGSTV
Sbjct  244   VAAAILASSGQKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTV  303

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGSAVNWSASIKTP +VL+EW E H +  FG+  YQ AMD VC ++GV  +CE+E FQN
Sbjct  304   GGGSAVNWSASIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQN  363

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
              VLRKGC  LG  V  +P+N+ + HYCG C +GC+ G K+GT  TWLVD V  G   I+ 
Sbjct  364   QVLRKGCENLGLKVEKVPRNSTTGHYCGSCGYGCRKGEKQGTDSTWLVDAVNHG-AVIIT  422

Query  1111  ECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              C+A + I ERN        K  GV+     D + +   IK+K T+ A GAL TP L+I+
Sbjct  423   NCKAERFILERNKNGSMKKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLMIS  482

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGL+NK+IGRNLHLHPV+  WG+FP++  G   KSYEG I++++  VV   + +    +I
Sbjct  483   SGLRNKHIGRNLHLHPVLMTWGYFPESNSGFKGKSYEGGIITSVHKVVSEESKSNPKTII  542

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +TP L PG  + L+PW SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L + 
Sbjct  543   ETPLLGPGSCAVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLSEE  602

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ----SL  431
             D ENL++GL + LRIL AAGA E+G +   G  L+ K   +EE E F+   S++    SL
Sbjct  603   DRENLKKGLRQSLRILVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSL  662

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              K  N+  SAHQMGSC++GV      ++  GE+WE EGLFV D SVLPTA+GVNPM+TI 
Sbjct  663   SKDWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQ  722

Query  250   SVSYCISQSVLEFLK  206
             S +YCIS  +   L+
Sbjct  723   STAYCISNRIAALLR  737



>ref|XP_009384649.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Musa acuminata 
subsp. malaccensis]
Length=752

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/752 (42%), Positives = 463/752 (62%), Gaps = 40/752 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAS  2231
             R+ E       LS +QM TLSA+C TF+P +            E  D +V  FF  S + 
Sbjct  14    RRAEKGGYRHGLSAAQMRTLSAMCGTFVPTVPIEAACLGGGKDEAPDEAVEAFFLASGSD  73

Query  2230  TGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  2051
             +  P +VA ++ +R +   +  + L+LW L+TR+GTL+LCG  SLS +FPF+ +F ++  
Sbjct  74    SPVPDEVAELLVRRGQKEAVALVKLVLWVLATRLGTLVLCGSLSLSWRFPFINKFSDMPV  133

Query  2050  KKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS  1874
             +KRE I+  W    S  F+R  F  +K   L VF++  +++ +N +WKAIGY  P     
Sbjct  134   EKREHILMKWNREKSFIFLRLVFVIVKVFCLYVFYSMTNEEEENRAWKAIGYNTPSEEKP  193

Query  1873  ekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
              K + ++              PL KGII+ ++  +  +   L + G +V    P   ++ 
Sbjct  194   HKSRGER--------------PLEKGIIETMDKTDSSLRQSLIEKGLAVTD-NPREHTYT  238

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I CD V+ GSGCGGGV + VLA++G+KV+V+EKGNY+   + + LE PSMD+++  GG+L
Sbjct  239   INCDVVIAGSGCGGGVAAAVLASSGHKVVVVEKGNYFTAEDYTALEAPSMDQLYEAGGIL  298

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              + D+ M+L+AGSTVGGGSAVNW+A ++TP +VLREW E H L LF S  Y  AMD+VC 
Sbjct  299   SSLDVKMMLMAGSTVGGGSAVNWAACVRTPDFVLREWAEEHHLRLFDSPTYTSAMDSVCA  358

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV  +C  E FQN VLR+GC+ LG  V ++P+N+  DHYCG C +GC+ G K+GT  T
Sbjct  359   RLGVTEKCTKEGFQNQVLRRGCQNLGLEVESVPRNSSEDHYCGTCCYGCRSGDKRGTDTT  418

Query  1156  WLVDLVKSGNGAILPECEALQVIHERNKAK----------GVMFTFQRDGVKQTAVIKSK  1007
             WLVD V  G   I+  C+A + I E ++            G++     + + +T  I++K
Sbjct  419   WLVDAVDRG-AVIITACKAERFIIEEDRQDSSSKKKKKCLGLIARTLNNAITKTLRIEAK  477

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKS-YEGAIMSA  830
              T+ A G+L TP L++ SGL+N NIG+NL LHPV+ AWG+FP++  + K + +EG I+++
Sbjct  478   ATISACGSLLTPPLMVASGLRNPNIGKNLRLHPVLLAWGYFPESVSDLKGNIFEGGIITS  537

Query  829   MSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             +  V  + N     ++I+T  L P  F+ L PW SG++ K +M RY+RTAH+FAL RD+G
Sbjct  538   LHKVKASENSNATRSIIETAVLGPASFATLFPWVSGKDMKEKMFRYSRTAHVFALVRDRG  597

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE  470
             +G       + Y LD++D+ENL+ GL + LRIL AAGA E+G +   G T+K K    EE
Sbjct  598   AGTIEGEGRLKYRLDRSDKENLREGLRRALRILVAAGAAEVGTHRSDGQTIKCKGMKEEE  657

Query  469   FERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGD  302
              E F+    S    +S      L  SAHQMGSCRMG   +   V+ +GE+WE  GLFV D
Sbjct  658   LEEFLDGIDSVGGPRSRSDVWTLHCSAHQMGSCRMGASEEEGGVDERGESWEAGGLFVCD  717

Query  301   GSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             GSV+PTA+GVNPM+TI +++YC+S+ + E+LK
Sbjct  718   GSVVPTAVGVNPMITIQAIAYCLSEGIAEYLK  749



>ref|XP_002314488.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEF00659.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=743

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/737 (45%), Positives = 455/737 (62%), Gaps = 40/737 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             LS ++ME+LS+LC T LP+++     +        +V  F++ SA+ T  P ++A ++ +
Sbjct  23    LSSAEMESLSSLCETILPSLSPIPKFDGKQNQPTKAVQAFYRASASQTPMPDEMAELLTK  82

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R     +  + L+LW LSTR+GT LLCG      ++P+   F  I   KRER++  W   
Sbjct  83    RGLPEAVFMVRLVLWLLSTRLGTFLLCGSLCFGEKWPYFKNFSSIPLDKRERVLQKWFKH  142

Query  2011  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdhe  1838
                  IR  F  +K LVL VFF+ VD+KGDNP+W+AI Y  G D +  +  K++      
Sbjct  143   RFFTPIRTAFVYVKILVLYVFFSRVDEKGDNPAWEAIEYNAGTDENPDQVPKER------  196

Query  1837  ddieELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgc  1661
                      PL KG+ID N   +  + + L + G  V +  P    + I+CD V+VGSGC
Sbjct  197   ---------PLQKGLIDTNQETDSTLLHSLKEKGLRVTQ-DPRKNLYKIKCDVVIVGSGC  246

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV + VLA +G KV VLEKGNY+  T+ S LEGPSMD+++  GG L T D +M+++AG
Sbjct  247   GGGVAAAVLAASGQKVFVLEKGNYFTATDYSGLEGPSMDQLYESGGKLATTDAEMLIMAG  306

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             S VGGGSAVNWSASIKTP  VL+EW     + LFGS  Y  AMD VC ++GV   C +E 
Sbjct  307   SAVGGGSAVNWSASIKTPNSVLQEWTGTQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEG  366

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             FQN VLRKGC  LG PV  +P+N+   HYCG C +GC  G KKGT  TWLVD V  G   
Sbjct  367   FQNQVLRKGCESLGIPVKTVPRNSSERHYCGSCGYGCLKGEKKGTDRTWLVDAVDHG-AV  425

Query  1120  ILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             IL  C+A + + E+N        K  GV      + ++    I++KVT+ A GAL TP L
Sbjct  426   ILTGCKAERFMLEKNEGGSKRKKKCVGVTAKIVNNNIRTRLQIEAKVTISACGALLTPPL  485

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYG  788
             +I+SGLKN+NIGRNLHLHPV+ AWG+FP++  E K K YEG I++A+  V+     +   
Sbjct  486   MISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYEGGIITAVHEVL--TGDSNAR  543

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+I+TPAL P  F AL PW SG + K RM++YARTAH+ A+ RD GSG+  +   ++Y+L
Sbjct  544   AIIETPALGPSSFVALCPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNL  603

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLR  428
             D  D+ENL+ GL + LRIL AAGA E+G +   G  +K +   +E+ E F+    + +  
Sbjct  604   DAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAGP  663

Query  427   KHP----NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
               P     L  SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+
Sbjct  664   LSPVEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI  723

Query  259   TIMSVSYCISQSVLEFL  209
             TI S +YC+S+ + E L
Sbjct  724   TIQSTAYCLSKKIAESL  740



>ref|XP_011030464.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Populus euphratica]
Length=745

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/738 (45%), Positives = 455/738 (62%), Gaps = 40/738 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             LS ++ME LS+LC T  P+++     +        ++  F++ SA+ T  P ++A ++ +
Sbjct  23    LSSAEMEALSSLCETIFPSLSPIPKFDGKQNQPTKAMQAFYRASASQTPMPDEMAELLTK  82

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R     +  + L+LW LSTR+GT LLCG      ++P+   F  I   KRER++  W   
Sbjct  83    RGLLEAVFLVRLVLWLLSTRLGTFLLCGSLCFEEKWPYFKNFSSIPLDKRERVLQKWFKH  142

Query  2011  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdhe  1838
                  IR  F  +K L+L VFF+ VD+KGDNP+W+AI Y  G D S  +  K++      
Sbjct  143   RFFTPIRAAFVYVKILILYVFFSRVDEKGDNPAWEAIEYNVGADESPDQVPKER------  196

Query  1837  ddieELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgc  1661
                      PL KG+ID N      + + L + G  V +  P    + I+CD V+VGSGC
Sbjct  197   ---------PLQKGLIDTNQETASTLLHSLKEKGLRVTQ-DPRKNVYKIKCDVVIVGSGC  246

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV + VLA +G KV VLEKGNY+  ++ S LEGPSMD+++  GG L T D +M+++AG
Sbjct  247   GGGVAAAVLAASGQKVFVLEKGNYFTASDYSGLEGPSMDQLYESGGKLATTDAEMLIMAG  306

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             S VGGGSAVNWSASIKTP  VL+EW     + LFGS  Y  AMD VC ++GV   C +E 
Sbjct  307   SAVGGGSAVNWSASIKTPNSVLQEWTRNQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEG  366

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             FQN VLRKGC  LG PV  +P+N+   HYCG C +GC+ G KKGT  TWLVD V  G   
Sbjct  367   FQNQVLRKGCESLGIPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTWLVDAVDHG-AV  425

Query  1120  ILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             I+  C+A + + E N        K  GV      + ++    I++KVT+ A GAL TP L
Sbjct  426   IITGCKAERFMLENNEGGSKRKKKCVGVTAKIVNNNIRTRLQIEAKVTISACGALLTPPL  485

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYG  788
             +I+SGLKN+NIGRNLHLHPV+ AWG+FP++  E K K YEG I++A+  V+     +   
Sbjct  486   MISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYEGGIITAVHEVL--TGDSNAR  543

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+I+TPAL P  F+AL PW SG + K RM++YARTAH+ A+ RD GSG+  +   ++Y+L
Sbjct  544   AIIETPALGPSSFAALYPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEGRISYNL  603

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ---  437
             D  D+ENL+ GL + LRIL AAGA E+G +   G  +K +   +E+ E F+    +    
Sbjct  604   DAMDKENLKAGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEFLDTVYATAGP  663

Query  436   -SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              SL +   L  SAHQMGSCRMG++ K   V+  GE+WE EGLF+ D SVLP+A+GVNPM+
Sbjct  664   LSLAEDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFICDASVLPSAVGVNPMI  723

Query  259   TIMSVSYCISQSVLEFLK  206
             TI S +YC+S+ + E L+
Sbjct  724   TIQSTAYCLSKKIAESLR  741



>ref|XP_010023906.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Eucalyptus grandis]
 gb|KCW60304.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=776

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/748 (43%), Positives = 454/748 (61%), Gaps = 48/748 (6%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPH  2216
             + S  +ME L+A+C T  P ++            E   +  D +V  F+++S +    P 
Sbjct  26    SFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGRIDREDEAVRFFYESSGSQAPVPQ  85

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             +VA ++ +R     +  + ++L  LSTR+GTLLLCG   +  ++P++  F  +   +RE+
Sbjct  86    EVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREK  145

Query  2035  IVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  1862
             ++  W     L  IR+ F  +K + L V F+ VD+KG+NP WKAIGY    +  +S+  +
Sbjct  146   VLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENPLWKAIGYQVDEEQEMSKPDQ  205

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
              +               PL KGII+ N   +  +   L + G  V +       + I+CD
Sbjct  206   GR---------------PLEKGIIETNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCD  249

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AV+VGSGCGGGV + VLA  GYKV+VLEKGNYY   + S LEGPSMD+++  GG+L +  
Sbjct  250   AVIVGSGCGGGVAAAVLAGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCT  309

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
              ++++LAGSTVGGGSAVNWSASI+TP  VL++W E HG+ELFGS  Y  AMD VC ++GV
Sbjct  310   ANVLILAGSTVGGGSAVNWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGV  369

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                C ++SFQN VL++GC +LG  +  +P+N+  DHYCG C +GC+ G K+GT  TWLVD
Sbjct  370   TDRCVEQSFQNKVLQEGCEKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGTDYTWLVD  429

Query  1144  LVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAG  989
              V  G   IL  C+A Q++ E+N        K  GV        ++     ++KVTV A 
Sbjct  430   AVNCG-AVILSGCKAEQLVFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAKVTVSAC  488

Query  988   GALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFP-DTPGE-NKKSYEGAIMSAMSTVV  815
             GAL TP LLI+SGLKNK+IGRNLHLHPV  AWGHFP D+  + +  SY+G I++ +  VV
Sbjct  489   GALLTPPLLISSGLKNKHIGRNLHLHPVAMAWGHFPQDSSSQLSGTSYQGGIITLIHKVV  548

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                +     A+I+TP L P  F+ L PW SG + K R+++YARTAH+  + RD+G GE  
Sbjct  549   EGNSNPNVQAIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVT  608

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE---  464
                 + Y +D  D+EN++ GL + LRIL AAGA+E+G +   GL +K +  +  E++   
Sbjct  609   REGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEE  668

Query  463   ---RFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
                R   E+   ++ +      SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SV
Sbjct  669   FLDRVSAEDGPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASV  728

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFL  209
             LPTA+GVNPM+TI S +YCI+  + E+L
Sbjct  729   LPTAVGVNPMITIESTAYCIANRIAEYL  756



>gb|KCW60303.1| hypothetical protein EUGRSUZ_H03017 [Eucalyptus grandis]
Length=781

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/748 (43%), Positives = 454/748 (61%), Gaps = 48/748 (6%)
 Frame = -3

Query  2359  TLSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPH  2216
             + S  +ME L+A+C T  P ++            E   +  D +V  F+++S +    P 
Sbjct  26    SFSSREMEALAAICETVFPPLSGAAAAGAAGGEFEGRIDREDEAVRFFYESSGSQAPVPQ  85

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             +VA ++ +R     +  + ++L  LSTR+GTLLLCG   +  ++P++  F  +   +RE+
Sbjct  86    EVAELLGRRGLLAAVIVVRVVLLVLSTRLGTLLLCGSLCVGGRWPYVNTFSSMGSDQREK  145

Query  2035  IVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  1862
             ++  W     L  IR+ F  +K + L V F+ VD+KG+NP WKAIGY    +  +S+  +
Sbjct  146   VLRGWLKHRFLTPIRSAFVYLKVMCLYVLFSRVDEKGENPLWKAIGYQVDEEQEMSKPDQ  205

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
              +               PL KGII+ N   +  +   L + G  V +       + I+CD
Sbjct  206   GR---------------PLEKGIIETNYSTDLGLLQSLKQKGLEVTQ-DSKNKIYRIKCD  249

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AV+VGSGCGGGV + VLA  GYKV+VLEKGNYY   + S LEGPSMD+++  GG+L +  
Sbjct  250   AVIVGSGCGGGVAAAVLAGCGYKVVVLEKGNYYTHKDYSSLEGPSMDQLYESGGILPSCT  309

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
              ++++LAGSTVGGGSAVNWSASI+TP  VL++W E HG+ELFGS  Y  AMD VC ++GV
Sbjct  310   ANVLILAGSTVGGGSAVNWSASIRTPHAVLQDWAEKHGMELFGSKEYASAMDIVCKRIGV  369

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                C ++SFQN VL++GC +LG  +  +P+N+  DHYCG C +GC+ G K+GT  TWLVD
Sbjct  370   TDRCVEQSFQNKVLQEGCEKLGLEINAVPRNSSEDHYCGSCGYGCRRGDKQGTDYTWLVD  429

Query  1144  LVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAG  989
              V  G   IL  C+A Q++ E+N        K  GV        ++     ++KVTV A 
Sbjct  430   AVNCG-AVILSGCKAEQLVFEKNAPGRARRKKCTGVRAKSMNSDIENVLQFEAKVTVSAC  488

Query  988   GALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFP-DTPGE-NKKSYEGAIMSAMSTVV  815
             GAL TP LLI+SGLKNK+IGRNLHLHPV  AWGHFP D+  + +  SY+G I++ +  VV
Sbjct  489   GALLTPPLLISSGLKNKHIGRNLHLHPVAMAWGHFPQDSSSQLSGTSYQGGIITLIHKVV  548

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                +     A+I+TP L P  F+ L PW SG + K R+++YARTAH+  + RD+G GE  
Sbjct  549   EGNSNPNVQAIIETPLLGPATFTVLCPWESGLDIKDRLAKYARTAHLLTIVRDRGHGEVT  608

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE---  464
                 + Y +D  D+EN++ GL + LRIL AAGA+E+G +   GL +K +  +  E++   
Sbjct  609   REGIINYKMDSVDKENIRAGLRQSLRILIAAGADEVGTHRSDGLRMKCRGGTASEYQVEE  668

Query  463   ---RFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
                R   E+   ++ +      SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SV
Sbjct  669   FLDRVSAEDGPLAMDEKWTFYTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASV  728

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFL  209
             LPTA+GVNPM+TI S +YCI+  + E+L
Sbjct  729   LPTAVGVNPMITIESTAYCIANRIAEYL  756



>emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
Length=741

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/737 (45%), Positives = 450/737 (61%), Gaps = 36/737 (5%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             T   S ++M++L+++C   LP +   ++       V +F+Q S +    P + A +  +R
Sbjct  19    THGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKGVQSFYQASGSQHPIPDEGAELFVKR  78

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
                  +  + ++L  LSTR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    
Sbjct  79    ALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFRHR  138

Query  2008  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdhed  1835
             L   IR  F  +K L L  FFT  D+  +N +W+AIGY    D + S+  K++       
Sbjct  139   LLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGYHTDTDGNRSKVPKER-------  191

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KG+++ +   E  +   L + G  V K  P    + I+CD VVVGSGCG
Sbjct  192   --------PLQKGMVETMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCG  242

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV + VLA++G+KV+VLEKGNY+  T+ S LEGPSM+++F  GG+L T D  M++LAGS
Sbjct  243   GGVAAAVLASSGHKVVVLEKGNYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGS  302

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             TVGGGSA+NWSASIKTP  VL+EW E H L LFGS  Y  AMD VC ++GV   C +E F
Sbjct  303   TVGGGSAINWSASIKTPKSVLQEWAEDHKLPLFGSSQYFSAMDAVCERIGVTETCAEEGF  362

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VLRKGC  LG  V  +P+N+   HYCG C++GC+ G KKGT  TWLVD V  G   I
Sbjct  363   QNQVLRKGCENLGLKVDLVPRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACG-AVI  421

Query  1117  LPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             +  C+A + I E        R K  GV+     + +K    I++KVT+ A G+L TP L+
Sbjct  422   ITGCKAERFILETNEYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLM  481

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGA  785
             I+SGLKN++IG+NLHLHPV   WG+FPD+  E   K+YEG I+++M  VV         A
Sbjct  482   ISSGLKNQHIGQNLHLHPVAMIWGYFPDSNSEFEGKAYEGGIITSMHKVV--SEDCQVRA  539

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             +I+TPAL PG F+AL PW SG + K RM RY RT H+FA+ RD+G+G+      ++Y+L 
Sbjct  540   IIETPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLS  599

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQ  437
               D+ENL+ G+ + LRIL AAGA E+G     G  LK K  + +E E F+      E  Q
Sbjct  600   AIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAVEGPQ  659

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
             S      +  +AHQMGSCRMG   K   V+  GE+WE  GLFV DGSVLPTA+GVNPM+T
Sbjct  660   SFVDKWTITGTAHQMGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMIT  719

Query  256   IMSVSYCISQSVLEFLK  206
             I S +YC+S+ + + L+
Sbjct  720   IQSTAYCLSKKIADSLE  736



>ref|XP_007224435.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
 gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
Length=721

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/736 (44%), Positives = 451/736 (61%), Gaps = 43/736 (6%)
 Frame = -3

Query  2341  METLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             M++L+++C   LPA+          E  P  TD +V +F Q S A T  P +VA ++ +R
Sbjct  1     MQSLASVCEALLPALPLNDFCFEGKEEQP--TDKAVQSFHQASGAQTPIPDEVAELLVKR  58

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
                  +  + ++LW LSTR+GTLLLCG      ++PF+L F  +   KRER++  W    
Sbjct  59    AFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWFKHR  118

Query  2008  -LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
              L  IR  F  +K L L +FF+ VD   +NP W+AIGY       +     ++       
Sbjct  119   FLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIGYHVDTDDQNTPTAPKER------  172

Query  1831  ieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                    PL KGII+ +   +  + +   + G +V +  P    + I+CD VVVGSGCGG
Sbjct  173   -------PLQKGIIETIYETDTTLLHSFAEKGLTV-RHDPQEKLYKIKCDVVVVGSGCGG  224

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA++G KV+VLEKGNYY  ++ S LEGPS D+M+  GG+  T D  +V+ AGST
Sbjct  225   GVAAAVLASSGQKVVVLEKGNYYTHSDYSSLEGPSQDQMYESGGIFATIDGKLVIQAGST  284

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSA I+TP  VL EW + H +  FG   Y  AMDTVC ++GV   C +E FQ
Sbjct  285   VGGGSAVNWSACIRTPDNVLEEWAKDHEIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQ  344

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLRKGC  LG  V  +P+N+   HYCG C +GC+ G KKGT  TWL+D V  G   IL
Sbjct  345   NQVLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLLDAVDHG-AVIL  403

Query  1114  PECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLI  959
               C A + + E        + K  GVM     + + +   I++KVT+ A GAL TP L+I
Sbjct  404   TGCRAEKFVLENIKSGSLRKKKCSGVMGKSLSNNISKKLQIEAKVTISACGALLTPPLMI  463

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAV  782
             +SGLKNKNIGRNLHLHPV+ AWG+FP++  E K K YEG I++++  V  +V+ +   A+
Sbjct  464   SSGLKNKNIGRNLHLHPVLMAWGYFPESNSEFKGKIYEGGIITSVHKVA-SVD-SKVKAI  521

Query  781   IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDK  602
             I+TPAL PG FS+L PW SG++ K RM +Y RT H+ ++ RD+GSG       V+Y+ + 
Sbjct  522   IETPALGPGAFSSLCPWVSGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVSYEFEA  581

Query  601   TDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQS  434
             +D+ENL+ GL + LRIL AAGA E+G +   GL +K K   +E+ E F+     E+  QS
Sbjct  582   SDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAEKGPQS  641

Query  433   LRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  254
             L ++    +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+TI
Sbjct  642   LVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITI  701

Query  253   MSVSYCISQSVLEFLK  206
              S +YC+S+ +   LK
Sbjct  702   QSTAYCLSKRIAGSLK  717



>ref|XP_010684652.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Beta vulgaris subsp. 
vulgaris]
Length=750

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/753 (43%), Positives = 456/753 (61%), Gaps = 41/753 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAAST  2228
             R  ++N+     S SQ++TL+A+C T +P++       + L      S+ +FF  SA+  
Sbjct  13    RSDKDNSFKHGFSSSQIQTLTAMCETIIPSLPHTSVTQQILSLHPQNSILSFFGNSASQP  72

Query  2227  GTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  2048
               P +VA +I +R+    +  + ++L  LSTR+GTLL CG   L  ++PF+ +F E+S +
Sbjct  73    PIPDEVAEIIVKRVLPEAVILIRVVLKLLSTRLGTLLFCGCLCLEWKWPFIHKFSEMSLE  132

Query  2047  KRERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSI  1877
             KRE+++  W+T S    +R  F  +K     +FFT  DD  +NP+W+AIGY     +P +
Sbjct  133   KREKLLQRWSTESYWTSLRVVFLLIKIACCFIFFTRTDDNAENPAWEAIGYNVDTREPPV  192

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSF  1700
                Q+++               P+ KGI++  +  +  V   L + G +V++        
Sbjct  193   HSSQEQR---------------PIQKGIVECRMMNDSTVVQILEEKGLTVSEDVDQS-VL  236

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              ++CD V+VGSGCGGGV + +LA+ G+KV++LEKGNY+A  + S LEGPS+++++L GG+
Sbjct  237   KVQCDVVIVGSGCGGGVAAAILASHGHKVVILEKGNYFAPGDYSSLEGPSLNELYLSGGM  296

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
             L T D  M++ +GSTVGGGSAVNWSA IKTP  VL EW   H L +FGS  Y+ AM+ V 
Sbjct  297   LTTLDGKMIVFSGSTVGGGSAVNWSACIKTPDSVLNEWSVNHKLPIFGSPDYKSAMNEVW  356

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++GV  +C +E FQN VLRKGC  LG  V  +P N+  DHYCG C +GC+ G KKGT  
Sbjct  357   KRLGVTEDCSEEGFQNQVLRKGCEHLGLKVEKVPTNSSKDHYCGSCCYGCRMGDKKGTDT  416

Query  1159  TWLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVT  1001
             TWLVD V +G   IL  C+A + I E       R +  GV+ T     V +   I+SKVT
Sbjct  417   TWLVDAVNNG-AIILTGCKANKFILEETQNGEKRKRCHGVLATLLSKDVSKKLQIESKVT  475

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD-TPGENKKSYEGAIMSAMS  824
             + A G+L+TP LLI+SGL+N NIG NLHLHP + AWG+FP+ TPG   K YEG I++++ 
Sbjct  476   ISACGSLSTPPLLISSGLQNSNIGTNLHLHPTLLAWGYFPESTPGLKGKCYEGGIITSLH  535

Query  823   TVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG  644
              VV     +   A+I+  AL P  FS+LMPW SG +FK R+ +Y RTA +F+L RDK SG
Sbjct  536   KVV--SEKSNVHAIIEASALGPASFSSLMPWVSGLDFKERLVKYGRTASLFSLVRDKSSG  593

Query  643   EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE  464
             E      V Y L+  D+ENL+ GL + LRIL AAGA E+G     G  L  K    EE E
Sbjct  594   EVKKEGRVRYRLNNHDKENLKMGLRQCLRILVAAGAVEVGTYRSDGQRLNCKGVKEEEME  653

Query  463   RF----VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS  296
              F    +    ++S  +H  +   AHQM SCRMG   +   V+  GETWE +GL+V DGS
Sbjct  654   EFLDSVIAPGGARSRTEHWTMYGCAHQMSSCRMGASKEDGAVDENGETWEAKGLYVCDGS  713

Query  295   VLPTALGVNPMVTIMSVSYCISQSVLEFLKTHD  197
             VLPTALGVNPM+TI SV+YCIS  +   L+  +
Sbjct  714   VLPTALGVNPMITIESVAYCISTRIASVLEEEN  746



>ref|XP_008447391.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2-like 
[Cucumis melo]
Length=739

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/732 (44%), Positives = 448/732 (61%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S SQME ++A C   +P +        D  + +F+Q+SA     P +VA ++ +R    
Sbjct  23    FSSSQMEAMAAFCEALIPPLPLFSETPLDQFLLSFYQSSAFQAPIPDEVADLLVERANPK  82

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-  2000
              +  + L+L  LS RIGTLLLCG      ++PF L+F EIS +KRE+I+ +W+ +  ++ 
Sbjct  83    AVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKREQILKNWSMAHHKYT  142

Query  1999  --IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K      FF+ +D+   N +WKA+GY      +  +++            
Sbjct  143   VLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKAMGY-----EVDTRKQLNHTQKER----  193

Query  1825  ELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL +G+I+  N  +  +F  L++ G  V + K  G ++ I+CD V+VGSGCGGGV
Sbjct  194   -----PLERGMIETGNEDDSTLFRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGV  248

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA +G KV+VLEKGNY+   + S LEGPSM++++  GGL  T D  ++LLAG+TVG
Sbjct  249   AAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLAGTTVG  308

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSA+NWSASI+TP  VL EW   H + L+GS  YQ AMD VC ++GV R C  ESFQN 
Sbjct  309   GGSAINWSASIRTPKSVLDEWSTDHKIPLYGSIDYQLAMDAVCDRIGVTRGCRVESFQNQ  368

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V ++ +N+  DHYCG C +GC+ G KKGT  TWLVD VK G   IL  
Sbjct  369   VLRKGCENLGLKVDSVSRNSSEDHYCGSCCYGCRVGDKKGTDTTWLVDAVKCG-AVILTG  427

Query  1108  CEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             C A + I E       + K  GV+ T     V +   I++K T+ A G+L TP LLI SG
Sbjct  428   CHADKFILENTNNTSXKKKCIGVIATPLSKNVTKKLHIEAKATISACGSLLTPPLLIASG  487

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             L+NKNIG NLHLHPV   WG+FP+   + K K YEG +++ +  VV   + +   A+I+T
Sbjct  488   LRNKNIGTNLHLHPVSLVWGYFPEELSDFKGKIYEGGLITCLHNVVSKYSNS--HAIIET  545

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PA+ P  F+AL PW SG+E K  M +Y+RTAH+FAL RD+G+GE     +V Y L++TD+
Sbjct  546   PAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALVRDQGAGEIKVKANVKYRLNQTDK  605

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRK  425
             ENL+ GL + LRIL AAGA EIG     G  ++ +   +E+ E F+    +     S +K
Sbjct  606   ENLKIGLRQALRILIAAGATEIGTYRSDGQRIRCQGTKKEDLEEFLDSVEAVGGPWSRQK  665

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             +  +  SAHQM SCRMG   +   V+  GE+WE EGLFV DGSVLPTA+GVNPM+TI S 
Sbjct  666   YWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQST  725

Query  244   SYCISQSVLEFL  209
             +YCIS+ + E L
Sbjct  726   AYCISKKIAESL  737



>ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gb|KGN58167.1| Electron carrier [Cucumis sativus]
Length=738

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/732 (44%), Positives = 451/732 (62%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S SQME ++A C   +P +        D S+ +F+Q+SA     P +VA ++ +R    
Sbjct  23    FSSSQMEAMAAFCEALIPPVPLFKESPLDQSLLSFYQSSAFQAPIPDEVADLLVERANPK  82

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-  2000
              +  + L+L  LS RIGTLLLCG      ++PF L+F EIS +KRERI+ +W+ +  ++ 
Sbjct  83    AVFLVKLVLRLLSFRIGTLLLCGNVCFDWRWPFFLKFSEISLEKRERILKNWSMAHHKYT  142

Query  1999  --IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K      FF+ +D+   N +WK +GY      +  +++            
Sbjct  143   VLLRMTFMIIKIFCCFKFFSRIDEGTKNVAWKGMGY-----KVDTRKQLNHTQKER----  193

Query  1825  ELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL +G+I+  N  +  +   L++ G  V + K  G ++ I+CD V+VGSGCGGGV
Sbjct  194   -----PLERGMIETGNEDDSTLLRSLSQKGLEVIEDKKHGNAYKIKCDVVIVGSGCGGGV  248

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA +G KV+VLEKGNY+   + S LEGPSM++++  GGL  T D  ++LLAG+TVG
Sbjct  249   AAAVLAKSGLKVVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLAGTTVG  308

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSA+NWSASIKTP  +L EW   + + L+GS  YQ AMD VC ++GV  EC  ESFQN 
Sbjct  309   GGSAINWSASIKTPKSILDEWSTDYKIPLYGSIDYQLAMDAVCDRIGVTEECPVESFQNQ  368

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V ++ +N+  DHYCG C +GC+ G KKGT  TWLVD V+ G   IL  
Sbjct  369   VLRKGCENLGLKVDSVSRNSSKDHYCGSCCYGCRVGDKKGTDTTWLVDAVEYG-AVILTG  427

Query  1108  CEALQVI-------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             C+A + I        +R +  GV+ T +   + +   I++K T+ A G+L TP LLI SG
Sbjct  428   CQADKFILDNTNNTSKRKRCIGVIATPRSKNITKKLHIEAKATISACGSLLTPPLLIASG  487

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             L+NKNIG NLHLHPV   WG+FP+   + K K YEG +++++  VV   + +   A+I+T
Sbjct  488   LRNKNIGTNLHLHPVSLVWGYFPEELSDFKGKIYEGGLITSLHKVVSKYSNS--HAIIET  545

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PA+ P  F+AL PW SG+E K  M +Y+RTAH+FAL RD+G+GE     +V Y L++TD+
Sbjct  546   PAVGPASFAALFPWTSGREMKDAMVKYSRTAHLFALIRDQGAGEIKVKANVKYRLNQTDK  605

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRK  425
             ENL+ GL + LRIL AAGA E+G     G  ++ +  ++EE E F+    +     S +K
Sbjct  606   ENLRIGLRQALRILIAAGATEVGTYRSDGQRIRCQGTNKEELEEFLDSVEAVGGPLSRQK  665

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             +  +  SAHQM SCRMG   +   V+  GE+WE EGLFV DGSVLPTA+GVNPM+TI S 
Sbjct  666   YWTMYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQST  725

Query  244   SYCISQSVLEFL  209
             +YCIS+ + E L
Sbjct  726   AYCISKKIAESL  737



>ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
Length=741

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/737 (44%), Positives = 449/737 (61%), Gaps = 36/737 (5%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAIN-EALPETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             T   S ++M++L+++C   LP +   ++      +V +F+Q S +    P + A +  +R
Sbjct  19    THGFSSAEMQSLASICEVLLPPLPLNSIEGQPSKAVQSFYQASGSQHPIPDEGAELFVKR  78

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
                  +  + ++L  LSTR+GTLLLCG  S S ++PF+  F  IS +KRE+I+  W    
Sbjct  79    ALIEAVILVRVVLIILSTRLGTLLLCGSLSFSDKWPFINNFSSISLEKREKILQRWFKHR  138

Query  2008  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdhed  1835
             L   IR  F  +K L L  FFT  D+  +N +W+AIGY    D + S+  K++       
Sbjct  139   LLTPIRLAFVYIKFLCLYAFFTLADENSENAAWEAIGYHTDTDGNRSKVPKER-------  191

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KG+++ +   E  +   L + G  V K  P    + I+CD VVVGSGCG
Sbjct  192   --------PLQKGMVETMQETESTLVQSLNQKGLKVVK-DPEQKLYKIKCDVVVVGSGCG  242

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV + VLA++G+KV+VLEKG Y+  T+ S LEGPSM+++F  GG+L T D  M++LAGS
Sbjct  243   GGVAAAVLASSGHKVVVLEKGTYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGS  302

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             TVGGGSA+NWSASIKTP  VL EW E H L LFGS  Y  AMD VC ++GV   C +E F
Sbjct  303   TVGGGSAINWSASIKTPKSVLHEWAEEHKLPLFGSSQYFSAMDAVCERIGVTETCVEEGF  362

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VL+KGC  LG  V  +P+N+   HYCG C++GC+ G KKGT  TWLVD V  G   I
Sbjct  363   QNQVLQKGCENLGLKVDLVPRNSSEKHYCGSCSYGCRSGDKKGTDSTWLVDAVACG-AVI  421

Query  1117  LPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             +  C+A + I E        R K  GV+     + +K    I++KVT+ A G+L TP L+
Sbjct  422   ITGCKAERFILETNEYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLM  481

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGA  785
             I+SGLKN++IG+NLHLHPV   WG+FPD+  E   K+YEG I+++M  VV         A
Sbjct  482   ISSGLKNQHIGQNLHLHPVAMVWGYFPDSNSEFEGKAYEGGIITSMHKVV--SEDCQVRA  539

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             +I+TPAL PG F+AL PW SG + K RM RY RT H+FA+ RD+G+G+      ++Y+L 
Sbjct  540   IIETPALGPGSFAALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVEGRISYNLS  599

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQ  437
               D+ENL+ G+ + LRIL AAGA E+G     G  LK K  + +E E F+      E  Q
Sbjct  600   AIDKENLRAGVRQGLRILIAAGAVEVGTYRSDGQRLKSKGINEKELEEFLDSVSAAEGPQ  659

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
             S      +  +AHQMGSCRMG   K   V+  GE+WE  GLFV DGSVLPTA+GVNPM+T
Sbjct  660   SFVDKWTITGTAHQMGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMIT  719

Query  256   IMSVSYCISQSVLEFLK  206
             I S +YC+S+ + + L+
Sbjct  720   IQSTAYCLSKKIADSLE  736



>ref|XP_010920358.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=756

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/754 (43%), Positives = 462/754 (61%), Gaps = 45/754 (6%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAAS  2231
             R+ E    +   SPSQ+++L+A+C  F+P+       +     +    S+  F++ S + 
Sbjct  18    RRREKGDYSHGFSPSQIQSLAAMCEAFVPSLPMEEFHVTSGKEDPPTKSLQAFYRASGSE  77

Query  2230  TGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  2051
                P +VA ++ +R     L  + L+LW L+T++GTL+LC   SL  +FPF+ +F ++  
Sbjct  78    FPMPDEVAELMVKRGLKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMPI  137

Query  2050  KKRERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP---DP  1883
             +KRE     W   +    +R  F  +K   L +F++  ++  +N SW AIGY  P    P
Sbjct  138   EKREEAFKRWNKENFFTPLRLVFVMVKVFCLYIFYSMTNENSENQSWNAIGYSLPIVEKP  197

Query  1882  SISekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGP  1706
               S+ ++                 PL KG+I+ ++  +  +   L+K G +V++  P   
Sbjct  198   LKSQTER-----------------PLEKGVIETMDQTDSSLLQSLSKKGLAVSQ-DPIQN  239

Query  1705  SFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGG  1526
              + I+CD  +VGSGCGGGV + VLA+AG+KV+V+EKGNY+   + + +E PSM++M+  G
Sbjct  240   LYDIKCDVAIVGSGCGGGVAAAVLASAGHKVVVIEKGNYFTSEDYTSIEAPSMNEMYECG  299

Query  1525  GLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDT  1346
             G+L T D  M+L+AGSTVGGGSAVNWSA IKTP YVL+EW E H L LFGS  Y  AMDT
Sbjct  300   GILSTTDGKMLLMAGSTVGGGSAVNWSACIKTPDYVLKEWAEEHQLPLFGSTDYLSAMDT  359

Query  1345  VCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGT  1166
             VC ++GV   C +E FQN VLRKGCR LG  V ++P+NA   H+CG C++GC++G K+GT
Sbjct  360   VCKRLGVTENCTEEGFQNKVLRKGCRNLGLQVDSVPRNASESHFCGSCSYGCREGDKRGT  419

Query  1165  AETWLVDLVKSGNGAILPECEALQVIHERN-------KAKGVMFTFQRDGVKQTAVIKSK  1007
               TWLVD V  G   I+  C+A + I E N       K  G++       V +   I++K
Sbjct  420   DTTWLVDAVNCG-AVIITGCKAERFILEENEPGKKKKKCVGLIAKSLSSMVTKKLKIQAK  478

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKK--SYEGAIMS  833
             VT+ A G+L TP L+I+SGL N NIG+NLHLHPVVFAWG+FPD+  +  K  ++EG I++
Sbjct  479   VTISACGSLLTPPLMISSGLTNPNIGKNLHLHPVVFAWGYFPDSGSDELKGRAFEGGIIT  538

Query  832   AMSTV-VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             ++  V     + +   A+I+TP L P  F+AL+PW SG E K RM+RY+RTA +FAL RD
Sbjct  539   SLHKVKAAEDSDSSLRAIIETPGLGPAAFAALVPWVSGLETKERMTRYSRTAVLFALVRD  598

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
             +GS +      V Y  D++D ENL+ GL + LRIL AAGA E+G +   G  +K K    
Sbjct  599   RGSAKVEREGRVNYRFDRSDRENLRVGLRRALRILVAAGAVEVGTHRSDGQRIKCKGMKE  658

Query  475   EEFERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
             EE E F+    +     S  +   + ASAHQMGSCRMGV  +   V+ KGE+WE +GLFV
Sbjct  659   EELEEFLDGIRTVGGPMSKSELWTMYASAHQMGSCRMGVSEEEGGVDEKGESWEAQGLFV  718

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              DGSVLPTA+G+NP++TI S +YC+S+ + E LK
Sbjct  719   CDGSVLPTAVGINPLITIQSTAYCLSKGIAESLK  752



>ref|XP_008224323.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Prunus mume]
Length=751

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/741 (44%), Positives = 456/741 (62%), Gaps = 43/741 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--NEALPE-----TTDASVTNFFQTSAASTGTPHQVAWVI  2198
              S ++M++L+++C   LPA+  N+   E      T+ +V +F + S A T  P +VA ++
Sbjct  22    FSSAEMQSLASVCEALLPALPLNDFCFEGKEEQRTNKAVQSFHKASGAQTPIPDEVAELL  81

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R     +  + ++LW LSTR+GTLLLCG      ++PF+L F  +   KRER++  W 
Sbjct  82    VKRAFIEAVVLVRVVLWVLSTRLGTLLLCGSLCFGERWPFILNFSSLPLAKRERLLQKWF  141

Query  2017  TSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP--DPSISekqkkqkhh  1847
                 L  IR  F  +K L L +FF+ VD   +NP W+AIGY     D +I    K++   
Sbjct  142   KHRFLTPIRLAFVYIKFLCLYIFFSRVDKNAENPIWQAIGYHVDIDDQNIPTAPKER---  198

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
                         PL KG+I+ +   +  + + L + G +V +  P    + I+CD VVVG
Sbjct  199   ------------PLQKGMIETIYETDTTLLHSLAEKGLTV-RHDPQENLYKIKCDVVVVG  245

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV + VLA++G KV+VLEKGNY+  ++ S LEGPS D+M+  GG+  T D  +V+
Sbjct  246   SGCGGGVAAAVLASSGQKVIVLEKGNYFTHSDYSSLEGPSQDQMYELGGIFATIDGKLVI  305

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
              AGSTVGGGSAVNWSA I+TP  VL EW + H +  FG   Y  AMDTVC ++GV   C 
Sbjct  306   QAGSTVGGGSAVNWSACIRTPDNVLEEWAKDHDIRFFGEPEYVSAMDTVCERIGVTDNCV  365

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E FQN VLRKGC  LG  V  +P+N+   HYCG C +GC+ G KKGT  TWL+D V  G
Sbjct  366   EEGFQNQVLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLLDAVDHG  425

Query  1129  NGAILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTT  974
                IL  C A + + E        + K  GVM     + + +   I++KVT+ A GAL T
Sbjct  426   -AVILTGCRAEKFVLENIKSGSLRKKKCSGVMAKSLSNNISKKLQIEAKVTISACGALLT  484

Query  973   PSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGT  797
             P L+I+SGLKNKNIGRNLHLHPV+ AWG+FP++  E K K YEG I++++  V      +
Sbjct  485   PLLMISSGLKNKNIGRNLHLHPVLMAWGYFPESNSEFKGKIYEGGIITSVHKVA--SADS  542

Query  796   GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVT  617
                A+I+TPAL PG FS+L PW SG++ K RM +Y RT H+ ++ RD+GSG       V+
Sbjct  543   KLRAIIETPALGPGAFSSLCPWESGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKGGRVS  602

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----E  449
             Y+ + +D+ENL+ GL + LRIL AAGA E+G +   GL +K K   +E+ E F+     E
Sbjct  603   YEFEASDKENLEAGLRQALRILIAAGAVEVGTHRSDGLRIKCKGIEKEKLEEFLDMVSAE  662

Query  448   ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
             +  QSL ++    +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP+A+GVN
Sbjct  663   KGPQSLVENWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVN  722

Query  268   PMVTIMSVSYCISQSVLEFLK  206
             PM+TI S +YC+S+ +   LK
Sbjct  723   PMITIQSTAYCLSKRIAGSLK  743



>gb|KHN02487.1| Long-chain-alcohol oxidase FAO2 [Glycine soja]
Length=744

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/744 (44%), Positives = 459/744 (62%), Gaps = 38/744 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  2210
             R+ E       LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + 
Sbjct  15    RRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEA  74

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             A ++ +R     ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I 
Sbjct  75    AELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIF  134

Query  2029  HSWATS-SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  1853
              +W    S   +R  F  +K      FF+  D  G NP+WKAIGY               
Sbjct  135   RNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY---------------  179

Query  1852  hhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                   +       PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+
Sbjct  180   -QVDTKEKLIRKERPLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVI  237

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSGCGGGV + VLA +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M
Sbjct  238   VGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKM  297

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             ++LAGSTVGGGSAVNWSASI+TP  VLREW + + + LFGS  YQ AMD+VC ++GV  +
Sbjct  298   MILAGSTVGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEK  357

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             C+ ESFQN +L +GC ++G+ V ++  N+ +D YCG C +GC+ G KKGT  TWLVD V 
Sbjct  358   CKKESFQNQILIQGCEKMGFKVESVAINSSADDYCGSCCYGCRTGDKKGTDSTWLVDSV-  416

Query  1135  SGNGA-ILPECEALQVIHE-------RNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGA  983
              GNGA IL  C+A + I E       + K  GV+     R  V +   I+SKVT+ A G+
Sbjct  417   -GNGAVILTGCKAERFILENVKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGS  475

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD--TPGENKKSYEGAIMSAMSTVVLN  809
             L TP L+I+SGLKN NIGRNLHLHPV FAWG+FP+  T   +  +YEG I++++      
Sbjct  476   LNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAE  535

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
              +   +  +I+TP+L PG FSA +PW SGQ+ K RM++YARTA+IFAL RD+GSGE  + 
Sbjct  536   DSTPRF--IIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAE  593

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               VTY LDK D+E+L+ GL K LRIL AAGA E+G     G  +K K    E+ E F+  
Sbjct  594   GRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDT  653

Query  448   ES----SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
              +     +S  +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A
Sbjct  654   VTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSA  713

Query  280   LGVNPMVTIMSVSYCISQSVLEFL  209
             +GVNPMVTI S SYCI+  + E L
Sbjct  714   VGVNPMVTIQSTSYCIASKIAESL  737



>ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
Length=744

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/744 (44%), Positives = 462/744 (62%), Gaps = 38/744 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  2210
             R+ E       LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + 
Sbjct  15    RRREEKGYNHGLSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEA  74

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             A ++ +R     ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I 
Sbjct  75    AELLYKRTVPEAVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIF  134

Query  2029  HSWATS-SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  1853
              +W    S   +R  F  +K      FF+  D  G NP+WKAIGY      +  K+K  +
Sbjct  135   RNWTREKSWVALRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY-----QVDTKEKLIR  189

Query  1852  hhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                           PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+
Sbjct  190   KER-----------PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVI  237

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSGCGGGV + VLA +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M
Sbjct  238   VGSGCGGGVAAAVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKM  297

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             ++LAGSTVGGGSAVNWSASI+TP  VLREW + + + LFGS  YQ AMD+VC ++GV  +
Sbjct  298   MILAGSTVGGGSAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEK  357

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             C+ ESFQN +L +GC ++G  V ++  N+ +DHYCG C +GC+ G KKGT  TWLVD V 
Sbjct  358   CKKESFQNQILIQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDKKGTDSTWLVDSV-  416

Query  1135  SGNGA-ILPECEALQVIHERNKAK-------GVMFTFQ-RDGVKQTAVIKSKVTVIAGGA  983
              GNGA IL  C+A + I E  K         GV+     R  V +   I+SKVT+ A G+
Sbjct  417   -GNGAVILTGCKAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGS  475

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD--TPGENKKSYEGAIMSAMSTVVLN  809
             L TP L+I+SGLKN NIGRNLHLHPV FAWG+FP+  T   +  +YEG I++++      
Sbjct  476   LNTPPLMISSGLKNPNIGRNLHLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAE  535

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
              +   +  +I+TP+L PG FSA +PW SGQ+ K RM++YARTA+IFAL RD+GSGE  + 
Sbjct  536   DSTPRF--IIETPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAE  593

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               VTY LDK D+E+L+ GL K LRIL AAGA E+G     G  +K K    E+ E F+  
Sbjct  594   GRVTYRLDKEDKESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDT  653

Query  448   ES----SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
              +     +S  +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A
Sbjct  654   VTIVGGPRSRNEVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSA  713

Query  280   LGVNPMVTIMSVSYCISQSVLEFL  209
             +GVNPMVTI S SYCI+  + E L
Sbjct  714   VGVNPMVTIQSTSYCIASKIAESL  737



>sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Lotus japonicus]
 emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
Length=749

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/750 (44%), Positives = 465/750 (62%), Gaps = 43/750 (6%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAI-NEALP--ETTDASVTN---FFQTSAASTGTP  2219
             ++N   +  S S+ME+L+++C   LP +  +AL   +  D S+ +   F+ TSA+    P
Sbjct  14    KDNKFRQGFSSSEMESLASICEVILPPLPMDALKIKKHDDVSIEDVEFFWNTSASHYPIP  73

Query  2218  HQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  2039
             H+VA ++++R     +  + ++LW L+TR+GT LLCG    S ++PF+  F  +S KKRE
Sbjct  74    HEVAEILSKRSLIEAVILIRVVLWLLATRLGTFLLCGLLCFSEKWPFINNFSSMSLKKRE  133

Query  2038  RIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekq  1865
             R++  W  +  +  IR  F  +K L L  +FT VD+ GDNP+WKAIGY    D  +    
Sbjct  134   RVMQWWLKNRFITPIRLAFAYLKVLCLFAYFTWVDENGDNPAWKAIGYEVSADEKLPNSS  193

Query  1864  kkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  1688
               +                L KGI++ ++     +   LT+ G +V           ++C
Sbjct  194   NGRL---------------LEKGIVETMHETNSTLQQSLTEKGLNVTLDSRNNI-LKVKC  237

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             DA+VVGSGCGGGV + VL+ AG+KV+VLEKGNY+A  + S LEGPSMD+++  GG+L + 
Sbjct  238   DAIVVGSGCGGGVAASVLSGAGHKVVVLEKGNYFAPRDYSSLEGPSMDQLYETGGILASV  297

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             D  ++LLAGSTVGGGSAVNWSA IKTP  VL+EW E H L LF +  Y  AM+TVC ++G
Sbjct  298   DSRILLLAGSTVGGGSAVNWSACIKTPHEVLKEWSENHNLSLFSTSEYLSAMETVCERIG  357

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V   C  E FQN VLRKGC+ LG  V  +P+N+  +H+CG C +GC  G K+GT +TWLV
Sbjct  358   VTESCTHEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHFCGSCGYGCPKGEKQGTQDTWLV  417

Query  1147  DLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             D V++G   I+  C+A + + E N        K  GV+       V     I++KVT+ A
Sbjct  418   DAVENG-AVIITGCKAERFLLENNRNGSGRKKKCLGVLAKALSSRVTMKLQIEAKVTISA  476

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVV  815
             GGAL TP L+I+SGLKNKNIG+NLHLHPV+  WG+FP++  E K K +EG I++++  V 
Sbjct  477   GGALLTPPLMISSGLKNKNIGKNLHLHPVLMTWGYFPESTSELKGKIFEGGIITSVHKVP  536

Query  814   LNVNGTGYG---AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG  644
              + +   Y    A+I+TP+L PG F++L PW SG +FK RM  Y RTAH+  + RDK  G
Sbjct  537   -SRDSNSYSDTRAIIETPSLGPGSFASLCPWESGLDFKERMLNYPRTAHLITIIRDKACG  595

Query  643   EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE  464
             +  +   V+Y L   D+EN++ GL++ LRIL AAGA E+G +   G  +K  + S  E  
Sbjct  596   QVTTEGRVSYKLSAFDKENMKCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMA  655

Query  463   RFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS  296
              F+      E + S  ++ N+  SAHQMGSCRMG++ K   V+  GE+WE +GLFV D S
Sbjct  656   EFIDSVCPMEGALSPGENWNIYTSAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDAS  715

Query  295   VLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             +LPTA+GVNPM+TI S +YCIS  V+++LK
Sbjct  716   LLPTAVGVNPMITIQSTAYCISNRVVDYLK  745



>gb|ACF22878.1| alcohol oxidase [Glycine max]
Length=723

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/733 (45%), Positives = 459/733 (63%), Gaps = 38/733 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
             LS +QM  ++A+C+  +P++      + D ++++F+ TSA+    P + A ++ +R    
Sbjct  5     LSTTQMHVMAAICDALIPSLPLNKDTSQDQALSDFYNTSASQLPFPDEAAELLYKRTVPE  64

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS-SLQF  2000
              ++ +  +LW LS R+GTLLLCG+ SL  ++PF+ +F EIS +KRE+I  +W    S   
Sbjct  65    AVSLVSWVLWILSFRLGTLLLCGRLSLDWKWPFIRKFSEISLEKREQIFRNWTREKSWVA  124

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K      FF+  D  G NP+WKAIGY      +  K+K  +           
Sbjct  125   LRVVFVLIKLFCFYNFFSRTDANGQNPTWKAIGY-----QVDTKEKLIRKER--------  171

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KG+I+ +   +  +   LT+ G  V + K     + ++CD V+VGSGCGGGV +
Sbjct  172   ---PLEKGLIETMYETDSTLIQSLTEKGLEVTEDKRQNL-YKVKCDVVIVGSGCGGGVAA  227

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              VLA +G+KV+VLEKG Y+   + S LEGPSMD+ +  GG++ + D  M++LAGSTVGGG
Sbjct  228   AVLANSGHKVVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGG  287

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSASI+TP  VLREW + + + LFGS  YQ AMD+VC ++GV  +C+ ESFQN +L
Sbjct  288   SAVNWSASIRTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQIL  347

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA-ILPEC  1106
              +GC ++G  V ++  N+ +DHYCG C +GC+ G KKGT  TWLVD V  GNGA IL  C
Sbjct  348   IQGCEKMGLKVESVAINSSADHYCGSCCYGCRTGDKKGTDSTWLVDSV--GNGAVILTGC  405

Query  1105  EALQVIHERNKAK-------GVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             +A + I E  K         GV+     R  V +   I+SKVT+ A G+L TP L+I+SG
Sbjct  406   KAERFILENGKNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMISSG  465

Query  949   LKNKNIGRNLHLHPVVFAWGHFPD--TPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQ  776
             LKN NIGRNLHLHPV FAWG+FP+  T   +  +YEG I++++       +   +  +I+
Sbjct  466   LKNPNIGRNLHLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRF--IIE  523

Query  775   TPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTD  596
             TP+L PG FSA +PW SGQ+ K RM++YARTA+IFAL RD+GSGE  +   VTY LDK D
Sbjct  524   TPSLGPGSFSAFVPWLSGQDMKDRMAKYARTANIFALIRDQGSGEVKAEGRVTYRLDKED  583

Query  595   EENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES----SQSLR  428
             +E+L+ GL K LRIL AAGA E+G     G  +K K    E+ E F+   +     +S  
Sbjct  584   KESLRVGLRKALRILVAAGAMEVGTYRSDGQRIKCKGMKEEDLEEFLDTVTIVGGPRSRN  643

Query  427   KHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS  248
             +   +  +AHQM SCRMG   +   ++  GETWE EGL+V DGSVLP+A+GVNPMVTI S
Sbjct  644   EVWTVFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQS  703

Query  247   VSYCISQSVLEFL  209
              SYCI+  + E L
Sbjct  704   TSYCIASKIAESL  716



>ref|XP_004289971.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/732 (43%), Positives = 453/732 (62%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S +Q+++L+A+C   +P +  +L +T+D ++ +F++ S +    P +VA +I +R    
Sbjct  24    FSAAQIQSLAAMCEALIPPL--SLDDTSDQALHSFYKASGSEPPIPDEVADLIKKRGVPE  81

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQF  2000
              +  L   L  LS R+GTLL+CG   L  + PF+  F E+S +KRE  +  W+    L  
Sbjct  82    AVGLLSFFLKVLSYRLGTLLVCGYPCLDRKGPFIHNFAEMSLEKREEALQRWSREKRLIP  141

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K      FF+ +     NPSWKAIGY     ++++++K  K           
Sbjct  142   LRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGY-----NVNKREKLIKTPKER------  190

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KGII+ +   +  +   LTK G  V           I+CD V+VGSGCGGGV +
Sbjct  191   ---PLEKGIIETMKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGSGCGGGVAA  247

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              VLA +G KV+VLEKGNY+   + SLLEGPSM++++  GG++ +KD  M++LAGSTVGGG
Sbjct  248   AVLAQSGQKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGSTVGGG  307

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSASI+TP  VL EW   H + LFGS  YQ AMD VC ++GV   C +E+ QN +L
Sbjct  308   SAVNWSASIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQIL  367

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC +LG  V ++P+N+ +DHYCG C +GC  G K+GT  TWLVD VK G   IL  C+
Sbjct  368   RKGCEKLGLKVDSVPRNSSADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCG-AVILTGCK  426

Query  1102  ALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             A + I E        R +  GV        + +   I++KVT+ A G+L TP L+I SGL
Sbjct  427   AERFIMENDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPPLMITSGL  486

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             KN NIGRNLHLHPV+ AWG+FP+   E K K++EG I++++  VV   N     A+++T 
Sbjct  487   KNPNIGRNLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSEDN-QNVRAIVETA  545

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             AL P  F+ L+PW SG + K R+++YARTAH+FAL RDKGSGE  +   + Y LD++D+E
Sbjct  546   ALGPASFATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAENKIEYRLDRSDKE  605

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKH  422
             N+Q GL + +RIL AAGA E+G     G  +  K   +E+ E F+    +    ++  ++
Sbjct  606   NIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPRTRGEY  665

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
               + ++AHQMGSC+MG   K   V+  GE+WE EGLFV DGS+LPTA+GVNPM+TI S +
Sbjct  666   WTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQSTA  725

Query  241   YCISQSVLEFLK  206
             YC+S+ + + LK
Sbjct  726   YCVSKKIADSLK  737



>ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=743

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/732 (43%), Positives = 452/732 (62%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S +Q+++L+A+C   +P +  +L +T+D ++ +F++ S +    P +VA +I +R    
Sbjct  24    FSAAQIQSLAAMCEALIPPL--SLDDTSDQALHSFYKASGSEPPIPDEVADLIRKRGAPE  81

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQF  2000
              +  L   L  LS R+G LL+CG   L   +PF+  F E+S +KRE  +  W+    L  
Sbjct  82    AVGVLSFFLKVLSYRLGNLLVCGYPCLDKNWPFIHNFAEMSLEKREEALQRWSREKRLIP  141

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K      FF+ +     NPSWKAIGY     ++++++K  K           
Sbjct  142   LRLLFVVVKIFCFFCFFSRIVGDSQNPSWKAIGY-----NVNKREKLIKTPKER------  190

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KGII+ +   +  +   LTK G  V           I+CD V+VGSGCGGGV +
Sbjct  191   ---PLEKGIIETMKKTDSTLIESLTKKGIEVTDGAAHPQIHKIKCDVVIVGSGCGGGVAA  247

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              VLA +G KV+VLEKGNY+   + SLLEGPSM++++  GG++ +KD  M++LAGSTVGGG
Sbjct  248   AVLAQSGQKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGSTVGGG  307

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSASI+TP  VL EW   H + LFGS  YQ AMD VC ++GV   C +E+ QN +L
Sbjct  308   SAVNWSASIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQIL  367

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC +LG  V ++P+N+ +DHYCG C +GC  G K+GT  TWLVD VK G   IL  C+
Sbjct  368   RKGCEKLGLKVDSVPRNSSADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCG-AVILTGCK  426

Query  1102  ALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             A + I E        R +  GV        + +   I++KVT+ A G+L TP L+I SGL
Sbjct  427   AERFIMENDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPPLMITSGL  486

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             KN NIGRNLHLHPV+ AWG+FP+   E K K++EG I++++  VV   N     A+++T 
Sbjct  487   KNPNIGRNLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSEDN-QNVRAIVETA  545

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             AL P  F+ L+PW SG + K R+++YARTAH+FAL RDKGSGE  +   + Y LD++D+E
Sbjct  546   ALGPASFATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAENKIEYRLDRSDKE  605

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKH  422
             N+Q GL + +RIL AAGA E+G     G  +  K   +E+ E F+    +    ++  ++
Sbjct  606   NIQAGLRQAVRILIAAGAVEVGTYRNDGQRIVCKGTKKEDLEEFLDSVIAVGGPRTRGEY  665

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
               + ++AHQMGSC+MG   K   V+  GE+WE EGLFV DGS+LPTA+GVNPM+TI S +
Sbjct  666   WTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQSTA  725

Query  241   YCISQSVLEFLK  206
             YC+S+ + + LK
Sbjct  726   YCVSKKIADSLK  737



>gb|KGN56837.1| hypothetical protein Csa_3G134850 [Cucumis sativus]
Length=669

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/660 (46%), Positives = 413/660 (63%), Gaps = 32/660 (5%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  1964
             +TR+GTLLLCG      ++PF+ +F E+  +KRE  +  W  + +   +R     +K + 
Sbjct  26    ATRLGTLLLCGSLCFCEKWPFVCKFSEMPLEKREEALRRWFKNKVFTPVRAALALIKLVF  85

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDL  1784
             L VFF+ VD  GDNPSW+AI Y    P I E   K                PL KGII+ 
Sbjct  86    LYVFFSRVDVNGDNPSWEAIKYV---PEIDEHPSKSSDAR-----------PLEKGIIEP  131

Query  1783  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
             N   E  F + L + G  +A     G +  +ECD VVVGSGCGGGV + +LA++G KV++
Sbjct  132   NNETESSFKKSLLQKGIRIAGDD--GHTLSVECDVVVVGSGCGGGVAAAILASSGQKVMI  189

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKGNY+  ++ S LEGPS+++++  G +  T D  +++LAGSTVGGGSAVNWSASIKTP
Sbjct  190   LEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTVGGGSAVNWSASIKTP  249

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
              +VL+EW E H +  FG+  YQ AMD VC ++GV  +CE+E FQN VLRKGC  LG  V 
Sbjct  250   DHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKGCENLGLKVE  309

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN---  1076
              +P+N+ + HYCG C +GC+ G K+GT  TWLVD V  G   I+  C+A + I ERN   
Sbjct  310   KVPRNSTTGHYCGSCGYGCRKGEKQGTDSTWLVDAVNHG-AVIITNCKAERFILERNKNG  368

Query  1075  -----KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLH  911
                  K  GV+     D + +   IK+K T+ A GAL TP L+I+SGL+NK+IGRNLHLH
Sbjct  369   SMKKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLMISSGLRNKHIGRNLHLH  428

Query  910   PVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMP  734
             PV+  WG+FP++  G   KSYEG I++++  VV   + +    +I+TP L PG  + L+P
Sbjct  429   PVLMTWGYFPESNSGFKGKSYEGGIITSVHKVVSEESKSNPKTIIETPLLGPGSCAVLVP  488

Query  733   WNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRI  554
             W SG + K RM +Y+RTAH   + RD GSG   S   V+Y+L + D ENL++GL + LRI
Sbjct  489   WVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSEGRVSYNLSEEDRENLKKGLRQSLRI  548

Query  553   LAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ----SLRKHPNLKASAHQMGS  386
             L AAGA E+G +   G  L+ K   +EE E F+   S++    SL K  N+  SAHQMGS
Sbjct  549   LVAAGATEVGTHRSDGQRLECKGIGKEELEEFLDSVSAEGGLLSLSKDWNVYTSAHQMGS  608

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             C++GV      ++  GE+WE EGLFV D SVLPTA+GVNPM+TI S +YCIS  +   L+
Sbjct  609   CKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCISNRIAALLR  668



>ref|XP_004982881.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Setaria italica]
Length=761

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/757 (41%), Positives = 449/757 (59%), Gaps = 47/757 (6%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQT  2243
             + L R    +  T  + P+QME L A+C   +P++           P   D  +  F++ 
Sbjct  20    HPLLRGWRRDRYTHGMHPAQMEALRAMCGALIPSLPADGAHGRGDPPGGKD--LERFYRA  77

Query  2242  SAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFP  2063
             SAA +  P +VA ++  R     +    ++LW LSTR+GTLLLCG+  L+  FP++ +F 
Sbjct  78    SAADSTIPDEVAELMVTRCIREAVALAWVVLWVLSTRVGTLLLCGRLCLAGGFPYVRKFA  137

Query  2062  EISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPD  1886
             +++ ++RE  +  W      F +R  F  +K L   VF+  V++  +NP WKAIGY   +
Sbjct  138   DMTPERREAALQRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVHE  197

Query  1885  PSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPG  1709
             P   + +                  PL  G+++  L +++   R L   G +V       
Sbjct  198   PREDQTEAAPSPSR-----------PLDVGVVETRLLDDNALLRSLVGRGLTVKPVASDA  246

Query  1708  PSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLG  1529
                V++CDAV+VGSGCGGGV + VLA+AGYKV+V+EKG+Y+  ++ S +EGPSM+++F  
Sbjct  247   NHHVVQCDAVIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTASDYSSIEGPSMERLFER  306

Query  1528  GGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMD  1349
             GG+  T ++  ++  G+TVGGGSAVNWSASI+TP  V +EW   HGL +F S  Y +AMD
Sbjct  307   GGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTPKEVTQEWAREHGLPVFASPGYAQAMD  366

Query  1348  TVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKG  1169
              VC ++ V   C +E FQN V+R+GC  LG     +P+N+   H+CG C FGC  G K+G
Sbjct  367   AVCARLSVTDGCREEGFQNKVVRRGCEALGLCADAVPRNSSEGHFCGSCNFGCPTGDKRG  426

Query  1168  TAETWLVDLVKSGNGAILPECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVI  1016
             T  TWLVD V SG   IL  C+A + + E+N            G++ T   DG+ +   I
Sbjct  427   TDTTWLVDAVASG-AVILTGCKAERFVFEKNSGGGRGRGKKCVGLVSTCASDGITKKLRI  485

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEG  845
             ++KV++ A GAL TP LL NSGLKN++IGRNLHLHPV  AWG+FP+    P    KSYEG
Sbjct  486   EAKVSIAACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENRQDPQLTGKSYEG  545

Query  844   AIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFAL  665
              I+++M  V           +I+TPAL PG F+A++PW SG++ K RM RY+RTAH FAL
Sbjct  546   GIITSMHRVTERT-------IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFAL  598

Query  664   ARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKD  485
              RD+G+G       V +   + D E L+ GL ++LRIL AAGA E+G +   GL L+ K 
Sbjct  599   VRDRGAGFVDGEGRVRFTPSREDVEELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKG  658

Query  484   ASREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVE  320
                E+ E F+ E + +    H       L  SAHQMGSCRMG  P+   V+ +GE+WE E
Sbjct  659   LRDEDLEAFLDEVTIEKGPMHSTADKWALHCSAHQMGSCRMGSSPRDGAVDGRGESWEAE  718

Query  319   GLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             GL+V DGS+LPTA+GVNPM+TI S++YC+S+ + E L
Sbjct  719   GLYVCDGSLLPTAVGVNPMITIQSIAYCLSKGIAETL  755



>ref|XP_010036770.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW48412.1| hypothetical protein EUGRSUZ_K02114 [Eucalyptus grandis]
Length=748

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/744 (42%), Positives = 460/744 (62%), Gaps = 48/744 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPA-----INEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
              SP+Q++ L+A+C T +P+     IN  +P   D ++  F+  S +    P +VA ++ +
Sbjct  22    FSPAQIQALAAICETLIPSVSLDSINPKIPHD-DPALHGFYSASGSQPSVPDEVAEILTK  80

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R +   +  + ++L  LS R+GTL+LC    L++ +PF+L F E+  ++RER++ +W+  
Sbjct  81    RAQRQVVVMVSIVLKMLSFRLGTLVLCWGSCLASTWPFILNFSEMPVERRERVLMNWSRQ  140

Query  2011  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-----CGPDPSISekqkkqkh  1850
                  +R  F  +K   L +F+T  D+  +N +W+AIGY       P+ S +++++    
Sbjct  141   KFVVPLRVVFMMIKIYCLFIFYTRTDENSNNLAWEAIGYRVDKRQKPNESHNKQER----  196

Query  1849  hdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                          PL +G+++ ++  +  +   LT+ G  V +  P   +F I+CD V++
Sbjct  197   -------------PLQRGLVETVHETDSSLIQSLTQKGLKVTQ-IPQHNAFKIKCDVVII  242

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSGCGGGV + VLA +G KV+VLEKGNY+   + S LEGPS+D+++    LL T D  +V
Sbjct  243   GSGCGGGVAAAVLAHSGQKVVVLEKGNYFVPQDYSSLEGPSLDQLYESSALLSTVDGKIV  302

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAGSTVGGGSAVNWSA I+TP +VL+EW   H + LFG+  Y  AMD VC K+GV ++C
Sbjct  303   VLAGSTVGGGSAVNWSACIRTPSHVLKEWSVDHKIRLFGTPDYGSAMDAVCKKIGVTQKC  362

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
             E E FQN +LRKGC  LG  V  + +N+   H+CG C +GC+ G KKGT  TWLVD V++
Sbjct  363   EQEGFQNQILRKGCESLGLKVEAVARNSSEGHFCGSCCYGCRTGDKKGTDSTWLVDAVEN  422

Query  1132  GNGAILPECEALQVIHER-------NKAKGVMFT--FQRDGVKQTAVIKSKVTVIAGGAL  980
             G   IL  C+A ++I E         K  GV+ +    +D  K+   I++KVT+ A  A+
Sbjct  423   G-AVILTGCKAKKLILENTPHGEKPKKCLGVIASSVLNKDVTKELH-IEAKVTIAACSAV  480

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVN  803
             +TP LLI+SGLKN NIGRNLHLHP  FAWG+FP+   G   K YEG I+++++ VVL   
Sbjct  481   STPPLLISSGLKNPNIGRNLHLHPCAFAWGYFPENLTGIQGKVYEGGIITSLNRVVLE-T  539

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
             G    A+I+TP+L PGLFSAL PW SG   K RM +Y+RTAH+F L RDKGSGE      
Sbjct  540   GAPVPAIIETPSLGPGLFSALCPWTSGANMKERMRKYSRTAHLFTLVRDKGSGEVREEGK  599

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE--  449
             + Y+L + D+E+++ GL + LRIL AAGAEE+G +   G  +K +    E+ E F+ +  
Sbjct  600   IVYNLSEFDKEHMKIGLRQALRILIAAGAEEVGTHRSDGQRMKCQGTKEEDIEEFLNDIV  659

Query  448   --ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
                   S  +  NL   AH MGSCR+G   +   V+  GE+WE +GLFV DGS++PTA+G
Sbjct  660   ISGGPTSREELWNLYCCAHPMGSCRIGASERDGAVDESGESWEAKGLFVCDGSLMPTAIG  719

Query  274   VNPMVTIMSVSYCISQSVLEFLKT  203
             VNPM+TI S +YCI++ + E L +
Sbjct  720   VNPMITIESTAYCIAKKIAESLSS  743



>ref|XP_010264984.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Nelumbo nucifera]
Length=750

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/745 (45%), Positives = 456/745 (61%), Gaps = 52/745 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAW  2204
              S  QME LSA+C  F+P+I          E  P   + SV +F+  S +    P +VA 
Sbjct  22    FSYYQMEALSAICEAFIPSIPFDPLRATGGEGSP---NKSVQSFYLVSGSQKPIPDEVAE  78

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
             ++  R     +  +  LLW LSTR+GT LLCG  +    +PFL +F E+  +KRE+I+  
Sbjct  79    LLVSRSLWHAVFMVKFLLWMLSTRLGTSLLCGVLTFGCGWPFLYKFSELPLEKREQILQK  138

Query  2023  WATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
             W+ +   + +R FF  +K   +L FF+  ++  +NP+W AIGY       S K ++++  
Sbjct  139   WSGARYHRHLRMFFMLLKVFCMLTFFSMTNENSENPAWDAIGYHVDTERRSYKTERKR--  196

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSF---VIECDAv  1679
                         PL KGII+ ++  +  +   LT  G  V +    GP +    IECD +
Sbjct  197   ------------PLEKGIIETVSESDSTLVQSLTIKGFKVTR----GPRWNLHKIECDVI  240

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + VLA++G KV+VLEKGNY+   + S LEGPS  +++  GG+L + D  
Sbjct  241   IVGSGCGGGVAAAVLASSGQKVIVLEKGNYFVPEDYSSLEGPSFSQLYESGGILPSLDGK  300

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             ++++AGSTVGGGSAVNWSA IKTP  VLREW   H + LFGS  Y  AMDTVC + GV  
Sbjct  301   IMMMAGSTVGGGSAVNWSACIKTPSSVLREWHMDHKIPLFGSSDYLSAMDTVCERNGVTD  360

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C +E FQN VLR+GC  LG  +  +P+N+  +HYCG C FGC+ G K+GT  TWLVD V
Sbjct  361   TCLEEGFQNQVLRRGCENLGLKIDPVPRNSSENHYCGSCGFGCRRGDKQGTDSTWLVDAV  420

Query  1138  KSGNGAILPECEALQVIHERNK---AK-----GVMF-TFQRDGVKQTAVIKSKVTVIAGG  986
               G   IL  C+A + I +RNK   AK     GV+  TF R+ ++    I++KVT+ A G
Sbjct  421   NHG-AVILTGCKAKRFILKRNKFGSAKTMKCVGVIARTFSRN-IRNKLQIEAKVTISACG  478

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLN  809
             +L TP L+I+SGL+N NIG+NLHLHPV+ AWG+FPD+  E K K+YEG I++++  VV  
Sbjct  479   SLLTPPLMISSGLRNPNIGKNLHLHPVMMAWGYFPDSMKEFKGKTYEGGIITSLHKVVTE  538

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                     +I+TPAL PG F+AL PW SG + K  M +YARTAH+FAL RD+GSGE    
Sbjct  539   -KSDDVCTIIETPALGPGSFAALFPWVSGLDMKECMVKYARTAHLFALVRDQGSGEVKIQ  597

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               +TY L + D+ENL+ GL + LRIL AAGA E+G +   G  +K +    E+ E F+  
Sbjct  598   GRITYRLSELDKENLKAGLRRALRILIAAGAVEVGTHRSDGQRIKCRGIKEEDLEEFLDT  657

Query  448   ----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
                 E   S  +H  + ASAHQMGSCRM    K   V+  GE+WE EGL+V DGSV P A
Sbjct  658   VSAVEGPMSREEHWTIYASAHQMGSCRMSAKEKDGAVDENGESWEAEGLYVCDGSVFPNA  717

Query  280   LGVNPMVTIMSVSYCISQSVLEFLK  206
             LGVNPM+TI S++YC+S+ + E L+
Sbjct  718   LGVNPMITIQSIAYCLSKKIAESLE  742



>gb|EYU46421.1| hypothetical protein MIMGU_mgv1a001868mg [Erythranthe guttata]
Length=747

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/734 (43%), Positives = 455/734 (62%), Gaps = 35/734 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
              S SQ+++L+A+C   +P++  N     + D ++ +++ +SA+ T  P++ A +I +R  
Sbjct  25    FSSSQIQSLAAVCEALIPSLPTNGVNQISDDNALYSYYTSSASQTPFPNETAELIVKRGI  84

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
                +  + L+L FLSTRIGTLLLCG   L  ++PF+ +F E+S  KRE I+  W+  +L 
Sbjct  85    PKAVLVVSLVLKFLSTRIGTLLLCGSNCLDWKWPFIHKFSELSINKRESILQKWSRGTLV  144

Query  2002  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K      FF+  D+K  NP+W+AIGY      IS + +K++         
Sbjct  145   LPLRTVFFMLKVTCFYTFFSLTDEKSQNPAWEAIGYHIEKVEISGQPEKER---------  195

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL KG+I+     +      L + G  VA+      +  IECD V+VGS CGGGV
Sbjct  196   -----PLEKGVIETEKENKLTLRESLVQKGLKVAENPKDHNTLNIECDVVIVGSDCGGGV  250

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA AG KV+VLEKG+Y+   + S LEGPSM++M+  GG+  T     +LLAGSTVG
Sbjct  251   AAAVLAKAGLKVVVLEKGHYFTAEDYSELEGPSMNEMYASGGIFSTLHGKFILLAGSTVG  310

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSAVNWSASIKTP +VL+EW     + +FG   YQ AMD V G++GV   C +E FQN 
Sbjct  311   GGSAVNWSASIKTPDHVLQEWSAEKKISMFGGAEYQSAMDEVWGRIGVTENCVEEGFQNQ  370

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             V+RKGC  LG  V  + +N+  +HYCG C +GC+ G KKGT  TWLVD V +G   IL  
Sbjct  371   VVRKGCENLGLKVEGVARNSTENHYCGSCGYGCRRGEKKGTDSTWLVDAVNNG-AVILTG  429

Query  1108  CEALQV-------IHERNKAKGVMFTF--QRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
             C+A +        + +R + KGV+ T   + +  +    I++K +V A GAL TP LL++
Sbjct  430   CKAEKFLLVKDKNLEQRKRCKGVIATVESESESTRMKLHIEAKASVAACGALFTPPLLVS  489

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGLKNKNIG+NLHLHPV+FAWG+FP++  + + K++EG I+++M+ V+       +  ++
Sbjct  490   SGLKNKNIGKNLHLHPVLFAWGYFPESGSQLRGKNFEGGIITSMNKVI--TGEPNFRTIV  547

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             QT    P  ++  +PW +G++ K RMS+Y+RTA +F L RD GSGE      V+Y L+K 
Sbjct  548   QTAGFGPASYAVFLPWVAGKDMKDRMSKYSRTALLFTLVRDVGSGEVREEGRVSYKLNKF  607

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSL  431
             DEENL+ GL + LRI+ AAGA E+G     G  L+ +    E+ E+F+++  +     S 
Sbjct  608   DEENLKAGLRQCLRIMIAAGAAEVGTFQNNGQRLECEGVGGEDVEKFLEKVMAAGGPSSG  667

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              ++ N  ASAHQM SCRMG D +   V+  GE+WE +GLFV DGSVLPTA+GVNPM+TI 
Sbjct  668   GQYWNTYASAHQMSSCRMGADERDGAVDGNGESWEGKGLFVCDGSVLPTAVGVNPMITIE  727

Query  250   SVSYCISQSVLEFL  209
             S +YCIS+ + ++L
Sbjct  728   STAYCISKRIADYL  741



>gb|AES89853.2| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=754

 Score =   548 bits (1413),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 331/751 (44%), Positives = 459/751 (61%), Gaps = 41/751 (5%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDAS--VTNFFQTSAASTGTPHQ  2213
             EN       S ++ME+L+++C    P++  ++AL +  ++S  V +FF  SA+    P +
Sbjct  14    ENRKYKHGFSVAEMESLTSICEVMFPSLPMDDALTKDDESSKDVQSFFNISASKYPIPDE  73

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA +  +R     +  + ++LW L+TR+GTLL+CG   LS ++PF+  F  +S  KRE+I
Sbjct  74    VAEMFEKRAVIEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  133

Query  2032  VHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             V        L   R  F  +K L L VFF+ VD+ GDNP+WKAIGY      +S   +K 
Sbjct  134   VQRGLKHKFLTPFRLAFVYIKILCLFVFFSWVDENGDNPAWKAIGY-----EVSTADEKM  188

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAv  1679
              +   +         PL KGII++    +    + L+  G +V           I+CDAV
Sbjct  189   INDTKKR--------PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAV  239

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             VVGSGCGGGV + VL+ AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D  
Sbjct  240   VVGSGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYENGGILASIDSR  299

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             +++LAGSTVGGGSAVNWSA IKTP  VL+EW E H L LF S  Y  AM+TVC ++GV  
Sbjct  300   ILILAGSTVGGGSAVNWSACIKTPEKVLKEWSEKHKLSLFDSIEYLSAMETVCERIGVNE  359

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C  E FQN VLRKGC+ LG  V  +P+N+P +HYCG C +GC  G K+GT  TWLVD V
Sbjct  360   NCTQEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAV  419

Query  1138  KSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVIAG  989
               G   I+  C+A + + E N          K  GV+      GV      ++KVT+ AG
Sbjct  420   DKG-AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTISAG  478

Query  988   GALTTPSLLINSGL-KNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV-  818
             GAL TP L+I+SGL KNKNIGRNLHLHPV+  WG+FP++  + K K+ EG I++++  V 
Sbjct  479   GALLTPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHRVP  538

Query  817   --VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG  644
                 + + +   A+I+TP L P  FSAL PW SG ++K RM  Y RTAH   + RDK  G
Sbjct  539   SSSNDDSISDTRAIIETPLLGPSSFSALYPWESGLDYKQRMLNYPRTAHFITIIRDKAGG  598

Query  643   EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKV-KDASREEF  467
             +  +   ++Y L+  D+EN++ G+++ LRIL AAGA E+G +   G  +K  ++ S +E 
Sbjct  599   QVTTERRISYKLNSIDKENMRAGIQQALRILIAAGAVEVGTHRSGGQRIKCNENTSEKEI  658

Query  466   ERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
             E F+      E +    ++ NL  SAHQMGSCRMGV+ K   V+  GE+WE EGLFV D 
Sbjct  659   EEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDA  718

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             SVLPTA+GVNPM+TI S ++CIS  +++FL+
Sbjct  719   SVLPTAVGVNPMITIQSTAFCISNRIVDFLR  749



>dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=752

 Score =   547 bits (1410),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 317/756 (42%), Positives = 446/756 (59%), Gaps = 43/756 (6%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAI--NEALP----ETTDASVTNFFQTS  2240
             + L R +  +  T  L P+QME L A+C+  +P++   EAL        D  +  F+  S
Sbjct  14    HPLLRVLRRDKYTHGLYPAQMEALRAMCDALIPSLPPEEALDGRRDTPRDKDLERFYLAS  73

Query  2239  AASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPE  2060
              A +  P +VA +   R        + + LW L TR+GTL LCG+  +S +FP++ RF +
Sbjct  74    GADSTIPDEVAELAFTRCVWEAGLLVHVTLWLLCTRLGTLALCGRLCVSGEFPYVRRFAD  133

Query  2059  ISQKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDP  1883
             +   +RE  +  W  +  L  ++  F  +K+L   VF+T V++  +NP WKAIG+  P+ 
Sbjct  134   MPVGRREEALGRWTRARWLIPVKIAFAIVKSLCFNVFYTKVNENSENPCWKAIGFSVPN-  192

Query  1882  SISekqkkqkhhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGP  1706
                      K    +   E     PL KG+++   L +  +   L   G +V KP   G 
Sbjct  193   --------VKEQRKKHPTEAAALRPLDKGVVETRELDDATLLRSLADKGLAV-KPATSGY  243

Query  1705  SFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGG  1526
                +ECD V+VGSGCGGGV + VLA+ G+KVLV+EKG+Y+   + S +EGPSM++++  G
Sbjct  244   YHAVECDVVIVGSGCGGGVAAAVLASVGHKVLVVEKGDYFTPDDYSSVEGPSMERLYEQG  303

Query  1525  GLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDT  1346
             G+  T ++  VL AG+TVGGGSAVNWSASI+TP  VL EW   HGL +FGS  Y ++MD 
Sbjct  304   GIFCTSNVTTVLFAGTTVGGGSAVNWSASIRTPREVLLEWSRDHGLPVFGSAGYVQSMDA  363

Query  1345  VCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGT  1166
             VC ++ V   C +E FQN V+R+GC  LG PV  +P+N+   HYCG C  GC  G K+GT
Sbjct  364   VCARLAVTDGCREEGFQNKVVRRGCEALGLPVDCVPRNSSEGHYCGNCYLGCPTGDKRGT  423

Query  1165  AETWLVDLVKSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIK  1013
               TWLVD V+ G   IL  C+A + I + N         K  G++ T    G+ +   I+
Sbjct  424   DTTWLVDAVQDG-AVILAGCKAERFILQNNINGKNGRSKKCVGLVATCVGSGITKKLRIE  482

Query  1012  SKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGA  842
             +KV++ A GAL TP LL NSGL+N+++GRNLHLHPV  AWG+FPDT   P    K YEG 
Sbjct  483   AKVSISACGALMTPPLLRNSGLRNRHVGRNLHLHPVSMAWGYFPDTNQVPQLTGKCYEGG  542

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             I+++M  V           +I+TPAL PG F++L+PW SG++ K RM RYARTAH FAL 
Sbjct  543   IITSMHRVTERT-------IIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALV  595

Query  661   RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA  482
             RD+ +G  +    V Y   + D E L+ GL + LRI+ AAGA E+G +   GL L+ K  
Sbjct  596   RDRAAGSVYGEGRVHYSPSRDDIEELRDGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGV  655

Query  481   SREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
               ++ E F+ E +       P      L  SAHQMGSCRMG  PK   V+ +GE+WE E 
Sbjct  656   QDKDLEAFLDEVTVPRGPMQPGTDTWALLCSAHQMGSCRMGSSPKEGAVDGRGESWEAED  715

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             L+V DGS+LPTA+GVNPM+TI S++YC++  + + L
Sbjct  716   LYVCDGSLLPTAVGVNPMITIQSLAYCLAMDIAQSL  751



>ref|XP_006367233.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum tuberosum]
Length=734

 Score =   545 bits (1404),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 305/734 (42%), Positives = 454/734 (62%), Gaps = 33/734 (4%)
 Frame = -3

Query  2377  NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             N+  T   S +Q++T+S+ C T +P  N            +FF +S A    P++VA ++
Sbjct  17    NSNYTHGFSSTQIQTISSFCETLVPPCN-----NKGIDDNSFFASSGARPPYPNEVAELL  71

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R K   L  + ++++ LSTR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+
Sbjct  72    VKRSKPEALFIIRIVVFLLSTRLGSLLLCGRVCLDKRWPFVHNFSELDLKDREALLQRWS  131

Query  2017  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
               +    +R  F  +K +   +FF+  D+   NP+W+AIGY  P+ + +    K++    
Sbjct  132   RETFLIPLRITFLMIKIVCFFIFFSWTDENCKNPTWEAIGYHLPETTETLSVNKKER---  188

Query  1840  eddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
                       PL +GI++ +N  +E +   L+K G ++A+      +F I+CD ++VGSG
Sbjct  189   ----------PLERGIVETINESDETLKESLSKKGVAIAEDTKDN-TFKIKCDVLIVGSG  237

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
             CGGGV +G+LA +GYKV+VLEKG+Y+   + S LEGPS+ +++  G +L + D  ++++A
Sbjct  238   CGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMA  297

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             G+TVGGGSAVNWSASI+TP  VL++W E H +  FG+  YQ AMDTVC ++GV   C +E
Sbjct  298   GTTVGGGSAVNWSASIRTPNDVLKDWSENHKISWFGTSEYQSAMDTVCKRIGVTENCSEE  357

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
               QN V+RKGC  LG  V  IP+N+  +HYCG C +GCK G KKGT  TWLVD V +G  
Sbjct  358   GLQNQVIRKGCENLGLKVDKIPRNSSENHYCGSCGYGCKTGDKKGTDSTWLVDAVNAG-A  416

Query  1123  AILPECEALQVIHERNKAK----GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              IL  C A + I E  K +    GV+ T +   + +   I+++ T+ + G+L TP LLI+
Sbjct  417   VILTGCTAQRFILEDGKMRKTCLGVIATTETKKIPKKLHIEARATISSCGSLFTPPLLIS  476

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGL+NKNIG NLHLHPV+ AWG+FP++  E K K+YEG IM+++  ++     T   A++
Sbjct  477   SGLQNKNIGTNLHLHPVLLAWGYFPESMAEIKGKNYEGGIMTSLHKML--PEETNAQAIV  534

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +  A+ P  F++L PW SGQ+ K +M++Y+RT  + AL +D+G GE      + Y LD+ 
Sbjct  535   EATAMGPAAFASLFPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEVKKAGRIKYSLDRI  594

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQSL  431
             D+EN++ GL + LRIL AAGA E+G     G  +   D   EE E F+      E   S 
Sbjct  595   DKENIKAGLRRALRILIAAGAVEVGTYRSDGQKISCTDMKNEELEEFLDTVEAPEGPMSK  654

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              ++  + ASAHQMGSCRMG   +   V+  GE WE +GL+V DGSVLPTA+GVNPM+TI 
Sbjct  655   EENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQ  714

Query  250   SVSYCISQSVLEFL  209
             S +YCI++ + E L
Sbjct  715   STAYCIAKRIAESL  728



>ref|XP_010069617.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Eucalyptus grandis]
 gb|KCW58025.1| hypothetical protein EUGRSUZ_H00753 [Eucalyptus grandis]
Length=746

 Score =   544 bits (1402),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 321/739 (43%), Positives = 454/739 (61%), Gaps = 44/739 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLP-----AINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
              S  Q+++L+A+C T LP     +I+E  P   + +V +FF+ S +    P ++A  + +
Sbjct  22    FSADQIQSLAAMCETLLPPLSPDSIDEDSPR--NEAVYSFFRASGSQHPIPDEIAERLAK  79

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-T  2015
             R +   L  + L+L  LS R+GTLLLCG   L  ++PF+ +F E+  ++RE +++ W+  
Sbjct  80    RGQRSALLVVSLVLKILSYRLGTLLLCGFLCLDWRWPFIRKFHEMPLERREIVLNRWSRQ  139

Query  2014  SSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqkhhd  1844
               L  ++  F  +K   L  FF+  D+   NPSW+AIGY       P  S++++      
Sbjct  140   KKLIPLKVAFAMVKLFCLFHFFSRTDENSKNPSWEAIGYEVDTQEKPVKSKRER------  193

Query  1843  heddieELLFGPLYKGIIDLNLPE-EHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL KG I+        +   LT  G  V++      S  I+CDAV++GS
Sbjct  194   -----------PLEKGTIETMYESGSSLVQSLTGKGLKVSECSKTN-SCNIKCDAVIIGS  241

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV + VLA +G KV+VLEKG+Y+   + S LE PSM++M+  GGLL T D   +++
Sbjct  242   GCGGGVAAAVLAQSGQKVVVLEKGDYFTPQDYSSLEAPSMNQMYESGGLLSTVDGKFMIM  301

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
             AGSTVGGGSAVNWSASIKTP  VL EW   H + LFGS  Y  AMD VC ++GV   C +
Sbjct  302   AGSTVGGGSAVNWSASIKTPSSVLHEWSVDHKIPLFGSPEYLSAMDAVCKRIGVTENCSE  361

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E FQN +LRKGC  LG  V  +P+N+P +HYCGWC +GC+ G K+GT  TWLVD V+ G 
Sbjct  362   EGFQNQILRKGCSNLGLHVETVPRNSPENHYCGWCCYGCRMGEKRGTDRTWLVDAVEHG-  420

Query  1126  GAILPECEALQVIHER-------NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
               IL  C+A ++I E        ++  GV  T       +   I++KVT+ A G+L TP 
Sbjct  421   AVILTGCKADKLILETGDDEKVGHRCSGVTATVSSRDFFKKLRIEAKVTISACGSLLTPP  480

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHFPD-TPGENKKSYEGAIMSAMSTVVLNVNGTGY  791
             LLI+SGLKN NIGRNL LHPV+  WG+FP+ + G   +SY+G I++++  VV + + +  
Sbjct  481   LLISSGLKNPNIGRNLRLHPVLLVWGYFPENSTGYRGRSYDGGIITSVHKVV-SEDSSEV  539

Query  790   GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
              A+I+TPAL PG F++L PW SG E K  M +Y+RTAH+FAL RD+GSG       +TY 
Sbjct  540   QAIIETPALGPGSFASLFPWVSGAEVKNSMVKYSRTAHLFALVRDQGSGVVKEEGVITYR  599

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ--  437
             L + D+ENL+ GL + LRIL AAGA E+G     G  +K + A +E+ E F+   ++   
Sbjct  600   LSQEDKENLKLGLRQALRILIAAGAVEVGTYRSDGQRIKCRGAKQEDIEEFLDSITTPGG  659

Query  436   --SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
               S ++H  +  SAHQMGSCRMG +  A  V+  GE+WE +GLFV DGS+LP+A+GVNPM
Sbjct  660   LGSRQEHWTMYCSAHQMGSCRMGANEGAGAVDENGESWEAKGLFVCDGSMLPSAVGVNPM  719

Query  262   VTIMSVSYCISQSVLEFLK  206
             +TI S +YCIS+ + E L+
Sbjct  720   ITIQSTAYCISKRIAESLR  738



>gb|EYU46424.1| hypothetical protein MIMGU_mgv1a001883mg [Erythranthe guttata]
Length=744

 Score =   544 bits (1402),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 314/734 (43%), Positives = 447/734 (61%), Gaps = 35/734 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPET---------TDASVTNFFQTSAASTGTPHQVAW  2204
              S SQ+++L+A+C+T +P +     E          T   ++N  Q   +S G P +VA 
Sbjct  23    FSASQIQSLTAICHTIIPPLTNLRAEVDDDDDDDVITGGDMSNHVQAFYSSNG-PDEVAE  81

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
             +I +R     +  + L+L FLS+R+GTL+LCG       +PF+  F E+  KKRE ++ +
Sbjct  82    LIVKRGVPKAVFIVSLVLKFLSSRLGTLVLCGYICFDKNWPFVRTFSELPLKKRESVLQN  141

Query  2023  WATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
             W+  +L   +R  F  +K + L +FF+  D+   NP+W+AIGY      + E  +KQ++ 
Sbjct  142   WSRQTLLLPLRIAFLLLKIITLFIFFSWTDENSSNPAWEAIGY-----HVEEILEKQENE  196

Query  1846  dheddieELLFGPLYKGIIDL--NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                         PL KG+I+   N  +  +   L + G SV +      +F I+CD  +V
Sbjct  197   P-----------PLKKGVIETMKNEDDASLKESLLQKGVSVIEDPNEKNTFKIKCDVAIV  245

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV + VLA +G KV+++EKGNY+   + S LEGPS+ +++  GG+L T+D  ++
Sbjct  246   GSGSGGGVAAAVLAKSGQKVIIIEKGNYFTPQDYSGLEGPSLSELYESGGILSTEDGKIM  305

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             + AGSTVGGGS+VNWSA I+TP YVL+EW + + L LF ++ Y+ AMD VC ++GV   C
Sbjct  306   IQAGSTVGGGSSVNWSACIRTPDYVLQEWSKQNKLPLFTTNEYKSAMDDVCERLGVTENC  365

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
              +E FQN VLRKG   LG  +  +P+N+ +DHYCG C +GCK G KKGT  TWLVD V  
Sbjct  366   VEEGFQNKVLRKGVENLGLKIEPVPRNSSADHYCGSCCYGCKRGDKKGTESTWLVDAVNE  425

Query  1132  GNGAILPECEALQVIHERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             G   IL  C+A + +  +N+  GV+ T +   +K+   I+++VT+ A G+L TP LLI+S
Sbjct  426   G-AVILSGCKAEKFVLVKNRCIGVIATSENKNIKKKLYIEARVTISACGSLLTPPLLISS  484

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQ  776
             GLKNKNIG NLHLHPV F WG+FP+   E K K +EG I++++  V  N     +  VI+
Sbjct  485   GLKNKNIGSNLHLHPVSFVWGYFPEPSSEIKGKCFEGGILTSLHKVQQNQESDNFETVIE  544

Query  775   TPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTD  596
               AL P  F+ L+PW S QE   RM++Y+RTA +FAL RD+G GE      V Y L K D
Sbjct  545   VSALGPASFAGLIPWASRQEINERMTKYSRTAVLFALTRDQGLGEVKRQGHVKYRLSKID  604

Query  595   EENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLR  428
              EN++ GL + LRIL AAGAEE+G     G  +K +    EE + F+    +    +S  
Sbjct  605   RENIKTGLRRALRILIAAGAEEVGTFRSDGQRIKCRGIKDEELDEFLDNVGAVGGPRSRS  664

Query  427   KHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS  248
             ++  +  SAHQMGSCRMG   +   V+  GE WE +GLFV DGSVLP+ALGVNPMVTI S
Sbjct  665   EYWTIYCSAHQMGSCRMGESDEDGAVDENGECWEAKGLFVCDGSVLPSALGVNPMVTIQS  724

Query  247   VSYCISQSVLEFLK  206
              +YCIS+ +   LK
Sbjct  725   TAYCISKRLAASLK  738



>ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum lycopersicum]
Length=731

 Score =   543 bits (1400),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 311/734 (42%), Positives = 454/734 (62%), Gaps = 36/734 (5%)
 Frame = -3

Query  2377  NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             N++ T   S SQ++T+SA C T +P  N       D S   FF +S A   + ++VA ++
Sbjct  17    NSSYTHGFSSSQIQTISAFCETLVPPCN-----NNDNS---FFASSGAHPPSTNEVAELL  68

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R K   L  + ++++ L+TR+G+LLLCG+  L  ++PF+  F E+  K RE ++  W+
Sbjct  69    VKRSKPEALLIIRIVVFLLTTRLGSLLLCGRVCLDKRWPFVHNFTELDLKDREALLQRWS  128

Query  2017  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
               +    +R  F  +K + L +FF+  D+   NP+W+AIGY  P+ + +  + K++    
Sbjct  129   RETFLIPLRITFLMIKIIYLFIFFSWTDENCKNPTWEAIGYHLPETTEALYENKKER---  185

Query  1840  eddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
                       PL +GI++ +N  +E +   L+K    + +       F IECD ++VGSG
Sbjct  186   ----------PLERGIVETINESDETLKESLSKKDVVITEDAKDNI-FKIECDVLIVGSG  234

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
             CGGGV +G+LA +GYKV+VLEKG+Y+   + S LEGPS+ +++  G +L + D  ++++A
Sbjct  235   CGGGVAAGILAKSGYKVVVLEKGHYFVPEDYSGLEGPSLSELYETGAMLSSLDGKVMIMA  294

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             G+TVGGGSAVNWSASIKTP  VL++W   H +  FG+  YQ AMD VC ++GV   C +E
Sbjct  295   GTTVGGGSAVNWSASIKTPNDVLKDWSVNHKISWFGTSEYQSAMDAVCKRIGVTENCSEE  354

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
               QN V+RKGC  LG  V  IP+N+  +HYCG C +GCK G KKGT  TWLVD V +G  
Sbjct  355   GLQNQVIRKGCENLGLKVEKIPRNSSENHYCGSCGYGCKTGDKKGTDSTWLVDAVNAG-A  413

Query  1123  AILPECEALQVIHERNKAK----GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              IL  C A + I E  K +    GV+ T +   + +   IK++ T+ + GAL TP LL++
Sbjct  414   VILTGCTAERFILEDGKMRKTCLGVIATTESKKITRKLHIKARATISSCGALFTPPLLLS  473

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGL+NKNIG NL+LHPV+ AWG+FP++  E K K+YEG IM+++  +V     T   A+I
Sbjct  474   SGLQNKNIGTNLYLHPVLLAWGYFPESMSEIKGKNYEGGIMTSLHEMV--PEETNAQAII  531

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +  A+ P  F++L PW SGQ+ K +M++Y+RT  + AL +D+G GE      + Y LD+ 
Sbjct  532   EATAVGPASFASLFPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEVKKAGRIKYSLDRI  591

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQSL  431
             D+EN++ GL + LRIL AAGA E+G     G  +K KD   EE E FV      E   S 
Sbjct  592   DKENIKAGLRRALRILIAAGAVEVGTYRSDGQKIKCKDIKNEELEEFVDTVEAPEGPMSK  651

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              ++  + ASAHQMGSCRMG   +   V+  GE WE +GL+V DGSVLPTA+GVNPM+TI 
Sbjct  652   EENWTVYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQ  711

Query  250   SVSYCISQSVLEFL  209
             S +YCI++ + E L
Sbjct  712   STAYCIAKRIAESL  725



>ref|XP_001763007.1| predicted protein [Physcomitrella patens]
 gb|EDQ72212.1| predicted protein [Physcomitrella patens]
Length=775

 Score =   545 bits (1403),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 311/756 (41%), Positives = 444/756 (59%), Gaps = 37/756 (5%)
 Frame = -3

Query  2386  KMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVA  2207
             K  N     + + +Q+ TL ++C+ F P+++          + +F+  SA+  G P  +A
Sbjct  22    KSWNPPTQHSFTKAQLRTLISICDAFSPSLSPPAECEEKQEIASFYTCSASDMGVPEDIA  81

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              +++  +K   L ++ + LW LSTRIGTL+L G+ SL+TQFPF   F  +S  K+E I+ 
Sbjct  82    GLLHVLLKPQLLMAIRVFLWLLSTRIGTLILGGRASLTTQFPFFQSFAYLSTDKQEDILR  141

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
              W+ S+L   R  +   K + +   +T +++ G N +WKAIGYCG DP +          
Sbjct  142   GWSLSTLGAFRAVYKLFKMITMWAVYTKIENGGFNRNWKAIGYCGADPQV-------IRS  194

Query  1846  dheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPP---------------  1712
                   + +   PL   +I      + +   L++ G  V     P               
Sbjct  195   RKCSSNDGVRSNPLQDMVIATQAAGDKLEKVLSRAGVKVLNDDIPLKKLASGNRNRNNSA  254

Query  1711  -GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  1535
              G    I CD VVVGSGCGGGVI+ VLA AGY+V++LEKG Y+   +L+ LEGPS   MF
Sbjct  255   AGGDLGISCDVVVVGSGCGGGVIASVLAKAGYQVVILEKGKYFRTEDLTTLEGPSQMAMF  314

Query  1534  LGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKA  1355
                G L T D  + L+AG+TVGGG+A+NWSA  +TP +VL+EW ++ GLELF S  Y+ A
Sbjct  315   EKLGSLATDDGGVNLVAGATVGGGTAINWSACFETPSHVLQEWKQISGLELFTSTRYKLA  374

Query  1354  MDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRK  1175
             M  +  ++ VQ     E+ QN VLR GC +L   V  + +NAP DH CGWCT+GC  G+K
Sbjct  375   MKKIWHRLNVQPNIARENLQNSVLRAGCEKLSAEVGTLARNAPVDHDCGWCTYGCPSGQK  434

Query  1174  KGTAETWLVDLVKSGNGAILPECEALQVIHERN-------KAKGVMFTFQRDGVKQTAVI  1016
               T  TWL D  +S N  +L ECEA +++  +N       KA+GVM        K+   I
Sbjct  435   GSTTSTWLKDAAESKNAVLLSECEAQRILFSKNHSGRKHYKARGVMAVVGSS--KKRIFI  492

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIM  836
             +++  V+A G+L TP LL+NSGL+N NIG+ LHLHPVVF WG+FP+  G     YEGAIM
Sbjct  493   EAQSVVVASGSLMTPPLLLNSGLRNPNIGKGLHLHPVVFMWGYFPEESGFPGTCYEGAIM  552

Query  835   SAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             ++ S  +   NG+   A+++ P+ HPG F++  PW S  +FK RM R++RT  + A+ RD
Sbjct  553   TSYSP-IYKKNGSFPVALLEVPSTHPGSFASFQPWTSAADFKERMRRFSRTVTLCAVTRD  611

Query  655   KGSG----EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK  488
               +G    EA     + Y L+  DEE +  G+EK LR+L AAGA EIG +   G    VK
Sbjct  612   TSNGQVSVEADGKPKIDYTLNAVDEETILEGIEKGLRVLIAAGATEIGTHQQDGERFCVK  671

Query  487   DASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
              A+  + E ++K   S+ ++K+  +  S H MGSC+MG DP+ S V+ +GETWEVEGL+V
Sbjct  672   GANSRDIEAYIKRVRSRGVKKNKIIIGSGHHMGSCKMGSDPRRSAVDGEGETWEVEGLYV  731

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
              DGSVLP+A+GVNPMVTI SV+YCI+ SVL+ L + 
Sbjct  732   SDGSVLPSAIGVNPMVTIQSVAYCIAHSVLQSLDSQ  767



>ref|XP_011091281.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Sesamum indicum]
Length=748

 Score =   544 bits (1401),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 318/739 (43%), Positives = 438/739 (59%), Gaps = 41/739 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  2195
              S S++E L+++C   LP I        +     D S   F   S +    P +VA +I 
Sbjct  22    FSTSELEILTSICEVLLPPIPLMNSQENSTKNEVDQSYEAFCNASGSQYPVPDEVAELIK  81

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +R        +   L  LSTR+GTLL+CG  S   ++P+L +F EIS +KRE++V  W  
Sbjct  82    KRGSWEAKILVRATLRILSTRLGTLLICGSHSFDKKWPYLKKFSEISLEKREKVVQKWFR  141

Query  2014  SSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdh  1841
             + L   +R  F  +K LVL VFFT V +   NP+WKA+ Y    D  + +  K++     
Sbjct  142   NRLLTPVRLAFVFIKFLVLYVFFTQVGEDAKNPAWKAMDYRVDVDEKLRDAPKER-----  196

Query  1840  eddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
                       PL +G+++     +  F N L   G  V +       + ++CD V+VGSG
Sbjct  197   ----------PLEQGMVETRHETDLTFANSLAAKGLKVTQ-NAQRSMYKVKCDVVIVGSG  245

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
             CGGGV + VL+ AG KV+VLEKGNYY   + S LEGPSM +++  GGLL T D   ++LA
Sbjct  246   CGGGVAAAVLSRAGLKVVVLEKGNYYTSKDYSALEGPSMSELYESGGLLSTLDGKTMILA  305

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             GSTVGGGSAVNWSA IKTP +VL EW     L LF S  Y  AM+ VCG++GV  +C+ E
Sbjct  306   GSTVGGGSAVNWSACIKTPDFVLDEWGNGQKLPLFSSSEYIAAMEKVCGRIGVTEKCDKE  365

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
              FQN +LRKGC +LG     + +N+   H+CG C +GC  G KKGT  TWLVD V  G  
Sbjct  366   GFQNQILRKGCEKLGLKADPVARNSSEGHFCGSCCYGCIRGDKKGTDTTWLVDAVNCG-A  424

Query  1123  AILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
              I+  C+A + + E        + +  GV+   +    +Q   I+++VT+ A G+L TP 
Sbjct  425   VIISGCKAERFVIEDKKYGSARKKRCLGVIAKSKIADTEQMIHIEARVTISACGSLLTPP  484

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGY  791
             LLI SGLKN+NIGRNLHLHPV+ AWG+FP+T  +   K YEG I++++  V    +    
Sbjct  485   LLIKSGLKNRNIGRNLHLHPVLMAWGYFPETSSDIEGKIYEGGIITSVHKV--GQDAKNL  542

Query  790   GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
              A+I++P L PG F+AL PW SG E K R+ +YARTAH+F++ RD+GSGE      + Y 
Sbjct  543   RAIIESPILGPGQFAALCPWESGVEIKNRILKYARTAHLFSMIRDRGSGEVMLEGRINYK  602

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----VKEES  443
             LDK D+EN++ GL + LRIL AAGA E+G +   G  LK K  + +E E+F    + E+ 
Sbjct  603   LDKYDKENMKVGLRRALRILIAAGAVEVGTHQSDGQKLKCKGITEKEVEKFLDNVIAEDG  662

Query  442   SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
              +S+ +     +SAHQMGSCRM    K   V+  GE+WE EGLFV D SVLP A+GVNPM
Sbjct  663   PKSMVEKWTTYSSAHQMGSCRMAKSEKDGAVDENGESWEAEGLFVCDASVLPGAVGVNPM  722

Query  262   VTIMSVSYCISQSVLEFLK  206
             +TI + SYC+S+ + E LK
Sbjct  723   ITIQTTSYCLSKKIAEKLK  741



>gb|KEH30749.1| long-chain-alcohol oxidase FAO2-like protein [Medicago truncatula]
Length=766

 Score =   544 bits (1402),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 330/753 (44%), Positives = 464/753 (62%), Gaps = 45/753 (6%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAI--NEALPETTDAS--VTNFFQTSAASTGTPHQ  2213
             EN+      S ++ME+L+++C   LP++  ++AL +  ++S  V +FF  SA+    P +
Sbjct  23    ENSKYKHGFSVAEMESLTSICEVVLPSLPMDDALTKDDESSKDVQSFFNISASMYPIPDE  82

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++ +      +  + ++LW L+TR+GTLL+CG   LS ++PF+  F  +S  KRE+I
Sbjct  83    VAEMLVKSGVTEAVILIRVILWLLATRLGTLLICGLLCLSKKWPFINNFSSLSLDKREKI  142

Query  2032  VHSWATSSLQFIRNF---FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             V       L+F+  F   F  +K L L VFF+ VD+ GDNP+WKAIGY      +S   +
Sbjct  143   VQR--ALKLRFLTPFRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGY-----EVSTADE  195

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECD  1685
             K  +   +         PL KGII++    +    + L+  G +V           I+CD
Sbjct  196   KMTNDTKKR--------PLEKGIIEIMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCD  246

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AVVVGSGCGGGV + VL+ AGYKV+VLEKGNY+   + S LEGPSMD+ +  GG+L + D
Sbjct  247   AVVVGSGCGGGVAASVLSKAGYKVVVLEKGNYFVPKDYSSLEGPSMDQQYEKGGMLASVD  306

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
               +VL AGSTVGGGSAVNWSA I+TP  VL+EW + H L LF +  Y  AM+TVC ++GV
Sbjct  307   SRIVLFAGSTVGGGSAVNWSACIRTPQNVLKEWSDEHKLPLFETLEYLSAMETVCERIGV  366

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                C  E FQN VLRKGC+ LG  V  +P+N+P +HYCG C +GC  G K+GT  TWLVD
Sbjct  367   NENCTQEGFQNQVLRKGCQNLGLKVDYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVD  426

Query  1144  LVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
              V  G   I+  C+A + + E N          K  GV+      GV      ++KVT+ 
Sbjct  427   AVDKG-AVIITGCKAERFLFENNYRNANTRKNKKCLGVLAKTLNSGVTMKLQFEAKVTIS  485

Query  994   AGGALTTPSLLINSGL-KNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMST  821
             AGGAL TP L+I+SGL KNKNIGRNLHLHPV+  WG+FP++  + K K+ EG I++++  
Sbjct  486   AGGALLTPPLMISSGLTKNKNIGRNLHLHPVLMTWGYFPESKSDFKGKANEGGIITSVHR  545

Query  820   V---VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             V     + + +   A+I+TP L P  F+++ PW SG +FK RM +Y RTAH+  + RDK 
Sbjct  546   VPSSSNDDSISDTRAIIETPLLGPSSFASIYPWESGLDFKQRMLKYPRTAHLITIIRDKA  605

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE-  473
             SG+  +   ++Y L+  D EN++ GL++ LRIL AAGA E+G +   G  +K  + + E 
Sbjct  606   SGQVKTEGRISYKLNSIDRENMRAGLQQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEK  665

Query  472   EFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
             E E F+      E +    ++ NL  SAHQMGSCRMGV+ K   V+  GE+WE EGLFV 
Sbjct  666   EIEEFIDSVYPMEGALWPGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVC  725

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             D SVLPTA+GVNPM+TI S ++CIS  +++FL+
Sbjct  726   DASVLPTAVGVNPMITIQSTAFCISNRIVDFLR  758



>ref|XP_011029789.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Populus euphratica]
Length=744

 Score =   543 bits (1399),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 325/748 (43%), Positives = 449/748 (60%), Gaps = 59/748 (8%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAW  2204
             LS ++M++L++LC T LP++          + LP     +V   ++ SA+ T  P ++A 
Sbjct  23    LSSAEMDSLASLCETILPSLPPPVTTFDGKQHLP---TKAVQALYRASASQTPVPDEIAE  79

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
             ++ +R     +  + L+LW LSTR+GT LLCG      ++  +  F  IS  KRE+++  
Sbjct  80    LLRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIQNFSSISLDKREKVLQK  139

Query  2023  WATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAIGYC-GPDPSISek  1868
             W      F R FFT +       K L + VFF+ V   GDNP+W+AI YC G D + ++ 
Sbjct  140   W------FKRRFFTPIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAIEYCAGTDENPNQV  193

Query  1867  qkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIE  1691
              K++               PL KG+ID N   +    R LT+ G  V +  P      I+
Sbjct  194   SKER---------------PLQKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIK  237

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD V+VGSGCGGGV + VLA +G KV VLEKGNY+   + S LEGPS+ +++  GGLL +
Sbjct  238   CDVVIVGSGCGGGVAAAVLAASGQKVFVLEKGNYFTAADYSGLEGPSIAQLYESGGLLAS  297

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D  M+++AGS VGGGS VNWSASIKTP  VL+EW +   + LFGS  Y  AMDTVC ++
Sbjct  298   ADAGMIIMAGSAVGGGSVVNWSASIKTPNSVLQEWTKNQKIPLFGSPEYFSAMDTVCARI  357

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C+ E FQN VLRKGC  LG PV  +P+N    HYCG C +GC+ G KKGT  TWL
Sbjct  358   GVTENCKVEGFQNQVLRKGCERLGVPVKTVPRNTSERHYCGSCGYGCRKGEKKGTDRTWL  417

Query  1150  VDLVKSGNGAILPECEALQVIHERNKA--------KGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C+A + + E+NK          GV+       +     I++KVT+ 
Sbjct  418   VDAVDHG-AVILTGCKAERFLLEKNKGLGKRKKKCLGVIAKIINSNIITRLQIEAKVTIS  476

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A GAL TP L+I+SGLKN+NIGRNLHLHPV+ AWG+FP++  E K K Y+G I++A+  V
Sbjct  477   ACGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVHEV  536

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+++TP L P  FS L PW SG + K RM +YARTAH+  + RD GSG+ 
Sbjct  537   V--AGDSNVRAIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYARTAHLITIIRDSGSGKV  594

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
              +   ++Y LD +D +NL+ GL + LRIL AAGA E+G +   G  +K +   +E+ E F
Sbjct  595   TTEGRISYKLDASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKKEDLEEF  654

Query  457   VKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +    +     S+ +     +SAHQMGSCRMG+  K   V+  GE+WE EGLFV D SVL
Sbjct  655   LDTVYATGGALSMEEDWMFYSSAHQMGSCRMGIKEKEGAVDENGESWEAEGLFVCDASVL  714

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             P+A+GVNPM+TI S +YC+S+ + E L+
Sbjct  715   PSAVGVNPMITIQSTAYCLSKKIAESLR  742



>ref|XP_009376994.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Pyrus x bretschneideri]
Length=749

 Score =   543 bits (1399),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 325/734 (44%), Positives = 461/734 (63%), Gaps = 29/734 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPE--TTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
              S ++M++L+++C   LP + E   E  T + +V +F++TSAA T  P +VA ++ +R  
Sbjct  26    FSSAEMQSLASICEALLPPLYEIKGEQPTINKAVQSFYKTSAAQTPIPDEVAQLMVKRAL  85

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  2006
                +  + ++LW L T++GTLLLCG       +PF+  F  +S +KRE+++  W     L
Sbjct  86    IEAVVLVRVVLWILGTKLGTLLLCGSLCFGKTWPFVHNFSSLSLEKREKVLQKWFKHRFL  145

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               IR  F  +K L L +FF+ V +  +N  W+AIGY        +++   K  + E    
Sbjct  146   TPIRLAFVYIKFLCLYIFFSRVGENAENLIWQAIGYHVETDDQDDQKNHSKMQEQER---  202

Query  1825  ELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL KGII+  L  +  + N L + G  V         + ++CD +VVGSGCGGGV
Sbjct  203   -----PLQKGIIETMLETDTTLLNSLAQKGFQVIHDCTKNI-YNVKCDVIVVGSGCGGGV  256

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA++G+KV+VLEKGNY+  ++ S LE PS D+++  GG+L+T D  +VL AGSTVG
Sbjct  257   AAAVLASSGHKVIVLEKGNYFTPSDYSSLEAPSHDQLYESGGILVTVDGKIVLQAGSTVG  316

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSA+NWSA IKTP YVL+EW + H ++ FG   Y  AMDTVC ++GV   C +E FQN 
Sbjct  317   GGSAINWSACIKTPNYVLQEWNKDHKIKFFGGSEYLSAMDTVCERIGVIENCVEEGFQNQ  376

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V  +P+N+   HYCG C +GC+ G KKGT  TWL+D V  G   I+  
Sbjct  377   VLRKGCENLGLGVDFVPRNSSEKHYCGSCGYGCRKGEKKGTDSTWLMDAVDYG-AVIITG  435

Query  1108  CEALQVIHERNKAK--------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINS  953
             C+A + + E NK+         GVM     + + +   I++KVT+ A GAL TP L+++S
Sbjct  436   CKAERFVLETNKSGSKRKKKCLGVMAKPLSNNITKRLQIEAKVTISACGALLTPPLMLSS  495

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQ  776
             GLKNKNIG+NLHLHPV+ AWG+FPD+  E K K+YEG I++++  VV     +   A+I+
Sbjct  496   GLKNKNIGQNLHLHPVLMAWGYFPDSNSEFKGKNYEGGIITSVYKVV--SADSKVKAIIE  553

Query  775   TPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTD  596
             TPAL PG FSAL PW SG++ K RM +++RTAH+ ++ RDKGSG       V+Y+    D
Sbjct  554   TPALGPGTFSALSPWVSGEDIKNRMLKFSRTAHLISIIRDKGSGVVTKGGRVSYEFSALD  613

Query  595   EENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----VKEESSQSLR  428
             +EN++ GL + LRIL AAGA E+G +   GL LK K   +EE E F    +  E  QSL 
Sbjct  614   KENIKGGLRQALRILIAAGAIEVGTHRSDGLRLKCKGIDKEELEEFLDMVIANEGPQSLV  673

Query  427   KHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMS  248
             ++    +SAHQMGSCRMG++ K   V+  GE+WE E LFV DGSVLP+A+GVNPM+TI S
Sbjct  674   ENWTTYSSAHQMGSCRMGINAKEGAVDENGESWEAESLFVCDGSVLPSAVGVNPMITIQS  733

Query  247   VSYCISQSVLEFLK  206
              +YC+S+ + + L+
Sbjct  734   TAYCLSKRIADSLR  747



>ref|XP_009790215.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Nicotiana sylvestris]
Length=742

 Score =   542 bits (1397),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 311/733 (42%), Positives = 446/733 (61%), Gaps = 34/733 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
              S S+METL+++C T LP +    +PE    ++    + SA+    P + A V+ +R   
Sbjct  22    FSSSEMETLTSICETILPPLPQNEIPEKNSHNIQYLHKASASQYPIPDECAEVVMKRGFL  81

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQ  2003
               +  +  LL  LSTRIGTLLLCG      ++P++ +F +I  +KRE ++  W  +  L 
Sbjct  82    EAIILVRGLLRILSTRIGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLT  141

Query  2002  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieE  1823
              +R  F  +K L L +FFT V +   N +W  IGY   +     +  +++          
Sbjct  142   PVRLAFMFIKFLCLYIFFTQVGEDSKNQAWDDIGYQVDNEEKHSETAEER----------  191

Query  1822  LLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvi  1646
                 PL KGI++ +   E  +   L + G  V         + ++CD V+VGSGCGGGV 
Sbjct  192   ----PLEKGIVEAIYETESTIVKSLVQKGLKVID-DTKNNMYKVQCDVVIVGSGCGGGVA  246

Query  1645  sgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  1466
             + VLA++G+KV+VLEKGNYY +++ S LEGPSM++M+  GG+L T D  ++++AGSTVGG
Sbjct  247   ASVLASSGHKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLDAKIMIMAGSTVGG  306

Query  1465  GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMV  1286
             GSA+NWSA IKTP  V++EW +   L +F S  Y  AMD VC ++GV   C  E  QN +
Sbjct  307   GSAINWSACIKTPDCVIQEWGDDKRLPIFQSPEYVSAMDKVCERIGVTENCTQEGLQNQI  366

Query  1285  LRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPEC  1106
             LRKGC  LG  V  + +N   +HYCG C +GC+ G KKGT  TWLVD V SG   I+  C
Sbjct  367   LRKGCENLGLEVEGVARNTSENHYCGSCCYGCRRGEKKGTDTTWLVDAVDSG-AVIITGC  425

Query  1105  EALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             +A + I E+N        K  GV+ T     + +   I++KVT+ A G+L TP L+I+SG
Sbjct  426   KAERFILEKNKYGKTRDKKCLGVIATSTNKDITKRICIEAKVTISACGSLLTPPLMISSG  485

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             L+N NIGRNLHLHPV+ AWG+FP++  + K K YEG I++++  V      +   A+I+ 
Sbjct  486   LRNPNIGRNLHLHPVIMAWGYFPESDSDLKGKIYEGGIITSVHKV--GSYDSNVRAIIEA  543

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
              AL PG F+AL PW SG++ K R+ +Y+RTAH+FA+ +D GSGE  S   ++Y  + TD+
Sbjct  544   TALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGEVRSDGRISYTFNATDK  603

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRK  425
             E+L++GL++ LRIL AAGA+E+G     G  +K K  S +E E F+      E  +SL K
Sbjct  604   ESLKQGLKQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLNTVTAAEGPKSLVK  663

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             +    +SAHQMGSCRMG+  K   V+  GE+WE  GLFV D SVLP A+GVNPM+TI S 
Sbjct  664   NFTTYSSAHQMGSCRMGMSEKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITIQST  723

Query  244   SYCISQSVLEFLK  206
             +YC+S+ + E +K
Sbjct  724   AYCLSKKIAEMIK  736



>ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium 
distachyon]
Length=786

 Score =   542 bits (1397),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 318/763 (42%), Positives = 448/763 (59%), Gaps = 62/763 (8%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQ  2213
             T  + P+QME L A+C  F+P++           A P      +  F+  SAA +  P +
Sbjct  36    THGMHPAQMEALRAICGAFIPSMPAEEAAGAGGRADPPPGGKDLERFYLASAADSTIPDE  95

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-------FPFLLRFPEIS  2054
             VA ++  R     +    ++LW LSTR+GTLLLCG+ SLS         FP + RF ++ 
Sbjct  96    VAELMVTRCIREAVLLAWVVLWVLSTRVGTLLLCGRLSLSFSGGARDFSFPCVSRFADMP  155

Query  2053  QKKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI  1877
               +RE  +  W +T  L  +R  FT +K L   VF+  V++K +NP WKAIGY       
Sbjct  156   VARREAALQRWNSTRWLLPLRIVFTLVKILSHYVFYAMVNEKSENPHWKAIGYRVDKRRT  215

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSF  1700
              +                    PL  G+++   L +  +   L   G +V+         
Sbjct  216   EQADDAAAKSPSPSR-------PLDSGVVETRALNDTTLLRSLADRGLAVSSD---ARHH  265

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              ++CDAV+VGSGCGGGV + +LA+AG KV+VLEKG+Y+   + S +EGPSM+++F  GG+
Sbjct  266   TVQCDAVIVGSGCGGGVAAAMLASAGLKVVVLEKGDYFTAEDYSSVEGPSMERLFEKGGI  325

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               T ++  ++  GSTVGGGSAVNWSASI+TP  VL+EW + HGL +FGSD Y +AMD VC
Sbjct  326   FCTSNVTTMVFTGSTVGGGSAVNWSASIRTPGTVLQEWSQEHGLPVFGSDGYVQAMDAVC  385

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++ V   C +E FQN V+R+GC  LG PV  +P+N+ + HYCG C FGC  G K+GT  
Sbjct  386   SRLAVTDACLEEGFQNKVVRRGCEALGLPVDAVPRNSSAGHYCGSCNFGCPTGDKRGTDT  445

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERNKAK--------------GVMFTFQRDGVKQTA  1022
             TWLVD V+ G   IL  C+A + I E N A               G++ T   +G+ +  
Sbjct  446   TWLVDAVEHG-AVILTGCKADRFILESNTADTGGKDNARRSKKCVGLVATCMSNGITKKL  504

Query  1021  VIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD----TPGE---N  863
              I+++V++ A GAL TP LL NSGL+N++IGRNLHLHPV  AWG+F D    T G+    
Sbjct  505   RIEARVSISACGALMTPPLLRNSGLRNRHIGRNLHLHPVSMAWGYFSDNKLPTSGQTIIT  564

Query  862   KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYART  683
              KSYEG I+++M  +           +++TPAL PG F+A++PW SG++ K RM RYART
Sbjct  565   GKSYEGGIITSMHRITDRT-------IVETPALSPGAFAAMVPWESGRDMKERMRRYART  617

Query  682   AHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             AH FAL RD+G+G       + +   + D + L+ GL ++LRIL AAGA E+G +   GL
Sbjct  618   AHAFALVRDRGAGFVDCEGRLRFTPSRDDTDELRNGLRRVLRILVAAGAAEVGTHRSDGL  677

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKG  338
              L+ K    E+ E F+ E + +    H       L +SAHQMGSCRMG  P+   V+  G
Sbjct  678   RLRCKGVRDEDLEAFLDEVTIEKGPMHSTTDKWALFSSAHQMGSCRMGSSPREGAVDGSG  737

Query  337   ETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             E+WE EGL+V DGS+LPTA+GVNPM+TI SV+YC+S+ + + L
Sbjct  738   ESWEAEGLYVCDGSLLPTAVGVNPMITIQSVAYCLSKDIAQAL  780



>ref|XP_010093072.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
 gb|EXB53500.1| Long-chain-alcohol oxidase FAO2 [Morus notabilis]
Length=743

 Score =   541 bits (1393),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 314/733 (43%), Positives = 448/733 (61%), Gaps = 39/733 (5%)
 Frame = -3

Query  2353  SPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
             S +Q+++L+++C   +P +   +P       S+  F++ S + +  P + A ++ ++   
Sbjct  26    SSAQIQSLASMCEALIPPL---IPNKNPLHKSLQTFYEASGSQSPIPDETAEMVVKKALP  82

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF  2000
             P  + +  +L  LS R+GTLLLCG      ++PFL +F E+S +KRE ++  W+    +F
Sbjct  83    PAASLVSWVLKILSFRLGTLLLCGFICFDWKWPFLHKFSEMSLEKREAVLKKWSKQR-RF  141

Query  1999  I--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
             +  R  F  +K      FF+ VD+   NP+W+AIGY      +  +++  K         
Sbjct  142   VPLRLAFVLIKLFCFFTFFSRVDENSHNPAWEAIGY-----HVDTRKRMTKTEKER----  192

Query  1825  ELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL  G+I+ +   +  +   L + G  V +  P   ++ I+CDAVVVGSGCGGGV
Sbjct  193   -----PLDNGVIETMKETDSSLVQSLIQKGLEVTE-DPNDNNYKIKCDAVVVGSGCGGGV  246

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA +G KV+VLE+GNY+   + S LEGPSM++++  GG+  T D  ++LLAGSTVG
Sbjct  247   AAAVLAKSGQKVIVLEQGNYFVAQDYSSLEGPSMEELYKFGGISSTIDGKIMLLAGSTVG  306

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSAVNWSASI+TP  VL EW   H + LFGS  YQ AMD VC ++GV  +C  E+FQN 
Sbjct  307   GGSAVNWSASIRTPSSVLHEWSVDHKIPLFGSSEYQSAMDVVCKRLGVTDKCTKENFQNQ  366

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             +LRKGC+ LG  +V++P+N+ +DHYC +C +GC  G KKGT  TWLVD V  G   IL  
Sbjct  367   ILRKGCQNLGLEIVSVPRNSSADHYCSFCCYGCPTGEKKGTDTTWLVDAVACG-AVILTG  425

Query  1108  CEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             C A + + E       R K  GV+       + +   I++KVTV A GAL+TP L+I+SG
Sbjct  426   CRAEKFVLENGKDGGARKKCLGVIARCSSKKITKKLKIEAKVTVSACGALSTPPLMISSG  485

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             L+N NIGRNLHLHPV+  WG+FP+   E K K YEG I++++  V+   N T   A+I+T
Sbjct  486   LQNPNIGRNLHLHPVLLTWGYFPEDGSEFKGKMYEGGIITSLHKVISEGNNT--RAIIET  543

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             P L P  F+ L PW SG + K RM +YART+H+FA+ RD+GSGE      V Y L + D+
Sbjct  544   PVLGPATFATLFPWVSGSDMKDRMVKYARTSHLFAMVRDQGSGEVKEEGMVKYRLTQLDK  603

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRK  425
             ENLQ GL + LRIL AAGA E+G     G  +K K    ++FE F+   ++     +  +
Sbjct  604   ENLQCGLRQALRILVAAGAVEVGTYRSDGQRIKCKGLKEKDFEEFLDTVTAVGGPGTRGE  663

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             H  +  SAHQMGSCRMG + +   V+  GE+WE E LFV DGSVLPTA GVNPM++I S 
Sbjct  664   HWTIYCSAHQMGSCRMGANEEEGAVDENGESWEAESLFVCDGSVLPTAAGVNPMISIEST  723

Query  244   SYCISQSVLEFLK  206
             ++CIS  +++ LK
Sbjct  724   AFCISTRIVKSLK  736



>ref|XP_009594479.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana tomentosiformis]
Length=745

 Score =   541 bits (1393),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 303/730 (42%), Positives = 453/730 (62%), Gaps = 32/730 (4%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN---EALPETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
              S SQ++T+++ C T +P +    + L    + ++ +FF +SA+    P++VA ++ +R 
Sbjct  23    FSSSQIQTIASFCETLIPPLPYNPQHLSPCNNKALDSFFSSSASQPPFPNEVAELLVKRS  82

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL  2006
                 +  + ++++ LSTR+G+L+LCG+  L  ++PF+  F E+S K+RE ++  W+  S 
Sbjct  83    NPEAMLIIRIVVFLLSTRLGSLVLCGRVCLDKRWPFVHNFSELSLKQRESLLQRWSRESF  142

Query  2005  QF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
                +R  F  +K +   +FF+  D+   NP+W+AIGY  PD   +  +  ++        
Sbjct  143   LLPLRITFLLIKTMCFFIFFSWTDENCKNPAWEAIGY-QPDTRQTPSENHKER-------  194

Query  1828  eELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcggg  1652
                   PL KGI++ +N  +E +   L+K G  + +      +F I CD V+VGSGCGGG
Sbjct  195   ------PLEKGIVETINESDETLKESLSKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGG  247

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V + +LA +G+KV+VLEKG+Y+   + S LEGPS+++++  G +L T D  ++++AG+TV
Sbjct  248   VAAAILAKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYETGAMLTTDDGKVMVMAGTTV  307

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGSAVNWSASI+TP  VL +W   H +  FG+  YQ AMD VC ++GV   C +E  QN
Sbjct  308   GGGSAVNWSASIRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENCANEGLQN  367

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
               +R+GC  LG  V NIP+N+  +HYCG C +GCK G KKGT  TWLVD V +G   ILP
Sbjct  368   QAIRRGCENLGLKVENIPRNSSENHYCGSCGYGCKTGDKKGTDTTWLVDAVNAG-AVILP  426

Query  1111  ECEALQVIHERNKAK----GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLK  944
              C A + I E +  +    GV+ T +   + +   I+++ T+ + G+L TP LLI+SGLK
Sbjct  427   GCTAERFILEDDMNEKICIGVIATTESKKITKKLHIEARATISSCGSLLTPPLLISSGLK  486

Query  943   NKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPA  767
             NKNIG NLHLHPV+ AWG+FP++  E K K+YEG IM+A+  +V     T   A+I+  A
Sbjct  487   NKNIGTNLHLHPVLLAWGYFPESMSEIKGKNYEGGIMTAVHKMV--PEETNAQAIIEATA  544

Query  766   LHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEEN  587
             L P  F+   PW SGQ+ K RM++Y+RTA++ ALA+D+GSGE      + Y LD+ D+EN
Sbjct  545   LGPASFACFFPWTSGQDMKERMTKYSRTANLLALAKDQGSGEVKKAGKIKYRLDEIDKEN  604

Query  586   LQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKHP  419
             ++ G+ + LRIL AAGA E+G     G  +  K  + EE E F+    +     S  +  
Sbjct  605   IKAGVRRALRILVAAGAAEVGTYRSDGQKISCKGITNEELEEFLDTVGATGGPSSKGEQW  664

Query  418   NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY  239
              +  SAHQMGSCRMG + +   V+  GE WE +GL+V DGSVLPTA+GVNPM+TI S +Y
Sbjct  665   AIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAY  724

Query  238   CISQSVLEFL  209
             CI+  + E +
Sbjct  725   CIANRIAESM  734



>ref|XP_007050220.1| Alcohol oxidase [Theobroma cacao]
 gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
Length=740

 Score =   540 bits (1392),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 315/739 (43%), Positives = 440/739 (60%), Gaps = 36/739 (5%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAI---NEALPETTDASVTNFFQTSAASTGTPHQVAW  2204
             ++ T   S +Q+++L+A+C TF+P +    +   +   A++  F + S A    P +VA 
Sbjct  18    SSYTHGFSSAQIQSLAAICETFVPPLPLDAKFDDKQNSAALDAFHKASGAEPPFPDEVAD  77

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
              + +R +   ++   L+L  +S R+GTLLLCG      ++PF+ +F EI  ++RE+I+  
Sbjct  78    FLMKRGQPKAVSFAKLVLTLVSFRLGTLLLCGWDCCDWKWPFIHKFSEIPVERREKILIK  137

Query  2023  WATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
             W+       +R  F  +K   L +FF+  D+   NP+WKAIGY   +       + +   
Sbjct  138   WSWKVHPLPLRAVFALIKTYCLFIFFSMTDENSGNPAWKAIGYQVDNRQKKAYPQGR---  194

Query  1846  dheddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
                         PL KGII+    ++  F   LT+ G  V +  P    + I+CD V+VG
Sbjct  195   ------------PLQKGIIETMHEDDSTFVQSLTEKGLQVME-DPEHNVYKIKCDVVIVG  241

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV + VLA++G KV+V+EKGNY+A  + + LEGPSM +++  GG L T +  +++
Sbjct  242   SGCGGGVAAAVLASSGQKVVVIEKGNYFAPQDYTSLEGPSMSELYESGGFLTTTNGKIMI  301

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             +AGSTVGGGSA+NWSASIKTP  VLREWC  H +  FGS  Y+ AMD V  ++GV   C 
Sbjct  302   MAGSTVGGGSAINWSASIKTPKNVLREWCVDHKIPFFGSSEYEIAMDAVRKRIGVTENCT  361

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E FQN VLRKGC +LG  V  +P+N   +HYCG C  GC+ G KKGT  TWLVD V  G
Sbjct  362   EEGFQNQVLRKGCEKLGLKVEAVPRNTADNHYCGSCNLGCRTGDKKGTDSTWLVDAVGCG  421

Query  1129  NGAILPECEALQVI-------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
                IL  C+A + I         R K  GV+ T     + +   I++K TV A G+L TP
Sbjct  422   -AVILTACKADKFILVNNNDARRRKKCLGVIATSWNKKLTKKLHIEAKATVSACGSLLTP  480

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFP-DTPGENKKSYEGAIMSAMSTVVLNVNGTG  794
              L+I+SGLKN NIGRNLHLHPV+  WG+FP D  G   K+YEG I+++   VV     T 
Sbjct  481   PLMISSGLKNPNIGRNLHLHPVLVGWGYFPEDASGLKGKTYEGGIITSFHKVV--SEETN  538

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+IQTPAL P   +AL PW SG EFK RM RY R AH+F L RD+GSGE      + Y
Sbjct  539   VHAIIQTPALGPASVAALSPWVSGSEFKERMVRYPRLAHLFTLIRDQGSGEVMEEGKIRY  598

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----E  446
                + D+ENL+ GL ++LRI+ AAGA E+G +   G  +K K  + E  + F+ +     
Sbjct  599   RFSEMDKENLKIGLRQVLRIIIAAGAVEVGTHRSDGQRIKCKGLTEESLQEFLDDVPVVG  658

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
              + S  ++  +  SAHQMGSCR+G   +   V+  G++WE EGLFV D SVLPTA+G+NP
Sbjct  659   GASSKEEYWTMYVSAHQMGSCRIGATQEEGAVDENGQSWEAEGLFVCDASVLPTAIGINP  718

Query  265   MVTIMSVSYCISQSVLEFL  209
             M+TI S SYCIS  + + L
Sbjct  719   MLTIQSTSYCISNKIADLL  737



>ref|XP_002311685.2| alcohol oxidase-related family protein [Populus trichocarpa]
 gb|EEE89052.2| alcohol oxidase-related family protein [Populus trichocarpa]
Length=744

 Score =   540 bits (1391),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 326/747 (44%), Positives = 452/747 (61%), Gaps = 57/747 (8%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETT--------DASVTNFFQTSAASTGTPHQVAWV  2201
             LS ++M++L++LC T LP++    P TT          +V   ++ S + T  P ++A +
Sbjct  23    LSSAEMDSLASLCETILPSLPP--PVTTLDGKQHQPTKAVQALYRASGSQTPMPDEIAEL  80

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             + +R     +  + L+LW LSTR+GT LLCG      ++  +  F  IS  KRE+++  W
Sbjct  81    LRKRGLPEAVFLVRLVLWLLSTRLGTFLLCGSLCFGEKWLCIKNFSSISLDKREKVLQKW  140

Query  2020  ATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAIGYC-GPDPSISekq  1865
                   F R FFTA+       K L + VFF+ V   GDNP+W+AI YC G D +  +  
Sbjct  141   ------FKRRFFTAIRIAFIYVKVLCVFVFFSRVGQNGDNPAWEAIEYCAGTDENPDQVP  194

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIEC  1688
             K++               PL KG+ID N   +    R LT+ G  V +  P      I+C
Sbjct  195   KER---------------PLQKGLIDTNQETDSTLLRSLTEKGLEVTR-DPRRNLCKIKC  238

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             D V+VGSGCGGGV + VLA +G KV VLEKGNY+  T+ S LEGPS+ +++  GGLL + 
Sbjct  239   DVVIVGSGCGGGVAAAVLAASGQKVFVLEKGNYFTATDYSGLEGPSLAQLYESGGLLTSA  298

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             D  ++++AGS VGGGS VNWSASIKTP  VL+EW +   + LFGS  Y  AMDTVC ++G
Sbjct  299   DAGVIIMAGSAVGGGSVVNWSASIKTPNSVLQEWTKNQKIPLFGSSEYLSAMDTVCARIG  358

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V   C+ E FQN VLRKGC  LG PV  +P+N+   HYCG C +GC+ G KKGT  TWLV
Sbjct  359   VTENCKVEGFQNQVLRKGCERLGVPVKTVPRNSSERHYCGSCGYGCRKGEKKGTDRTWLV  418

Query  1147  DLVKSGNGAILPECEALQVIHERNKA--------KGVMFTFQRDGVKQTAVIKSKVTVIA  992
             D V +G   IL  C+A + I E+NK          GV+     + +     I++KVT+ A
Sbjct  419   DAVDNG-AVILTGCKAERFILEKNKGLGKRKKKCLGVIAKIINNNIITRLQIEAKVTISA  477

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVV  815
              GAL TP L+I+SGLKN+NIGRNLHLHPV+ AWG+FP++  E K K Y+G I++A+  VV
Sbjct  478   CGALLTPPLMISSGLKNQNIGRNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVHEVV  537

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                  +   A+++TP L P  FS L PW SG + K RM +Y+RTAH+  + RD GSG+  
Sbjct  538   --AGDSNVRAIVETPGLGPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVT  595

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
             +   ++Y L+ +D +NL+ GL + LRIL AAGA E+G +   G  +K +    E+ E F+
Sbjct  596   TEGRISYYLNASDRDNLKVGLRQALRILVAAGAVEVGTHRSDGQRIKCRGIKIEDLEEFL  655

Query  454   KEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
                 +     SL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP
Sbjct  656   DTVYATGGALSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLP  715

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             +A+GVNPM+TI S +YC+S+ + E L+
Sbjct  716   SAVGVNPMITIQSTAYCLSKKIAESLR  742



>ref|XP_008668721.1| PREDICTED: uncharacterized protein LOC100274574 isoform X1 [Zea 
mays]
 gb|ACR36691.1| unknown [Zea mays]
 tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=783

 Score =   541 bits (1394),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 311/749 (42%), Positives = 439/749 (59%), Gaps = 52/749 (7%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETTDA---------SVTNFFQTSAASTGTPHQ  2213
             T  + P+QME L A+C   +P+    LP   DA          +  F+  SAA +  P +
Sbjct  49    THGMRPAQMEALRAMCGALIPS----LPADADAGRGDPPGGKDLERFYLASAADSTIPDE  104

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++  R     +    ++LW LSTR GTLLLCG+ SL   FP++ RF +++ ++RE  
Sbjct  105   VAELMVTRCIREAVALAWVVLWALSTRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAA  164

Query  2032  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             +  W      F +R  F  +K L   VF+  V++  +NP WKAIGY   +P     +   
Sbjct  165   LRRWNRVRWLFPLRIAFAIVKILCHYVFYAMVNENSENPYWKAIGYSVDEPREDRARTAT  224

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL  G+++  L +++   R L   G +V           ++CDAV
Sbjct  225   PSPSR----------PLDVGVVETRLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAV  274

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + VLA+AGYKV+V+EKG+Y+   + S +EGPSM+++F  GG+  T ++ 
Sbjct  275   IVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVT  334

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
              ++  G+TVGGGSAVNWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++GV  
Sbjct  335   TMIFTGATVGGGSAVNWSASIRTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTD  394

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C++E FQN V+R+GC  LG     +P+N+   H+CG C FGC  G K+GT  TWLVD V
Sbjct  395   GCQEEGFQNKVVRRGCEALGLCADAVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAV  454

Query  1138  KSGNGAILPECEALQVIHERN-----------KAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
               G   IL  C+A   + E+N           K  G++ T   +GV +   I++KV++ A
Sbjct  455   ARG-AVILTGCKAEYFVLEKNHSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAA  513

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMST  821
              GAL TP LL  SGLKN++IG NLHLHPV  AWG+FP+    P  + K YEG I+++M  
Sbjct  514   CGALMTPPLLRRSGLKNRHIGSNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHR  573

Query  820   VVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGE  641
             V           +I+TPAL PG F+A++PW SG++ K RM RY+RTAH FAL RD+G G 
Sbjct  574   VTDRT-------IIETPALGPGAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGF  626

Query  640   AFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFER  461
                   V +   + D + L+ GL ++LRIL AAGA E+G +   GL L+ K    E+ E 
Sbjct  627   VDGEGRVRFTPSREDVDELRNGLRRVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEG  686

Query  460   FVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS  296
             F+ E + +    H       L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS
Sbjct  687   FLDEVTIEKGPMHSRVDKWALHCSAHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGS  746

Query  295   VLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             +LPTA+GVNPM+TI S+++C+S+ + E +
Sbjct  747   LLPTAVGVNPMITIQSIAFCLSKGIAETM  775



>ref|XP_010262397.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X2 [Nelumbo 
nucifera]
Length=757

 Score =   540 bits (1391),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 324/740 (44%), Positives = 450/740 (61%), Gaps = 45/740 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVAW  2204
              S S+M+ ++A+C   +P I          E+ P     S+ +F+  S +    P +VA 
Sbjct  30    FSLSEMQVVTAICEALIPPIPLGSLHVNGKESPP---SKSIQSFYLASGSQKPIPDEVAE  86

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHS  2024
             +I  +     +  + LLLW LSTR+GTLL+CG  S  +++PFL +F E+S +KRE ++  
Sbjct  87    LIVTKALWHGVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEKREEVLKK  146

Query  2023  WATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
             W+ +  Q  +R  F   K      FF+  D+   NP+W AIGY       S K  K++  
Sbjct  147   WSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIGYHVDTYESSHKTDKKR--  204

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
                         PL KGII+ +N  +  +   LT+ G  V +  P      IECD VVVG
Sbjct  205   ------------PLQKGIIETMNESDSTLVQSLTQKGFKVTE-DPKRNLHKIECDVVVVG  251

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV + VLA++G KV+VLEKGNY+A  + S +EGPS+++++  GG+L T D  +++
Sbjct  252   SGCGGGVAASVLASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYESGGMLSTFDGKVMI  311

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             +AGSTVGGGSAVNWSASIKTP  VLREW   H + LFGS  Y  AMD V  + GV   C 
Sbjct  312   MAGSTVGGGSAVNWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMDVVFKRNGVTENCV  371

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
              E  QN VL+KGC  LG  V ++P+N+  +HYCG C FGC+ G K+GT  TWLVD V  G
Sbjct  372   KEGLQNQVLQKGCENLGLKVESVPRNSSENHYCGSCGFGCRRGDKRGTDTTWLVDAVDHG  431

Query  1129  NGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTT  974
                IL  C A + + E+N        K  GVM       + +   I++KVT+ A G+L T
Sbjct  432   -AVILTGCLAKRFMLEKNNHGRTKKKKCLGVMARAYSKNITKELQIEAKVTISACGSLLT  490

Query  973   PSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGT  797
             P L+I+SGLKN NIG+NL LHPV  AWG+FP++ P    K++EG I++++  VV     +
Sbjct  491   PPLMISSGLKNPNIGKNLRLHPVTMAWGYFPESMPKLKGKAFEGGIITSIHKVV--TEKS  548

Query  796   GYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVT  617
                A+I+TPAL P  F +L+PW SG + K RM +YARTAH+FAL RD+GSGE  S   +T
Sbjct  549   DVQAIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEVKSRGMIT  608

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQ  437
             Y+  K+D+ENL+ GL++ LRIL AAGA E+G +   G  +K K    E+ E F++  ++ 
Sbjct  609   YEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEFLETVTTA  668

Query  436   ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
                 S  ++  L +SAHQMGSCRM    K   V+  GE+WE EGL+V DGSVLP A+GVN
Sbjct  669   GGFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVLPNAVGVN  728

Query  268   PMVTIMSVSYCISQSVLEFL  209
             PM+TI S++YC+S+ + + L
Sbjct  729   PMITIQSIAYCLSKKIAKSL  748



>ref|XP_004247745.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Solanum lycopersicum]
Length=741

 Score =   539 bits (1389),  Expect = 7e-177, Method: Compositional matrix adjust.
 Identities = 309/732 (42%), Positives = 440/732 (60%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S S+++TL+++C T LP I     +  +  + NF + S +    P +VA ++ +R    
Sbjct  22    FSSSEIQTLTSICETILPPIPLNSLQKNNKKIQNFHKVSGSQYPIPDEVAEIVMKRGFFE  81

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QF  2000
                 +  LL  LSTRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     
Sbjct  82    ARMLVRSLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTP  141

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K L L +FFT V +  +NP+W  IGY   +   S +   ++           
Sbjct  142   VRLAFVFVKFLCLYIFFTQVGEDSNNPAWDDIGYQVDNEENSSETPDER-----------  190

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KGII+ +   E  +   L + G  V +       + ++CD V+VGSGCGGGV +
Sbjct  191   ---PLQKGIIETIYETESSIVKSLVEKGLKVTE-DTTNNMYKVQCDVVIVGSGCGGGVAA  246

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              VLA++G KV+VLEKGNY+A+++ S LEGPS  +M+  GG+L T D  +++LAGSTVGGG
Sbjct  247   SVLASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGILSTLDGKVMILAGSTVGGG  306

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSA IKTP  V++EW +   + +F +  Y  AMD VC ++ V  +C  E  QN +L
Sbjct  307   SAVNWSACIKTPDSVIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQIL  366

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             RKGC  LG  V  + +N+  DHYCG C +GC+ G KKGT  TWLVD V  G   I+  C+
Sbjct  367   RKGCERLGLEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCG-AVIITGCK  425

Query  1102  ALQVIHER--------NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             A + I E+         K  GV+ T     + ++  I++KVT+ A G+L TP L+I+SGL
Sbjct  426   AERFILEKKKYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMISSGL  485

Query  946   KNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             KN+NIGRNLHLHPV+ AWG+FP++  G   K YEG I++++  V      +   A+I+ P
Sbjct  486   KNRNIGRNLHLHPVIMAWGYFPESNSGLKGKIYEGGIITSVHKV--GSYDSNVRAIIEAP  543

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             AL PG F+AL PW SG++ K R+  Y RTAH+FA+ +D GSGE  S   ++Y  +  D+E
Sbjct  544   ALGPGSFAALCPWTSGEDIKNRLLNYDRTAHLFAMVKDVGSGEVRSEGRISYTFNGMDKE  603

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRKH  422
             +L+ GL + LRIL AAGA E+G     G  +K    S +  E F++     E  +SL K 
Sbjct  604   SLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCTGQSEKALESFLETVTAAEGPKSLVKD  663

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
                 +SAHQMGSCRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+TI S +
Sbjct  664   FTTYSSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTA  723

Query  241   YCISQSVLEFLK  206
             YC+S+ + E +K
Sbjct  724   YCLSKKIAEMIK  735



>gb|KDP40361.1| hypothetical protein JCGZ_02359 [Jatropha curcas]
Length=755

 Score =   539 bits (1388),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 316/737 (43%), Positives = 442/737 (60%), Gaps = 40/737 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALP----ETTDASVTNFFQTSAASTGTPHQVAWVINQR  2189
              S ++M+ LS++C T LP I  ++P          V  FF+ S      P Q+A ++ +R
Sbjct  22    FSSAEMKALSSICETVLPPI--SIPGKGGHEISKPVQAFFKASGFENPVPDQIAELLVKR  79

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
                  L  + L+L  LSTR+GTLLLCG      ++P+L  F  IS  KRE+I+  W  + 
Sbjct  80    AIIEGLILVRLVLLALSTRLGTLLLCGSLCFGEKWPYLNTFSSISLDKREKIMQKWFKNR  139

Query  2008  L-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
                 IR  F  +K   L  FF   D+ G NP+W+AIGY      I+ +  +++       
Sbjct  140   FFTPIRLVFQLIKVGCLYTFFAQADENGKNPAWEAIGYSVDTDEIANQVPQER-------  192

Query  1831  ieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                    PL +GII+ +   E  + + LT+ G  V K  P      I CD  +VGSGCGG
Sbjct  193   -------PLQEGIIETMQENESTLMHNLTQKGLKVTK-DPKKKICKINCDVAIVGSGCGG  244

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLAT+G KVLVLEKGNY+   + S LEGPS D+++  G +L T D +++++AGS 
Sbjct  245   GVAAAVLATSGQKVLVLEKGNYFTAKDYSGLEGPSHDQLYESGAILPTTDANLMIMAGSA  304

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSA+NWSA I TP  +L+EW E H L+LFG+  Y  AM+TVC ++GV R C +E FQ
Sbjct  305   VGGGSAINWSACINTPQSLLQEWSENHKLKLFGTAEYLSAMETVCQRIGVTRNCVEEGFQ  364

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLRKGC  LG  V  +P+N+   HYC  C +GC  G KKGT  TWLVD V  G   IL
Sbjct  365   NQVLRKGCENLGLEVNTVPRNSSEKHYCWSCGYGCPTGDKKGTDTTWLVDAVNHG-AVIL  423

Query  1114  PECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
               C+A + I E NK K         GV+     + +     I++K+T+ A GAL TP L+
Sbjct  424   TGCKAERFILEENKKKGSRRQKKCLGVIAKTLNNNIHLRLQIEAKITIAACGALLTPPLM  483

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGA  785
             I+SGLKN NIG+NLHLHPV+ AWG+FPD+  + K K +EG I++++  V+ N N     A
Sbjct  484   ISSGLKNPNIGQNLHLHPVLMAWGYFPDSNKDLKGKCHEGGIITSVHKVISNDN--NLRA  541

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             +I+TP L P  +  L PW SG + K R+ +Y+RTAH+  + RD+G+G+  +   ++Y+LD
Sbjct  542   IIETPQLGPSAYGVLCPWESGLDIKKRLVKYSRTAHLITIVRDRGAGKVKTEGRISYNLD  601

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQ  437
               D ENL+ GL + LRIL AAGA E+G +   G  L+ +  ++++ E F+          
Sbjct  602   PFDMENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLQCQGITKKDLEEFLDTVFPCRGIL  661

Query  436   SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
             S  K   + +SAHQMGSC+MG++ K   V+  GE+WE EGLFV D SVLP+A+GVNPM+T
Sbjct  662   SPVKDWMIYSSAHQMGSCKMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMIT  721

Query  256   IMSVSYCISQSVLEFLK  206
             I S +YC+S+ + E LK
Sbjct  722   IQSTAYCLSKGIAESLK  738



>ref|XP_006354463.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Solanum 
tuberosum]
Length=741

 Score =   538 bits (1386),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 308/732 (42%), Positives = 439/732 (60%), Gaps = 33/732 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S S++ETL+++C T LP +     +  +  + NF + S +    P +VA ++ +R    
Sbjct  22    FSSSEIETLTSICETILPPLPLNSLQENNKKIQNFHKVSGSQYPIPDEVAEIVMKRAFFE  81

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QF  2000
                 +  LL  LSTRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     
Sbjct  82    ARMLVRGLLRILSTRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTP  141

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K L L +FFT V +   NP+W  IGY   +   S +   ++           
Sbjct  142   VRLAFVFVKFLCLYIFFTQVGEDSKNPAWDDIGYQVDNEENSSETPDER-----------  190

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KGII+ +   E  +   L + G  V +       + ++CD V+VGSGCGGGV +
Sbjct  191   ---PLQKGIIETIYETESTIVKSLVEKGLKVTE-DTKNNMYKVQCDVVIVGSGCGGGVAA  246

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              VLA++G KV+VLEKGNY+A+++ S LEGPS  +M+  GG+  T D  +++LAGSTVGGG
Sbjct  247   SVLASSGQKVVVLEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKVMILAGSTVGGG  306

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSA IKTP  +++EW +   + +F +  Y  AMD VC ++ V  +C  E  QN +L
Sbjct  307   SAVNWSACIKTPDSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQIL  366

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             +KGC  LG  V  + +N+  DHYCG C +GC+ G KKGT  TWLVD V  G   I+  C+
Sbjct  367   QKGCERLGLEVEGVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCG-AVIITGCK  425

Query  1102  ALQVIHER--------NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             A + I E          K  GV+ T     + ++  I++KVT+ A G+L TP L+I+SGL
Sbjct  426   AERFILENKKYGKTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMISSGL  485

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             KN+NIGRNLHLHPV+ AWG+FP++  + K K YEG I++++  V    + +   A+I+ P
Sbjct  486   KNRNIGRNLHLHPVIMAWGYFPESNSDLKGKIYEGGIITSVHKV--GSHDSNVRAIIEAP  543

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
             AL PG F+AL PW SG++ K R+ +Y RTAH+FA+ +D GSGE  S   + Y  + TD+E
Sbjct  544   ALGPGSFAALCPWTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTFNGTDKE  603

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRKH  422
             +L+ GL + LRIL AAGA E+G     G  +K K  S +  E F+      E  +SL K 
Sbjct  604   SLKLGLRQALRILIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKD  663

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
                  SAHQMGSCRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+TI S +
Sbjct  664   FTTYCSAHQMGSCRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTA  723

Query  241   YCISQSVLEFLK  206
             YC+S+ + E +K
Sbjct  724   YCLSKKIAEMIK  735



>ref|XP_006489686.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Citrus 
sinensis]
Length=744

 Score =   538 bits (1386),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 315/748 (42%), Positives = 458/748 (61%), Gaps = 39/748 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGT  2222
             R+ +       LS +++ +L++LC  FLP +    +E   +    ++ +F++ S A    
Sbjct  12    RRSKAEKHNHGLSSAELLSLASLCEVFLPTLPSVSSEGKEDRPSQALESFYKASGAQAPV  71

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72    PDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  2041  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-DPSISek  1868
             E+++  W  + +   +R  F  +K   L VFF+ +D+ G NP+W+AI Y    D  +SE 
Sbjct  132   EKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDYHAENDEDVSEV  191

Query  1867  qkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIE  1691
             Q+++               PL KGI++ +      +   LT+ G  V K       + I+
Sbjct  192   QQER---------------PLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQN-VYKIK  235

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T
Sbjct  236   CDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPT  295

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D  M +LAGSTVGGGSAVNWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++
Sbjct  296   TDASMTILAGSTVGGGSAVNWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERI  355

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C  E FQN VLRKGC+ LG  V  IP+N+  +HYCG C  GCK G KKGT  TWL
Sbjct  356   GVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWL  415

Query  1150  VDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C+A + I E++        K  GV+     + ++    I++K T+ 
Sbjct  416   VDAVNHG-AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATIS  474

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A GAL TP L+I+SGLKN++IG+NLHLHPV+ AWG+FPD+  E K K+YEG I+++   V
Sbjct  475   ACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKV  534

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+I+TP   P  FS L PW SG +FK  M +Y+RTAH+  + RD+GSGE 
Sbjct  535   V--SGDSEVRALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEV  592

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  +++ LD+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  + +E E+F
Sbjct  593   KVEGRISHKLDQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQF  652

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +      E  +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV 
Sbjct  653   LDTVYAAEGPKSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVF  712

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             P+A+GVNPM+TI S +YC+S+ + E L+
Sbjct  713   PSAVGVNPMITIQSTAYCLSKRIAESLR  740



>ref|XP_008804287.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=759

 Score =   538 bits (1386),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 309/753 (41%), Positives = 456/753 (61%), Gaps = 41/753 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAAS  2231
             R+ E    +   SPSQ+++L+A+C  F+P+       ++    +    S+  F+  S + 
Sbjct  19    RRTEKGGHSHGFSPSQIQSLAAMCEAFIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSE  78

Query  2230  TGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  2051
             +  P +VA ++ +R     L  + L+LW L+T++GTL+LC   SL  +FPF+ +F ++  
Sbjct  79    SPIPDEVAELLVKRGMKEALLLVKLVLWLLATKLGTLVLCRSLSLCGRFPFINKFSDMPI  138

Query  2050  KKRERIVHSW-ATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS  1874
             +KRE ++  W    +   +R  F  +K   L +F++  ++  +N SW AIGY  P     
Sbjct  139   EKREEVLKRWNKEKNFVPLRMVFVMVKIFCLYIFYSMTNENSENQSWNAIGYSLPTEEKP  198

Query  1873  ekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
              K + ++              PL KGII+ ++  +  +   LT  G +V++  P    + 
Sbjct  199   PKSQSER--------------PLEKGIIETMDQTDSSLLQSLTMKGLAVSQ-DPNQNLYE  243

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I+CD  +VGSGCGGGV + VLA+AG KV+V+EKGNY+   + + +E PSM++M+  GG+L
Sbjct  244   IKCDVAIVGSGCGGGVAAAVLASAGRKVVVIEKGNYFTSEDYTSIEAPSMNEMYESGGIL  303

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D  ++LLAGSTVGGGSAVNWSA IKTP +VL+EW     L LFGS  Y  AMD VC 
Sbjct  304   STLDGKIMLLAGSTVGGGSAVNWSACIKTPDHVLKEWAGERRLRLFGSTDYLSAMDAVCR  363

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV   C +E FQN VLRKGC  LG  V ++P+N    H+CG C +GC++G K+GT  T
Sbjct  364   RLGVTENCTEEGFQNKVLRKGCENLGLQVDSVPRNTSERHFCGSCCYGCREGDKRGTDTT  423

Query  1156  WLVDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVT  1001
             WLVD V  G   I+  C+A + + + N        K  G++       V +   I++K T
Sbjct  424   WLVDAVNHG-AVIITGCKAERFVFKENEPGKKKTKKCVGLIAKSLSRMVTKKLRIQAKAT  482

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK---KSYEGAIMSA  830
             + A G+L TP L+I+SGL N NIGRNLHLHPVVFAWG+FPD+  ++    +++EG I+++
Sbjct  483   ISACGSLLTPPLMISSGLTNSNIGRNLHLHPVVFAWGYFPDSASDHHHRGRAFEGGIITS  542

Query  829   MSTV-VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDK  653
             +  V  +  + +   A+I+ PA+ P  F++L+PW SGQ+ K RM+RY+RTA +FAL RD+
Sbjct  543   LHKVKAVEDSDSSLRAIIEAPAMGPASFASLVPWVSGQDSKERMARYSRTALLFALVRDR  602

Query  652   GSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE  473
             GSG       V Y  D  D ENL+ GL + LRIL AAGA E+G +   G  +K K    +
Sbjct  603   GSGTVEGEGRVKYRFDALDRENLREGLRRALRILVAAGAVEVGTHRSDGQRMKCKGIEEK  662

Query  472   EFERFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
             + E F+   S+     S R+   L ASAHQ+GSCR+G   +   V+  GE+WE +GLFV 
Sbjct  663   DLEEFLDGISAVGGPMSRRELWTLHASAHQIGSCRIGASEEEGGVDESGESWEAQGLFVC  722

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             D SVLP+A+G+NPM+TI SV+YC+S+ + E LK
Sbjct  723   DASVLPSAVGINPMITIQSVAYCLSKGIAESLK  755



>ref|XP_010466677.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=746

 Score =   538 bits (1385),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 312/756 (41%), Positives = 449/756 (59%), Gaps = 44/756 (6%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTN--------FFQTSAA  2234
             +++    + + ++ ++METL++ C    P +     E + A   N        F+ TSA+
Sbjct  4     QRIAGKFSLRDITAAEMETLASFCEAVFPPVAPPQEELSGAGDNNHRKEALRSFYSTSAS  63

Query  2233  STGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEIS  2054
              T    Q   ++ +R          L+L+ L++R+GTLL+CG   L T++PF+ +F E+S
Sbjct  64    QTPILCQSMELLTKRATMEACLVTRLILFLLASRLGTLLICGTECLVTRWPFVEKFSELS  123

Query  2053  QKKRERIVH-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI  1877
              +KRER++   +    L  IR  F  +K + L  FF+ V  KG+NP+W+AIGY       
Sbjct  124   LEKRERVIQKQFRNWILTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIGY-------  176

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSF  1700
                     + D     E     PL KGI++ +N  E+ +   L + G   A       + 
Sbjct  177   ------HVNLDENKPSETYKARPLEKGIVETMNETEQTLLESLARKGLE-ADHDMDQDTI  229

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              I+CDAVV+GSG GGGV + VLA +G KV+VLEKG+YY  ++    EGP MDK++  GG+
Sbjct  230   RIKCDAVVIGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGI  289

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
             L T D ++++LAG+TVGGGSAVNWSA IKTP  VL+EW E   +  +G+  Y  AMD V 
Sbjct  290   LPTVDGNLMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQKIPFYGTKEYVSAMDVVW  349

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              +MGV  +CE ESFQN +LRKGC  +G  V N+P+N+   HYCG C +GC+ G KKG+ +
Sbjct  350   KRMGVTEKCEMESFQNQILRKGCENIGVNVENVPRNSSEGHYCGSCGYGCRQGDKKGSDQ  409

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSK  1007
             TWLVD V  G   +L  C+A + I E+          K  GVM       + +  +I++K
Sbjct  410   TWLVDAVSHG-AVVLTGCKAERFILEKKGSNVGGKQMKCLGVMAKSLNGNIAKKLIIEAK  468

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAI  839
             VTV AGG+L TP L+I+SGL+N+NIGRNLHLHP + +WG+FP+    +     KSYEG I
Sbjct  469   VTVSAGGSLLTPPLMISSGLRNRNIGRNLHLHPTLMSWGYFPEKKSSSLSFKGKSYEGGI  528

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             ++++S V      +   A+I+T +L PG FS L PW SG + K RM+RY+RTA +  + R
Sbjct  529   ITSVSKVF--SEDSEVRAIIETASLGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVR  586

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+GSGE  +   + Y +DKTD+ N+  GL + LRIL AAGAEE+G +   G  LK K   
Sbjct  587   DRGSGEVKTEGRIRYVVDKTDKGNIIAGLRQSLRILIAAGAEEVGTHRSDGKILKCKGVD  646

Query  478   REEFERFV----KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
                 E F+     EE  + + +  N+  SAHQMGSCR+G + K   ++  GE+WE E LF
Sbjct  647   ENSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDLNGESWEAERLF  706

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT  203
             V D S LP+A+GVNPM+T+MS +YCIS  + + + T
Sbjct  707   VCDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  742



>ref|XP_006420281.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
 gb|ESR33521.1| hypothetical protein CICLE_v10004405mg [Citrus clementina]
Length=744

 Score =   537 bits (1383),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 314/748 (42%), Positives = 459/748 (61%), Gaps = 39/748 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  2222
             R+ +       LS +++  L++LC  FLP +     E   +    ++ +F++ S A    
Sbjct  12    RRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGAQAPV  71

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72    PDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  2041  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISek  1868
             E+++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI Y    D  +SE 
Sbjct  132   EKVLQKWFKNWIFTPVRIAFVTLKIFCLFVFFCQLDENGKNPAWEAIDYHVENDEDVSEV  191

Query  1867  qkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIE  1691
             Q+++               PL KGI++ +   +  + + LT+ G  V K       + I+
Sbjct  192   QQER---------------PLEKGIVETMYETDSTIVHSLTQKGLQVTKDSKQ-KVYKIK  235

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T
Sbjct  236   CDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPT  295

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D +M +LAGST+GGGSA+NWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++
Sbjct  296   TDANMTILAGSTIGGGSAINWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERI  355

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C  E FQN VLRKGC+ LG  V  IP+N+  +HYCG C  GCK G KKGT  TWL
Sbjct  356   GVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWL  415

Query  1150  VDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C+A + I E++        K  GV+     + ++    I++K T+ 
Sbjct  416   VDAVNHG-AVILTGCKAERFIIEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATIS  474

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A GAL TP L+I+SGLKN++IG+NLHLHPV+ AWG+FPD+  E K K+YEG I+++   V
Sbjct  475   ACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKV  534

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+I+TP   P  FS   PW SG +FK  M +Y+RTAH+  + RD+GSGE 
Sbjct  535   V--SADSEVRALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEV  592

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  +++ LD+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  + +E E+F
Sbjct  593   KVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQRLKCEGITEKEVEQF  652

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +      E  +S  ++  + A+AHQMGSCRMGV+ K   V+  G++WE EGL+V D SVL
Sbjct  653   LDTVYAAEGPKSPVENWMVYATAHQMGSCRMGVNEKEGGVDENGQSWEAEGLYVCDASVL  712

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             P+A+GVNPM+TI S +YC+S+ + E L+
Sbjct  713   PSAVGVNPMITIQSTAYCLSKRIAESLR  740



>ref|XP_006589281.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Glycine 
max]
Length=740

 Score =   536 bits (1381),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 322/745 (43%), Positives = 456/745 (61%), Gaps = 43/745 (6%)
 Frame = -3

Query  2377  NNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             N      LS ++ME+LS++C   LP +   L  T   +V +F++ S +    PH++A ++
Sbjct  16    NKYTPHILSSAEMESLSSICEALLPPLQ--LDSTKSKTVQHFWKASGSQFSIPHEIAEIL  73

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R     L  L ++LW LSTR+GTLLLCG   LS ++PF+  F  +S   RE+++  W 
Sbjct  74    IKRALKEALILLRVILWLLSTRLGTLLLCGTLCLSKKWPFINSFSNLSLDNREKVLQKWF  133

Query  2017  TSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
                 L  IR  F  +K L   VFF+  DD G+NP+W+AIGY      I+      +    
Sbjct  134   KHRFLTPIRLVFIYIKVLCFFVFFSQCDDNGENPAWEAIGYQVDSDGITTTSNVHRER--  191

Query  1840  eddieELLFGPLYKGIID------LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                       PL KGI++      L+LP+      L + G  VA       +  I+CD V
Sbjct  192   ----------PLEKGIVEAMKESNLSLPKS-----LIEKGLEVA-IDSKNNTLNIKCDVV  235

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + +LA++G KVLVLEKGNY+   + S LEGPS+++++  GG   ++D  
Sbjct  236   IVGSGCGGGVAASILASSGLKVLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGK  295

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             M +L G+TVGGGSAVNW+ASI+TP +VL EW + H L LF S  Y  AMD VC ++GV  
Sbjct  296   MAILTGTTVGGGSAVNWAASIRTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTD  355

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
             +C +E  QN VLRKGC+ LG PV  +P+N+   HYCG C +GC  G K+GT  TWLVD V
Sbjct  356   KCIEEGLQNQVLRKGCKNLGLPVDYVPRNSSERHYCGSCNYGCTRGEKQGTEVTWLVDAV  415

Query  1138  KSGNGAILPECEALQVIH---------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
               G   IL   +A + I           R K  GVM     + +     +++KVTV A G
Sbjct  416   DHG-AVILTGTKAERFILGKKNKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACG  474

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLN  809
             AL TP L+I+SGLKNK+IG+NLHLHPV+ +WG+FPD+  E K K YEG I++++  VV +
Sbjct  475   ALFTPPLMISSGLKNKHIGKNLHLHPVLMSWGYFPDSNSELKGKCYEGGIITSVHKVV-S  533

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
              + +   A+++TPAL PG  S L+PW SG +FK RM +Y+RT H+  + RD G GE  S 
Sbjct  534   EDYSKVKAIVETPALGPGALSTLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSE  593

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               V Y+LD++D+EN++ G+++ LRIL AAGA E+G +   G  ++    + +E ERFV+ 
Sbjct  594   GRVHYELDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGHRIECNGKNEKELERFVES  653

Query  448   -ESSQSLRKHP---NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
               +++ L  H    ++ +SAHQMGSCRMG+  K   V+  G +WE EGLFV D S+LPTA
Sbjct  654   VYATEGLMSHEEKWSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTA  713

Query  280   LGVNPMVTIMSVSYCISQSVLEFLK  206
             +GVNPM+TI S +YC+++ +  FLK
Sbjct  714   IGVNPMITIQSTAYCVAKRIAAFLK  738



>ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=744

 Score =   536 bits (1381),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 315/744 (42%), Positives = 453/744 (61%), Gaps = 51/744 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-NEALPET----TDASVTNFFQTSAASTGTPHQVAWVINQ  2192
              S + ME L+++C   LP I +E L +     T+ ++  F++ S +    PHQVA ++ +
Sbjct  24    FSSANMEALASMCEALLPPIESEYLDKKGMKPTNKAIHLFWKLSGSHLSVPHQVAEMLVE  83

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R     L  + ++L  LSTR+GTLLLCG   L+ ++PF+  F  IS + RE+++  W   
Sbjct  84    RALPEALTLIRVILSMLSTRLGTLLLCGSLCLNKKWPFINNFSNISLENREKVIQKWLKH  143

Query  2011  S-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdhe  1838
               L  +R  F  +K L L+VFF+  ++ G+N +W+AIGY    D + S   K++      
Sbjct  144   RFLTPVRLVFIYIKVLCLIVFFSRCNENGENQAWEAIGYEVESDENTSNDHKER------  197

Query  1837  ddieELLFGPLYKGIID------LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                      PL KGI++      L+LP+      L++ G  + +         ++CD V+
Sbjct  198   ---------PLEKGIVEAMNEDNLSLPQS-----LSQKGLEI-EIDAKNNILKVKCDVVI  242

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSGCGGGV + VLA +G KVLVLEKGNY+ + + S LEGPS+++++  GG   + D ++
Sbjct  243   VGSGCGGGVAAAVLAKSGLKVLVLEKGNYFTQNDYSSLEGPSLNELYELGGTFASCDGNI  302

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
              +LAGSTVGGGSAVNWSASI+TP YVL+EW E H L LF S  Y  AMD VC ++GV   
Sbjct  303   AILAGSTVGGGSAVNWSASIRTPDYVLKEWSENHKLPLFSSHEYVSAMDMVCKRIGVTDT  362

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             C +E  QN VLRKGC +LG  V  +P+N+   HYCG C +GC+ G K+GT  TWL D V 
Sbjct  363   CVEEGLQNQVLRKGCEKLGLQVDYVPRNSSQHHYCGSCNYGCRKGEKQGTDVTWLADAVD  422

Query  1135  SGNGAILPECEALQVIH--------ERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
              G   IL  C+A + I          R K  G+M  F  + +     +++K T+ + GAL
Sbjct  423   DG-AVILTRCKAKKFILVDNKEGCVRRKKCLGLMANFLTENITWRLQVEAKATISSCGAL  481

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVN  803
             +TP L+I+SGLKNKNIG NLHLHPV+  WG+FPD+  + K +SYEG I++++  V+   +
Sbjct  482   STPPLMISSGLKNKNIGNNLHLHPVLMTWGYFPDSISDLKGRSYEGGIITSIHKVL--SD  539

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
              +   A+I+TPAL PG FS L PW SG  FK RM RY+R  H   + +DK  GE  S   
Sbjct  540   DSKVKAIIETPALAPGTFSTLFPWESGFGFKERMLRYSRMVHFITIIQDKSCGEVKSEGR  599

Query  622   VTYDLDKT-DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEE  446
             + Y+LD+  D+EN++ GL++ LRIL AAGA E+G +   G  +    ++ +E  +FV+  
Sbjct  600   IKYELDEEFDKENIKDGLQQALRILIAAGAVEVGTHRSDGQRIACSGSNEKELNKFVESV  659

Query  445   SS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
              +     S  ++ ++ ASAHQMGSCR+GV  K   V+  G++WE EGLFV D S+LPTA+
Sbjct  660   YATGGPMSHGENWSIYASAHQMGSCRVGVTEKEGAVDENGQSWEAEGLFVCDSSLLPTAI  719

Query  277   GVNPMVTIMSVSYCISQSVLEFLK  206
             GVNPM+TI SV+YCI+  +   L+
Sbjct  720   GVNPMITIQSVAYCIANRIAVILR  743



>gb|KDO60414.1| hypothetical protein CISIN_1g004496mg [Citrus sinensis]
Length=748

 Score =   536 bits (1381),  Expect = 9e-176, Method: Compositional matrix adjust.
 Identities = 324/735 (44%), Positives = 439/735 (60%), Gaps = 43/735 (6%)
 Frame = -3

Query  2344  QMETLSALCNTFLPAINEALPETT------DASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             ++E+L+A+C T +P +    PET       + ++ +F++ SA+    PH+VA ++ +R +
Sbjct  27    EIESLAAICQTLVPPLP---PETITKQHSHNQAIVSFYKASASQHPIPHEVAELMVKRGQ  83

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  2006
                +    L+L  LS R+GTLLLCG       +PF+  F EIS +KRE+I+  W+    L
Sbjct  84    PQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKKWSRERYL  143

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K   L  FF   D+K +NP+W+AIGY       S K + ++         
Sbjct  144   LPLRIVFVMIKMFCLFDFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER---------  194

Query  1825  ELLFGPLYKGIIDL---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                  PL KGI++    N  +  +F RL   G  V         F I+CD VVVGSGCGG
Sbjct  195   -----PLQKGIVETVHENENDHSLFQRLVDHGLQVTVDHEHN-LFEIKCDVVVVGSGCGG  248

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA++G KVLVLEKGNY+   + S LEGPSM +++  GGLL T D   ++ AGS 
Sbjct  249   GVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMHELYESGGLLSTLDGKFMVFAGSA  308

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSA I+TP  VLR+W   H + LFGS  Y+ AMD V  ++GV   C +E FQ
Sbjct  309   VGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTEHCTEEGFQ  368

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLRKGC  LG+ V ++ +N P +HYCG C +GC+ G KKGT  TWLVD V +G   IL
Sbjct  369   NQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGDKKGTDVTWLVDAVDNG-AVIL  427

Query  1114  PECEALQVIHERNKAK-------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
                +A + I   NK         GV  T     V +   IK+K T+ A G+L TP L+I+
Sbjct  428   AGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQIKAKATISACGSLLTPPLMIS  487

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGL+N NIG NLHLHPV+ AWG+ PD   E K K++EG I++++  VV     +   A+I
Sbjct  488   SGLENPNIGTNLHLHPVLLAWGYIPDHVSELKGKTFEGGIITSIHKVV--SEDSKVQAII  545

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             ++PA+ P  F+A  PW SG+E K RM RY R A +FAL RD+GSGE      + Y L K 
Sbjct  546   ESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKYRLSKN  605

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQSL  431
             D+ENL+ GL + LRIL AAGAEE+G     G  ++ K    E+ E F+          S 
Sbjct  606   DKENLKTGLRQALRILIAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGMASR  665

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              +H ++  SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+G+NPM+TI 
Sbjct  666   GEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMITIE  725

Query  250   SVSYCISQSVLEFLK  206
             S SYCIS+ + + LK
Sbjct  726   STSYCISKKIADSLK  740



>ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
 gb|KHN27785.1| Long-chain-alcohol oxidase FAO1 [Glycine soja]
Length=751

 Score =   536 bits (1382),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 320/744 (43%), Positives = 454/744 (61%), Gaps = 44/744 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAASTGTPHQVA  2207
              S ++ME+L+++C   LP +          ++     +  S+ +F+  SA+    PH+VA
Sbjct  23    FSAAEMESLASICEVVLPPLPMDALKIRKEDQIDDYDSSKSLKSFWDISASRYPIPHEVA  82

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              ++ +R     +  + ++LW L+TR+GTLLLCG   L  ++P++  F  IS +KRE ++ 
Sbjct  83    EMLTKRSLIEAVILIRVVLWLLATRLGTLLLCGFLCLGEKWPYVNNFSNISLEKREMVMQ  142

Query  2026  SWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-DPSISekqkkqk  1853
              W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIGY  P D +++   K + 
Sbjct  143   KWLKHRFLTPIRLAFAYIKVLCLFVFFSWVDENGDNPAWKAIGYEVPADENLTNASKTR-  201

Query  1852  hhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                           PL KGII+ +N  +  +   L   G +V           ++CDA+V
Sbjct  202   --------------PLEKGIIETMNESDSALQQSLANKGLNVTLDSKSNI-LKVKCDALV  246

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSGCGGGV + VL++AGYKV+VLEKGNY++  + S LEGPSM++++  GG+L + D  +
Sbjct  247   VGSGCGGGVAAAVLSSAGYKVVVLEKGNYFSTQDYSSLEGPSMNQLYETGGILASVDSRV  306

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             ++LAGSTVGGGSAVNWSA IKTP  VL EW E H L  F S  Y  AM+TVC ++GV   
Sbjct  307   LVLAGSTVGGGSAVNWSACIKTPHKVLNEWSENHKLPFFSSQEYLSAMETVCERIGVTEN  366

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             C  E FQN VLRKGC+ LG  V  +P+N+  +HYCG C +GC  G K+GT  TWLVD V+
Sbjct  367   CTQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCGSCGYGCPKGEKQGTQATWLVDAVE  426

Query  1135  SGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
               +  I+  C+A + + E N        K  GVM       V     I++KVT+ AGGAL
Sbjct  427   R-DAVIITGCKAERFLLESNRSGNGRKKKCLGVMAKALNSRVTMKLQIEAKVTISAGGAL  485

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--NKKSYEGAIMSAMSTVVLNV  806
              TP LLI+SGLKNKNIG+NLHLHPV+  WG+FP++       K YEG I++++  V    
Sbjct  486   LTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGKVYEGGIITSVHKVPSTD  545

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
             + +   A+I+TP+L P  F+AL PW SG +FK RM  Y RT+H+  + RD   G+  +  
Sbjct  546   SNSDSRAIIETPSLGPASFAALCPWESGLDFKERMLNYPRTSHLITIIRDMACGQVSTEG  605

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE-  449
              ++Y L++ D+EN++ GL++ L+IL AAGA E+G +   G  LK       E + F+   
Sbjct  606   RISYKLNEIDKENMKAGLKQALKILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSV  665

Query  448   ---ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
                E + S  ++ N+ +SAHQMGSCRMGV+ K   V+  GETWE EGLFV D SVLP+A+
Sbjct  666   CPMEGALSPGEYWNIYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPSAV  725

Query  277   GVNPMVTIMSVSYCISQSVLEFLK  206
             GVNPM+T+ S +YCIS  + ++L+
Sbjct  726   GVNPMITVQSTAYCISNRIADYLR  749



>ref|XP_006420282.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
 gb|ESR33522.1| hypothetical protein CICLE_v10004403mg [Citrus clementina]
Length=744

 Score =   536 bits (1381),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 313/748 (42%), Positives = 457/748 (61%), Gaps = 39/748 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  2222
             R+ +       LS +++ +L++LC  FLP ++    E   +    ++ +F++ S A    
Sbjct  12    RRSKAEKHNHGLSSAELLSLASLCEVFLPTLSSVSSEGKEDRPSQALESFYKASGAQAPV  71

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72    PDKVAEIVVKRLLTEAVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  2041  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISek  1868
             E+++  W  + +   +R  F  +K   L VFF  +D+ G NP+W+AI Y    D  +SE 
Sbjct  132   EKVLQKWFKNWIFTPVRIAFFILKTFCLFVFFCQLDENGKNPAWEAIDYHVENDEDVSEV  191

Query  1867  qkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIE  1691
             Q+++               PL KGI++ +   +  +   LT+ G  V K       + I+
Sbjct  192   QQER---------------PLEKGIVETMYETDSTIVQSLTQKGLQVTKDSKQN-VYKIK  235

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T
Sbjct  236   CDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPT  295

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D  M +LAGSTVGGGSAVNWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++
Sbjct  296   TDASMTILAGSTVGGGSAVNWSACIKTPKSLLQEWAGDYKLPLFGSPDYLSAMDIVWERI  355

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C  E FQN VL+KGC+ LG  V  IP+N+  +HYCG C  GCK G KKGT  TWL
Sbjct  356   GVTENCVQEGFQNQVLQKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWL  415

Query  1150  VDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C+A + I E++        K  GV+     + ++    I++K T+ 
Sbjct  416   VDAVNHG-AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATIS  474

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A GAL TP L+I+SGLKN++IG+NLHLHPV+ AWG+FPD+  E K K+YEG I+++   V
Sbjct  475   ACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKV  534

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+I+TP   P  FS   PW SG +FK  M +Y+RTAH+  + RD+GSGE 
Sbjct  535   V--SADSEVRALIETPEFSPAKFSVFCPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEV  592

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  +++ LD+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  + +E E+F
Sbjct  593   KVEGRISHKLDQLDKENLKAGLRQALRILIAAGAVEVGTHRSDGQQLKCEGITEKEVEQF  652

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +      E  +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV 
Sbjct  653   LDTVYAAEGPKSPVENWMVYGTAHQMGSCRMGVNEKEGAVDENGQSWEAEGLYVCDASVF  712

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             P+A+GVNPM+TI S +YC+S+ + E L+
Sbjct  713   PSAVGVNPMITIQSTAYCLSKRIAESLR  740



>ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName: Full=Long-chain 
fatty alcohol oxidase 3 [Arabidopsis thaliana]
 gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
Length=746

 Score =   536 bits (1380),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 313/747 (42%), Positives = 450/747 (60%), Gaps = 48/747 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN--------EALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             ++ ++ME+L++ C   LP++         E        ++ +F+ TS + T    Q   +
Sbjct  15    ITVAEMESLASFCEAVLPSVQPPPEELSGEGDNHRNKEALRSFYSTSGSKTPVLRQSIEL  74

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-S  2024
             + +R       +  L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++   
Sbjct  75    VTKRGTIEAYIATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQ  134

Query  2023  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhh  1847
             +    L  IR  F  +K   L  FF+ V+  G+NP+W+AIGY   PD +   +   ++  
Sbjct  135   FKNWILTPIRAAFVYIKVAFLFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNER--  192

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
                         PL KGI++ +   E+ +   L   G   A       +  I+CD VVVG
Sbjct  193   ------------PLEKGIVETMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVG  239

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GGGV + VLA +G KV+VLEKG+Y+  +     EGP +DK++  GG+L + D   ++
Sbjct  240   SGSGGGVAASVLAKSGLKVVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMV  299

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAG+TVGGGSAVNWSA IKTP  VL+EW E   + LFG+  Y  AM+ V  +MGV  +CE
Sbjct  300   LAGATVGGGSAVNWSACIKTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCE  359

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
              ESFQN +LRKGC  LG+ V N+P+N+   HYCG C +GC+ G KKG+  TWLVD V  G
Sbjct  360   LESFQNQILRKGCENLGFNVENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAV--G  417

Query  1129  NGA-ILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
             +GA IL  C+A + I E+N         K  GVM       + +   I++KVTV AGGAL
Sbjct  418   HGAVILTGCKAERFILEKNGSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGAL  477

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVL  812
              TP L+I+SGL+N+NIG+NLHLHPV+ AWG+FPD    N      SYEG I++++S V+ 
Sbjct  478   LTPPLMISSGLRNRNIGKNLHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVSKVL-  536

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
                 +   A+I+TP L PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +
Sbjct  537   -SEDSEVRAIIETPQLGPGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKT  595

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK  452
                + Y +DKTD +NL+ GL + LRIL AAGAEE+G +   G  L  K  +    + F+ 
Sbjct  596   EGRINYTVDKTDRDNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLD  655

Query  451   ----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT  284
                 EE ++ + +  N+ +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+
Sbjct  656   SVSTEEGAKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPS  715

Query  283   ALGVNPMVTIMSVSYCISQSVLEFLKT  203
             A+GVNPM+T+MS +YCIS  + + + T
Sbjct  716   AVGVNPMITVMSTAYCISTRIAKSMTT  742



>gb|KHG17178.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=746

 Score =   535 bits (1379),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 304/737 (41%), Positives = 458/737 (62%), Gaps = 39/737 (5%)
 Frame = -3

Query  2347  SQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             ++++TL+++   F P++      +        +V +F + SA+    P +VA ++ +R  
Sbjct  27    AEIQTLASVAEVFFPSLPPDSWFQGKDTQPSKAVQSFLKASASQPPFPDEVAELLGKRAF  86

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
                +  + ++L  L TR+G+LLLCG+  L  ++P +  F  +  +KRE+++ +W      
Sbjct  87    IESVIVVRIVLMLLWTRVGSLLLCGRQCLGKEWPIINDFGSMGLEKREKVMQNWLKHGFL  146

Query  2002  F--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
             F  IR  F  +K   L V+F+ V + G+NP+W+AIGY     ++ + + + +        
Sbjct  147   FTPIRAAFIYLKVFCLFVYFSRVGEDGENPAWEAIGY-----NVDKVEDQPQARKER---  198

Query  1828  eELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcggg  1652
                   PL KG+I+ ++  +  ++  L++ G  V +       + I+CDAV++GSGCGGG
Sbjct  199   ------PLQKGMIETVHEKDSTLYRSLSQKGLLVTEDTQQN-VYRIKCDAVIIGSGCGGG  251

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V + +LA +G KV+V+EKGNY+  T+ S  EGPSMDK++  GG+L + D  +++LAGSTV
Sbjct  252   VAAAMLAGSGLKVVVVEKGNYFTSTDYSPFEGPSMDKLYESGGILPSLDGQLLILAGSTV  311

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGSAVNWSA IKTP  VL+EW E   + LFGS+ Y  AM+TVC ++GV  +C++E FQN
Sbjct  312   GGGSAVNWSACIKTPKSVLKEWAEDCKIPLFGSNEYVSAMETVCERIGVTHDCKEEGFQN  371

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
              VLRKGC  LG  V  +P+N+   HYCG C FGC+ G KKGT  TWLVD V + N  I+ 
Sbjct  372   QVLRKGCENLGVKVEKVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDAVNN-NAVIIT  430

Query  1111  ECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              C+A + I ERN        K  GV+       + +   I++KVT+ A GAL TP L+ +
Sbjct  431   GCKADRFILERNNVGSVRKLKCLGVIAKPSNQNITKELHIEAKVTISACGALLTPLLMHS  490

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGLKN+NIG+NLHLHPV+ AWG+FP++  + K K+YEG I++++  VV N N     A+I
Sbjct  491   SGLKNRNIGQNLHLHPVLMAWGYFPNSDSKFKGKAYEGGIITSVHKVVGNDNKV--QAII  548

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +TP+L P  +SA+ PW SG + K RM +++RTAH+  + RD+GSG+  +   VTY  ++ 
Sbjct  549   ETPSLGPAQYSAVCPWVSGLDMKARMLKFSRTAHMITIIRDQGSGKVHAGGRVTYKFEEV  608

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES--SQSLRK  425
             D +NL+ GL + LRIL AAGA E+G +   G  ++ K  S EE + F+   S  +  L  
Sbjct  609   DRQNLRAGLRQSLRILVAAGAVEVGTHRSDGQRIRCKGISNEELDEFLDSVSMLTSPLCT  668

Query  424   HPN--LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
               N  +  +AHQMGSCRMG++ K   V+  GE+WE EGLFV D S+LP+A+GVNPM+T+ 
Sbjct  669   GENWVVHTTAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASILPSAVGVNPMITVQ  728

Query  250   SVSYCISQSVLEFLKTH  200
             S +YC+S+ + E L+  
Sbjct  729   STAYCLSKKIAESLRQQ  745



>ref|XP_006489687.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Citrus 
sinensis]
Length=744

 Score =   535 bits (1378),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 315/750 (42%), Positives = 456/750 (61%), Gaps = 39/750 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAIN----EALPETTDASVTNFFQTSAASTGT  2222
             R+ +       LS +++  L++LC  FLP +     E   +    ++ +F++ S A    
Sbjct  12    RRSKAEKYNHGLSSAELLALASLCEVFLPPLPSVSLEGKEDRPGQALESFYKASGAQAPV  71

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA ++ +R+    +  + ++L  LST++GTL+LCG   LS ++P++  F  +S +KR
Sbjct  72    PDKVAEIVVKRLLTEGVILIRVVLLMLSTKLGTLMLCGSLCLSEKWPYINNFSSMSLEKR  131

Query  2041  ERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-DPSISek  1868
             E+++  W  + +   +R  F  +K   L VFF+ +D+ G NP+W+AI Y    D  +SE 
Sbjct  132   EKVLQKWFKNWIFTPVRIAFFILKIFCLFVFFSQLDENGKNPAWEAIDYHAENDEDVSEV  191

Query  1867  qkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIE  1691
             Q+++               PL KGI++ +      +   LT+ G  V K       + I+
Sbjct  192   QQER---------------PLEKGIVETMYETGSTIVQSLTQKGLQVTKDSKQN-VYKIK  235

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD V+VGSGCGGGV + VLA+AG KV+V+EKGNY+   + SLLEGPS ++++  GG+L T
Sbjct  236   CDVVIVGSGCGGGVAAAVLASAGQKVVVIEKGNYFTPKDYSLLEGPSFEQLYESGGILPT  295

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D  M +LAGSTVGGGSAVNWSA IKTP  +L+EW   + L LFGS  Y  AMD V  ++
Sbjct  296   TDASMTILAGSTVGGGSAVNWSACIKTPKSLLQEWAGQYKLPLFGSPDYLSAMDIVWERI  355

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C  E FQN VLRKGC+ LG  V  IP+N+  +HYCG C  GCK G KKGT  TWL
Sbjct  356   GVTENCVQEGFQNQVLRKGCKNLGLDVERIPRNSSENHYCGSCGHGCKSGDKKGTDSTWL  415

Query  1150  VDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C+A + I E++        K  GV+     + ++    I++K T+ 
Sbjct  416   VDAVNHG-AVILTGCKAERFILEKSDNGSTRTMKCSGVIAKALNNDIRMKFQIETKATIS  474

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A GAL TP L+I+SGLKN++IG+NLHLHPV+ AWG+FPD+  E K K+YEG I+++   V
Sbjct  475   ACGALLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPDSNLEFKGKNYEGGIITSAHKV  534

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+I+TP   P  FS L PW SG +FK  M +Y+RTAH+  + RD+GSGE 
Sbjct  535   V--SGDSEVRALIETPEFSPAKFSVLWPWLSGIDFKQTMLKYSRTAHLITIIRDRGSGEV  592

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  +++ LD+ D+ENL+ GL + LRIL AAGA E+G +   G  LK +  + +E E+F
Sbjct  593   KVEGRISHKLDQLDKENLKAGLRQALRILLAAGAVEVGTHRSDGQRLKCEGITEKEVEQF  652

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +      E  +S  ++  +  +AHQMGSCRMGV+ K   V+  G++WE EGL+V D SV 
Sbjct  653   LDTVYAAEGPKSSVENWMVYGTAHQMGSCRMGVNDKEGAVDENGQSWEAEGLYVCDASVF  712

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             P+A+GVNPM+TI S +YC+S+ + E L+  
Sbjct  713   PSAVGVNPMITIQSTAYCLSKRIAESLREQ  742



>ref|XP_007200494.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
 gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
Length=754

 Score =   535 bits (1379),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 319/744 (43%), Positives = 446/744 (60%), Gaps = 47/744 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPHQ  2213
              SP+Q+++L+A+C   +P ++            E  P+  D ++ + ++ S +    P +
Sbjct  25    FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPD--DQALHSIYRASGSQPPIPDE  82

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++ +R     +  + L L  LS R+GTLLLCG   LS ++PF+  F E+S +KRE +
Sbjct  83    VAELMLKRALPEVMEGMKLFLKMLSFRLGTLLLCGHRCLSWKWPFIHSFSEMSLEKREEV  142

Query  2032  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             +  W+   L   +R  F  +K      FF+ +D+   NP+WKA+GY   D + ++K  K 
Sbjct  143   LKKWSKEKLVLTLRLMFLVVKIFCFYTFFSRLDENSRNPAWKAVGY---DLNTNKKLIKT  199

Query  1855  khhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL +GII+ LN  +      LTK G  V+          I+CD V
Sbjct  200   PKER-----------PLEQGIIETLNESDSTFVQSLTKRGLQVSDDTTHNI-HKIKCDVV  247

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + VLA +G KV+V+EKGNY+   + S LEGPSM++++  GG++ + D  
Sbjct  248   IVGSGCGGGVAAAVLAQSGQKVMVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSVDGM  307

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             +++LAGSTVGGGSA+NWSASI+TP  VL EW   H + L+ S  Y+ AMD VC ++ V  
Sbjct  308   IMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVPLYASSDYKYAMDVVCKRISVTD  367

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C +E+FQN +LRKGC  LG  V  +P+N+P DHYCG C +GC  G K+GT  TWLVD V
Sbjct  368   SCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSCNYGCPTGEKQGTDSTWLVDAV  427

Query  1138  KSGNGAILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGA  983
             K G   IL  C+A + I E        R +  GV  T     +K+   I++KVT+ A G+
Sbjct  428   KCG-AVILTGCKAEKFILENDSQGGGTRKRCLGVEATSLSKNMKKKLQIEAKVTISACGS  486

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNV  806
             L TP L+I+SGLKN NIGRNLHLHPV+ +WG+FP+   E + ++YEG I++++  VV + 
Sbjct  487   LLTPPLMISSGLKNPNIGRNLHLHPVLLSWGYFPEHESEFRGRTYEGGIITSLHKVVSDT  546

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
               T   A+I+TPAL P  F+ L PW S  + K RM +YARTAH+FAL RDKGSG      
Sbjct  547   --TNVRAIIETPALGPASFATLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----  458
              + Y LD+ D+ENLQ GL + LRIL AAGA E+G     G  +K K    E+ E F    
Sbjct  605   RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDSV  664

Query  457   VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
             V      S  +     +SAHQMGSCRM    +   V+  GE+WE +GLFV DGS+LPTA+
Sbjct  665   VAAAGPSSREELWTTYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  277   GVNPMVTIMSVSYCISQSVLEFLK  206
             GVNPM+TI S +YCIS+ + E L+
Sbjct  725   GVNPMITIQSTAYCISKKIAESLE  748



>gb|KFK39637.1| hypothetical protein AALP_AA3G269600 [Arabis alpina]
Length=744

 Score =   535 bits (1377),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 317/747 (42%), Positives = 449/747 (60%), Gaps = 54/747 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--------NEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
              + ++ME+L++ C   LP +         E        S+ +F+ TS + T    Q   +
Sbjct  15    FTATEMESLASFCEAVLPPVPPPPEELSGEDDHHRKKESLRSFYSTSGSQTPILRQTIEL  74

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-S  2024
             I +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S ++RER++   
Sbjct  75    IVKRGTIEAYLMSRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLERRERVIQKQ  134

Query  2023  WATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC----GPDPSISekqkkq  1856
             +    L   R  F  +K+  L  FF+ V   G+NP+W+AIGYC       PS + K++  
Sbjct  135   FKNWLLTPFRAAFVYLKSAFLFCFFSRVSSNGENPAWEAIGYCVNLEENKPSETHKER--  192

Query  1855  khhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL KG+++ +    + +   L + G  V        +  I+CDAV
Sbjct  193   ---------------PLEKGMVETMKETNQTLLESLAQKGLEVDHDTD---AIRIKCDAV  234

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSG GGGV + VLA +G KV+V+EKG+Y+   + +  EGPS++KM+  GG+L + D +
Sbjct  235   IVGSGSGGGVAASVLAKSGLKVVVMEKGSYFTPLDYTPFEGPSVEKMYENGGVLPSLDGN  294

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
              ++LAG+TVGGGSAVNWSA IKTP  VL+EW E   + LF +  Y  AM+ VC ++GV  
Sbjct  295   FMVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQKIPLFATKEYVSAMELVCKRIGVTE  354

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
             +CE ESFQN +LRKGC  LG  V N+P+N+   HYCG C  GC+ G KKG+  TWLVD V
Sbjct  355   KCETESFQNQILRKGCENLGINVENVPRNSSERHYCGSCGHGCRQGDKKGSDRTWLVDAV  414

Query  1138  KSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
               G   IL  C+A + I E+N         K  GVM       + +   I++KVTV A G
Sbjct  415   SHG-AVILTGCKAERFILEKNNNRVGGKKMKCLGVMAKSLNGNITKKIKIEAKVTVSAAG  473

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK----KSYEGAIMSAMSTV  818
             +L TP L+I+SGLKN++IG+NLHLHPV+ AWG+FP+    N     KSYEG I++++S V
Sbjct  474   SLLTPPLMISSGLKNQHIGKNLHLHPVLMAWGYFPEKESSNYDFKGKSYEGGIITSVSKV  533

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             +     +   A+I+TPAL P  FSAL PW SG + K RMSRY+RTA++  + RD GSGE 
Sbjct  534   L--SEDSEVRAIIETPALGPASFSALCPWTSGLDMKRRMSRYSRTANLITIVRDCGSGEV  591

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
              +   + Y +DKTD ENL+ GL + LRIL AAGAEE+G N   G  L  K    +  E F
Sbjct  592   KTEGRIRYTVDKTDRENLKAGLRQSLRILIAAGAEEVGTNTSDGQRLICKGVDEKSIEEF  651

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +     EE  +S+ ++ N+ +SAHQMGSCR+G D K   ++  GE+WE E LFV DGSVL
Sbjct  652   LDSVNAEEGPKSMTENWNVYSSAHQMGSCRIGEDEKEGALDLNGESWEAEKLFVCDGSVL  711

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFL  209
             P+A+GVNPM+TIMS +YCIS  + + +
Sbjct  712   PSAIGVNPMITIMSTAYCISTRITQSM  738



>ref|XP_007035183.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035184.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 ref|XP_007035185.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
Length=750

 Score =   535 bits (1377),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 318/737 (43%), Positives = 455/737 (62%), Gaps = 38/737 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-----EALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
             LS ++++TL+++     P++      E        +V +F + SA+ +  P +VA ++ +
Sbjct  27    LSSAEVQTLASIGEAVFPSLKPNSDFEGKQNQPRKAVQSFLEASASESPIPDEVAQLLVK  86

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R        L ++L  LSTR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S
Sbjct  87    RTFMETRILLRVVLLLLSTRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKS  146

Query  2011  SL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
              L   +R  F  +K   L VFF+ V +  DNP+W+AIGY   +   S++  K++      
Sbjct  147   WLFTLVRIAFIYLKVACLYVFFSRVGENNDNPAWEAIGYQVDNVENSKQVSKER------  200

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KG+I+ ++  +  +   LT+ G  V +       + I+CDAV+VGSGCG
Sbjct  201   --------PLQKGMIETMHEKDSTLLQSLTQKGLQVTEDTERN-VYKIKCDAVIVGSGCG  251

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV + +LA++G KV+VLEKG+Y+A ++ S  EGPSMD+++  GG+L + D  M++LAGS
Sbjct  252   GGVAAAILASSGLKVVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGS  311

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             TVGGGSA+NWSASIKTP  +L+EW E   L LFGS  Y  AMD VC ++GV   C++E F
Sbjct  312   TVGGGSAINWSASIKTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGF  371

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN +LRKGC+ LG  V N+P+N+   HYCG C FGC+ G KKGT  TWLVD V +G   I
Sbjct  372   QNQILRKGCKNLGLEVENVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNG-AVI  430

Query  1117  LPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             L  C+A + I E+N        K  GV+       + +   I++KVT+ A GAL TP L+
Sbjct  431   LTGCKAEKFILEKNKICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLM  490

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGA  785
              +SGLKN+NIGRNLHLHPV+ AWG+FPD+  E K K YEG I++++  VV   N     A
Sbjct  491   HSSGLKNRNIGRNLHLHPVLMAWGYFPDSDSEFKGKVYEGGIITSVHKVVAADNKV--RA  548

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             +I+TP+L P  ++AL PW SG + K RM  ++RTAH+  + RD+GSG+  +   VTY  D
Sbjct  549   IIETPSLGPAQYAALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKFD  608

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRK  425
               D +N+Q GL + LRIL AAGA E+G +   G +++ K  S +E E F++  S      
Sbjct  609   ALDRQNMQSGLRQALRILVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPM  668

Query  424   HPNLK----ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
              P  K     SAHQMGSCRMG++ K   V+  GE+WE EGLFV D SVLP A+GVNPM+T
Sbjct  669   FPAEKWVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMIT  728

Query  256   IMSVSYCISQSVLEFLK  206
             + S +YC+S+ + E L+
Sbjct  729   VQSTAYCLSKRIAESLR  745



>ref|XP_009764096.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Nicotiana sylvestris]
Length=733

 Score =   533 bits (1374),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 305/730 (42%), Positives = 448/730 (61%), Gaps = 40/730 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S SQ++T+++ C T +P      P     S   FF +S +    P++VA ++ +R K  
Sbjct  19    FSSSQIQTIASFCETLIPP-----PYDHQDS---FFSSSGSQPPFPNEVAELLVKRSKPE  70

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-  2000
              +  + ++++ LSTR+G+L+LCG+  L  + PF+  F E+S K+RE ++  W+  S    
Sbjct  71    AMFIIRIVVFMLSTRLGSLVLCGRVCLDKRRPFVHNFSELSLKQREPLLQRWSRESFLLP  130

Query  1999  IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieEL  1820
             +R  F  +K +   +FF+  D+   NP+W+AIGY  PD   +  +  ++           
Sbjct  131   LRITFLLIKIMSFFIFFSWTDENFKNPAWEAIGY-HPDTRQTPSEYHKER----------  179

Query  1819  LFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvis  1643
                PL KGI++ +N  +E +   LTK G  + +      +F I CD V+VGSGCGGGV +
Sbjct  180   ---PLEKGIVETINESDETLKESLTKKGVPLTEDTKDN-TFKIRCDVVIVGSGCGGGVAA  235

Query  1642  gVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGG  1463
              +LA +G+KV+VLEKG+Y+   + S LEGPS+++++  G +L T D  ++++AG+TVGGG
Sbjct  236   AILAKSGHKVVVLEKGHYFVPEDYSGLEGPSLNELYESGAMLSTLDGKIMIMAGTTVGGG  295

Query  1462  SAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVL  1283
             SAVNWSAS++TP  VL +W   H +  FG+  YQ AMD VC ++GV   C +E  QN V+
Sbjct  296   SAVNWSASLRTPTDVLNDWSVKHKIPWFGTSEYQSAMDAVCKRIGVTENCSNEGLQNQVI  355

Query  1282  RKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECE  1103
             R+GC  LG  V NIP+N+  +HYCG C +GCK G KKGT  TWLVD V +G   IL  C 
Sbjct  356   RRGCENLGLKVENIPRNSSENHYCGSCGYGCKTGDKKGTDTTWLVDAVNAG-AVILTGCT  414

Query  1102  ALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLK  944
             A + I E       R +  GV+ T +   + +   I+++ T+ + G+L TP LLI+SGLK
Sbjct  415   AERFILEDDMDGKMRKRCLGVVATTESKKLTRKLHIEARATISSCGSLFTPPLLISSGLK  474

Query  943   NKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPA  767
             NKNIG NLHLHPV+ AWG+FP++  E K K+YEG IM+++  +V     T   A+I+  A
Sbjct  475   NKNIGTNLHLHPVLLAWGYFPESMSEFKGKNYEGGIMTSLHKMV--PEETNARAIIEATA  532

Query  766   LHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEEN  587
             L P +F+ L PW SGQ+ K RM++Y+RT ++ ALA+D+GSGE      + Y LD+ D+EN
Sbjct  533   LGPAIFAVLFPWTSGQDMKERMTKYSRTVNLLALAKDQGSGEVKKAGRIAYRLDEIDKEN  592

Query  586   LQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKHP  419
             ++ GL + LRIL AAGA E+G     G  +  K    EE E F+    +     S  +  
Sbjct  593   IKAGLRRALRILVAAGAVEVGTYQSDGQKISCKGIKNEELEEFLDTVRATGGPNSKGEQW  652

Query  418   NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY  239
              +  SAHQMGSCRMG + +   V+  GE WE +GL+V DGSVLPTA+GVNPM+TI S +Y
Sbjct  653   TIYGSAHQMGSCRMGANEEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAY  712

Query  238   CISQSVLEFL  209
             CI++ + E +
Sbjct  713   CIAKRIAESM  722



>ref|XP_010934290.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Elaeis guineensis]
Length=755

 Score =   534 bits (1375),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 309/740 (42%), Positives = 452/740 (61%), Gaps = 39/740 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPETT---DASVTN---FFQTSAASTGTPHQVAWVI  2198
              SPSQ+++L+A+C  F+P+++ E L  ++   D    N   F+  S + +  P +VA ++
Sbjct  28    FSPSQIQSLAAMCEAFIPSLSMEELHVSSGKEDPPTKNLQAFYLASGSESPVPDEVAELM  87

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R     +  + L+LW L+T++GTL+LCG  SL  +FPF+ +F ++S +KRE ++  W 
Sbjct  88    VKRGLREAVLLVKLVLWLLATKLGTLVLCGSLSLCGEFPFINKFSDMSVEKREEVLKRWN  147

Query  2017  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
               ++   +R  F  +K   L +F++  ++  +N SW AIGY  P      K + ++    
Sbjct  148   KENIFIPLRMVFVMVKVFCLHIFYSMTNENSENLSWNAIGYSLPTEEKPPKSQSER----  203

Query  1840  eddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
                       PL KGII+ ++  +  + + LTK G +V++  P    + I CD  +VGSG
Sbjct  204   ----------PLEKGIIETMDQNDSSLLHSLTKKGLAVSQ-DPIQNMYRIRCDVAIVGSG  252

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
             CGGGV + VLA+AG+KV+V+EKGNY+   + + +E PSM +M+  GG+L T D  M+LLA
Sbjct  253   CGGGVAAAVLASAGHKVVVIEKGNYFTSEDYTSIEAPSMYEMYESGGILSTLDGKMMLLA  312

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             GSTVGGGSAVNWSA IKTP YVL+EW E H L LF S  Y  +MD VC ++GV   C  E
Sbjct  313   GSTVGGGSAVNWSACIKTPDYVLKEWAEEHQLPLFRSTDYLSSMDAVCKRLGVTENCTQE  372

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
              FQN VLRKGC+ LG  V ++P+N+   H+CG C +GC+ G K+GT  TWLVD V  G  
Sbjct  373   GFQNEVLRKGCQNLGLKVDSVPRNSSESHFCGSCCYGCRSGDKRGTDTTWLVDAVDCG-A  431

Query  1123  AILPECEALQVI--------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
              I+  C+A + +         +R K  G++       V     I++KVTV A G+L TP 
Sbjct  432   VIVTGCKAERFLFVENEPGGKKRKKCVGLIAKSLSHKVTMKLEIEAKVTVSACGSLLTPP  491

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNG-TG  794
             L+  SGL N NIGRNLHLHP V AWG+FPD+  + + K++EG I++++  V    +  + 
Sbjct  492   LMKASGLTNPNIGRNLHLHPAVLAWGYFPDSVSDLRGKTFEGGIITSLHEVRAREDSDSS  551

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+I+TPA+ P  F+ L+PW SG + K RM+RY+RTAH+FAL RD+G+G       V Y
Sbjct  552   LRAIIETPAVGPAAFATLVPWVSGLDMKERMARYSRTAHLFALVRDRGTGTVEGEGMVRY  611

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES---  443
               D  D EN++ GL + LRIL AAGA E+G +   G  ++ K     E E F+   +   
Sbjct  612   RFDALDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIQCKGIKEAELEEFLDGITMVG  671

Query  442   -SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +S  +       AHQMGSCRMGV  +   V+  GE+WE +GLFV DGSVLP+A+G+NP
Sbjct  672   GPRSRNELWTFYCCAHQMGSCRMGVSEEEGGVDETGESWEAQGLFVCDGSVLPSAVGINP  731

Query  265   MVTIMSVSYCISQSVLEFLK  206
             M+TI S++YC+S+ + + L+
Sbjct  732   MITIQSIAYCLSKGIAKSLR  751



>gb|EPS58840.1| hypothetical protein M569_15969, partial [Genlisea aurea]
Length=668

 Score =   531 bits (1367),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 298/658 (45%), Positives = 420/658 (64%), Gaps = 29/658 (4%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW-ATSSLQFIRNFFTAMKALV  1964
             STR+G+LL+CG+  L  ++P++ RF EI  + RE IV  W     L  IR  F  +K L+
Sbjct  24    STRLGSLLICGRLCLVGKWPYVRRFSEIGVEDREEIVRRWFGNWFLTPIRVAFVFLKLLI  83

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDL  1784
             LLVFF+ VD+   NP+WKAIGY   DP    K+   +              PL +GI++ 
Sbjct  84    LLVFFSRVDENSQNPAWKAIGYEVDDPGRRCKKSDGRR-------------PLERGIVEG  130

Query  1783  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
              L  E  F + L + G + A P     ++ +ECDAVVVGSGCGGGV + VLA AG+KV+V
Sbjct  131   RLETESSFVDSLAEKGLT-ATPSERENAYRVECDAVVVGSGCGGGVAAAVLARAGHKVVV  189

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKG+Y+A  + S LEGPS+ +++  GG+  + +  +++LAG+TVGGGSAVNWSA IKTP
Sbjct  190   LEKGDYFAADDYSGLEGPSLRQLYESGGVFSSLEGKLMILAGATVGGGSAVNWSACIKTP  249

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
             P VL +W   + L LF S  Y  AMD +  ++GV + C  ESFQN VLRKGC  LG    
Sbjct  250   PEVLNQWANDYKLPLFTSPGYASAMDEIWSRIGVTQNCAAESFQNKVLRKGCEALGLKSE  309

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVI-----HE  1082
             ++  N+  +H+CG C +GC  G KKGT  TWLVD V+SG   I+  C+A ++I       
Sbjct  310   SVATNSSENHFCGSCCYGCMRGDKKGTDTTWLVDAVESG-AVIISGCKAQKLILQNGGRR  368

Query  1081  RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVV  902
             +NK  G+  +F    +K+   I ++ TV A GAL+TP  LI+SGL+N+NIGRNLHLHPV+
Sbjct  369   KNKCVGIEASFTNSHIKKRIKIIARATVSACGALSTPPFLISSGLRNRNIGRNLHLHPVL  428

Query  901   FAWGHFPDTPGENKKSYEGAIMSAMSTVVLNVNGTG--YGAVIQTPALHPGLFSALMPWN  728
              AWG+FP+T   N KSY+G I++++  V+ + NG+     A++++P L PG F+AL PW 
Sbjct  429   MAWGYFPETESPNGKSYQGGIITSLHKVI-SENGSSPKVKAIVESPILGPGSFAALCPWE  487

Query  727   SGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILA  548
             SG++ K RM RY+RTAH+F++ +D+  GE      ++Y L++ D+EN+  GL   LRIL 
Sbjct  488   SGEDMKNRMMRYSRTAHLFSIIKDEAGGEVIREGRISYHLNQIDKENITSGLRTALRILI  547

Query  547   AAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRKHPNLKASAHQMGSCR  380
             +AGA E+G +   G  LK +  S +E E F+      E  +S+ +  ++  SAHQMGSCR
Sbjct  548   SAGAVEVGTHRSDGQRLKCRGISEKEIEEFLDGVTAPEGPKSMVRDWSVYCSAHQMGSCR  607

Query  379   MGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             MG + +   V+  GE+WE EGLFV D S+LP A+GVNPM+TI + SYCIS ++ + LK
Sbjct  608   MGRNEEEGGVDENGESWEAEGLFVCDSSLLPGAIGVNPMITIQATSYCISLNIADNLK  665



>ref|XP_010262396.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform X1 [Nelumbo 
nucifera]
Length=763

 Score =   534 bits (1376),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 323/747 (43%), Positives = 451/747 (60%), Gaps = 53/747 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQVA-  2207
              S S+M+ ++A+C   +P I          E+ P     S+ +F+  S +    P +V  
Sbjct  30    FSLSEMQVVTAICEALIPPIPLGSLHVNGKESPP---SKSIQSFYLASGSQKPIPDEVTV  86

Query  2206  ------WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKK  2045
                    ++ + + H  +  + LLLW LSTR+GTLL+CG  S  +++PFL +F E+S +K
Sbjct  87    VELVAELIVTKALWH-GVLVVRLLLWMLSTRLGTLLICGTLSFGSRWPFLCKFSELSLEK  145

Query  2044  RERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISek  1868
             RE ++  W+ +  Q  +R  F   K      FF+  D+   NP+W AIGY       S K
Sbjct  146   REEVLKKWSRARYQIHLRLMFAMFKIFCCFAFFSLTDENSTNPAWDAIGYHVDTYESSHK  205

Query  1867  qkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIE  1691
               K++              PL KGII+ +N  +  +   LT+ G  V +  P      IE
Sbjct  206   TDKKR--------------PLQKGIIETMNESDSTLVQSLTQKGFKVTE-DPKRNLHKIE  250

Query  1690  CDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMT  1511
             CD VVVGSGCGGGV + VLA++G KV+VLEKGNY+A  + S +EGPS+++++  GG+L T
Sbjct  251   CDVVVVGSGCGGGVAASVLASSGQKVIVLEKGNYFAPEDYSSVEGPSLNQLYESGGMLST  310

Query  1510  KDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKM  1331
              D  ++++AGSTVGGGSAVNWSASIKTP  VLREW   H + LFGS  Y  AMD V  + 
Sbjct  311   FDGKVMIMAGSTVGGGSAVNWSASIKTPSSVLREWFVGHKIPLFGSSDYLSAMDVVFKRN  370

Query  1330  GVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWL  1151
             GV   C  E  QN VL+KGC  LG  V ++P+N+  +HYCG C FGC+ G K+GT  TWL
Sbjct  371   GVTENCVKEGLQNQVLQKGCENLGLKVESVPRNSSENHYCGSCGFGCRRGDKRGTDTTWL  430

Query  1150  VDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             VD V  G   IL  C A + + E+N        K  GVM       + +   I++KVT+ 
Sbjct  431   VDAVDHG-AVILTGCLAKRFMLEKNNHGRTKKKKCLGVMARAYSKNITKELQIEAKVTIS  489

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTV  818
             A G+L TP L+I+SGLKN NIG+NL LHPV  AWG+FP++ P    K++EG I++++  V
Sbjct  490   ACGSLLTPPLMISSGLKNPNIGKNLRLHPVTMAWGYFPESMPKLKGKAFEGGIITSIHKV  549

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V     +   A+I+TPAL P  F +L+PW SG + K RM +YARTAH+FAL RD+GSGE 
Sbjct  550   V--TEKSDVQAIIETPALGPAAFGSLVPWVSGLDMKKRMVKYARTAHLFALIRDQGSGEV  607

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
              S   +TY+  K+D+ENL+ GL++ LRIL AAGA E+G +   G  +K K    E+ E F
Sbjct  608   KSRGMITYEFSKSDKENLKAGLQQALRILIAAGAVEVGTHRNDGQRIKCKGIKEEDLEEF  667

Query  457   VKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             ++  ++     S  ++  L +SAHQMGSCRM    K   V+  GE+WE EGL+V DGSVL
Sbjct  668   LETVTTAGGFLSGEENWTLYSSAHQMGSCRMSSTEKEGAVDENGESWEAEGLYVCDGSVL  727

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFL  209
             P A+GVNPM+TI S++YC+S+ + + L
Sbjct  728   PNAVGVNPMITIQSIAYCLSKKIAKSL  754



>ref|XP_010512451.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Camelina sativa]
Length=749

 Score =   534 bits (1375),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 313/748 (42%), Positives = 447/748 (60%), Gaps = 47/748 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNT-FLPAINEALPETTDASVTN----------FFQTSAASTGTPHQV  2210
             +  ++METL++ C   F P       E + A  TN          F+ TS + T    Q 
Sbjct  15    IKAAEMETLASFCEAIFPPVAPPPPEELSGAGDTNKHRNTEALRSFYSTSGSQTPVLRQS  74

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
               ++ +R          L+L+ L+TR+GTLL+CG   L T++PF+ +F E+S +KRER++
Sbjct  75    IELLTKRGTMEAYLVTRLILFLLATRLGTLLICGTECLVTRWPFVEKFSELSLEKRERVI  134

Query  2029  H-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  1853
                +    L  IR  F  +K + L  FF+ V  KG+NP+W+AIGY               
Sbjct  135   QKQFRNWILTPIRAGFVYIKVVFLFCFFSRVSPKGENPAWEAIGY-------------HV  181

Query  1852  hhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
             + D     E     PL KGI++ +N  E+ +   L + G   A       +  I+CDAVV
Sbjct  182   NLDENKPSETYKARPLEKGIVETMNETEQTLLESLARKGLK-ADHDMDQDTIRIKCDAVV  240

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             +GSG GGGV + VLA +G KV+VLEKG+YY  ++    EGP MDK++  GG+L T D ++
Sbjct  241   IGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILPTVDGNL  300

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             ++LAG+TVGGGSAVNWSA IKTP  VL+EW E   +  +G+  Y  AM+ V  +MGV  +
Sbjct  301   MVLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQKIHFYGTKDYVSAMNVVWKRMGVTEK  360

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             CE ESFQN +LRKGC  +G  V N+ +N+   HYCG C +GC+ G KKG+ +TWLVD V 
Sbjct  361   CEMESFQNQILRKGCENIGVHVENVARNSSEGHYCGSCGYGCRQGDKKGSDQTWLVDAVS  420

Query  1135  SGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGA  983
              G   +L  C+A ++I E+          K  GVM       + +   I++KVTV AGG+
Sbjct  421   HG-AVVLTGCKAERLILEKKGSNVGGKQMKCLGVMAKSLNGNIAKKLKIEAKVTVSAGGS  479

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVV  815
             L TP L+I+SGL+N+NIG+NLHLHP + +WG+FP+    +     KSYEG I++++S V+
Sbjct  480   LLTPPLMISSGLRNRNIGKNLHLHPTLMSWGYFPEKESSSLSFKGKSYEGGIITSVSKVL  539

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                  +   A+I+T +L PG FS L PW SG + K RMSRY+RTA +  + RD+GSGE  
Sbjct  540   --SEDSEVRAIIETASLGPGSFSVLFPWTSGLDLKTRMSRYSRTASLITIVRDRGSGEVK  597

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
             +   ++Y +DKTD+EN++ GL + LRIL AAGAEE+G +   G  LK K    +  E F+
Sbjct  598   TEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDEKSIEEFL  657

Query  454   ----KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
                  EE  + + +  N+  SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP
Sbjct  658   DSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFVCDASALP  717

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLKT  203
             +A+GVNPM+T+MS +YCIS  + + + T
Sbjct  718   SAVGVNPMITVMSTAYCISTRIAKSMTT  745



>ref|XP_009610950.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Nicotiana tomentosiformis]
Length=742

 Score =   533 bits (1374),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 307/733 (42%), Positives = 442/733 (60%), Gaps = 34/733 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH  2180
              S S+METL+++C T LP +    +PE    ++    + S +    P + A V+ +R   
Sbjct  22    FSSSEMETLTSICETILPPLPQNEIPENNSQNIQYLHRASGSQYPIPDECAEVVMKRGFS  81

Query  2179  PKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQ  2003
               +  L  LL  LSTR GTLLLCG      ++P++ +F +I  +KRE ++  W  +  L 
Sbjct  82    EAIILLRGLLRILSTRFGTLLLCGSFCFVQKWPYINKFCDIPLEKREIVLQKWFKNRFLT  141

Query  2002  FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieE  1823
              +R  F  +K L L +FFT V +   N +W  IGY   +     +  +++          
Sbjct  142   PVRLAFLFIKFLSLYIFFTQVGEDSKNQAWDDIGYQVDNEEKHSETAEER----------  191

Query  1822  LLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvi  1646
                 PL KGI++ +   E  V   L + G  V +       + ++CD V+VGSGCGGGV 
Sbjct  192   ----PLEKGIVETIYETESTVVKSLVQKGLKVIE-DTKNNMYKVQCDVVIVGSGCGGGVA  246

Query  1645  sgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  1466
             + VLA++G KV+VLEKGNYY +++ S LEGPSM++M+  GG+L T +  ++++AGSTVGG
Sbjct  247   ASVLASSGNKVIVLEKGNYYTKSDYSSLEGPSMNQMYESGGILSTLNAKIMIMAGSTVGG  306

Query  1465  GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMV  1286
             GSA+NWSA +KTP  V++EW +   L +F S  Y   MD VC ++GV   C  E  QN +
Sbjct  307   GSAINWSACLKTPDSVIQEWGDDKRLPIFQSPEYVSVMDKVCERIGVTENCTQEGLQNQI  366

Query  1285  LRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPEC  1106
             LRKGC  LG  V  + +N+  +HYCG C +GC+ G KKGT  TWLVD V+ G   I+  C
Sbjct  367   LRKGCENLGLEVEGVARNSSENHYCGSCCYGCRRGEKKGTDTTWLVDAVECG-AVIITGC  425

Query  1105  EALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             +A + I E+N        K  GV+ T     + +   I++KVT+ A G+L TP L+I+SG
Sbjct  426   KAERFILEKNKYGKTRDKKCLGVIATSTNKDITKRICIEAKVTISACGSLLTPPLMISSG  485

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             LKN NIGRNLHLHPV+ AWG+FP++    K K YEG I++++  V      +   A+I+ 
Sbjct  486   LKNPNIGRNLHLHPVIMAWGYFPESKSNFKGKIYEGGIITSVHKV--ESYDSNVRAIIEA  543

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
             PAL PG F+AL PW SG++ K R+ +Y+RTAH+FA+ +D GSG+  S   ++Y  +  D+
Sbjct  544   PALGPGSFAALCPWTSGEDLKNRLLKYSRTAHLFAMVKDVGSGKVRSDGRISYKFNAMDK  603

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRK  425
             E+L++GL + LRIL AAGA+E+G     G  +K K  S +E E F+      E  +SL K
Sbjct  604   ESLKQGLRQALRILIAAGADEVGTQRSDGQRMKCKGKSEKEIEAFLDTVTAAEGPKSLVK  663

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             +    +SAHQMGSCRMG+  K   V+  GE+WE  GLFV D SVLP A+GVNPM+TI S 
Sbjct  664   NFTTYSSAHQMGSCRMGMSKKDGAVDENGESWEANGLFVCDASVLPGAVGVNPMITIQST  723

Query  244   SYCISQSVLEFLK  206
             +YC+S+ + E +K
Sbjct  724   AYCLSKKIAETIK  736



>ref|XP_006443786.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
 ref|XP_006479488.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Citrus sinensis]
 gb|ESR57026.1| hypothetical protein CICLE_v10018992mg [Citrus clementina]
Length=748

 Score =   533 bits (1374),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 323/735 (44%), Positives = 439/735 (60%), Gaps = 43/735 (6%)
 Frame = -3

Query  2344  QMETLSALCNTFLPAINEALPETT------DASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             ++E+L+A+C T +P +    PET       + ++ +F++ SA+    PH+VA ++ +R +
Sbjct  27    EIESLAAICQTLVPPLP---PETITKQHSHNQAIVSFYKASASQHPIPHEVAELMVKRGQ  83

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  2006
                +    L+L  LS R+GTLLLCG       +PF+  F EIS +KRE+I+ +W+    L
Sbjct  84    PQAVFLARLILTLLSFRLGTLLLCGYLCFDWNWPFIHNFSEISLEKREKILKNWSRERYL  143

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K   L  FF   D+K +NP+W+AIGY       S K + ++         
Sbjct  144   LPLRVVFVMIKMFCLFYFFARTDEKSENPAWEAIGYHVDTREPSNKPRGER---------  194

Query  1825  ELLFGPLYKGIIDL---NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                  PL KGI++    N  +  +F  L   G  V         F I+CD VVVGSGCGG
Sbjct  195   -----PLQKGIVETVHENENDHSLFQCLVDHGLQVTVDHEHN-LFEIKCDVVVVGSGCGG  248

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA++G KVLVLEKGNY+   + S LEGPSM +++  GGLL T D   ++ AGS 
Sbjct  249   GVAAAVLASSGQKVLVLEKGNYFVAEDYSSLEGPSMLELYESGGLLSTLDGKFMVFAGSA  308

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSA I+TP  VLR+W   H + LFGS  Y+ AMD V  ++GV   C +E FQ
Sbjct  309   VGGGSAVNWSACIETPDSVLRDWFVEHKIPLFGSLDYRAAMDKVSKRIGVTEHCTEEGFQ  368

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLRKGC  LG+ V ++ +N P +HYCG C +GC+ G KKGT  TWLVD V +G   IL
Sbjct  369   NQVLRKGCENLGFKVESVARNTPEEHYCGSCNYGCRTGDKKGTDVTWLVDAVDNG-AVIL  427

Query  1114  PECEALQVIHERNKAK-------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
                +A + I   NK         GV  T     V +   IK+K T+ A G+L TP L+I+
Sbjct  428   AGFKAEKFILVDNKDSIRSKKCLGVTATALNKNVTRKLQIKAKATISACGSLLTPPLMIS  487

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGL+N NIG NLHLHPV+ AWG+ PD   E K K++EG I++++  VV     +   A+I
Sbjct  488   SGLENPNIGTNLHLHPVLLAWGYIPDHVSELKGKTFEGGIITSIHKVV--SEDSKVQAII  545

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             ++PA+ P  F+A  PW SG+E K RM RY R A +FAL RD+GSGE      + Y L K 
Sbjct  546   ESPAMGPASFAASFPWISGRELKDRMLRYGRIAQLFALVRDQGSGEVKVEGKIKYRLSKN  605

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----ESSQSL  431
             D+ENL+ GL + LRIL AAGAEE+G     G  ++ K    E+ E F+          S 
Sbjct  606   DKENLKTGLRQALRILVAAGAEEVGTYRSDGHRIRCKGIKEEDLEEFIGSIEVVGGMASR  665

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              +H ++  SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A+G+NPM+TI 
Sbjct  666   GEHWSVYFSAHQMGSCRMGATEEDGAVDENGESWEAEGLFVCDGSVLPSAIGINPMITIE  725

Query  250   SVSYCISQSVLEFLK  206
             S SYCIS+ + + LK
Sbjct  726   STSYCISKKIADSLK  740



>emb|CDP11641.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   533 bits (1374),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 314/740 (42%), Positives = 451/740 (61%), Gaps = 42/740 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--NEALPET------TDASVTNFFQTSAASTGTPHQVAWV  2201
              S S++E L+ +C  F+P +  N + P+       T  ++ +F+++S A    P +VA +
Sbjct  23    FSSSELEALTGMCEAFIPPLPLNNS-PDIVGKDGKTKEAIQSFYKSSGAQYPNPDKVAEL  81

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             + +R     +  + +LL  LSTR+GTLLLCG      ++P++ +F +I    RE+++  W
Sbjct  82    VVKRGFMEAVMLVRILLIILSTRLGTLLLCGALCFGKKWPYINKFSDIPVDNREKVIQKW  141

Query  2020  ATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
                  L  IR  F  +K L L  FFT V +   NP+W+A+ Y   +   S     +K   
Sbjct  142   LKHKFLTPIRLPFVLIKFLCLYAFFTQVWEDFKNPAWEAMDYQVDNRKDSSTTPHEK---  198

Query  1843  heddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL KG+++  +  E  + + L + G  VA+  P    + I+CD V+VGS
Sbjct  199   -----------PLMKGMVETTHETESTIVSSLVQKGLRVAE-DPKEKLYKIKCDVVIVGS  246

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV + VLA +G KV+V+EKGNY+ +T+ S LEGPSM++++  GG+L T D  +++L
Sbjct  247   GCGGGVAAAVLAKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLDGKLLML  306

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
             AGSTVGGGSAVNWSA +KTP  VL+EW +   + LF S  Y  AMDTV  ++GV  +C +
Sbjct  307   AGSTVGGGSAVNWSACLKTPMSVLQEWAKDCQIPLFTSSQYVSAMDTVSQRIGVTEKCSE  366

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E FQN +LR+GC +LG  V ++P+N+  +HYCG C +GC+ G KKGT  TWLVD V  G 
Sbjct  367   EGFQNQILRQGCEKLGLEVESVPRNSSENHYCGSCNYGCRTGDKKGTDSTWLVDAVDCG-  425

Query  1126  GAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
               I+  C+A + + E+N        K  GV+       + +   I++KVT+ A G+L TP
Sbjct  426   AVIITGCKAEKFVLEKNKYGRSRKSKCLGVIAKCLNGDITKRICIEAKVTISACGSLLTP  485

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG  794
              L+I+SGL N++IGRNLHLHPV+ AWG+FP++    K K YEG I++++  V    + +G
Sbjct  486   PLMISSGLTNQHIGRNLHLHPVLMAWGYFPESDSVLKGKIYEGGIITSVHKV--GSDDSG  543

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+I++PAL PG F+AL PW SG E K R+ +YARTAH+F++ RD+GSGE  +   ++Y
Sbjct  544   VRALIESPALGPGSFAALRPWESGLETKKRILKYARTAHLFSMIRDRGSGEVRAEGRISY  603

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE----E  446
               D TD+EN+  GL + L IL AAGA E+G     G   K K  S  E E F+ E    E
Sbjct  604   TFDATDKENITAGLRQALMILVAAGAVEVGTLQSNGQKFKCKGTSERELEEFLDEVTAAE  663

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +SL ++     SAHQMGSCRMG   K S V+  GE+WE E LFV D SVLP A+GVNP
Sbjct  664   GPKSLVQNWTTYFSAHQMGSCRMGKSEKVSAVDENGESWEAEDLFVCDASVLPGAVGVNP  723

Query  265   MVTIMSVSYCISQSVLEFLK  206
             M+TI S ++C+S  + E LK
Sbjct  724   MITIQSTAFCLSNKIAEILK  743



>ref|XP_006582261.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
Length=749

 Score =   532 bits (1371),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 320/751 (43%), Positives = 454/751 (60%), Gaps = 45/751 (6%)
 Frame = -3

Query  2377  NNTATKTLSPSQMETLSALCNTFLPAI-NEALP---------ETTDASVTNFFQTSAAST  2228
             +N      S ++ME+L+++C   LP +  +AL          ++++ S+ +F   SA+  
Sbjct  15    DNKYKHGFSTAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISASRY  74

Query  2227  GTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  2048
               PH+VA +I +R     +  + ++LW L+TR+GTLLLCG   L   +P++ +F  IS +
Sbjct  75    PIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNISLE  134

Query  2047  KRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-DPSIS  1874
             KRE+I+  W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIGY  P D  ++
Sbjct  135   KREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIGYEVPADEKMT  194

Query  1873  ekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
                  +               PL KGII+ +N  +  +   L   G +V           
Sbjct  195   NTSNTR---------------PLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSN-ILK  238

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             ++CDA+VVGSGCGGGV + VL++AG+KV+VLEKGNY+   + S LEGPSM++++  GG+L
Sbjct  239   VKCDALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGIL  298

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              + D  +++LAGSTVGGGSAVNWSA IKTP  VL+EW E H L  F S  Y  AM+ VC 
Sbjct  299   ASVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCE  358

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV   C  E FQN VLRKGC+ LG  V  +P+N+  +HYC  C +GC  G K+GT +T
Sbjct  359   RIGVTENCSQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCS-CGYGCPKGEKQGTQDT  417

Query  1156  WLVDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVT  1001
             WL D V+  +  I+  C+A + + E N        K  GV        +     I++KVT
Sbjct  418   WLADAVER-DAVIITGCKAERFLLESNRSGNGRKKKCLGVTAKTLNSRITMKLQIEAKVT  476

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--NKKSYEGAIMSAM  827
             + AGGAL TP LLI+SGLKNKNIG+NLHLHPV+  WG+FP++       K YEG I++++
Sbjct  477   ISAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGKVYEGGIITSV  536

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
               V    + +   A+I+TP L P  F+AL PW SGQ+FK RM  Y RT+H+  + RD   
Sbjct  537   HKVPSPDSNSDSRAIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMAC  596

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             G+  +   ++Y L++ D+EN++ GL++ LRIL AAGA E+G +   G  LK       E 
Sbjct  597   GQVTTEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEV  656

Query  466   ERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
             + F+      E + S  +  N+ +SAHQMGSCRMGV  K   V+  GETWE EGLFV D 
Sbjct  657   QEFLDSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDA  716

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             SVLP+A+GVNPM+T+ S +YCIS  ++++L+
Sbjct  717   SVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>gb|KHN28101.1| Long-chain-alcohol oxidase FAO1-like protein [Glycine soja]
Length=749

 Score =   532 bits (1370),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 318/751 (42%), Positives = 452/751 (60%), Gaps = 45/751 (6%)
 Frame = -3

Query  2377  NNTATKTLSPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAAST  2228
             +N      S ++ME+L+++C   LP +          +    ++++ S+ +F   SA+  
Sbjct  15    DNKYKHGFSAAEMESLTSICEVVLPPLPMDALKIRKEDHDDDDSSNKSLQSFLDISASRY  74

Query  2227  GTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQK  2048
               PH+VA +I +R     +  + ++LW L+TR+GTLLLCG   L   +P++ +F  IS +
Sbjct  75    PIPHEVAEMITKRSLIETVILIRVVLWLLATRLGTLLLCGFLCLGENWPYINKFSNISLE  134

Query  2047  KRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP-DPSIS  1874
             KRE+I+  W     L  IR  F  +K L L VFF+ VD+ GDNP+WKAIGY  P D  ++
Sbjct  135   KREKIMQKWLKHRFLTPIRLTFACIKVLCLFVFFSWVDENGDNPAWKAIGYEVPADEKMT  194

Query  1873  ekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
                  +               PL KGII+ +N  +  +   L   G +V           
Sbjct  195   NTSNTR---------------PLEKGIIETMNESDSTLQQSLANKGLNVTLDSKSN-ILK  238

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             ++CDA+VVGSGCGGGV + VL++AG+KV+VLEKGNY+   + S LEGPSM++++  GG+L
Sbjct  239   VKCDALVVGSGCGGGVAAAVLSSAGHKVVVLEKGNYFTPQDYSSLEGPSMNQLYETGGIL  298

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              + D  +++LAGSTVGGGSAVNWSA IKTP  VL+EW E H L  F S  Y  AM+ VC 
Sbjct  299   ASVDSRVLVLAGSTVGGGSAVNWSACIKTPHKVLKEWSESHKLPFFSSQEYLSAMENVCE  358

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV   C  E FQN VLRKGC+ LG  V  +P+N+  +HYC  C +GC  G K+GT +T
Sbjct  359   RIGVTENCSQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCS-CGYGCPKGEKQGTQDT  417

Query  1156  WLVDLVKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVT  1001
             WL D V+  +  I+  C+A + + E N        K  GV        +     I++KVT
Sbjct  418   WLADAVER-DAVIITGCKAERFLLESNRSGNGRKKKCLGVTAKTLNSRITMKLQIEAKVT  476

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKS--YEGAIMSAM  827
             + AGGAL TP LLI+SGLKNKNIG+NLHLHPV+  WG+FP++     K   YEG I++++
Sbjct  477   ISAGGALLTPPLLISSGLKNKNIGKNLHLHPVLMTWGYFPESNDSEFKGNVYEGGIITSV  536

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
               V    + +   A+I+TP L P  F+AL PW SGQ+FK RM  Y RT+H+  + RD   
Sbjct  537   HKVPSPDSNSDSRAIIETPLLGPASFAALCPWESGQDFKERMLNYPRTSHLITIIRDMAC  596

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             G+  +   ++Y L++ D+EN++ GL++ LRIL AAGA E+G +   G  LK       E 
Sbjct  597   GQVTTEGRISYKLNEVDKENMKAGLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEV  656

Query  466   ERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
             + F+      E + S  +  N+ +SAHQMGSCRMGV  K   V+  GETWE EGLFV D 
Sbjct  657   QEFLDSVCPMEGALSPGEKWNIYSSAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDA  716

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             SVLP+A+GVNPM+T+ S +YCIS  ++++L+
Sbjct  717   SVLPSAVGVNPMITVQSTAYCISNRIVDYLR  747



>ref|XP_006296686.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
 gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
Length=744

 Score =   531 bits (1369),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 316/747 (42%), Positives = 450/747 (60%), Gaps = 46/747 (6%)
 Frame = -3

Query  2362  KTLSPSQMETLSALCNTFLPAINEALPETTDAS-------VTNFFQTSAASTGTPHQVAW  2204
             + ++ ++METL++ C   LP +     E +  S       + +F+ TS + T    Q   
Sbjct  13    RDITAAEMETLASFCEAVLPPVPPPPEEISGDSNHRNKEALRSFYSTSGSQTPVLRQSIE  72

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-  2027
             +I +R          L+L+ L+TRIGTLL+CG   L +++PF+ +F E+S +KRER++  
Sbjct  73    LITKRGTIEAYLVTRLILFLLATRIGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQK  132

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkh  1850
              +    L  +R  F  +K  +L  FF+ V   G+N +W+AIGY    D +  E  K +  
Sbjct  133   QFRNWFLTPVRAGFVYIKVAILFCFFSRVSPNGENSAWEAIGYKVNLDENKPETHKAR--  190

Query  1849  hdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                          PL KGI++ +N  EE +   L +  C          +  I+CDAVVV
Sbjct  191   -------------PLEKGIVETMNETEETLLESLAR-KCLQTDHDVDNDAIRIKCDAVVV  236

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV + VLA +G KV+VLEKG+YY  +     EGP MDK++  GG+L + D +++
Sbjct  237   GSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSEYLPFEGPGMDKLYENGGILPSVDGNIM  296

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAG+TVGGGSAVNWSA IKTP  VL+EW E   +  FG+  Y  AM+ V  +MGV  +C
Sbjct  297   VLAGATVGGGSAVNWSACIKTPKTVLQEWSEDQKIPFFGTKEYVLAMEAVWERMGVTEKC  356

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
             E ES QN VLRKGC  LG+ V N+P+N+   HYCG C +GC+ G KKG+  TWLVD V  
Sbjct  357   EMESLQNQVLRKGCENLGFNVENVPRNSSEKHYCGSCGYGCRQGDKKGSDRTWLVDAVSH  416

Query  1132  GNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
             G   IL   +A + I E+N         K  GV+       +++   I++KVTV AGGAL
Sbjct  417   G-AVILTGSKAERFILEKNCSNKGGKKMKCLGVVAKSLNGNIEKKIKIEAKVTVSAGGAL  475

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVL  812
              TP L+I+SGL+N++IGRNLHLHPV+ AWG+FPD    N     KSYEG I++++S V+ 
Sbjct  476   LTPPLMISSGLRNRHIGRNLHLHPVLMAWGYFPDKASSNFNIKGKSYEGGIITSVSKVL-  534

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
                 +   A+I+TPAL PG FS L PW SG + K RM+RY+RTA++  + RD+GSGE  +
Sbjct  535   -SEDSEVRAIIETPALGPGSFSVLCPWTSGLDMKKRMARYSRTANLITIVRDRGSGEVKT  593

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK  452
                ++Y +DKTD +N++ GL + LRIL AAGAEE+G +   G  L  K    +  + F+ 
Sbjct  594   EGRISYVVDKTDRDNIKAGLRQSLRILIAAGAEEVGTHRSDGQRLICKGVDEDSIQEFLD  653

Query  451   ----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT  284
                 EE  + + +  N+ +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+
Sbjct  654   AVSTEEGPKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPS  713

Query  283   ALGVNPMVTIMSVSYCISQSVLEFLKT  203
             A+GVNPM+T+MS +YCIS  + + + T
Sbjct  714   AVGVNPMITVMSTAYCISTRIAKSMTT  740



>ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gb|EEF32533.1| electron carrier, putative [Ricinus communis]
Length=745

 Score =   531 bits (1368),  Expect = 7e-174, Method: Compositional matrix adjust.
 Identities = 312/744 (42%), Positives = 442/744 (59%), Gaps = 37/744 (5%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAI-----NEALPETTDASVTNFFQTSAASTGTPHQV  2210
             NT     S +Q++TLSA C T +P +     +  LP     ++ +F++ S +    P +V
Sbjct  19    NTYNHGFSSAQIQTLSAFCETLIPPLPVNNFSNELPFDKQKALLSFYKASGSEQPIPDEV  78

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             A ++  R     +  +  LL  LS R+GTLLLCG   L   +PF+ +F EIS  KRE IV
Sbjct  79    AELMVNRGLKEVVLVVDFLLKVLSFRLGTLLLCGFICLEWNWPFIHKFSEISLSKREDIV  138

Query  2029  HSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqk  1853
               WA     F +R  F A+K      FF+  DD  +NP+W+AIGY               
Sbjct  139   KRWAKQKYFFPLRVLFMAVKIFCSYTFFSRTDDNSENPAWEAIGY--------------H  184

Query  1852  hhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                 E   +     PL KGI++L N  +  +   L + G  V +  P   ++ I+CD V+
Sbjct  185   KDTREKLTKSRKERPLEKGIVELANEDDLTLVKSLMQKGIQVTE-DPDHNTYKIKCDVVI  243

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             +GSGCGGGV + VLA++G KVLVLEKGNY+   + S +EGPSM +++  GG L T +  +
Sbjct  244   IGSGCGGGVAAAVLASSGQKVLVLEKGNYFVPEDYSSVEGPSMAELYESGGFLPTLNGKI  303

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
             ++LAGSTVGGGSA+NWSA IKTP  VL+EWC  + + LFGS  Y  AMD V  ++GV   
Sbjct  304   MILAGSTVGGGSAINWSACIKTPDTVLKEWCVDYRIPLFGSPDYHYAMDVVQKRIGVTDN  363

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
             C +E FQN VLR+GC  LG  V ++P+N+ +DHYCG C +GC+ G KKGT  TWLVD V 
Sbjct  364   CSNEGFQNQVLRRGCENLGLKVDSVPRNSSADHYCGSCCYGCRTGDKKGTDSTWLVDAVG  423

Query  1135  SGNGAILPECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
             SG   IL    A + I E       R +  GV+       V +   I+++ T+ A G+L 
Sbjct  424   SG-AVILTGTRAEKFILEEDHSGRSRKRCIGVIAKTSNTNVTKKLQIEARATISACGSLL  482

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNG  800
             TP L+I+SGL N NIGRNLHLHPV+ AWG+FP+   + + K YEG I++++  VV     
Sbjct  483   TPPLMISSGLANPNIGRNLHLHPVIMAWGYFPEHISDLSGKIYEGGIITSVHKVV--SEE  540

Query  799   TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
             +   A+++ PAL P  ++AL PW SGQ+FK +M +YARTA++FAL RD+GSGE      +
Sbjct  541   SKVCAILEAPALGPASYAALSPWVSGQDFKDKMVKYARTANLFALIRDQGSGEVKLEKKI  600

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS  440
              + + ++D ENL+ GL + LRIL  AGA E+G     G  ++ K     + E F+   ++
Sbjct  601   KHRMSRSDNENLRIGLRQALRILVGAGAVEVGTYRSDGQRIECKGVKETDLEEFLDTVTA  660

Query  439   Q----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  272
                  S  ++ N+  SAHQM SCRMG   +   V+  GE+WE + LFV DGS+LP+A+G+
Sbjct  661   SGGLTSKEEYWNMLFSAHQMSSCRMGATEEEGAVDENGESWEAKNLFVCDGSILPSAVGI  720

Query  271   NPMVTIMSVSYCISQSVLEFLKTH  200
             NPM+TI S +YCIS+ + E +K +
Sbjct  721   NPMITIQSTAYCISKRIAESMKKY  744



>ref|XP_009102621.1| PREDICTED: long-chain-alcohol oxidase FAO3 [Brassica rapa]
Length=745

 Score =   531 bits (1367),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 315/752 (42%), Positives = 453/752 (60%), Gaps = 48/752 (6%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAI---NEALPET----TDASVTNFFQTSAASTGTPH  2216
             N   + ++ ++ME+L++ C   LP +    E L E        ++ +F+ T  + T    
Sbjct  9     NFGHREVTAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVAR  68

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             Q   +I +R       +  L+L+ L+TR+GTLL+CG   L + +PF+ +F E++ +KRER
Sbjct  69    QTIDLIIKRGTMEAYLATRLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELTLEKRER  128

Query  2035  IVH-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  1862
             ++   +    L  IR  F  +K   L  FF+ V   G+NP+W+AIGY    D +   + +
Sbjct  129   VLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGYRVNLDENKPSETR  188

Query  1861  kqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
             K++              PL KG+++ +   E+ +   LT+ G    +      +  I+CD
Sbjct  189   KER--------------PLEKGVVETMKETEQTLLESLTQKG---LEADTDHDAIRIKCD  231

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AVVVGSG GGGV + VLA AG KV+V+EKG+YY  ++    EG  M+K++  GG+L + D
Sbjct  232   AVVVGSGSGGGVAASVLAKAGLKVIVMEKGSYYTESDYPPFEGHGMEKLYENGGILPSID  291

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
               +++LAG+TVGGGSAVNWSA IKTP  VL+EW E H + LFG+  Y  AMD V  +MGV
Sbjct  292   GCLMILAGATVGGGSAVNWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLVWKRMGV  351

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                CE E FQN VLRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  TWLVD
Sbjct  352   TETCEKEGFQNQVLRKGCENLGINVQNVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVD  411

Query  1144  LVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
              V  G   +L  C+A + I E+N          K  GV+       + +   I++KVTV 
Sbjct  412   AVSHG-AVVLTGCKAERFILEKNGNKNRGGKKMKCLGVLSKSLNGNIAKKIKIEAKVTVS  470

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK----KSYEGAIMSAM  827
             A G+L TP L+I+SGL+N++IG+NLHLHPV+ AWG+F D    +     KSYEG I+++M
Sbjct  471   AAGSLLTPPLMISSGLRNRHIGKNLHLHPVLMAWGYFSDKESSSSNFKGKSYEGGIITSM  530

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
             S V+     +   A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GS
Sbjct  531   SKVL--SEDSEVRAIIETPALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGS  588

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             GE  +   ++Y +DKTD+ENL+ GL + LRIL AAGAEE+G +   G  L  K    +  
Sbjct  589   GEVKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSI  648

Query  466   ERFVK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
             E F+     EE  +++ +   + +SAHQMGSCR+G D K   ++  GE+WE E LFV DG
Sbjct  649   EEFLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDG  708

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFLKT  203
             SVLP+A+GVNPM+TIMS +YCIS  +++ + T
Sbjct  709   SVLPSAVGVNPMITIMSTAYCISTRIVKSMTT  740



>ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp. 
lyrata]
Length=743

 Score =   531 bits (1367),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 313/739 (42%), Positives = 450/739 (61%), Gaps = 43/739 (6%)
 Frame = -3

Query  2362  KTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAW  2204
             + ++ ++ME+L++ C   LP +       +E        ++ +F+ TS + T    Q   
Sbjct  13    RDITEAEMESLASFCEAVLPPVLPPEEVSSEGDNHRNKEALRSFYSTSGSQTPVLRQSIE  72

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-  2027
             +I +R       +  L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++  
Sbjct  73    LITKRGTIEAYLATRLILFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQK  132

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkh  1850
              +    L  IR  F  +K   L  FF+ V   G+NP+W+AIGY    D +   + +K++ 
Sbjct  133   QFRNWFLTPIRAAFVYIKVAFLFCFFSRVTPDGENPAWEAIGYHVNLDENKPSETRKER-  191

Query  1849  hdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                          PL KGI++ +   E+ +   L + G   A       +  I+CDAVVV
Sbjct  192   -------------PLEKGIVETMEETEQTLLELLAQKGLE-ADLDTVHDAIRIKCDAVVV  237

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSG GGGV + VLA +G KV+VLEKG+Y+  ++    EGP +DK++  GG+L + D +++
Sbjct  238   GSGSGGGVAASVLAKSGLKVVVLEKGSYFTPSDYRPFEGPGLDKLYENGGILPSVDGNLM  297

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAG+TVGGGSAVNWSA IKTP  VL+EW E   + LF +  Y  AM+ V  +MGV  +C
Sbjct  298   VLAGATVGGGSAVNWSACIKTPKSVLQEWSEDQNIPLFATKEYVSAMEVVWERMGVTDKC  357

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
             E ESFQN VLRKGC+ LG  V N+P+N+   HYCG C +GC  G KKG+  TWLVD V  
Sbjct  358   EMESFQNQVLRKGCQNLGVNVENVPRNSSESHYCGSCGYGCIQGDKKGSDRTWLVDAVSQ  417

Query  1132  GNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
             G   IL  C+A + I E+N         K  GVM       + +T  I++KVTV AGGAL
Sbjct  418   G-AVILTGCKAERFILEKNSGNEGGKKMKCLGVMAKSLNGNIAKTLKIEAKVTVSAGGAL  476

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--KKSYEGAIMSAMSTVVLNV  806
              TP L+I+SGL+N++IG+NLHLHPV+ AWG+FP     N   KSYEG I++++S V+   
Sbjct  477   LTPPLMISSGLRNRHIGKNLHLHPVLMAWGYFPMKESSNFKGKSYEGGIITSVSKVL--S  534

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
               +   A+I+TPAL PG FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +  
Sbjct  535   EDSEVRAIIETPALGPGSFSVLCPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEG  594

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK--  452
              ++Y +DKTD +NL+ GL + L+IL AAGAEE+G +   G  L  K +     E F+   
Sbjct  595   RISYAVDKTDRDNLKAGLRQSLKILIAAGAEEVGTHRSDGQRLICKGSDENSIEEFLDSV  654

Query  451   --EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
               EE  + + +  N+ +SAHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+
Sbjct  655   STEEGPKGMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAV  714

Query  277   GVNPMVTIMSVSYCISQSV  221
             GVNPM+T+MS +YCIS  +
Sbjct  715   GVNPMITVMSTAYCISTRI  733



>ref|XP_010488398.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Camelina sativa]
Length=750

 Score =   531 bits (1367),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 311/755 (41%), Positives = 449/755 (59%), Gaps = 56/755 (7%)
 Frame = -3

Query  2362  KTLSPSQMETLSALCNTFLPAINEALPETTDASVTN-----------FFQTSAASTGTPH  2216
             + ++ ++METL++ C    P +    PE    +  N           F+ TS + T    
Sbjct  13    RDITAAEMETLASFCEAVFPPVAPPPPEELSGAGDNNNHRNTEALWSFYSTSGSQTPVLR  72

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             Q   ++ +R          L+L+ L+TR+GTLL+CG   L T++PF+ +F E+S +KRER
Sbjct  73    QSIELLTKRATMEACLVTRLILFLLATRLGTLLICGTECLVTRWPFVEKFSELSLEKRER  132

Query  2035  IVH-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC----GPDPSISe  1871
             ++   +    L  IR  F  +K + L  FF+ V  KG+NP+W+AIGY        PS + 
Sbjct  133   VIQKQFRNWILTPIRAGFVYIKVIFLFCFFSRVSPKGENPAWEAIGYHVNLDENKPSATY  192

Query  1870  kqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVI  1694
             K +                 PL KGI++ +N  E+ +   L + G   A       +  I
Sbjct  193   KAR-----------------PLEKGIVETMNETEQTLLESLARKGLE-ADHDMDQDTIRI  234

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CDAVV+GSG GGGV + VLA +G KV+VLEKG+YY  ++    EGP MDK++  GG+L 
Sbjct  235   KCDAVVIGSGSGGGVAASVLAKSGLKVVVLEKGSYYTPSDYRPYEGPGMDKLYENGGILP  294

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T D ++++LAG+TVGGGSAVNWSA IKTP  VL+EW +   +  +G+  Y  AMD V  +
Sbjct  295   TVDGNLMVLAGATVGGGSAVNWSACIKTPKSVLQEWSDDQKIPFYGTKEYVSAMDVVWKR  354

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             MGV  +CE ESFQN +LRKGC  +G  V N+ +N+   HYCG C +GCK G KKG+ +TW
Sbjct  355   MGVTEKCEMESFQNQILRKGCENIGVHVENVARNSSEGHYCGSCGYGCKQGDKKGSDQTW  414

Query  1153  LVDLVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKV  1004
             LVD V  G   +L  C+A + + E+           K  GVM       + +   I++KV
Sbjct  415   LVDAVSHG-AVVLTGCKAERFVLEKKGGSNVEGKQMKCLGVMAKSLNGNIAKKLKIEAKV  473

Query  1003  TVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIM  836
             TV AGG+L TP L+I+SGL+N+NIG+NLHLHP + +WG+FP+    +     KSYEG I+
Sbjct  474   TVSAGGSLLTPPLMISSGLRNRNIGKNLHLHPTLMSWGYFPEKESSSLSFKGKSYEGGII  533

Query  835   SAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             +++S V+     +   A+I+T +L PG FS L PW SG + K RM+RY+RTA +  + RD
Sbjct  534   TSVSKVL--SEDSEVRAIIETASLGPGSFSVLFPWTSGLDMKTRMARYSRTASLITIVRD  591

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
             +GSGE  +   ++Y +DKTD+EN++ GL + LRIL AAGAEE+G +   G  LK K    
Sbjct  592   RGSGEVKTEGRISYVVDKTDKENIKAGLRQSLRILIAAGAEEVGTHRSDGQILKCKGVDE  651

Query  475   EEFERFV----KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
             +  E F+     EE  + + +  N+  SAHQMGSCR+G + K   ++  GE+WE E LFV
Sbjct  652   KSIEEFLDSVSSEEGPKGMTEKWNIYCSAHQMGSCRIGENEKEGAIDVNGESWEAEKLFV  711

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT  203
              D S LP+A+GVNPM+T+MS +YCIS  + + + T
Sbjct  712   CDASALPSAVGVNPMITVMSTAYCISTRIAKSMTT  746



>ref|XP_008664883.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Zea mays]
 tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
Length=762

 Score =   531 bits (1367),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 314/758 (41%), Positives = 447/758 (59%), Gaps = 39/758 (5%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAIN------EALPETTDASVTNFFQTSAA  2234
             L R+ +    T  L P QME L A+C   +P++       +  P      +  FF+ SAA
Sbjct  10    LLRRCKREGYTHGLRPPQMEALRAMCGALIPSLPVEGLHVQPQPGRGKDDLDRFFRASAA  69

Query  2233  STGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLS---TQFPFLLRFP  2063
                 P +VA ++  R     +  + ++LW LSTRIGTL LCG+   S   + FP+  RF 
Sbjct  70    DGAIPDEVAEMVT-RCVWEGVLLMRIVLWVLSTRIGTLALCGRLCFSAGKSSFPYACRFA  128

Query  2062  EISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPD  1886
             ++  ++RER++  W+ +   F ++  F   K L    F+T V++  DNPSWKAIGY  P 
Sbjct  129   DMPVERRERVLQRWSGARWLFPLKITFVIAKLLSHYAFYTMVNENSDNPSWKAIGYSVPV  188

Query  1885  PSISekqkkqkhhdheddieELLF-GPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPP  1712
             P+ +    + +  +      E     PL  G+++  +L +  +   LT+ G +V K    
Sbjct  189   PAAAADVDRLRPRELGPAEAEAPSPRPLDSGVVETRSLNDATLLKSLTERGVAV-KAGVS  247

Query  1711  GPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFL  1532
             G    ++CD V+VGSGCGGGV + VLA AG KV+V+EKG+Y+   + + +EGPSM++++ 
Sbjct  248   GAHHTVQCDVVIVGSGCGGGVAAAVLAAAGRKVVVVEKGDYFTAESYTSVEGPSMERLYE  307

Query  1531  GGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAM  1352
              GG+  T ++  ++ AG+TVGGGSA+NWSAS++TP +V +EW   HGL +FG   Y  AM
Sbjct  308   KGGIFCTSNVTTIMFAGTTVGGGSAINWSASVRTPEWVTQEWAREHGLPMFGRPEYAHAM  367

Query  1351  DTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKK  1172
             D VC ++ V   C +E FQN VLR+GC  LG     +P+N+   H+CG C  GC  G K+
Sbjct  368   DAVCARLAVTGGCREEGFQNKVLRRGCEALGLRGDAVPRNSSEGHFCGSCHLGCPTGDKR  427

Query  1171  GTAETWLVDLVKSGNGAILPECEALQVIHE---------RNKAKGVMFTFQRDGVKQTAV  1019
             GT  TWLVD V  G   +L  C+A + + E          N+  G++ T   DG+ +   
Sbjct  428   GTDTTWLVDAVARG-AVVLTGCKAERFVLESNPGGRDGRSNRCVGLVATCMSDGITKKLR  486

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK---KSYE  848
             I++KV+V A GAL TP LL NSGL+N ++GRNLHLHPV  AWG+FPD+  E +   K YE
Sbjct  487   IEAKVSVSACGALMTPPLLRNSGLQNSHVGRNLHLHPVSMAWGYFPDSTPEAELSGKCYE  546

Query  847   GAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFA  668
             G I++ M  V           +IQTPAL PG +++L+PW SG++ K RM RYARTAH FA
Sbjct  547   GGIITTMRRVTART-------IIQTPALGPGCWASLVPWESGRDMKERMLRYARTAHAFA  599

Query  667   LARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK  488
             L RD+G+G       V Y   + D + L+ GL + LRIL AAGA E+G +   GL L+  
Sbjct  600   LVRDRGAGHVDGEGRVRYTPSREDVDELRNGLRQTLRILVAAGAAEVGTHRSDGLRLRCD  659

Query  487   DASREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
                 E+ E F+K+ + +     P      L  SAHQMGSCRMG  PK   V+ +GE+WE 
Sbjct  660   GLRDEDLEAFLKQVTVEKGPMVPGHDKWALHCSAHQMGSCRMGSSPKHGAVDGRGESWEA  719

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             EGL+V DGS+LPTA+GVNPM+TI S +YC+S+ + E L
Sbjct  720   EGLYVCDGSLLPTAVGVNPMITIQSTAYCVSKGIAESL  757



>ref|XP_008235630.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Prunus mume]
Length=760

 Score =   530 bits (1364),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 317/744 (43%), Positives = 447/744 (60%), Gaps = 47/744 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN------------EALPETTDASVTNFFQTSAASTGTPHQ  2213
              SP+Q+++L+A+C   +P ++            E  P+  D ++ + ++ S +    P +
Sbjct  25    FSPAQIQSLAAICEALVPPLSLEDTINNNNNNKEESPD--DQALHSIYRASGSQPPIPDE  82

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++ +R     L  + L L  LS R+GTLLLC    LS ++PF+  F E+S +KRE +
Sbjct  83    VAELMVKRALPEVLEGMKLFLKMLSFRLGTLLLCRHRCLSWKWPFIHSFSEMSLEKREEV  142

Query  2032  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             +  W+   L   +R  F  +K      FF+ +D+   NP+WKA+GY   D + ++K  K 
Sbjct  143   LKKWSREKLVLTLRLMFLVVKIFCFYTFFSWLDENSRNPAWKAVGY---DLNTNKKLIKT  199

Query  1855  khhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL +GII+ +N  +  +   LTK G  V+          I+CD V
Sbjct  200   PKER-----------PLEQGIIETMNESDSTLVQSLTKRGLRVSDDTTHN-LHKIQCDVV  247

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + VLA +G KV+V+EKGNY+   + S LEGPSM++++  GG++ + D  
Sbjct  248   IVGSGCGGGVAAAVLAESGQKVIVVEKGNYFLPKDYSSLEGPSMNELYESGGIMSSVDGM  307

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             +++LAGSTVGGGSA+NWSASI+TP  VL EW   H + L+ S  Y+ AMD VC ++ V  
Sbjct  308   IMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVRLYASSDYKSAMDVVCKRIRVTD  367

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C +E+FQN +LRKGC  LG  V  +P+N+P DHYCG C +GC  G K+GT  TWLVD V
Sbjct  368   SCTEENFQNQILRKGCDTLGLKVDLVPRNSPGDHYCGSCNYGCPTGEKQGTDSTWLVDAV  427

Query  1138  KSGNGAILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGA  983
             K G   IL  C+A + I E        R +  GV  T     +K+   I++KVT+ A G+
Sbjct  428   KCG-AVILTGCKAEKFILENDSQGGGTRKRCLGVEATSLGKNIKKKLQIEAKVTISACGS  486

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNV  806
             L TP L+I+SGLKN NIG NLHLHPV+ +WG+FP+   E + ++YEG I++++  VV + 
Sbjct  487   LLTPPLMISSGLKNPNIGTNLHLHPVLLSWGYFPEHESEFRGRTYEGGIITSLHKVVSDT  546

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
               T   A+I+TPAL P  F++L PW S  + K RM +YARTAH+FAL RDKGSG      
Sbjct  547   --TNVRAIIETPALGPASFASLSPWISRLDMKDRMEKYARTAHLFALVRDKGSGVVKREG  604

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----  458
              + Y LD+ D+ENLQ GL + LRIL AAGA E+G     G  +K K    E+ E F    
Sbjct  605   RIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRNDGQRIKCKGTKHEDLEEFLDTV  664

Query  457   VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
             V      S  +   + +SAHQMGSCRM    +   V+  GE+WE +GLFV DGS+LPTA+
Sbjct  665   VAPAGPSSREELWTIYSSAHQMGSCRMSASEEEGGVDENGESWEAKGLFVCDGSLLPTAI  724

Query  277   GVNPMVTIMSVSYCISQSVLEFLK  206
             GVNPM+TI S +YCIS+ + E L+
Sbjct  725   GVNPMITIQSTAYCISKKIAESLE  748



>ref|XP_006857358.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
 gb|ERN18825.1| hypothetical protein AMTR_s00067p00112750 [Amborella trichopoda]
Length=798

 Score =   531 bits (1367),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 315/768 (41%), Positives = 441/768 (57%), Gaps = 67/768 (9%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAASTGTPHQ-----  2213
              + +Q+++L+A+C   +P+       ++         S+ +F++ S +    P Q     
Sbjct  25    FTKAQIQSLTAICEALIPSMPITALHVSSQRDPPPSPSLVSFYKASGSDYQVPDQALFRS  84

Query  2212  ------VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  2051
                   VA ++ +R     +  +  +LW LSTR+GTLLLCG   LS  FPF+  F E+  
Sbjct  85    RNSETFVAELMVKRGLPDAVTLVSWVLWALSTRLGTLLLCGSTCLSLNFPFIRSFSEMPV  144

Query  2050  KKRERIVHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI  1877
             +KRE+++ +W+     F  +R  F   K   + VF++  D    NPSW+AI Y       
Sbjct  145   EKREKVLMAWSRERSFFSALRLSFALFKIFCVYVFYSWTDVNSKNPSWEAIDYSPGPLKP  204

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
              +    +   D                I    L +E + + +   G +V +  P      
Sbjct  205   PKNPPPKSFKDSI--------------ISTTTLTKESLVSTIKTKGITVTE-DPSADLLT  249

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             +ECDAVVVGSG GG V +  LA +GY+VLVLEKG Y+   + SLLEGPSMD+M+  GG+L
Sbjct  250   LECDAVVVGSGPGGSVAAAKLAKSGYQVLVLEKGLYFTPQDYSLLEGPSMDQMYESGGIL  309

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              T D  +++ AGSTVGGGSA+NWSA IKTP  VL++W E   L LFGS  Y+ AM+ VC 
Sbjct  310   STTDAKVLITAGSTVGGGSAINWSACIKTPDKVLKQWSEDFSLSLFGSHNYRAAMEAVCK  369

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV  +CE E+FQN V R GC  LG  V  +P+N+P  HYCG C +GC+ G K+GT  T
Sbjct  370   RLGVTEKCEKENFQNEVFRSGCERLGLKVEFVPRNSPEGHYCGQCGYGCRTGEKQGTQCT  429

Query  1156  WLVDLVKSGNGAILPECEALQVIHERN-----KAKGVMFTFQRD----------------  1040
             WLVD  ++G   I    +A + +   N     K  G  ++ +RD                
Sbjct  430   WLVDAAEAG-ALIFTGVKAKKFVMRENDGLERKESGKPWSRERDQRCVGVMAVTGCKVNQ  488

Query  1039  -GVKQT--AVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTP-  872
              G K +   +IK+K++V A G+L TP LLI+SGL+N NIGRNL LHPV  AWG+FP+   
Sbjct  489   KGKKSSLRLMIKAKLSVSACGSLLTPPLLISSGLRNPNIGRNLRLHPVSMAWGYFPEQDC  548

Query  871   GEN--KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMS  698
             GE+   K Y+G I++++  +VL       G +I+TP L P  FSA+ PW SG E K  M 
Sbjct  549   GESLRGKCYQGGIITSIHKLVLENQDHDSGVIIETPFLGPASFSAIFPWLSGSEMKEAMR  608

Query  697   RYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCN  518
             RYART HIF L RD GSGE      +TY+L +TD E  ++GL   LRIL AAGA E+G +
Sbjct  609   RYARTVHIFVLVRDTGSGEVMKERKITYNLHRTDREKFKKGLRTALRILVAAGAVEVGTH  668

Query  517   HGTGLTLKVKDASREEFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVV  350
                G  +K K    E+FE F+        + S  +  NL  SAHQMGSCRMG D + S V
Sbjct  669   RSDGQRIKTKGMRDEDFEEFLDGIEVFGGAYSGEEKWNLYTSAHQMGSCRMGADEEKSAV  728

Query  349   NPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             + +GE+WE EGLFV DGS++PTALGVNPM+T+ S+++CIS +++EFL+
Sbjct  729   DERGESWEAEGLFVCDGSLMPTALGVNPMITVQSIAHCISDNMVEFLR  776



>ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
Length=747

 Score =   529 bits (1363),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 327/759 (43%), Positives = 441/759 (58%), Gaps = 45/759 (6%)
 Frame = -3

Query  2395  LHRKMENNTA--TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             +H  ++   A    +L P Q+E ++A+C+TFLPA+     E  + +   FF TSA+  G 
Sbjct  1     MHPDLQGGQAPFAHSLDPPQLEAVAAICDTFLPALPLRALECEEEAQRAFFATSASDAGI  60

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P QVA  I + +   +   +L +L  LS+RIGTL+LCG+ + S +FPFL RF  +    R
Sbjct  61    PAQVAGWIFECLDSAQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNR  120

Query  2041  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             ER + SW+  S+    + +   K   +  FFT  D +G N SWKAIGY  PDP  +  + 
Sbjct  121   ERTLRSWSGGSIAQFHSLYKLFKCFAMFAFFTKADARGRNDSWKAIGYPVPDPLWNGLKD  180

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPS-------  1703
                    +D+ E     PL    +  N   E V + L+     V++    G         
Sbjct  181   DDDAKVTDDNEEPR--PPLRVFDVHQNSAAELV-DYLSSSKFRVSEEVRDGGDGGSGQAM  237

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I+CD VV+GSGCGGGV +GVL+  GYKV+V+EKG YY    LSLLEGPSM  M+ GGG
Sbjct  238   LAIDCDVVVIGSGCGGGVCAGVLSQKGYKVVVIEKGKYYVGDQLSLLEGPSMRAMYEGGG  297

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             LL T D  + L+AGSTVGGG+ +NW+AS++TP  V  EW  VHGL+LF S+ Y+ AMD V
Sbjct  298   LLTTADGGINLMAGSTVGGGTVMNWAASLRTPQAVREEWSSVHGLKLFTSEEYEAAMDKV  357

Query  1342  CGKMGVQ---RECEDESFQNMVLRKGCRELGYPVVNIPQNAPSD-HYCGWCTFGCKDGRK  1175
             C ++GV+    E E ESFQN VLR GC+++G  V  IP N     H CG C FGCK   K
Sbjct  358   CERLGVETLGNEEEHESFQNKVLRSGCKKIGLDVETIPTNCRGRRHKCGLCGFGCKSRTK  417

Query  1174  KGTAETWLVDLVKSGNGAILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAV  1019
             +GT ETWL+D V +G   IL  C A +++ E        + KA GV+ T    G  ++  
Sbjct  418   QGTHETWLMDAVDAG-AVILCGCNAERILLEPGELRSAKQWKAGGVIAT----GGGKSLF  472

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG-ENKKSYEGA  842
             I++K TV + GAL TP LL  SGL N++IG NLHLHP    WG+ P   G    +  +G 
Sbjct  473   IRAKATVTSCGALNTPVLLQKSGLVNRHIGSNLHLHPSQLLWGYVPSGEGLPAGRISDGP  532

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             IMSA+S +          AV++ PA +PG    + PW SG  FK +M RY+R AH+  + 
Sbjct  533   IMSAVSRIA--------DAVLEVPAFYPGGLGVMFPWRSGLSFKEQMLRYSRLAHVVVIT  584

Query  661   RDKGSGEAFSPT-------SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             RD+GSG     +        VTY +   DE+ L+ G EK +R+L AAGA E+G  H  G 
Sbjct  585   RDRGSGTVRPSSSSSSQLPKVTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGD  644

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
             +L V+ +  +  E+F++   S+ L       ASAHQMGSCRMG DP +S V+P+GE WE 
Sbjct  645   SLVVEGSDEKALEKFLRVIGSKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWES  704

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              GLFV D SV PTALGVNPMVT  SV+ CI++SV  FL+
Sbjct  705   TGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVHRFLE  743



>ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
Length=747

 Score =   529 bits (1362),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 327/759 (43%), Positives = 441/759 (58%), Gaps = 45/759 (6%)
 Frame = -3

Query  2395  LHRKMENNTA--TKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             +H  ++   A    +L P Q+E ++A+C+TFLPA+     E  + +   FF TSA+  G 
Sbjct  1     MHPDLQGGQAPFAHSLDPPQLEAVAAICDTFLPALPLRALECEEEAQRAFFATSASDAGI  60

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P QVA  I + +   +   +L +L  LS+RIGTL+LCG+ + S +FPFL RF  +    R
Sbjct  61    PAQVAGWIFECLDSAQQAGVLRVLSLLSSRIGTLILCGRHAFSAEFPFLHRFARLPASNR  120

Query  2041  ERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             ER + SW+  S+    + +   K   +  FFT  D +G N SWKAIGY  PDP  +  + 
Sbjct  121   ERTLRSWSGGSIAQFHSLYKLFKCFAMFAFFTKADARGRNDSWKAIGYPVPDPLWNGLKD  180

Query  1861  kqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPS-------  1703
                    +D+ E     PL    +  N   E V + L+     V++    G         
Sbjct  181   DDDAKVTDDNEEPR--PPLRVFDVHQNSAAELV-DYLSSSKFRVSEEVRDGGDGGSGQAM  237

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I+CD VV+GSGCGGGV +GVL+  GYKV+V+EKG YY    LSLLEGPSM  M+ GGG
Sbjct  238   LAIDCDVVVIGSGCGGGVCAGVLSQKGYKVVVIEKGKYYVGDQLSLLEGPSMRAMYEGGG  297

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             LL T D  + L+AGSTVGGG+ +NW+AS++TP  V  EW  VHGL+LF S+ Y+ AMD V
Sbjct  298   LLTTADGGINLMAGSTVGGGTVMNWAASLRTPQAVREEWSSVHGLKLFTSEEYEAAMDKV  357

Query  1342  CGKMGVQ---RECEDESFQNMVLRKGCRELGYPVVNIPQNAPSD-HYCGWCTFGCKDGRK  1175
             C ++GV+    E E ESFQN VLR GC+++G  V  IP N     H CG C FGCK   K
Sbjct  358   CERLGVETLGNEEEHESFQNKVLRSGCKKIGLDVETIPTNCRGRRHKCGLCGFGCKSRTK  417

Query  1174  KGTAETWLVDLVKSGNGAILPECEALQVIHE--------RNKAKGVMFTFQRDGVKQTAV  1019
             +GT ETWL+D V +G   IL  C A +++ E        + KA GV+ T    G  ++  
Sbjct  418   QGTHETWLMDAVDAG-AVILCGCNAERILLEPGELRSAKQWKAGGVIAT----GGGKSLF  472

Query  1018  IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG-ENKKSYEGA  842
             I++K TV + GAL TP LL  SGL N++IG NLHLHP    WG+ P   G    +  +G 
Sbjct  473   IRAKATVTSCGALNTPVLLQKSGLVNRHIGSNLHLHPSQLLWGYVPSGEGLPAGRISDGP  532

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             IMSA+S +          AV++ PA +PG    + PW SG  FK +M RY+R AH+  + 
Sbjct  533   IMSAVSRIA--------DAVLEVPAFYPGGLGVMFPWRSGLSFKEQMLRYSRLAHVVVIT  584

Query  661   RDKGSGEAFSPT-------SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
             RD+GSG     +        VTY +   DE+ L+ G EK +R+L AAGA E+G  H  G 
Sbjct  585   RDQGSGTVRPSSSSSSQLPKVTYTISAEDEKTLKAGAEKAIRVLIAAGAVEVGTQHPDGD  644

Query  502   TLKVKDASREEFERFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEV  323
             +L V+ +  +  E+F++   S+ L       ASAHQMGSCRMG DP +S V+P+GE WE 
Sbjct  645   SLVVEGSDEKALEKFLRVIDSKQLTHAAMATASAHQMGSCRMGNDPASSAVDPRGEAWES  704

Query  322   EGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
              GLFV D SV PTALGVNPMVT  SV+ CI++SV  FL+
Sbjct  705   TGLFVADTSVFPTALGVNPMVTAQSVALCIAKSVHRFLE  743



>emb|CDX85097.1| BnaC07g08090D [Brassica napus]
Length=743

 Score =   529 bits (1362),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 315/751 (42%), Positives = 451/751 (60%), Gaps = 46/751 (6%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAI---NEALPET----TDASVTNFFQTSAASTGTPH  2216
             N   + ++ ++ME+L++ C   LP +    E L E        ++ +F+ T  + T    
Sbjct  9     NFGQREITAAEMESLASFCEAVLPPVPHPEELLGEDDHHPNKEALRSFYTTCGSQTPVAR  68

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             Q   +I +R       +  L+L+ L+TR+GTLL+CG   L + +PF+ +F E+S +KRER
Sbjct  69    QTIDLIIKRGTMEAYLAARLVLFLLATRLGTLLICGTECLVSSWPFVEKFSELSLEKRER  128

Query  2035  IVH-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqk  1862
             ++   +    L  IR  F  +K   L  FF+ V   G+NP+W+AIGY    D +   + +
Sbjct  129   VLQKQFRNWFLTPIRAAFVYIKVAFLFCFFSRVSSNGENPAWEAIGYRVNLDENKPSETQ  188

Query  1861  kqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
             K++              PL KG+++ +   E+ +   LT+ G    +      +  I+CD
Sbjct  189   KER--------------PLEKGVVETMKETEQTLLESLTQKGL---ESDTDHDAIRIKCD  231

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
             AVVVGSG GGGV + VLA AG KV+V+EKG+Y   ++    EG  M+K++  GG+L + D
Sbjct  232   AVVVGSGSGGGVAASVLAKAGLKVVVMEKGSYCTESDYPPFEGHGMEKLYENGGILPSID  291

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
               +++LAG+TVGGGSAVNWSA IKTP  VL+EW E H + LFG+  Y  AMD +  +MGV
Sbjct  292   GCLMILAGATVGGGSAVNWSACIKTPKSVLQEWSEDHKIPLFGTKEYVSAMDLMWKRMGV  351

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                CE E FQN VLRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  TWLVD
Sbjct  352   TETCEKEGFQNQVLRKGCENLGINVQNVARNSSEKHYCGSCGYGCRQGEKKGSDRTWLVD  411

Query  1144  LVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
              V  G   +L  C+A + I E N          K  GV+       + +   I++KVTV 
Sbjct  412   AVSHG-AVVLTGCKAERFILENNGNKNRGGKKMKCLGVLAKSLNGNIAKKIKIEAKVTVS  470

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN--KKSYEGAIMSAMST  821
             A G+L TP L+I+SGL+N++IG+NLHLHPV+ AWG FPD    +   KSYEG I+++MS 
Sbjct  471   AAGSLLTPPLMISSGLRNRHIGKNLHLHPVLMAWGFFPDKESSSFKGKSYEGGIITSMSK  530

Query  820   VVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGE  641
             V+     +   A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE
Sbjct  531   VL--SEDSEVRAIIETPALGPASFSVLCPWTSGVDMKKRMSRYSRTANLITIVRDRGSGE  588

Query  640   AFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFER  461
               +   ++Y +DKTD+ENL+ GL + LRIL AAGAEE+G +   G  L  K    +  E 
Sbjct  589   VKTEGRISYVVDKTDKENLRAGLRQSLRILIAAGAEEVGTHRSDGQKLVCKGVDEKSIEE  648

Query  460   FVK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
             F+     EE  +++ +   + +SAHQMGSCR+G D K   ++  GE+WE E LFV DGSV
Sbjct  649   FLDSVSAEEGPKAMTEKWGVYSSAHQMGSCRIGEDEKEGALDLNGESWEAERLFVCDGSV  708

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             LP+A+GVNPM+TIMS +YCIS  +++ + T 
Sbjct  709   LPSAVGVNPMITIMSTAYCISTRIVKSMTTR  739



>ref|XP_008364320.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Malus domestica]
Length=743

 Score =   528 bits (1361),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 318/734 (43%), Positives = 440/734 (60%), Gaps = 36/734 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPETTDA---SVTNFFQTSAASTGTPHQVAWVINQR  2189
              S +QM++L+A+C   +P ++ E +P+   A   S +++   S +    P +VA +I +R
Sbjct  25    FSSAQMQSLAAICEALIPPLSLEEIPDDHQALHYSSSSYHTASGSQPPIPDEVAEMIVKR  84

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS  2009
              +   ++++ L L  LS R+GT LLCGK     ++PF+ +F E S  KRE++++ W+   
Sbjct  85    AQPEAVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEXSLDKREQVLNKWSRGK  144

Query  2008  LQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
             L   IR  F  +K      FF+ +D+   NP+WKAIG+   D    EK  K         
Sbjct  145   LVITIRLMFMVVKMFCFYTFFSRIDENSRNPAWKAIGF---DLDKKEKLIKTPKER----  197

Query  1831  ieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                    PL KGII+ +   +  +   LTK G  VA          I CD V+VGSGCGG
Sbjct  198   -------PLDKGIIETVYESDSTLVQSLTKKGLEVAD-DAANNIHRINCDVVIVGSGCGG  249

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA +G KV+VLEKGNY+   + S LEGPSM +++  GG++ + D  +++LAGST
Sbjct  250   GVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMASVDAMVMILAGST  309

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSASI+TP  VLREW   H + L+ S+ YQ AMD VC ++ V   C +E+FQ
Sbjct  310   VGGGSAVNWSASIRTPHNVLREWSVDHKIPLYASEDYQSAMDIVCKRISVTEGCTEENFQ  369

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N +LRKGC  LG  V ++P+N+ +DHYCG+C +GC  G KKGT  TWLVD V+ G   IL
Sbjct  370   NQILRKGCENLGLKVESVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVECG-AVIL  428

Query  1114  PECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
               C+A + I E       R +  GV  T     +K+   I++KVT+ A G+L TP L+I+
Sbjct  429   TGCKAEKFILESDNDGGRRKRCLGVQATSXSKNIKRKLKIEAKVTISACGSLLTPPLMIS  488

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGLKN+NIGRNLHLHPV+ +WG+FP    E   K YEG I++++  VV         A+I
Sbjct  489   SGLKNRNIGRNLHLHPVLLSWGYFPQHESEFXXKKYEGGIITSIHKVVSETANA--RAII  546

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +T  L P  F+ L PW S  + K +M +YARTA++FAL RD  SG       V Y LD+ 
Sbjct  547   ETAVLGPASFATLSPWISRLDMKDKMEKYARTANLFALVRDXSSGVVKREGRVHYTLDQL  606

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF---VKEESSQSLR  428
             D+ENL  GL + LRIL AAGA E+G     G  +K K    E+ E F   V   +  S R
Sbjct  607   DKENLLAGLRQALRILIAAGAVEVGTYRNDGQRIKCKGVKEEDLEEFLDTVVTSAGPSAR  666

Query  427   KHP-NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
             +    + +SAHQMGSCRMG   +   V+  GE+WE +GLFV D S+LPTA+GVNPM+TI 
Sbjct  667   EELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPMITIE  726

Query  250   SVSYCISQSVLEFL  209
             S +YCIS+ + + L
Sbjct  727   STAYCISKKIAQSL  740



>ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
Length=760

 Score =   528 bits (1361),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 312/752 (41%), Positives = 439/752 (58%), Gaps = 51/752 (7%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAINEALPETT----------DASVTNFFQTSAASTGTPH  2216
             T  L  +QME L A+C  F+P++ EA               D  +  F+  SAA    P 
Sbjct  25    THGLGAAQMEALRAICGAFIPSLPEAAAALAEADDEGRGGGDKDLERFYLASAADAAVPD  84

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ------FPFLLRFPEIS  2054
             +VA ++  R     +  + ++LW L+TR GTL LCG  +           P + RF ++ 
Sbjct  85    EVAELMVNRCAWEAVALVTVVLWLLATRAGTLALCGAAACVASSAAGGWLPSVRRFADLP  144

Query  2053  QKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI  1877
              ++RE  +  W+++   F ++  FT +K +   VF+T +D+K  NPSWKAIGY  P  + 
Sbjct  145   PERREAALRRWSSARWLFPLKITFTVIKIICHFVFYTKLDEKSRNPSWKAIGYAAPAAAA  204

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSF  1700
             +  ++++               PL  G+++    +++   R L + G +V          
Sbjct  205   AAVEQRRPASPSRR--------PLEDGVVETRRMDDNALLRSLVEKGLAVKTGT--AAHH  254

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              ++CDAVVVGSGCGGGV + VLA+ GYKV+V+EKG+Y+A  + + LEGPSM++++  GG+
Sbjct  255   TVQCDAVVVGSGCGGGVAAAVLASKGYKVVVVEKGDYFATEDYTSLEGPSMERLYEKGGV  314

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               T ++  +L  G+TVGGGSAVNWSA I+TP  +  EW   HGL +F S  Y +AMD VC
Sbjct  315   FGTSNVTTILFTGATVGGGSAVNWSACIRTPAEIREEWSREHGLPVFASTAYAQAMDAVC  374

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++ V   CE+E FQN VLR+GC  LG     +P+N+   H+CG C  GC  G KKGT  
Sbjct  375   DRIRVTGGCEEEGFQNRVLRRGCDALGMRADAVPRNSSEGHFCGSCNLGCPTGDKKGTDT  434

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSK  1007
             TWLVD V+ G   IL  C+A   I ERN         +  G+M T    G+ +   I++K
Sbjct  435   TWLVDAVERG-AVILTGCKAEHFILERNAGGRGGRSKRCVGLMATCTSSGITKKLRIEAK  493

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSA  830
             V++ A GAL TP LL NSGLKN++IGRNLHLHPV  AWG+FPD+  E   K YEG I+++
Sbjct  494   VSISACGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKCYEGGIITS  553

Query  829   MSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKG  650
             M  V           +I+TPAL PG FSA++PW SG++ K RM RYARTAH FAL RD+G
Sbjct  554   MHRVTDRT-------IIETPALGPGAFSAVVPWESGRDMKERMRRYARTAHAFALVRDRG  606

Query  649   SGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREE  470
             +G       V +   + D E L+ GL + LRIL AAGA E+G +   GL L+ K     +
Sbjct  607   AGAVDGEGRVRFSPSRDDAEELRAGLRRALRILVAAGAAEVGTHRSDGLRLRCKGVRDAD  666

Query  469   FERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
              E F+ E + +    +P      +  SAHQMGSCRMG  P+   V+  GE+WE EGL+V 
Sbjct  667   VEAFLDEVTIEKGPMYPGSDKWAIFCSAHQMGSCRMGASPRDGAVDGAGESWEAEGLYVC  726

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             DGS+LPTA+GVNPM+TI S++YC+S  + + L
Sbjct  727   DGSLLPTAVGVNPMITIQSIAYCLSNGIADTL  758



>ref|XP_010670985.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Beta vulgaris subsp. 
vulgaris]
Length=748

 Score =   527 bits (1358),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 322/749 (43%), Positives = 450/749 (60%), Gaps = 46/749 (6%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLPAINEALP----ETTDASVTNFFQTSAASTGTPHQ  2213
             + N   + LS S+ME+L ++C TF P ++        +  + S+  FFQ+SA+    P++
Sbjct  16    KKNYDRQLLSSSEMESLISICETFFPPLDPPSKLDHHDQINNSIKYFFQSSASQKPIPNE  75

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA V+  R     +  + ++LW +STR+GTLLLCG      ++P++ +F  +  ++RERI
Sbjct  76    VAEVMKDRGLVEAVILVRVVLWLISTRLGTLLLCGFLCFGKEWPYITKFSHLPIERRERI  135

Query  2032  VHSWATSSLQF---IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             + +W  SS +F   +R  F  +K+L L   F+ VDD   NP+W+AI Y  PD + S+   
Sbjct  136   LKNW--SSHRFFSPLRLVFYFLKSLCLYFCFSLVDDHAHNPAWEAIDY-KPDTTNSKAIN  192

Query  1861  kqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
             +++              PL  GII+        +   LT  G SV +       + I+CD
Sbjct  193   QER--------------PLENGIIETFYETPTTLLQSLTSKGLSVTEDHIDN-LYRIKCD  237

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
              V+VGSGCGGGV + +LA AG KV+VLEKGNYY   + S LEGPSMD++   GG++ T D
Sbjct  238   VVIVGSGCGGGVAAAILAGAGQKVVVLEKGNYYTAPDYSSLEGPSMDELLEKGGMIPTTD  297

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
               ++LLAGSTVGGG+AVNWSA++ TP  VL+EW E HGL LFGS  Y+ AM +V  ++GV
Sbjct  298   GAVMLLAGSTVGGGTAVNWSAALNTPDPVLKEWSEEHGLSLFGSPQYKFAMQSVTQRLGV  357

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
               EC  E FQN VLRKGC  LG     +P+N+   HYCG C +GC+   K+GT  TWLVD
Sbjct  358   TTECVKEGFQNQVLRKGCENLGLEADRVPRNSSESHYCGSCYYGCRSADKQGTDVTWLVD  417

Query  1144  LVKSGNGAILPECEALQ---VIHER---NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGA  983
              V  G   I+  C+A +   V H R   N+  GV+     + +K+   I++KVT+ A G+
Sbjct  418   AVNLG-AVIITGCKAEKLRLVKHGRRRENRCIGVVARSLNNEIKRELQIEAKVTISACGS  476

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFP---DTPGENKKSYEGAIMSAMSTVVL  812
             L TP LL++SGL+NK IG+NLHLHP +  WG+FP    T     KSYEG ++++   V+L
Sbjct  477   LRTPPLLMSSGLRNKKIGKNLHLHPSLMVWGYFPPQGPTSEFEGKSYEGGLITSAHRVIL  536

Query  811   NVNGTGY-GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
             +        A+I+TPAL P   +AL PW SG + K RM RY+RTAH+F + RDKGSGE  
Sbjct  537   DQRPNSMPRALIETPALGPAACAALSPWESGNDIKKRMLRYSRTAHLFVMVRDKGSGEVK  596

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
             S   ++Y+L + D EN+  GL + L+IL AAGA E+G     G  ++    + EE E F+
Sbjct  597   SERRISYELTQEDRENMTAGLRRALKILIAAGAVEVGTYRSDGQRIECIGKNEEEIEEFL  656

Query  454   KEESSQSLRKHP------NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSV  293
                 S S  K P       +  +AHQMGSCRM        V+  GE+WE EGLFV DGSV
Sbjct  657   ---GSVSATKGPMAACFWAVYCTAHQMGSCRMSKRENEGAVDENGESWEAEGLFVCDGSV  713

Query  292   LPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             LP+A+GVNPM+TI S +YCI++ + E LK
Sbjct  714   LPSAVGVNPMITIQSTAYCIAKKLAESLK  742



>ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
Length=762

 Score =   527 bits (1358),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 321/755 (43%), Positives = 457/755 (61%), Gaps = 44/755 (6%)
 Frame = -3

Query  2380  ENNTATKTLSPSQMETLSALCNTFLP-----AINE------ALPETTDASVTNFFQTSAA  2234
             EN+      S ++ME+L+++C   LP     A+N+         + +   V +F   SA+
Sbjct  14    ENSKYKHGFSVAEMESLTSICEVVLPSLPVDAMNQRKDDQHDDDDESRKHVQSFLNLSAS  73

Query  2233  STGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEIS  2054
                 PH+VA  + +R     +  + ++LW L+TR+GTLLLCG   LS ++PF+ +F  +S
Sbjct  74    QYPIPHEVAEALVKRGLIEAVMLIRVVLWLLATRLGTLLLCGFLCLSKEWPFVNKFSSMS  133

Query  2053  QKKRERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPS  1880
               KRE+IV  W     L  IR  F  +K L   VFF+ VD+ GDNP+WKAIGY   P+  
Sbjct  134   LDKREKIVQRWLKHRFLTPIRVAFGYIKVLCHFVFFSWVDENGDNPTWKAIGYEVSPNEK  193

Query  1879  ISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPS  1703
             ++   K+ +              PL KGII+     +    + L+  G +V         
Sbjct  194   MTNVSKESEER------------PLEKGIIETMHEHDSTLQKSLSDKGLNVI-VDSKNNI  240

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               I+CDAVVVGSG GGGV + VL+ AGYKV+VLEKGNY+   + S LEGPSM++ +  GG
Sbjct  241   LKIKCDAVVVGSGSGGGVAASVLSNAGYKVIVLEKGNYFVPKDYSSLEGPSMNQQYECGG  300

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             +L++ D  +++LAGSTVGGGSA+NWSA +KTP  V++EW E H L +F S  Y  AM+TV
Sbjct  301   MLVSADSRILVLAGSTVGGGSAINWSACLKTPQEVIKEWSEKHKLSMFSSLEYLSAMETV  360

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C ++GV + C  E FQN VLRKGC+ LG  V  +P+N+  +HYCG C +GC  G K GT 
Sbjct  361   CERIGVNQNCTQEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHYCGSCGYGCPKGEKLGTQ  420

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHERN----KAK---GVMF-TFQRDGVKQTAVIKSK  1007
              TWLVD V+ G   I+  C+A + + + N    K K   GV+  T     V     I++K
Sbjct  421   VTWLVDAVEKG-AVIITGCKAEKFLFQTNNNTRKKKSCLGVLAKTLNNTRVTMKLQIEAK  479

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKS--YEGAIMS  833
             VTV + GAL TP L+I SGLKNKNIGRNLHLHPV+  WG+FP++   + K   YEG I++
Sbjct  480   VTVSSCGALLTPPLMITSGLKNKNIGRNLHLHPVLMTWGYFPESKNLDLKGKVYEGGIIT  539

Query  832   AMSTVVLNVNGTGYG-AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             ++  ++ + +   Y  A+I+TP + P  F+++ PW SG +FK RM  Y+RT+H   + RD
Sbjct  540   SVHKLLSSNDSNSYTRAIIETPLIGPASFASMCPWESGLDFKQRMLNYSRTSHFITIIRD  599

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
                G+  S   ++Y L++ D+EN++ GL++ LRIL AAGA+E+G +   G  +K  + S 
Sbjct  600   SSCGKVTSEGRISYKLNEIDKENIRSGLQQALRILIAAGADEVGTHRSDGQRIKCSEKSE  659

Query  475   EEFERFVKEESSQSLRKHP-----NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
              E E F++          P     N+  SAHQMGSCRMGV+ K   V+  GE+WE EGLF
Sbjct  660   IEIEEFIESVCPMEGALLPGNEKWNIYTSAHQMGSCRMGVNEKEGGVDENGESWEAEGLF  719

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             V D SVLPTA+GVNPM+T+ S +YCIS  ++++L+
Sbjct  720   VCDASVLPTAVGVNPMITVQSTAYCISNRIVDYLR  754



>ref|XP_008785203.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Phoenix dactylifera]
Length=758

 Score =   527 bits (1357),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 306/740 (41%), Positives = 446/740 (60%), Gaps = 40/740 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPA-------INEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
              SPSQ+++L+A+C   +P+       ++    +    S+  F+  S + +  P +VA ++
Sbjct  30    FSPSQIQSLAAMCEALIPSLPMEELHVSSGKEDPPTKSLQAFYLASGSESPVPDEVAELL  89

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
              +R     +  + L+LW L+T++GTL+LCG  SL   FPF+ +F ++  +KRE ++  W 
Sbjct  90    VKRGLREAVLLVKLVLWLLATKLGTLVLCGFLSLRGGFPFINKFSDMPVEKREEVLKRWN  149

Query  2017  TSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdh  1841
               +    +R  F  +K     +F++  ++  +N SW AIGY  P      K ++++    
Sbjct  150   KENFFIPLRMVFVMVKVFCFHIFYSMTNENSENLSWNAIGYSLPTEEKPRKSQRER----  205

Query  1840  eddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
                       PL KGII+ ++  +  +   L K G +V++  P    + I CD  +VGSG
Sbjct  206   ----------PLEKGIIETMDQTDASLLESLAKKGLTVSQ-DPMQNIYRIRCDVAIVGSG  254

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
             CGGGV + VLA+AG KV+V+EKGNY+   + + +E PSM +++  GG+  T D  ++LLA
Sbjct  255   CGGGVAAAVLASAGRKVVVIEKGNYFTSEDYTSIEAPSMYELYESGGIHSTVDGKVMLLA  314

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             GSTVGGGSAVNW+A IKTP +VLREW E   L LF S  Y  AMD VC ++GV   C +E
Sbjct  315   GSTVGGGSAVNWAACIKTPDHVLREWAEERQLPLFTSTDYLSAMDAVCRRLGVTESCSEE  374

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
              FQN VLRKGC+ LG  V ++P+N+   H+CG C +GC+ G K+GT  TWLVD V  G  
Sbjct  375   GFQNKVLRKGCQNLGLRVDSVPRNSSESHFCGSCCYGCRAGDKRGTDATWLVDAVDCG-A  433

Query  1123  AILPECEALQVI--------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPS  968
             AIL  C+A + +         +R K  G++       V +   I++KVT+ A G+L TP 
Sbjct  434   AILTGCKAERFVFVENEPGEKKRKKCVGLIARSSSHKVTKKLEIEAKVTISACGSLLTPP  493

Query  967   LLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNG-TG  794
             L+I SGL N NIGRNL LHP   AWG+FPD+  + + +++EG I++++  V    N    
Sbjct  494   LMIASGLANPNIGRNLRLHPAALAWGYFPDSVSDLRGRAFEGGIITSLHEVRAQENSDAS  553

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS-VT  617
               A+I+TPAL P  F+ L+PW SG++ K RM+RY+RTAH+FAL RD+GSG        V 
Sbjct  554   LRAIIETPALGPAAFATLVPWVSGRDMKERMARYSRTAHLFALVRDRGSGTVEGKEGIVR  613

Query  616   YDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS-  440
             Y  D  D EN++ GL + LRIL AAGA E+G +   G  +K K    E+ E F+   ++ 
Sbjct  614   YRFDGLDRENMREGLRRALRILVAAGAVEVGTHRSDGQRIKCKGIKEEDLEEFLDGITAV  673

Query  439   ---QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVN  269
                +S  +   +  SAHQMGSCRMGV  +   V+ +GE+WE +GLFV DGSVLPTALG+N
Sbjct  674   GGPRSRSELWTIYGSAHQMGSCRMGVSEEEGGVDERGESWEAQGLFVCDGSVLPTALGIN  733

Query  268   PMVTIMSVSYCISQSVLEFL  209
             PM+TI SV+YC+S+ + E L
Sbjct  734   PMITIQSVAYCLSKGIAESL  753



>ref|XP_007162567.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
 gb|ESW34561.1| hypothetical protein PHAVU_001G162800g [Phaseolus vulgaris]
Length=729

 Score =   526 bits (1354),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 323/734 (44%), Positives = 452/734 (62%), Gaps = 55/734 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             LS SQM  ++++CNT  P++  N    ET+      +  TSA+     H+ A ++++R+ 
Sbjct  24    LSTSQMHVMASICNTLFPSLPLNPLTNETSQPLSPCYNNTSAS-----HEAAELLHKRVV  78

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
                L+ +  +LW LS R+GTLL+CG+  L  ++PF+ +F EIS +KRE I+ +W+     
Sbjct  79    PEALSLVGWVLWMLSFRLGTLLICGRLCLDWKWPFIHKFSEISLEKREEILRNWSREKRW  138

Query  2002  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K +    FF+  D+ G NP WKAIGY      +  K+K  +         
Sbjct  139   VPLRLVFVLIKLIFFCTFFSRSDENGHNPVWKAIGY-----QVDTKKKLVRKER------  187

Query  1825  ELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL KG+I+     +H +   L + G  V++ K     + ++CD V+VGSGCGGGV
Sbjct  188   -----PLEKGLIETMHETDHTLMQSLAEKGLEVSEDKLQNL-YKVKCDVVIVGSGCGGGV  241

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA +G KV+VLEKG Y+   + S LEGPSMD+++  GG+L + D  M++LAGSTVG
Sbjct  242   AAAVLANSGQKVIVLEKGEYFVSHDYSSLEGPSMDELYESGGILSSLDGKMMILAGSTVG  301

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSA+NWSA I+TP  VLRE  +           YQ AMD+VC ++GV  +C+ ESFQN 
Sbjct  302   GGSAINWSACIRTPDSVLRECSD-----------YQSAMDSVCRRIGVTEKCKKESFQNR  350

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA-ILP  1112
             VL +GC ++G+ V ++  N+ +DHYCG C +GC+ G KKGT  TWLVD V  GNGA IL 
Sbjct  351   VLIQGCEKMGFKVESVATNSSADHYCGSCCYGCRTGDKKGTDSTWLVDAV--GNGAVILS  408

Query  1111  ECEALQVIHE-------RNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              C+A + I E       + K  GV+     R  V +  +I+SKVT+ A G+L+TP L+I+
Sbjct  409   GCKAERFILEDGNDGMKKKKCLGVIAAATWRSKVTKKLLIESKVTISACGSLSTPPLMIS  468

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFP-DTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGLKN NIGRNLHLHPV FAWG+FP D    +  ++EG I++++  V+   +   +  +I
Sbjct  469   SGLKNPNIGRNLHLHPVQFAWGYFPEDMTNFSGNNHEGGIITSIHKVLAEDSTPRF--II  526

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +TPAL PG FSAL+PW SG + K RM++YARTA+IFAL RD GSG+  +   VTY LD+ 
Sbjct  527   ETPALGPGSFSALVPWLSGHDMKDRMAKYARTANIFALIRDHGSGKVKAEGRVTYRLDQV  586

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES----SQSL  431
             D+ENL+ GL K LRIL AAGA E+G     G   K +    E+ E F+         +S 
Sbjct  587   DKENLRIGLRKALRILVAAGAVEVGTYRSDGQRFKCRGVKEEDLEEFLDTVKIVGGPRSR  646

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              +   +  SAHQM SCRMG   +   V+  GE+WE +GL+V DGSVLPTA+GVNPMVTI 
Sbjct  647   NELWTVLTSAHQMTSCRMGATEEEGAVDETGESWEAKGLYVCDGSVLPTAVGVNPMVTIQ  706

Query  250   SVSYCISQSVLEFL  209
             S +YCI+  + E L
Sbjct  707   STAYCIASKIAESL  720



>ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium 
distachyon]
Length=757

 Score =   526 bits (1356),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 311/754 (41%), Positives = 445/754 (59%), Gaps = 39/754 (5%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             + L R +  +  T  L P+QME L A+C   +P++     E  +  +  F+  S A +  
Sbjct  14    HPLLRVLRRDEYTHGLRPAQMEALRAMCGALIPSLPLPPEEGGNKDLERFYLASGADSAV  73

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
             P +VA +   R        + + LW L+TR+GTL LCG   L      + RF ++  ++R
Sbjct  74    PDEVAELAFTRCVWEAGVLVSVALWLLTTRLGTLALCGW--LCVVDSSVRRFADMPVERR  131

Query  2041  ERIVHSWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  1865
             E  +  W  +  L  ++  F  +K+L+  VF+T V++  +NP WKAIGY  PD     ++
Sbjct  132   EAALQRWTRARWLIPVKIAFAIVKSLLFNVFYTKVNENSENPCWKAIGYSVPDVEEQRRR  191

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  1688
             +K                PL KG+++   L +  +   L   G +V      GP   ++C
Sbjct  192   RKNGTEATARRR------PLDKGVVETRELDDAALLRSLAAKGLTVKPAASNGPHHTVQC  245

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             DAV+VGSGCGGGV + VLA AG+KV+VLEKG+Y+A  + S +EGPSM++++  GG+  T 
Sbjct  246   DAVIVGSGCGGGVAAAVLAAAGHKVVVLEKGDYFAAQDYSSVEGPSMERLYEQGGIFCTS  305

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             ++  VL +G+TVGGGSAVNWSASI+TP  +L+EW   HGL +F S  Y +AMD V  ++ 
Sbjct  306   NVTTVLYSGTTVGGGSAVNWSASIRTPREILQEWSRGHGLPVFASAGYAQAMDAVSARLA  365

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V   C +E FQN V+R+GC  LG PV  +P+N+ +DHYCG C  GC  G K+GT  TWLV
Sbjct  366   VSDACLEEGFQNKVVRRGCEALGLPVDAVPRNSSADHYCGSCNLGCPTGDKRGTDTTWLV  425

Query  1147  DLVKSGNGAILPECEALQVIHERN------KAKGVMFTFQRDGVKQTAV-IKSKVTVIAG  989
             D V+ G   I+  C+A + I E +      + K  +      G+ Q  + I++KV++ A 
Sbjct  426   DAVEHG-AVIITGCKADRFILESSYTGKGRRGKKCVGLVATCGITQKKLRIEAKVSISAC  484

Query  988   GALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK---------KSYEGAIM  836
             GAL TP LL +SGLKN++IGRNLHLHPV  AWG+FP+ P   +         K YEG I+
Sbjct  485   GALMTPPLLRSSGLKNRHIGRNLHLHPVSMAWGYFPEEPEPQEQDAEEIISGKCYEGGII  544

Query  835   SAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             ++M  V           +I+TPAL PG F++L+PW SG++ K RM RYARTAH FAL RD
Sbjct  545   TSMHRVTERT-------IIETPALGPGAFASLVPWESGRDMKERMRRYARTAHAFALVRD  597

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
             +G+G       V +   + D E L+ GL + LRI+ AAGA E+G +   GL L+ K    
Sbjct  598   RGAGSVDGEGRVHFVPSRDDNEELRNGLRRALRIMVAAGAAEVGTHRSDGLRLRCKGVRD  657

Query  475   EEFERFVKEESS-----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
             E+ E F+ + +      Q+      L  SAHQMGSCRMG  P+   V+  GE+WE EGL+
Sbjct  658   EDLEAFLDDVAVARGPMQAGTDTWALLCSAHQMGSCRMGSSPREGAVDGSGESWEAEGLY  717

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             V DGS+LPTA+GVNPM+TI S++YC+S+++ E L
Sbjct  718   VCDGSLLPTAVGVNPMITIQSLAYCLSKNIAESL  751



>emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
Length=678

 Score =   522 bits (1345),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 297/667 (45%), Positives = 414/667 (62%), Gaps = 40/667 (6%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATSSLQFIRNFFTAMKALV  1964
             +TR+GTLL+CG   L +++PF+ +F E+S +KRER++   +    L  IR  F  +K   
Sbjct  27    ATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFKNWILTPIRAAFVYIKVAF  86

Query  1963  LLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhhdheddieELLFGPLYKGIID  1787
             L  FF+ V+  G+NP+W+AIGY   PD +   +   ++              PL KGI++
Sbjct  87    LFCFFSRVNPNGENPAWEAIGYRVNPDENKPSETHNER--------------PLEKGIVE  132

Query  1786  -LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVL  1610
              +   E+ +   L   G   A       +  I+CD VVVGSG GGGV + VLA +G KV+
Sbjct  133   TMEETEQTLLESLAHKGLE-AVLDTEHDAIRIKCDVVVVGSGSGGGVAASVLAKSGLKVV  191

Query  1609  VLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKT  1430
             VLEKG+Y+  +     EGP +DK++  GG+L + D   ++LAG+TVGGGSAVNWSA IKT
Sbjct  192   VLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVNWSACIKT  251

Query  1429  PPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPV  1250
             P  VL+EW E   + LFG+  Y  AM+ V  +MGV  +CE ESFQN +LRKGC  LG+ V
Sbjct  252   PKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGCENLGFNV  311

Query  1249  VNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA-ILPECEALQVIHERN-  1076
              N+P+N+   HYCG C +GC+ G KKG+  TWLVD V  G+GA IL  C+A + I E+N 
Sbjct  312   ENVPRNSSESHYCGSCGYGCRQGDKKGSDRTWLVDAV--GHGAVILTGCKAERFILEKNG  369

Query  1075  --------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNL  920
                     K  GVM       + +   I++KVTV AGGAL TP L+I+SGL+N+NIG+NL
Sbjct  370   SNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRNIGKNL  429

Query  919   HLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGL  752
             HLHPV+ AWG+FPD    N      SYEG I++++S V+     +   A+I+TP L PG 
Sbjct  430   HLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVSKVL--SEDSEVRAIIETPQLGPGS  487

Query  751   FSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGL  572
             FS L PW SG + K RM+RY+RTA +  + RD+GSGE  +   + Y +DKTD +NL+ GL
Sbjct  488   FSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTEGRINYTVDKTDRDNLKAGL  547

Query  571   EKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRKHPNLKAS  404
              + LRIL AAGAEE+G +   G  L  K  +    + F+     EE ++ + +  N+ +S
Sbjct  548   RESLRILIAAGAEEVGTHRSDGQRLICKGVNENSIQEFLDSVSTEEGAKGMTEKWNVYSS  607

Query  403   AHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS  224
             AHQMGSCR+G + K   ++  GE+WE E LFV D S LP+A+GVNPM+T+MS +YCIS  
Sbjct  608   AHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMSTAYCISTR  667

Query  223   VLEFLKT  203
             + + + T
Sbjct  668   IAKSMTT  674



>gb|EYU18303.1| hypothetical protein MIMGU_mgv1a001896mg [Erythranthe guttata]
Length=742

 Score =   525 bits (1351),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 313/736 (43%), Positives = 441/736 (60%), Gaps = 36/736 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-----NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ  2192
              S SQ++TL+++C   LP       +E +    D  V  F++ SA+    P +VA ++ +
Sbjct  24    FSSSQIQTLTSICEVLLPPTPLNNPHENINPQNDV-VQAFYKASASQYPVPDEVAELVMK  82

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R        ++ ++  LSTR+GTLL+CG   +S ++PFL +F EI  + RE++V  W T+
Sbjct  83    RAFFEAKILVIAIVRILSTRVGTLLICGSSGVSKKWPFLKKFSEIPLENREKVVQKWFTN  142

Query  2011  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
              L   +R  F  +K LVLLVFFT V +   NP+WKA+ Y      +    +       ++
Sbjct  143   WLLTPVRLAFVFLKFLVLLVFFTQVGEDSSNPAWKAMDY-----KVDVIGENSPEEMSKE  197

Query  1834  dieELLFGPLYKGIIDLNLP-EEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KGII+  L  +  +   L   G           ++ ++CDAV+VGSGCG
Sbjct  198   R-------PLDKGIIETRLETDSSLAAALAGKGLKPTLNPASRDTYTVKCDAVIVGSGCG  250

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV + VLA AG KV+VLEKG+Y+   + S LEGPS+D+++  GG+L T D   +LLAGS
Sbjct  251   GGVAAAVLAAAGLKVVVLEKGDYFTAGDYSSLEGPSLDRLYESGGILSTLDGKTMLLAGS  310

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             TVGGGSAVNWSA  KTP +++ +W     L LF    Y  AMD VC ++GV   C  E F
Sbjct  311   TVGGGSAVNWSACFKTPDHIINDWAHGQNLPLFSGPEYLDAMDKVCDRIGVTVGCTKEGF  370

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN +LR+GC  LG     +P+N+   HYCG C +GC  G KKGT  TWLVD V S +  I
Sbjct  371   QNQILRQGCENLGLKADPVPRNSSESHYCGSCCYGCIRGDKKGTDTTWLVDAVNS-DAVI  429

Query  1117  LPECEALQVI--------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             +   +A++ +         ++ K  GV+  F    +K T  I+++VT+ A GAL TP LL
Sbjct  430   ISGAKAVRFVINQNNKNQRKKKKCHGVIAKFTNQDIKITLRIEARVTISACGALLTPPLL  489

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAV  782
             INSGLKN+NIGRNLHLHPV+ AWG+FP+      K+YEG I++++  V   V      A+
Sbjct  490   INSGLKNRNIGRNLHLHPVLMAWGYFPEPDIVEGKAYEGGIITSVHKV---VEQDKVRAI  546

Query  781   IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDK  602
             I++P L PG F+AL+P+ SG E K R+ +Y+RT H+F++ +D GSG   S   + Y LD 
Sbjct  547   IESPILGPGSFAALLPFESGIELKNRIIKYSRTCHLFSMIKDNGSGSVLSEGRIDYKLDS  606

Query  601   TDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQS  434
             +D+EN++ GL + LRIL AAGA E+G +   G  +K +    E  E F+K     E  +S
Sbjct  607   SDKENMKIGLVRALRILIAAGAVEVGTHQSDGQRVKCEGGDDEGVEEFLKGVVAPEGPKS  666

Query  433   LRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  254
             + +  +   SAHQMGSCRMGVD +   V+  GE+WE EGLFV D SVLP A+GVNPM+TI
Sbjct  667   MVEKWSTYCSAHQMGSCRMGVDERCGAVDTWGESWEAEGLFVCDASVLPGAVGVNPMITI  726

Query  253   MSVSYCISQSVLEFLK  206
              + +YCIS+ + E LK
Sbjct  727   QATAYCISKKIAEKLK  742



>ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
Length=774

 Score =   525 bits (1353),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 311/768 (40%), Positives = 447/768 (58%), Gaps = 56/768 (7%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASV-------------  2261
             + L R       T  L  +QME L A+C   +P++   LP  T+ S+             
Sbjct  18    HPLLRGCRRERYTHGLHLAQMEALRAMCGALIPSL--PLPPVTERSLHGDSSDGGERKDL  75

Query  2260  TNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLST-QF  2084
               F+  SAA    P +VA ++  R     +  + ++LW LST++GTL LCG+  +S  +F
Sbjct  76    ERFYLASAADGTIPEEVAELVT-RCVWEAVVLVNVVLWILSTKVGTLALCGRLCISGGKF  134

Query  2083  PFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGD-NPSWK  1910
             P++ +F ++  ++RE+ +  W  +   F ++  F  +K L    F+T++++  D NPSWK
Sbjct  135   PYVRKFADMPVERREQALTQWNRTRWLFPLKITFVVVKILSHYAFYTTINENSDDNPSWK  194

Query  1909  AIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCS  1733
             AIGY  P      ++ + +              PL  GI++   L +  +   L   G  
Sbjct  195   AIGYSVPHGEEETREDETEAAPSPR--------PLDNGIVETKALDDTALLTSLMARGLE  246

Query  1732  VAKPKPPGPSF-VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEG  1556
             V    PP  ++  + CD V+VGSGCGGGV + VLA+AG+KV+V+EKG+Y+   + S +EG
Sbjct  247   VKPAAPPANAYHTVRCDVVIVGSGCGGGVAAAVLASAGHKVVVIEKGDYFTAEDYSSVEG  306

Query  1555  PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1376
             PSM++++  GG+  T ++  +L  G+TVGGGSA+NWSASI+TP  V +EW   HGL +F 
Sbjct  307   PSMERLYEKGGIFCTTNVTTILFTGTTVGGGSAINWSASIRTPEEVRQEWAREHGLPVFA  366

Query  1375  SDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTF  1196
             S  Y +AMD VC ++ V   C DE FQN V+R+GC  L      +P+N+  DH+CG C  
Sbjct  367   SPGYVQAMDAVCARLAVTDGCRDEGFQNKVVRRGCEALALRADAVPRNSSEDHFCGSCYI  426

Query  1195  GCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQ  1046
             GC  G K+GT  TWLVD V  G   IL  C+A + I E N          K  GV+    
Sbjct  427   GCPTGEKRGTDTTWLVDAVARG-AVILTGCKAERFILESNSNSSSGRKGRKCVGVVARCM  485

Query  1045  RDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE  866
              +G+ +   I++KV++   GAL TP LL NSGLKN++IGRNLHLHPV  AWG+FP+   +
Sbjct  486   SNGITKELRIEAKVSISGCGALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQ  545

Query  865   NK---KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSR  695
              +   K +EG I+++M  V           +I+TPAL PG F++LMPW SG++ K RM R
Sbjct  546   AQITGKCFEGGIITSMHRVTERT-------IIETPALGPGCFASLMPWESGRDMKERMRR  598

Query  694   YARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNH  515
             YARTAH FAL RD+G+G       V Y  ++ D E L+ GL + LRIL AAGA E+G + 
Sbjct  599   YARTAHAFALVRDRGAGTVDGEGRVRYTPNRADAEELRNGLRRALRILVAAGAAEVGTHR  658

Query  514   GTGLTLKVKDASR-EEFERFVKEESSQS--LRKHPN---LKASAHQMGSCRMGVDPKASV  353
               G  L+     R +E E F+ E +     +R  P+   L  SAHQMGSCRMG  PK   
Sbjct  659   SDGFGLRCNGGVRDDELEAFLDEVTVAEGPMRPGPDKWALHCSAHQMGSCRMGSSPKDGA  718

Query  352   VNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             V+ +GE+WE EGL+V DGS+LPTA+GVNPM+TI S+++C+S+ + E L
Sbjct  719   VDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKGIAETL  766



>emb|CDX94858.1| BnaC03g43300D [Brassica napus]
Length=741

 Score =   523 bits (1347),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 310/746 (42%), Positives = 448/746 (60%), Gaps = 49/746 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDA---------SVTNFFQTSAASTGTPHQVAW  2204
             ++ ++ME+L + C   LP ++   PE   A         ++ +FF TS + T    +   
Sbjct  16    ITTAEMESLGSFCEAVLPPVSP--PEEYSAGDDHCRNKEALRSFFSTSGSRTPVVRESIE  73

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-  2027
             +I +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++  
Sbjct  74    LITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQK  133

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
              +    L  IR  F  +K   L  FF+ V   G+NP+W+AIGY     +++  + K    
Sbjct  134   QFRNWILTPIRAAFVYIKVAFLFCFFSWVSPNGENPAWEAIGY-----NVNTNENKPSET  188

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
               E         PL KG+++ +   E+ +   L ++G    + +    +  I+CDAVVVG
Sbjct  189   HRER--------PLEKGMVETMQETEQTLLESLAQMGL---EAETDHDTIRIKCDAVVVG  237

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GGGV + VLA AG KV+V+EKG+YY  +     EGP MDK++  GG+L T D +M++
Sbjct  238   SGSGGGVAASVLAKAGLKVVVMEKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMV  297

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAG+TVGGGSAVNWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  +MGV   CE
Sbjct  298   LAGATVGGGSAVNWSACIKTPKSVLQEWSEDRNIPLYATKEYVSAMELVWERMGVTETCE  357

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
              E FQN VLRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  TWLVD V  G
Sbjct  358   LEGFQNQVLRKGCENLGINVENVARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHG  417

Query  1129  NGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
                IL  C+A + I E N         K  GV+       + +   I+++VT+ A G+L 
Sbjct  418   -AVILTGCKAERFILENNGNNVGRKKMKCLGVIAKSLNGNIAKKIKIEARVTISASGSLL  476

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVLN  809
             TP L+I SGLKN++IG+NLHLHPV+  WG+FPD    +     KSYEG I+++MS V+  
Sbjct  477   TPPLMIKSGLKNRHIGKNLHLHPVLMTWGYFPDKASSSFYFKGKSYEGGIITSMSKVL--  534

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                +   A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  + 
Sbjct  535   SEDSEVRAIIETPALGPASFSVLCPWTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTE  594

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK-  452
               ++Y +DK D EN+  GL + LRIL AAGAEE+G +   G  L  K    +  + F+  
Sbjct  595   GRISYVVDKVDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIDEFLDS  654

Query  451   ---EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
                EE  +++ ++ ++ +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A
Sbjct  655   VSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLNGESWEADKLFVCDGSVLPSA  714

Query  280   LGVNPMVTIMSVSYCISQSVLEFLKT  203
             +GVNPM+TIMS +YCI+  +++ + T
Sbjct  715   VGVNPMITIMSTAYCIATRIVKSMTT  740



>ref|XP_010532672.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=746

 Score =   523 bits (1348),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 320/748 (43%), Positives = 455/748 (61%), Gaps = 50/748 (7%)
 Frame = -3

Query  2362  KTLSPSQMETLSALCNTFLPAIN-EALPETTD-----ASVTNFFQTSAASTGTPHQVAWV  2201
             +  + ++ME+L+A+C T LP ++ E  P+  D      ++ +F+  S + +   HQ   +
Sbjct  15    RGFTAAEMESLAAVCETLLPPLSPEYSPDGEDDHPNKEALRSFYSDSGSKSHVLHQGVEL  74

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             I +R     +  + L+L  LS+R+GTLLLCG   L   +PF+ RF  +S +KRER++  W
Sbjct  75    ITRRGLIEAVLVVRLVLLLLSSRLGTLLLCGTHCLVPNWPFVERFGSLSLEKRERVLQKW  134

Query  2020  ATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
               + L   IR  F  +K + L  FF+ V   G+NP+W+AIGY             + + +
Sbjct  135   FRNRLLAPIRLAFVYIKVVFLYCFFSWVGPNGENPAWEAIGY-------------RVNLE  181

Query  1843  heddieELLFGPLYKGII------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDA  1682
                    +   PL KG++      D  LP+      L++ G  V       P   I+CDA
Sbjct  182   ESKPSNIMKERPLEKGMVETVKETDSTLPKS-----LSEKGLEVMSGSNHDP-IKIKCDA  235

Query  1681  vvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDL  1502
             V+VGSG GGGV + VLA+AG KV+VLEKG Y+A +  S  EG   D+++  GG+L T D 
Sbjct  236   VIVGSGSGGGVAAAVLASAGLKVVVLEKGTYFAPSEYSPFEGHGFDQLYESGGVLPTVDG  295

Query  1501  DMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQ  1322
             ++++LAG+TVGGGSAVNWSA IKTP  VL+EW E H + LFG+  Y  AM+ V  ++GV 
Sbjct  296   NVMILAGATVGGGSAVNWSACIKTPEPVLQEWSEDHKIPLFGTQEYGSAMEVVWKRIGVT  355

Query  1321  RECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDL  1142
              +C  ESFQN VLRKGC  LG  V N+P+N+  +HYCG C +GC+ G K+G+  TWL+D 
Sbjct  356   EKCRQESFQNQVLRKGCLNLGLKVENVPRNSSENHYCGSCCYGCRQGDKQGSDRTWLLDA  415

Query  1141  VKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVIA  992
             V  G   IL  CEA ++I E+N          K  GVM       + +   I++KVTV+A
Sbjct  416   VNHG-AVILTGCEAERLILEKNINKGVGAKKMKCSGVMAKSLNGNISKKLQIEAKVTVVA  474

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFP--DTPGENKKSYEGAIMSAMSTV  818
              GA++TP L+I SGLKN+NIGRNLHLHPV+ AWG+FP  +T     K YEG IM++++ V
Sbjct  475   CGAISTPPLIIKSGLKNRNIGRNLHLHPVLMAWGYFPEKETSHLKGKIYEGGIMTSVNKV  534

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             +L    +   A+I+TPA+ P  F+A+ PW SG + K RM++Y+RTAH+  + RD+ SGE 
Sbjct  535   LL-AKDSEVRAIIETPAMGPASFTAICPWISGLDMKKRMTKYSRTAHLITIVRDRRSGEV  593

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
              +   + Y LDKTD+EN+  GL + LRIL +AGA E+G +   G  LK K    E  E F
Sbjct  594   MAEGRIRYTLDKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQRLKCKGIDEETIEAF  653

Query  457   VK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +     E+   S  +   + ASAHQMGSCR+G + +   ++  GE+WE +GLFV DGS L
Sbjct  654   LDTVTAEDGPGSYAEKWAVYASAHQMGSCRIGENEEKGALDLNGESWEAKGLFVCDGSAL  713

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             P+ALGVNPM+TIM+ SYCIS  +++ LK
Sbjct  714   PSALGVNPMITIMATSYCISTGIVKSLK  741



>ref|XP_007035188.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
 gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
Length=655

 Score =   520 bits (1338),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 301/659 (46%), Positives = 417/659 (63%), Gaps = 33/659 (5%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  1964
             STR+GTLLLCG   L  ++P++  F  +  + RE+++  W  S L   +R  F  +K   
Sbjct  15    STRLGTLLLCGSLCLGDKWPYINYFSCMPLENREKVLQMWFKSWLFTLVRIAFIYLKVAC  74

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID-  1787
             L VFF+ V +  DNP+W+AIGY   +   S++  K++              PL KG+I+ 
Sbjct  75    LYVFFSRVGENNDNPAWEAIGYQVDNVENSKQVSKER--------------PLQKGMIET  120

Query  1786  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
             ++  +  +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +LA++G KV+V
Sbjct  121   MHEKDSTLLQSLTQKGLQVTEDTERN-VYKIKCDAVIVGSGCGGGVAAAILASSGLKVVV  179

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKG+Y+A ++ S  EGPSMD+++  GG+L + D  M++LAGSTVGGGSA+NWSASIKTP
Sbjct  180   LEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASIKTP  239

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
               +L+EW E   L LFGS  Y  AMD VC ++GV   C++E FQN +LRKGC+ LG  V 
Sbjct  240   KSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGLEVE  299

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN---  1076
             N+P+N+   HYCG C FGC+ G KKGT  TWLVD V +G   IL  C+A + I E+N   
Sbjct  300   NVPRNSSESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNG-AVILTGCKAEKFILEKNKIC  358

Query  1075  -----KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLH  911
                  K  GV+       + +   I++KVT+ A GAL TP L+ +SGLKN+NIGRNLHLH
Sbjct  359   SKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNLHLH  418

Query  910   PVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMP  734
             PV+ AWG+FPD+  E K K YEG I++++  VV   N     A+I+TP+L P  ++AL P
Sbjct  419   PVLMAWGYFPDSDSEFKGKVYEGGIITSVHKVVAADNKV--RAIIETPSLGPAQYAALCP  476

Query  733   WNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRI  554
             W SG + K RM  ++RTAH+  + RD+GSG+  +   VTY  D  D +N+Q GL + LRI
Sbjct  477   WESGLDMKRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRI  536

Query  553   LAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLK----ASAHQMGS  386
             L AAGA E+G +   G +++ K  S +E E F++  S       P  K     SAHQMGS
Sbjct  537   LVAAGAVEVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGS  596

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             CRMG++ K   V+  GE+WE EGLFV D SVLP A+GVNPM+T+ S +YC+S+ + E L
Sbjct  597   CRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESL  655



>ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
Length=732

 Score =   521 bits (1341),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 313/747 (42%), Positives = 437/747 (59%), Gaps = 57/747 (8%)
 Frame = -3

Query  2341  METLSALCNTFLPAI------NEALPETTDA--SVTNFFQTSAASTGTPHQVAWVINQRM  2186
             ME L A+C   +P++      ++  P        +  F++ SAA    P +VA ++  R 
Sbjct  1     MEALRAMCGALIPSLPVDPEGDQQQPARGKGHDDLERFYRASAADGVIPDEVAEMVT-RC  59

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-----FPFLLRFPEISQKKRERIVHSW  2021
                 +  + ++LW LSTR+GTL LCG+  L        FPF+ +F ++  K+RE+++  W
Sbjct  60    VWEAMLLMRVILWMLSTRVGTLALCGRLCLCFSDNGKFFPFVCKFADMPVKRREQVLKRW  119

Query  2020  ATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
             + +   F ++  F   K L    F+T V++  DNPSWKAIGY  P+P +    ++     
Sbjct  120   SKARWLFPLKITFLIAKLLSHYSFYTMVNENSDNPSWKAIGYSVPEPDVDRPPEEAPSAW  179

Query  1843  heddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL  GI++  +L +  +   LT+ G +V K    G    ++CD V+VGS
Sbjct  180   -----------PLDAGIVETRSLNDATLLRSLTERGLAV-KADVSGAHHTVQCDVVIVGS  227

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV + VLA AG+KV+V+EKG+Y+   + + +EGPSM++++  GG+  T ++  ++ 
Sbjct  228   GCGGGVAAAVLAAAGHKVIVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMF  287

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
              G+TVGGGSA+NWSASI+TP +V +EW   HGL +FG+  Y +AMD VC ++ V   C  
Sbjct  288   TGATVGGGSAINWSASIRTPEWVTKEWARDHGLPVFGTPEYARAMDAVCARLAVTGGCRQ  347

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E FQN  LR+GC  LG     +P+N+   H+CG C  GC  G K+GT  TWLVD V  G 
Sbjct  348   EGFQNKALRRGCEALGLRGDAVPRNSSEGHFCGSCHLGCPTGEKRGTDTTWLVDAVDRG-  406

Query  1126  GAILPECEALQVIHERN-----------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
               IL  C+A + I E N           K  G++     DG+ +   I++KV++ A GAL
Sbjct  407   AVILTGCKAERFILESNPGGGGDNGRSKKCVGLVAACMSDGISKKLRIEAKVSISACGAL  466

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK----KSYEGAIMSAMSTVVL  812
              TP LL NSGLKN++IGRNLHLHPV  AWG+FPD   EN     K YEG I++ M  V  
Sbjct  467   MTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDGTPENAELSGKCYEGGIITTMHRVTA  526

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
                      +IQTPAL PG +++L+PW SG++ K RM RYARTAH FAL RD+G+G    
Sbjct  527   RT-------IIQTPALGPGCWASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGHVDG  579

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-EEFERFV  455
                V Y   + D E L+ GL + LRIL AAGA E+G +   GL L+     R E+ E F+
Sbjct  580   EGRVRYAPSREDVEELRNGLRQALRILVAAGAAEVGTHRSDGLRLRCDGGLRDEDLEAFL  639

Query  454   KEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             KE +       P      L  SAHQMGSCRMG  PK   V+ +GE+WE EGL+V DGSVL
Sbjct  640   KEVTVGEGPMLPGPDKWALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVL  699

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFL  209
             PTA+GVNPM+TI S +YC+S+ + E L
Sbjct  700   PTAVGVNPMITIQSTAYCVSKGIAESL  726



>gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
Length=748

 Score =   521 bits (1342),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 320/738 (43%), Positives = 440/738 (60%), Gaps = 42/738 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP--HQVAWVINQRM  2186
              SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P   +VA +I +  
Sbjct  27    FSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPPFTDEVAEMIVKNG  79

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  2009
             +   +  L ++L  LS R GTLLLCG   L   +PF+LRF ++   KRE I+ +W+  S 
Sbjct  80    RSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLRFSQLPLDKREAILRNWSRQSG  139

Query  2008  --LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
               L F   FF A K   L  FF+  D+   NP+ +AIGYC      S  +K +       
Sbjct  140   FLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR-  197

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG G
Sbjct  198   --------PLEKGIIETMHESDVTITQSLTEKGVHVARDDGDN-VYRIRCDAVVVGSGSG  248

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV +  LA AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS
Sbjct  249   GGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGS  308

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
              VGGG+AVNWSASI+TP +VL+EW E   ++ FGS  YQ AMD V  ++GV   C    F
Sbjct  309   AVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGF  368

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VLRKGC  LG  V ++P+N+P DHYCG C +GC+ G K GT +TWLVD V++G   I
Sbjct  369   QNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENG-AVI  427

Query  1117  LPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             L   +A + +        +ER K   GV  +     + +  +I+++VTV + G+L TP L
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYG  788
             +++SGLKN NIGRNL LHPV+  WG+FP+   E + K YEG I++++    +N   +G  
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHH--MNDTESGCK  545

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE      VTY  
Sbjct  546   AILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRT  605

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----  440
              K D ENL+ GL + LR+  AAGA E+G     G  +K +  ++E  E F+ E  +    
Sbjct  606   TKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGV  665

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              +  ++     SAHQMGSCRMGV  +   ++  GE+WE EGLFV DGS+LP+A+GVNPM+
Sbjct  666   GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI  725

Query  259   TIMSVSYCISQSVLEFLK  206
             TI S +YCIS  +++ L+
Sbjct  726   TIQSTAYCISSKIVDSLQ  743



>ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
Length=747

 Score =   521 bits (1341),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 317/741 (43%), Positives = 446/741 (60%), Gaps = 42/741 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEAL---PETTDASVTNFFQTSAASTGTPHQVAWVINQRM  2186
              S ++M++L++LC+T  P I+ A     E  + +V  FF+ S +    P +VA +I  R 
Sbjct  23    FSSAEMDSLASLCHTIWPPISAAQHHNQEPANPAVQEFFKASGSQYPLPDEVAELIAMRG  82

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  2009
                 +  + L+L  LSTR+GTLLL G      ++PF+ +F  I  +KRE+++  W     
Sbjct  83    LIEAVMVVRLVLLLLSTRLGTLLLSGSLCFGEKWPFINKFSSIPVEKREKVLQKWLRHRF  142

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
             L  IR  F  +KA+ L VFFT +D+ G+NP+W+AIGY   +   + +  K++        
Sbjct  143   LTPIRLAFFYVKAICLHVFFTQIDENGNNPAWEAIGYKVQNEENATQVPKER--------  194

Query  1828  eELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFV-IECDAvvvgsgcgg  1655
                   PL KGI++     +  F N + + G  VA    PG +   I+CD V+VGSGCGG
Sbjct  195   ------PLEKGIVETMHESDSTFLNSIAQKGLKVAHV--PGHNLCKIKCDVVIVGSGCGG  246

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA +G KVLVLEKGNY+   + S LEGPS + ++  GGL+ + D   ++LAGS 
Sbjct  247   GVAAAVLAASGQKVLVLEKGNYFTAKDFSGLEGPSYNHLYEAGGLMPSADAKFIILAGSV  306

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSA I TP YVL+EW E H ++LFGS  Y  AMD VC ++GV   C +E FQ
Sbjct  307   VGGGSAVNWSACINTPNYVLKEWAENHKIQLFGSPEYLSAMDIVCKRIGVTENCVEEGFQ  366

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N V+RKGC  LG  +  +P+N+   HYCG C +GC+ G KKGT  TWLVD V +G   IL
Sbjct  367   NQVIRKGCENLGLEINTVPRNSSEKHYCGSCGYGCQTGDKKGTDSTWLVDAVNNG-AVIL  425

Query  1114  PECEALQVIHERNKAKG------------VMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
               C+A + I E N  K             +    + D +     I+++VT+ A GAL+TP
Sbjct  426   TGCKAERFILEENNKKSGGSQRKKKCLGVIAKILKNDNIWMRLQIEARVTISACGALSTP  485

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG  794
              L+I+SGL N NIGRNLHLHPV+  WG+FPD+    K KS+EG I++++  V      + 
Sbjct  486   PLMISSGLNNPNIGRNLHLHPVLMTWGYFPDSNTVFKGKSFEGGIITSVHKVA--SEDSN  543

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+I+TP L P  F+AL PW S  +FK R+ +Y+RTA++  + RD+GSGE  S   + Y
Sbjct  544   VRAIIETPQLGPASFAALCPWESALDFKERLLKYSRTANLITIIRDRGSGEVKSEGRIAY  603

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQS  434
             + D  D ENL+ GL + LRIL AAGA E+G +   G  LK +  ++++ E F+   S   
Sbjct  604   NFDALDIENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLKCQGITKKQLEEFLDTVSPPR  663

Query  433   LRKHPNLK----ASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
                 P        SAHQ+GSCRMG+  K   V+  GE+WE EGLFV D SVLP+A+GVNP
Sbjct  664   GPLSPGKDWVAYTSAHQLGSCRMGISEKEGAVDENGESWEAEGLFVCDASVLPSAIGVNP  723

Query  265   MVTIMSVSYCISQSVLEFLKT  203
             M+TI S +YC+S+ + ++L+T
Sbjct  724   MITIQSTAYCLSERISKYLRT  744



>gb|KDP26499.1| hypothetical protein JCGZ_17657 [Jatropha curcas]
Length=659

 Score =   518 bits (1333),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 298/656 (45%), Positives = 405/656 (62%), Gaps = 33/656 (5%)
 Frame = -3

Query  2134  RIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALVLL  1958
             R+GTLLLCG       +PF  +F E+S KKRE I+  W+     F +R  F A++   L 
Sbjct  23    RLGTLLLCGFICFDWNWPFFHKFSELSVKKREEILLKWSRQKYIFPLRAAFVAVRIFCLY  82

Query  1957  VFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDL-N  1781
              FF+  D+  +NP+W+AIGY   +     ++++                PL KGI++L N
Sbjct  83    TFFSRTDENSENPAWEAIGYHKDNREKLRREER----------------PLQKGIVELAN  126

Query  1780  LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLE  1601
               +  +   L + G  V +         I+CD V+VGSGCGGGV + VLA++G KVLVLE
Sbjct  127   EDDSTILQSLIEKGLEVTEDSEHKIC-KIKCDVVIVGSGCGGGVAAAVLASSGLKVLVLE  185

Query  1600  KGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPY  1421
             KGNY+   + S LEGPSM +++  GG+L T +  +++LAGSTVGGGSA+NWSA I+TP Y
Sbjct  186   KGNYFVAEDYSSLEGPSMAELYESGGILSTLNGKVMILAGSTVGGGSAINWSACIRTPDY  245

Query  1420  VLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNI  1241
             VLREW   H +  +GS  YQ AMD V  ++GV   C +ESFQN VLRKGC  LG  V ++
Sbjct  246   VLREWSLDHKIRFYGSSDYQYAMDAVSKRIGVTDNCLNESFQNQVLRKGCENLGLKVESV  305

Query  1240  PQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE-------  1082
              +N+ +DHYCG C FGC+ G KKGT  TWLVD V S N  I+  C+A ++I E       
Sbjct  306   ARNSSADHYCGSCNFGCRTGDKKGTDSTWLVDAV-SCNATIITGCKAEKLILEDDTTGNR  364

Query  1081  RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVV  902
             + K  GV+       + +   I+++ TV A G+L TP L+I+SGL N NIG NLHLHPVV
Sbjct  365   KKKCLGVIARAANTNITKKLQIEARATVSACGSLLTPPLMISSGLLNPNIGSNLHLHPVV  424

Query  901   FAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNS  725
              AWG+FP+   + K KSYEG I+++M  V+     +   A+IQTPAL P  ++AL PW S
Sbjct  425   VAWGYFPEHESDFKGKSYEGGIITSMHRVI--SEESKVRAIIQTPALGPSSYAALSPWVS  482

Query  724   GQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAA  545
             GQ+FK +M +Y RTA +FAL RD+GSGE  +   + +  ++ D+ENL+ GL + LRIL  
Sbjct  483   GQDFKDKMVKYPRTAGLFALIRDQGSGEVKAEGRIKHWQNQFDKENLKIGLRQALRILVG  542

Query  544   AGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSL---RKHPNLKASAHQMGSCRMG  374
             AGA E+G     G  +  K    ++ E F+   +   L    +H  L  SAHQMGSCRMG
Sbjct  543   AGAVEVGTYRSDGQKIACKGIQDKDLEDFLDTVTVSGLTSKEEHWTLLFSAHQMGSCRMG  602

Query  373   VDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
                K   V+  GE+WE + LFV DGSVLPTA+GVNPM+TI S +YCIS+ ++E LK
Sbjct  603   ATEKEGAVDENGESWEAKDLFVCDGSVLPTAIGVNPMITIQSTAYCISRKIVESLK  658



>ref|XP_007132926.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
 gb|ESW04920.1| hypothetical protein PHAVU_011G136600g [Phaseolus vulgaris]
Length=755

 Score =   521 bits (1341),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 319/742 (43%), Positives = 443/742 (60%), Gaps = 43/742 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI----------NEALPETTDASVTNFFQTSAASTGTPHQVA  2207
              S ++ME+L+++C   LP +          ++A  + T   + +F   S +    PH+VA
Sbjct  22    FSAAEMESLASMCEVVLPPLPMDAFKSRKEDQAGDDDTKL-LQSFCDISGSRYPIPHEVA  80

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              ++        L  + ++LW L+TR+GTLLLCG   L  ++P++  F  +S +KRE+IV 
Sbjct  81    ELLTNTSLIEALILVRVVLWMLATRLGTLLLCGFLCLGEKWPYINNFSNMSLEKREKIVQ  140

Query  2026  SWATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh  1850
              W     L  IR  F  +K L L  FF+ VD+ GDNP+WKAIGY   D          + 
Sbjct  141   KWLKHRFLTPIRLAFVYVKVLCLYSFFSMVDENGDNPAWKAIGYEVSDNEKQNNVSNNR-  199

Query  1849  hdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                          PL KG I+ ++  +  +   L K G +V           ++CDAVVV
Sbjct  200   -------------PLEKGTIETMHESDSTLQQSLAKKGLNVTLDFKSNI-LKVKCDAVVV  245

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSGCGGGV + VL++AG+KV+VLEKGNY++  + S LEGPSM +++  GG+L + D  ++
Sbjct  246   GSGCGGGVAAAVLSSAGHKVVVLEKGNYFSPQDYSSLEGPSMKQLYETGGILASADSRVL  305

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             +LAGSTVGGGSAVNWSA IKTP  VL++W E H L  F S  Y  AM+TVC ++GV   C
Sbjct  306   ILAGSTVGGGSAVNWSACIKTPHKVLKDWSEGHKLPFFSSQEYLSAMETVCERIGVTENC  365

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
               E FQN VLRKGC+ LG  V  + +N+  +HYCG C +GC  G K+GT  TWLVD V  
Sbjct  366   TQEGFQNQVLRKGCQNLGLKVDYVARNSSGNHYCGSCGYGCPKGEKQGTQATWLVDAVDK  425

Query  1132  GNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
             G   I+  C+A +++ E N        K  GV+       V     I++KVT+ +GGAL 
Sbjct  426   G-AVIITGCKAEKLLLESNRSGNGRKKKCLGVVAKVLNKVVTMKLQIEAKVTISSGGALL  484

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--NKKSYEGAIMSAMSTVVLNVN  803
             TPSLLI+SGL NKNIGRNLHLHPV+  WG+FP++       K YEG I++++  V    +
Sbjct  485   TPSLLISSGLHNKNIGRNLHLHPVLMTWGYFPESNNSEFKGKVYEGGIITSVHKVPSTDS  544

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
              +   A+I+TP+L P  F+AL PW SG +FK RM  Y RTAH+  + RD   G+  S   
Sbjct  545   KSDSRAIIETPSLGPACFAALFPWESGLDFKERMLNYPRTAHLITIIRDMACGQVTSEGR  604

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE--  449
             + Y L++ D EN++ G+++ LRIL AAGA E+G +   G  L+    S ++ + F+    
Sbjct  605   IIYKLNEIDRENMRAGMQQALRILIAAGAVEVGTHRSDGQRLRCSGVSEDKVQEFLDSVC  664

Query  448   --ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
               E + S     NL +SAHQMGSCRMGV+ K   V+  GETWE EGLFV D SVLPTA+G
Sbjct  665   PMEGALSPGDKWNLYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPTAVG  724

Query  274   VNPMVTIMSVSYCISQSVLEFL  209
             VNPM+TI S +YCIS  ++++L
Sbjct  725   VNPMITIQSTAYCISNRIVDYL  746



>gb|AAM63097.1| unknown [Arabidopsis thaliana]
Length=748

 Score =   520 bits (1339),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 319/738 (43%), Positives = 440/738 (60%), Gaps = 42/738 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP--HQVAWVINQRM  2186
              SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P   +VA +I +  
Sbjct  27    FSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPPFTDEVAEMIVKNG  79

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  2009
             +   +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   KRE I+ +W+  S 
Sbjct  80    RSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSG  139

Query  2008  --LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
               L F   FF A K   L  FF+  D+   NP+ +AIGYC      S  +K +       
Sbjct  140   FLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR-  197

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG G
Sbjct  198   --------PLEKGIIETMHESDLTITQSLTEKGVHVARDDGDN-VYRIRCDAVVVGSGSG  248

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV +  LA AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS
Sbjct  249   GGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGS  308

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
              VGGG+AVNWSASI+TP +VL+EW E   ++ FGS  YQ AMD V  ++GV   C    F
Sbjct  309   AVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGF  368

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VLRKGC  LG  V ++P+N+P DHYCG C +GC+ G K GT +TWLVD V++G   I
Sbjct  369   QNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENG-AVI  427

Query  1117  LPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             L   +A + +        +ER K   GV  +     + +  +I+++VTV + G+L TP L
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYG  788
             +++SGLKN NIGRNL LHPV+  WG+FP+   E + K YEG I++++    +N   +G  
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHH--MNDTESGCK  545

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE      VTY  
Sbjct  546   AILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRT  605

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----  440
              K D ENL+ GL + LR+  AAGA E+G     G  +K +  ++E  E F+ E  +    
Sbjct  606   TKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGV  665

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              +  ++     SAHQMGSCRMGV  +   ++  GE+WE EGLFV DGS+LP+A+GVNPM+
Sbjct  666   GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI  725

Query  259   TIMSVSYCISQSVLEFLK  206
             TI S +YCIS  +++ L+
Sbjct  726   TIQSTAYCISSKIVDSLQ  743



>ref|XP_009369441.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=746

 Score =   520 bits (1338),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 318/737 (43%), Positives = 441/737 (60%), Gaps = 37/737 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPETTDA--SVTNFFQTSAASTGTPHQVAWVINQRM  2186
              S +Q+++LSA+C   LP I+ E +P+  +   S +++   SA+    P +VA ++ +R 
Sbjct  25    FSSAQIQSLSAICEALLPPISPEDIPDDHNPLHSSSSYCTASASQPPIPDEVAELMVKRT  84

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA-TSS  2009
                 +  + + L  LS R+GT LLCGK     ++ F+ +F E+S  KRE+++  W+   S
Sbjct  85    LPEVVGGVRVFLKMLSLRLGTFLLCGKCCFDWKWTFIDKFSEMSLDKREQVLKKWSRQKS  144

Query  2008  LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddi  1829
             +  IR  F  +K     +FF+ VD+   NP+WKAIGY              +    E  I
Sbjct  145   VITIRLMFMVIKMFCFYIFFSRVDENSRNPAWKAIGY--------------ELDRKEKLI  190

Query  1828  eELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcggg  1652
             +     PL KGII+     +      LTK G  +           I+CD V+VGSGCGGG
Sbjct  191   KTPKQRPLEKGIIETAYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGCGGG  249

Query  1651  visgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTV  1472
             V + VLA +G KV+VLEKGNY+   + S LEGPSM++++  GG++ + D  +++LAGSTV
Sbjct  250   VAAAVLARSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGMVMILAGSTV  309

Query  1471  GGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQN  1292
             GGGSAVNWSASIKTP  VLR+W   H + L+ S+ Y+ AMD VC ++GV   C +E+F N
Sbjct  310   GGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPN  369

Query  1291  MVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILP  1112
              +LRKGC  LG  V  +P+N+ +DHYCG+C +GC  G KKGT  TWLVD VK G   IL 
Sbjct  370   QILRKGCENLGLKVDAVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVKFG-AVILT  428

Query  1111  ECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINS  953
              C+A + I E       R +  GV  T     +K+   I++ VT+ A G+L TP L+I+S
Sbjct  429   GCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLCTPPLMISS  488

Query  952   GLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG-YGAVI  779
             GLKN+NIGRNLHLHPV+ AWG+FP+   E K KSYEG I++++  V   V+GT     +I
Sbjct  489   GLKNRNIGRNLHLHPVLLAWGYFPEHEPEFKGKSYEGGIITSLHKV---VSGTANVRTII  545

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             +T  L P  FS L PW S  + K  M +YARTA++FA+ RD+GSG       + Y LD+ 
Sbjct  546   ETAVLGPATFSTLFPWTSRLDMKDTMDKYARTANLFAMVRDRGSGTVKREGRIHYTLDQL  605

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFER----FVKEESSQSL  431
             D+ENLQ GL + LRIL AAGA E+G     G  +K K    E+ E      V      S 
Sbjct  606   DKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRMKCKGVEEEDLEEFLDTVVAAAGPSSR  665

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              +     +SAHQMGSCRMG   +   V+  GE+WE +GLFV DGS+LPTA+GVNPM+TI 
Sbjct  666   EELWTTYSSAHQMGSCRMGTTEEDGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIE  725

Query  250   SVSYCISQSVLEFLKTH  200
             S +YCIS+ + + L+  
Sbjct  726   STAYCISKRIAQSLEKQ  742



>ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName: Full=Long-chain 
fatty alcohol oxidase 4B [Arabidopsis thaliana]
 emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
Length=748

 Score =   520 bits (1338),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 319/738 (43%), Positives = 440/738 (60%), Gaps = 42/738 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP--HQVAWVINQRM  2186
              SPSQ+++L+ +C TFLP      PETT +    N F   A+ST  P   +VA +I +  
Sbjct  27    FSPSQIQSLAVICQTFLP------PETTSEQQAVNSFHV-ASSTQPPFTDEVAEMIVKNG  79

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  2009
             +   +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   KRE I+ +W+  S 
Sbjct  80    RSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREAILRNWSRQSG  139

Query  2008  --LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
               L F   FF A K   L  FF+  D+   NP+ +AIGYC      S  +K +       
Sbjct  140   FLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYCIDGTERSSNKKSEADEKRR-  197

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL KGII+ ++  +  +   LT+ G  VA+       + I CDAVVVGSG G
Sbjct  198   --------PLEKGIIETMHESDVTITQSLTEKGVHVARDDGDN-VYRIRCDAVVVGSGSG  248

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV +  LA AG KVLVLEKGNY+   + S LE PSM +++  GGLL T D   +LLAGS
Sbjct  249   GGVAAANLAKAGLKVLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGS  308

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
              VGGG+AVNWSASI+TP +VL+EW E   ++ FGS  YQ AMD V  ++GV   C    F
Sbjct  309   AVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGF  368

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VLRKGC  LG  V ++P+N+P DHYCG C +GC+ G K GT +TWLVD V++G   I
Sbjct  369   QNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDQTWLVDAVENG-AVI  427

Query  1117  LPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             L   +A + +        +ER K   GV  +     + +  +I+++VTV + G+L TP L
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPL  487

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYG  788
             +++SGLKN NIGRNL LHPV+  WG+FP+   E + K YEG I++++    +N   +G  
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHH--MNDTESGCK  545

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE      VTY  
Sbjct  546   AILENPLIGPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENEVTYRT  605

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----  440
              K D ENL+ GL + LR+  AAGA E+G     G  +K +  ++E  E F+ E  +    
Sbjct  606   TKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCEAITKEAMEEFLDEVDAVGGV  665

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              +  ++     SAHQMGSCRMGV  +   ++  GE+WE EGLFV DGS+LP+A+GVNPM+
Sbjct  666   GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI  725

Query  259   TIMSVSYCISQSVLEFLK  206
             TI S +YCIS  +++ L+
Sbjct  726   TIQSTAYCISSKIVDSLQ  743



>ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gb|ACN25897.1| unknown [Zea mays]
 tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
Length=675

 Score =   516 bits (1330),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 287/665 (43%), Positives = 401/665 (60%), Gaps = 39/665 (6%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  1964
             STR GTLLLCG+ SL   FP++ RF +++ ++RE  +  W      F +R  F  +K L 
Sbjct  21    STRAGTLLLCGRLSLGAGFPYVRRFADMAPERREAALRRWNRVRWLFPLRIAFAIVKILC  80

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDL  1784
               VF+  V++  +NP WKAIGY   +P     +                  PL  G+++ 
Sbjct  81    HYVFYAMVNENSENPYWKAIGYSVDEPREDRARTATPSPSR----------PLDVGVVET  130

Query  1783  NLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
              L +++   R L   G +V           ++CDAV+VGSGCGGGV + VLA+AGYKV+V
Sbjct  131   RLLDDNKLLRSLVGRGLTVKPASSDANHHTVQCDAVIVGSGCGGGVAAAVLASAGYKVVV  190

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             +EKG+Y+   + S +EGPSM+++F  GG+  T ++  ++  G+TVGGGSAVNWSASI+TP
Sbjct  191   VEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASIRTP  250

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
               V +EW   HGL +F S  Y +AMD VC ++GV   C++E FQN V+R+GC  LG    
Sbjct  251   EEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGLCAD  310

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN---  1076
              +P+N+   H+CG C FGC  G K+GT  TWLVD V  G   IL  C+A   + E+N   
Sbjct  311   AVPRNSSDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARG-AVILTGCKAEYFVLEKNHSS  369

Query  1075  --------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNL  920
                     K  G++ T   +GV +   I++KV++ A GAL TP LL  SGLKN++IG NL
Sbjct  370   GSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIGSNL  429

Query  919   HLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLF  749
             HLHPV  AWG+FP+    P  + K YEG I+++M  V           +I+TPAL PG F
Sbjct  430   HLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDRT-------IIETPALGPGAF  482

Query  748   SALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLE  569
             +A++PW SG++ K RM RY+RTAH FAL RD+G G       V +   + D + L+ GL 
Sbjct  483   AAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFVDGEGRVRFTPSREDVDELRNGLR  542

Query  568   KLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPN-----LKAS  404
             ++LRIL AAGA E+G +   GL L+ K    E+ E F+ E + +    H       L  S
Sbjct  543   RVLRILVAAGAAEVGTHRSDGLRLRCKGLRDEDLEGFLDEVTIEKGPMHSRVDKWALHCS  602

Query  403   AHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQS  224
             AHQMGSCRMG  PK   V+ +GE+WE EGL+V DGS+LPTA+GVNPM+TI S+++C+S+ 
Sbjct  603   AHQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMITIQSIAFCLSKG  662

Query  223   VLEFL  209
             + E +
Sbjct  663   IAETM  667



>emb|CDX92985.1| BnaA03g37070D [Brassica napus]
Length=721

 Score =   518 bits (1334),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 310/739 (42%), Positives = 443/739 (60%), Gaps = 49/739 (7%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPET---------TDASVTNFFQTSAASTGTPHQVAWVINQR  2189
             ME+L++ C   LP ++   PE             ++ +FF TS + T    +   +I +R
Sbjct  1     MESLASFCEAVLPPVSP--PEEYCGGDDHYRNKETLRSFFFTSGSRTPVVRESIELITKR  58

Query  2188  MKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-SWATS  2012
                       L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++   +   
Sbjct  59    GTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQKQFRNW  118

Query  2011  SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhedd  1832
              L  IR  F  +K   L  FF+ V   G+NP+W+AIGY      I+ + K  + H     
Sbjct  119   LLTPIRAAFVYIKVAFLFCFFSRVSPNGENPAWEAIGY----NVITNENKPSETHKER--  172

Query  1831  ieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgg  1655
                    PL KG+++ +   ++ +   L + G    + +    +  I+CDAVVVGSG GG
Sbjct  173   -------PLQKGMVETMQETDQTLLESLAQKGL---EAETDHDTIRIKCDAVVVGSGSGG  222

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
             GV + VLA AG KV+V+EKG+YY  +     EGP MDK++  GG+L T D +M++LAG+T
Sbjct  223   GVAASVLAKAGMKVVVMEKGSYYTPSTYPSTEGPGMDKLYENGGILPTIDGNMMVLAGAT  282

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             VGGGSAVNWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  ++GV   CE E FQ
Sbjct  283   VGGGSAVNWSACIKTPKSVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTERCELEGFQ  342

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAIL  1115
             N VLRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  TWLVD V  G   IL
Sbjct  343   NQVLRKGCENLGINVENVARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHG-AVIL  401

Query  1114  PECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
               C+A + I E+N         K  GVM       + +   I+++VTV A G+L TP L+
Sbjct  402   TGCKAERFILEKNGNNVGRKKKKCLGVMAKSLNGNIAKKIKIEARVTVSAAGSLLTPPLM  461

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVLNVNGTG  794
             I SGLKN++IG+NLHLHPV+  WG+FPD    +     +SYEG I+++MS V+     + 
Sbjct  462   IKSGLKNRHIGKNLHLHPVLMTWGYFPDKESSSFNFKGRSYEGGIITSMSKVL--SEDSE  519

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  +   ++Y
Sbjct  520   VRAIIETPALGPASFSVLCPWTSGLDMKKRMSRYSRTANLITIVRDRGSGEVRTEGRISY  579

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EE  446
              +DK D EN+  GL + LRIL AAGAEE+G +   G  L  K    +  E F+     EE
Sbjct  580   VVDKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKSIEEFLDSVSAEE  639

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +++ ++ ++ +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A+GVNP
Sbjct  640   GPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSAVGVNP  699

Query  265   MVTIMSVSYCISQSVLEFL  209
             M+TIMS +YCIS  +++ +
Sbjct  700   MITIMSTAYCISTRIVKSM  718



>ref|XP_009336115.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=750

 Score =   519 bits (1336),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 313/736 (43%), Positives = 441/736 (60%), Gaps = 38/736 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPETTDA-----SVTNFFQTSAASTGTPHQVAWVIN  2195
              S +QM++L+A+C + +P +  E +P+   A     S +++   S +    P +VA +I 
Sbjct  25    FSSAQMQSLAAICESLIPPLPLEEIPDDHQALHSSSSSSSYHTASGSQPPIPDEVAEMIV  84

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +R     ++++ L L  LS R+GT LLCGK     ++PF+ +F E+S  KRE++++ W+ 
Sbjct  85    KRALPEGVDAMRLFLKMLSLRLGTFLLCGKICFDWKWPFIHKFSEMSLDKREQVLNKWSR  144

Query  2014  SSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe  1838
               L   IR  F  +K      FF+ +D+   NP+WKAIG+              +    E
Sbjct  145   GKLVITIRLMFMVVKMCCFYTFFSRIDENSRNPAWKAIGF--------------ELDKKE  190

Query  1837  ddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgc  1661
               I+     PL KGII+ +   +  +   LTK G  VA          I+CD V+VGSGC
Sbjct  191   KLIKTPKERPLDKGIIETVYESDSTLVQSLTKKGLEVAD-DAENNIHRIKCDVVIVGSGC  249

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV + VLA +G KV+VLEKGNY+   + S LEGPSM +++  GG++ + D  +++LAG
Sbjct  250   GGGVAAAVLAQSGQKVVVLEKGNYFVPKDYSSLEGPSMSELYESGGIMSSVDAMVMILAG  309

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGSAVNWSASI+TP  VLREW   H + L+ S+ YQ AMD VC ++GV   C  E+
Sbjct  310   STVGGGSAVNWSASIRTPNNVLREWSVDHKIPLYASEDYQSAMDIVCKRIGVTESCTKEN  369

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             FQN +LRKGC  LG  V ++P+N+ +DHYCG+C +GC  G KKGT  TWLVD V+ G   
Sbjct  370   FQNQILRKGCENLGLKVESVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVECG-AV  428

Query  1120  ILPECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             IL  C+A + I E       R +  GV  T     +K+   I++KV + A G+L TP L+
Sbjct  429   ILTGCKAEKFILEKDNDGGRRKRCLGVQATSLSKNLKRKLEIEAKVIISACGSLLTPPLM  488

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGA  785
             ++SGLKN+NIGRNLHLHPV+ +WG+FP    E K K YEG I++++  VV         A
Sbjct  489   VSSGLKNRNIGRNLHLHPVLLSWGYFPQHESEFKGKKYEGGIITSIHKVVSETANA--RA  546

Query  784   VIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLD  605
             +I+T  L P  F+ L PW S  + K +M +YARTA++FAL RD  SG       + Y LD
Sbjct  547   IIETAVLGPASFATLSPWISRLDMKDKMEKYARTANLFALVRDHSSGVVKREGRIHYTLD  606

Query  604   KTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF---VKEESSQS  434
             + D+EN+  GL + LRIL AAGA E+G     G  LK K    E+ E F   V   +  S
Sbjct  607   QLDKENILAGLRQALRILIAAGAVEVGTYRNDGQRLKCKGVKEEDLEEFLDTVVTSAGPS  666

Query  433   LRKHP-NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVT  257
              R+    + +SAHQMGSCRMG   +   V+  GE+WE +GLFV D S+LPTA+GVNPM+T
Sbjct  667   AREELWTIYSSAHQMGSCRMGATEEEGGVDENGESWEAKGLFVCDASLLPTAVGVNPMIT  726

Query  256   IMSVSYCISQSVLEFL  209
             + S +YCI++ + + L
Sbjct  727   VESTAYCIAKKIAQSL  742



>ref|XP_006406028.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
 gb|ESQ47481.1| hypothetical protein EUTSA_v10020141mg [Eutrema salsugineum]
Length=746

 Score =   519 bits (1336),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 311/756 (41%), Positives = 445/756 (59%), Gaps = 55/756 (7%)
 Frame = -3

Query  2374  NTATKTLSPSQMETLSALCNTFLPAINEALPE--------TTDASVTNFFQTSAASTGTP  2219
             N   + ++ ++ME L + C   LP +     E            ++ +F+ TS + T   
Sbjct  10    NFGHRDVTVAEMEALVSFCEAVLPPVPPPPEEFSGEDDHHRNKEALRSFYSTSGSQTPVV  69

Query  2218  HQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  2039
              Q   +I +R          L+L+ L+TR+GTLL+CG+  L T++PF+ +F E+S +KRE
Sbjct  70    RQTIELITKRGTIEAYLITRLVLFLLATRLGTLLICGRECLVTKWPFVEKFSELSLEKRE  129

Query  2038  RIVH-SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCG----PDPSIS  1874
             R+    +       IR  F  +K   L  FF+ V   G+NPSW+AIGY        PS +
Sbjct  130   RVFQKQFKNWFFTPIRAAFVYIKVAFLFCFFSRVSPNGENPSWEAIGYRANLDQKKPSET  189

Query  1873  ekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFV  1697
             +K++                 PL KGI++ +   E+ +   L + G    +      +  
Sbjct  190   QKER-----------------PLEKGIVETMKETEQTLLESLAQKGL---EADADHDAIT  229

Query  1696  IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLL  1517
             I+CDAVVVGSG GGGV + VLA +G KV+V+EKG+Y+  ++    EGP MDK++  GG+L
Sbjct  230   IKCDAVVVGSGSGGGVAASVLAKSGLKVVVMEKGSYFTESDYPPFEGPGMDKLYENGGIL  289

Query  1516  MTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCG  1337
              + D ++++LAGSTVGGGSAVNWSA IKTP  VL EW E   + LF +  Y  AM+ V  
Sbjct  290   PSVDGNVMILAGSTVGGGSAVNWSACIKTPKSVLHEWSEDQKIPLFATKEYVSAMELVWK  349

Query  1336  KMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAET  1157
             ++GV   CE E FQN +LRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  T
Sbjct  350   RIGVTERCEKEGFQNQILRKGCENLGINVENVARNSSEKHYCGSCGYGCRQGEKKGSDRT  409

Query  1156  WLVDLVKSGNGAILPECEALQVIHERNKAK----------GVMFTFQRDGVKQTAVIKSK  1007
             WLVD V  G   IL  C+A + I E+N  K          GVM       + +   I++K
Sbjct  410   WLVDAVSHG-AVILTGCKAERFILEKNNCKNRGGKKMKCLGVMAKSLNGNILKKIKIEAK  468

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPD--TPGENKKS--YEGAI  839
             VTV A GAL TP L+I+SGL+N++IG+NLHLHPV+ AWG+FP+  +P  N K   YEG I
Sbjct  469   VTVSAAGALLTPPLMISSGLRNRHIGKNLHLHPVLMAWGYFPEKASPNSNFKGNCYEGGI  528

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             +++MS V+     +   A+I+TPAL P  F+ L PW SG + K RMSRY+RT ++  + R
Sbjct  529   ITSMSKVL--SEDSEVRAIIETPALGPASFAVLCPWISGLDMKKRMSRYSRTVNLITIVR  586

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+GSGE  +   V+Y +DKTD+ENL  GL + LRIL  AGAEE+G +   G  L  K   
Sbjct  587   DRGSGEVKTEGRVSYVVDKTDKENLNAGLRQSLRILIQAGAEEVGTHRSDGQKLVCKGVD  646

Query  478   REEFERFVK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
              +  E F+     EE  +++ +  ++ +SAHQMGSC++G D +   ++  GE+WE E LF
Sbjct  647   EKSIEEFLDSVNAEEGPKAMTEKWSVYSSAHQMGSCKIGEDEEEGAIDLNGESWEAEKLF  706

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT  203
             V DGS LP+A+GVNPM+TIM+ +YCIS  + + + T
Sbjct  707   VCDGSALPSAVGVNPMITIMATAYCISTRIAKSMTT  742



>ref|XP_008382898.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase FAO2 
[Malus domestica]
Length=674

 Score =   515 bits (1327),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 305/662 (46%), Positives = 405/662 (61%), Gaps = 34/662 (5%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNFFTAMKALV  1964
             S R+GT LLCGK     ++PF+ +F E+S  KRE+++  W+   L   IR  F  +K   
Sbjct  28    SLRLGTFLLCGKCCFDWKWPFIHKFAEMSLDKREQVLKKWSRQKLVITIRLMFMVVKMFC  87

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDL  1784
                FF+ VD+   NP+WKAIGY      +  K+K  K              PL KGII+ 
Sbjct  88    FYTFFSRVDENSRNPAWKAIGY-----ELDRKEKLIKTPKER---------PLEKGIIET  133

Query  1783  NLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
                 +      LTK G  +A          I+CD V+VGSGCGGGV + VLA +G KV+V
Sbjct  134   AYESDSTLVESLTKKGLDLAD-DAVNNIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVVV  192

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKGNY+   + S LEGPSM++++  GG+L + D  +++LAGSTVGGGSAVNWSASIKTP
Sbjct  193   LEKGNYFVPKDYSSLEGPSMNELYESGGILSSVDGMVMILAGSTVGGGSAVNWSASIKTP  252

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
               VLR+W   H + L+ S+ Y+ AMD VC ++GV   C +E+F N +LRKGC  LG  V 
Sbjct  253   DNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEENFPNQILRKGCENLGLKVD  312

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE-----  1082
              +P N+ +DHYCG+C +GC  G KKGT  TWLVD VK G   IL  C+A + I E     
Sbjct  313   AVPXNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVKFG-AVILTGCKAEKFILENDNEG  371

Query  1081  --RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHP  908
               R +  GV  T     +K+   I++ VT+ A G+L TP L+I+SGLKN+NIGRNLHLHP
Sbjct  372   GIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLLTPPLMISSGLKNRNIGRNLHLHP  431

Query  907   VVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG-YGAVIQTPALHPGLFSALMP  734
             V+ AWG+FP+   E K KSYEG I++++  V   V+GT     +I+T A+ P  FS L P
Sbjct  432   VLLAWGYFPEHEPEFKGKSYEGGIITSLHKV---VSGTANVRTIIETAAVGPATFSTLFP  488

Query  733   WNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRI  554
             W S  + K  M +YARTA++FAL RD+GSG       + Y LD+ D+ENLQ GL + LRI
Sbjct  489   WTSRLDMKDTMEKYARTANLFALVRDRGSGAVKREGRIHYTLDQLDKENLQVGLRQTLRI  548

Query  553   LAAAGAEEIGCNHGTGLTLKVKDASREEFERF---VKEESSQSLRKHP-NLKASAHQMGS  386
             L AAGA E+G     G  +K K    E+ E F   V   +  S R+      +SAHQMGS
Sbjct  549   LIAAGAVEVGTYRNDGQRIKCKGVEEEDLEVFLDTVVAAAGPSAREELWTTYSSAHQMGS  608

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             CRMG   +   V+  GE+WE +GLFV DGS+LPTA+GVNPM+TI S +YCIS+ + + L+
Sbjct  609   CRMGATEEEGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMITIESTAYCISKRIAQSLE  668

Query  205   TH  200
               
Sbjct  669   KQ  670



>emb|CDO99261.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   518 bits (1333),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 320/740 (43%), Positives = 449/740 (61%), Gaps = 42/740 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI--NEALPET------TDASVTNFFQTSAASTGTPHQVAWV  2201
              S S++E L+ +C  F+P +  N + P+       T  ++ +F+++S A    P +VA +
Sbjct  23    FSSSELEALTGICEAFIPPLPLNNS-PDIVGKDGKTKEAIQSFYKSSGAQYPIPDEVAEL  81

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
               +R     +  + LLL  LSTR+GTLLLCG      ++P++ +F +I  + RE+++  W
Sbjct  82    AVKRGFLEAVILVRLLLIILSTRLGTLLLCGTLCFGEKWPYINKFSDIPVENREKVIQKW  141

Query  2020  ATSS-LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
                  L  IR  F  +K L L  FFT V D   NP+W+A+ Y   +   S     +K   
Sbjct  142   FKHRFLTPIRLPFVFIKFLCLYAFFTQVWDDLKNPAWEAMDYQVDNRKDSSTTPHEK---  198

Query  1843  heddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL KG+++  +  E  + + L + G  V K  P    + I+CD V+VGS
Sbjct  199   -----------PLMKGMVETTHETESTIVSSLVQKGLRV-KEVPKEKLYKIKCDVVIVGS  246

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV + VLA +G KV+V+EKGNY+ +T+ S LEGPSM++++  GG+L T D  M+LL
Sbjct  247   GCGGGVAAAVLAKSGQKVVVIEKGNYFTKTDYSSLEGPSMNELYESGGILATLDGKMMLL  306

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
             AGSTVGGGSAVNWSA IKTP  VL+EW     + LF S  Y  AMDTV  ++GV  +C +
Sbjct  307   AGSTVGGGSAVNWSACIKTPMSVLQEWANDCQIPLFTSSQYISAMDTVSQRIGVTEKCSE  366

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E FQN +LR+GC +LG  V ++P+N+  +HYCG C +GC+ G KKGT  TWLVD V  G 
Sbjct  367   EGFQNQILRRGCEKLGLEVESVPRNSSENHYCGSCNYGCRTGDKKGTDSTWLVDAVACG-  425

Query  1126  GAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTP  971
               I+  C+  + + E+N        K  GV+       ++    I++KVT+ A G+L TP
Sbjct  426   AVIITGCKTEKFVLEKNKYGRSRKSKCLGVIAKCLNGDIRNRLCIEAKVTISACGSLLTP  485

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG  794
              L+I+SGL N++IGRNLHLHPV+ AWG+FP++  E K K YEG I++++  V    + + 
Sbjct  486   PLMISSGLTNQHIGRNLHLHPVLMAWGYFPESDSELKGKIYEGGIITSVHKV--GSDDSS  543

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
               A+I++PAL P  F+AL PW SG E K RM +YARTAH+F++ RD+GSGE  S   +++
Sbjct  544   VRALIESPALGPASFAALRPWESGLESKKRMLKYARTAHLFSMIRDRGSGEVRSEGRISH  603

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS--  440
               D TD+ENL  GL + LRIL AAGA E+G     G   K K  S  E E F+ E ++  
Sbjct  604   TFDATDKENLTAGLRQALRILVAAGAVEVGTLQSDGQKFKCKGTSEGELEEFLDEVTAAG  663

Query  439   --QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +SL ++     SAHQMGSCRMG   K   V+  GE+WE EGLFV D SVLP A+GVNP
Sbjct  664   GPKSLVQNWTTYFSAHQMGSCRMGKSEKVGAVDENGESWEAEGLFVCDASVLPGAVGVNP  723

Query  265   MVTIMSVSYCISQSVLEFLK  206
             M+TI S +YC+S  + E LK
Sbjct  724   MITIQSTAYCLSNKIAEILK  743



>gb|KHG12235.1| Long-chain-alcohol oxidase FAO1 [Gossypium arboreum]
Length=748

 Score =   517 bits (1332),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 308/757 (41%), Positives = 450/757 (59%), Gaps = 65/757 (9%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAAS  2231
              ++E        S +++ TL+A+     P++            +T   +V +F +TSA+ 
Sbjct  16    EEIEGKKYDHGFSSAEVNTLAAIAEALFPSLPPSSCCFERRENQTISKAVRSFMETSASQ  75

Query  2230  TGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQ  2051
             +  P + A ++ +R+    +  + ++L  LST++GTLLLCG      ++P++  F  +  
Sbjct  76    SPFPDEAAEMLWKRLFIECVVVVRVVLLLLSTKVGTLLLCGSHCWGKEWPYINGFTSMPL  135

Query  2050  KKRERIVHSWATSSLQFIRNFFTAM-------KALVLLVFFTSVDDKGDNPSWKAIGYCG  1892
              KRE+++ +W      F   FFT         K  +L + F+ VD+ G+NP+W+AIGY  
Sbjct  136   AKREQVLQAW------FKHRFFTPFRVAFLYFKVAILFIIFSRVDENGENPAWEAIGY--  187

Query  1891  PDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR------LTKLGCSV  1730
                +I + +                  PL +GI++      HV +       LT+ G  V
Sbjct  188   ---NIDKVENVPNER------------PLQQGIVETM----HVIDSIDLHKLLTEKGLQV  228

Query  1729  AKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
              +  P   +  I+CDAV+VGSGCGGGV +  LA++G KV+VLEKG+Y+   + S  EGPS
Sbjct  229   TQ-DPHKNAIKIKCDAVIVGSGCGGGVAAATLASSGLKVVVLEKGSYFGPADYSPFEGPS  287

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             M+K++  GG L + D    +LAGSTVGGGSAVNWSA IKTP  VL+EW +   + +FGS+
Sbjct  288   MEKLYELGGSLPSIDGQFAILAGSTVGGGSAVNWSACIKTPESVLKEWTDECKIPVFGSN  347

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
              Y  AMD VC ++GV  +CE+E FQN+VL KGC+ LG+ +  +P+N+ S HYCG C FGC
Sbjct  348   EYVSAMDIVCERIGVTEDCEEEGFQNLVLCKGCKNLGFDIEKVPRNSSSRHYCGSCGFGC  407

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDG  1037
             + G KKGT +TWLVD V +G   IL  C+A + + E+N         K  GV+ T     
Sbjct  408   RRGDKKGTDKTWLVDAVNNGT-VILTACKAEKFMLEQNTTMISTRKMKCTGVIATTFNKN  466

Query  1036  VKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NK  860
             + +   I++KVT+ A GAL TP L+ +SGLKN NIGRNL LHPV+ +WG+FPD+  +   
Sbjct  467   ITKKLQIEAKVTISACGALHTPLLMYSSGLKNPNIGRNLRLHPVLMSWGYFPDSDSDIEG  526

Query  859   KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTA  680
             K+ +G I++++  V+   N     A+I+TP+L PG ++AL PW SG +FK RM +++RTA
Sbjct  527   KAVDGGIITSVHKVLGPNNNV--QAIIETPSLGPGQYTALCPWVSGLDFKQRMLKFSRTA  584

Query  679   HIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLT  500
             H+  + +D+GSGE      VTY  D TD ENL+ GL + LR+L AAGA E+G +   G  
Sbjct  585   HLITIVKDRGSGEVHMGGRVTYKFDATDRENLRAGLRRSLRVLVAAGAVEVGTHRSDGQK  644

Query  499   LKVKDASREEFERFVKEESSQSLRKHPNLK----ASAHQMGSCRMGVDPKASVVNPKGET  332
             LK K  S+EE E F+    S         K     +AHQMGSC+MG + K   V+  GE+
Sbjct  645   LKCKGVSKEELEEFLDTVFSVGGPLFGGDKWMVHTTAHQMGSCKMGRNEKDGGVDENGES  704

Query  331   WEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV  221
             WE EGL+V D SVLPTA+GVNPM+T+MS +YC+S+ +
Sbjct  705   WEAEGLYVCDASVLPTAIGVNPMITVMSTAYCLSKRI  741



>ref|XP_006354464.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Solanum 
tuberosum]
Length=667

 Score =   513 bits (1322),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 289/660 (44%), Positives = 404/660 (61%), Gaps = 33/660 (5%)
 Frame = -3

Query  2140  STRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALV  1964
             STRIG+LLLCG       +P++ +F +IS  KRE ++  W  +     +R  F  +K L 
Sbjct  20    STRIGSLLLCGLFCFGKSWPYINKFSDISLDKREIVMQKWFNNRFFTPVRLAFVFVKFLC  79

Query  1963  LLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID-  1787
             L +FFT V +   NP+W  IGY   +   S +   ++              PL KGII+ 
Sbjct  80    LYIFFTQVGEDSKNPAWDDIGYQVDNEENSSETPDER--------------PLQKGIIET  125

Query  1786  LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLV  1607
             +   E  +   L + G  V +       + ++CD V+VGSGCGGGV + VLA++G KV+V
Sbjct  126   IYETESTIVKSLVEKGLKVTED-TKNNMYKVQCDVVIVGSGCGGGVAASVLASSGQKVVV  184

Query  1606  LEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTP  1427
             LEKGNY+A+++ S LEGPS  +M+  GG+  T D  +++LAGSTVGGGSAVNWSA IKTP
Sbjct  185   LEKGNYFAKSDYSSLEGPSQSQMYESGGIFSTLDGKVMILAGSTVGGGSAVNWSACIKTP  244

Query  1426  PYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVV  1247
               +++EW +   + +F +  Y  AMD VC ++ V  +C  E  QN +L+KGC  LG  V 
Sbjct  245   DSIIQEWGDDKRISMFKTPEYVSAMDKVCERINVTEKCTQEGLQNQILQKGCERLGLEVE  304

Query  1246  NIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHER----  1079
              + +N+  DHYCG C +GC+ G KKGT  TWLVD V  G   I+  C+A + I E     
Sbjct  305   GVARNSSEDHYCGSCCYGCRRGEKKGTDTTWLVDAVDCG-AVIITGCKAERFILENKKYG  363

Query  1078  ----NKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLH  911
                  K  GV+ T     + ++  I++KVT+ A G+L TP L+I+SGLKN+NIGRNLHLH
Sbjct  364   KTRSKKCLGVISTSMNKDITKSICIEAKVTISACGSLLTPPLMISSGLKNRNIGRNLHLH  423

Query  910   PVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMP  734
             PV+ AWG+FP++  + K K YEG I++++  V    + +   A+I+ PAL PG F+AL P
Sbjct  424   PVIMAWGYFPESNSDLKGKIYEGGIITSVHKV--GSHDSNVRAIIEAPALGPGSFAALCP  481

Query  733   WNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRI  554
             W SG++ K R+ +Y RTAH+FA+ +D GSGE  S   + Y  + TD+E+L+ GL + LRI
Sbjct  482   WTSGEDIKNRLLKYDRTAHLFAMVKDVGSGEVRSEGRINYTFNGTDKESLKLGLRQALRI  541

Query  553   LAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----EESSQSLRKHPNLKASAHQMGS  386
             L AAGA E+G     G  +K K  S +  E F+      E  +SL K      SAHQMGS
Sbjct  542   LIAAGAAEVGTQRSDGQRIKCKGQSEKALESFLDTVTAAEGPKSLVKDFTTYCSAHQMGS  601

Query  385   CRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             CRMG++ K S V+  GE+WE EGLFV D SVLP A+GVNPM+TI S +YC+S+ + E +K
Sbjct  602   CRMGMNEKDSAVDENGESWEAEGLFVCDASVLPGAVGVNPMITIQSTAYCLSKKIAEMIK  661



>ref|XP_004982884.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=764

 Score =   516 bits (1330),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 305/756 (40%), Positives = 436/756 (58%), Gaps = 44/756 (6%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDA-------SVTNFFQTSA  2237
             L R+ +    T  L P QME L A+C   +P++    P   D         V  F++ SA
Sbjct  19    LLRRCKRERYTHGLRPPQMEALRAMCGALIPSLPVEGPFHGDKHGGGNKDDVERFYRASA  78

Query  2236  ASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEI  2057
             A    P +VA +     +   +  + ++LW LST++GT +LCG   +S++FP++ +F ++
Sbjct  79    ADGAIPDEVAEMATGCARE-AMLLVRVILWMLSTKVGTFVLCGWLCVSSRFPYVFKFADM  137

Query  2056  SQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPS  1880
               ++RE ++  W+ +   F ++  F  +K L    F+T++++  DNPSWKAIGY  PD  
Sbjct  138   PLERREEVLKWWSKTRWLFPLKVTFVLVKILSHYSFYTTINEHSDNPSWKAIGYSVPDVD  197

Query  1879  ISekqkkqkhhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPS  1703
               ++   +               PL  G+++  +L +  +   L   G +V K    GP 
Sbjct  198   RPQEDLSEAAPSPSPR-------PLDSGVVETRSLDDAALLRSLMDKGLAV-KADVSGPH  249

Query  1702  FVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGG  1523
               ++CD V+VGSGCGGGV + VLA AG+KV+V+EKG+Y+   + S +EGPSM++++  GG
Sbjct  250   HTVQCDVVIVGSGCGGGVAAAVLAAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGG  309

Query  1522  LLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTV  1343
             +  T +   ++  G+TVGGGSA+NWSASI+TP +V +EW   HGL +FGS  Y  AMD V
Sbjct  310   IFCTSNASTIMFTGATVGGGSAINWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAV  369

Query  1342  CGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTA  1163
             C ++ V   C +E FQN  LR GC  LG     +P+N    H+CG C  GC  G K+GT 
Sbjct  370   CTRLAVTSGCREEGFQNKALRNGCEALGLRADAVPRNTSEGHFCGSCHLGCPTGEKRGTD  429

Query  1162  ETWLVDLVKSGNGAILPECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVIKS  1010
              TWLVD V  G   +L  C+A + + E N  K         G++     DG+ +   I++
Sbjct  430   TTWLVDAVAQG-AVVLTGCKAERFVLESNPGKNGCRSKRCVGLVAKCMGDGITRKLRIEA  488

Query  1009  KVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK----KSYEGA  842
             KV++ A GAL TP LL  SGLKN++IGRNLHLHPV  AWG+FPD   E +    K YEG 
Sbjct  489   KVSISACGALMTPPLLRRSGLKNRHIGRNLHLHPVSMAWGYFPDGTPEPRPLTGKCYEGG  548

Query  841   IMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALA  662
             I++ +  V           ++QTPAL PG  ++L+PW SG++ K RM RYARTAH FAL 
Sbjct  549   IITTLHRVTART-------IVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALV  601

Query  661   RDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA  482
             RD+G+G       V Y     D E L+ GL + LRIL AAGA E+G +   GL L+ +  
Sbjct  602   RDRGAGTVGREGRVRYVPSSEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGL  661

Query  481   SREEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEG  317
               E+ E F+ E +       P      L  SAHQMGSCRMG  P+   V+ +GE+WE EG
Sbjct  662   RDEDLEAFLNEVTVAKGPMIPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEG  721

Query  316   LFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             L+V DGS+LPTA+GVNPM+TI S +Y +S+ + E L
Sbjct  722   LYVCDGSLLPTAVGVNPMITIQSTAYYVSKGIAESL  757



>ref|XP_010457422.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Camelina sativa]
Length=752

 Score =   516 bits (1328),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 308/744 (41%), Positives = 435/744 (58%), Gaps = 46/744 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
              SPS ++ LSA+C   LP +          L    + ++ +FF++S+     P +VA ++
Sbjct  23    FSPSDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSSGPHVRPDEVAELL  82

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSW  2021
               +     +  + ++L  L+ R+GTLLLCG   L    +PFLL+F EIS +KRE+++  W
Sbjct  83    ATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVCLDQANWPFLLKFSEISLEKREKVLQRW  142

Query  2020  ATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
              T       R  F  +KA+ L  +FT  D+  +NP+W AIGY     S+   + +   H 
Sbjct  143   NTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIGY-----SVDMNESEGMEHK  197

Query  1843  heddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL KGII+ +  +E     R+   G  V + +    ++ IECDAVVVGS
Sbjct  198   ER---------PLEKGIIETDKEDEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVVVGS  247

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV +  LA +G +V+VLEKGNY+   + S LEGPS  +MF    LLMT D     +
Sbjct  248   GCGGGVAAANLAKSGLRVVVLEKGNYFVPRDYSSLEGPSTFEMFESNSLLMTHDGRFRFM  307

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
             AGSTVGGGS VNW+AS+KTP  ++ EW    G+ +F S+ Y+ AMD VC ++GV      
Sbjct  308   AGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISVFSSEKYKTAMDRVCKRIGVTERVIR  367

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E FQN +LRKGC +LG  V  +P+N+   HYCG C+FGC  G K+GT  TWLVD V + N
Sbjct  368   EGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSFGCPTGEKRGTDLTWLVDAV-NNN  426

Query  1126  GAILPECEALQVIHERNKAK------------GVMFTFQRDGVKQTAVIKSKVTVIAGGA  983
               IL +C+A +VI   N A             GV  +   +  ++   I +KVT++A G+
Sbjct  427   AVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAASLS-NRTRKKLQINAKVTIVACGS  485

Query  982   LTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNV  806
             L TP LL +SGLKN NIGR LH+HP++ AWG+FP+   +    ++EG I++A+   V  +
Sbjct  486   LKTPQLLASSGLKNPNIGRGLHIHPILMAWGYFPEKKSDFEGAAHEGEIVTALH-YVHPM  544

Query  805   NGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPT  626
             + T     ++TPA+ PG F+AL+PW SG + K R+++Y+RT+HIF + RD+G GE     
Sbjct  545   DSTTSNITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVMVRDEGVGEVKGGI  604

Query  625   SVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEE  446
              V Y L K DEENL  GL++ L+ILAAAGA E+G     G  +K       + E F++  
Sbjct  605   -VKYRLTKADEENLTIGLKQALQILAAAGAAEVGTYRSDGQRIKCDGMKHNDLEAFLQTV  663

Query  445   SS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTAL  278
              +     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLPTAL
Sbjct  664   EAPAGVMSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTAL  723

Query  277   GVNPMVTIMSVSYCISQSVLEFLK  206
             GVNPM+TI S +YCIS  + E +K
Sbjct  724   GVNPMITIQSTAYCISNRIAELMK  747



>ref|XP_010532673.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=770

 Score =   516 bits (1330),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 314/749 (42%), Positives = 448/749 (60%), Gaps = 61/749 (8%)
 Frame = -3

Query  2362  KTLSPSQMETLSALCNTFLPAINEALPETT----------DASVTNFFQTSAASTGTPHQ  2213
             +  + ++ME+L+A+C+T LP ++   PE +            ++ +F   SA+     HQ
Sbjct  43    RGFTAAEMESLAAVCDTILPPLS---PEDSAGGGEDDHPNKEALRSFCSASASQPLFLHQ  99

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
                ++ +R     +  + L+L  LS+R GTLLLCG   L   +PF+ RF  +S +KRER+
Sbjct  100   TVELMLKRGFIEAVLVVRLVLLLLSSRFGTLLLCGTHCLVPNWPFVERFGSLSLEKRERV  159

Query  2032  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekqk  1862
             +  W  + L F IR  F  +K + L  FF+ +   GDNP+W+AI Y     D   S   K
Sbjct  160   LQKWFRNRLLFPIRVAFIFIKVIFLFCFFSWIGPNGDNPAWEAIQYQVKAEDNESSYVPK  219

Query  1861  kqkhhdheddieELLFGPLYKGIIDL------NLPEEHVFNRLTKLGCSVAKPKPPGPSF  1700
             ++               PL KG++D        LPE     R  +LG +         + 
Sbjct  220   ER---------------PLEKGMVDTMKETDSTLPETI---RQKELGVTFGSKHD---TI  258

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              I+CDAV++GSG GGGV + VLA AG KV+VLEKG+Y+  +  S  EGP + +++  GG+
Sbjct  259   EIKCDAVIIGSGSGGGVAAAVLANAGLKVVVLEKGSYFVSSEYSPFEGPGLSELYESGGI  318

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
             L T D ++++LAG+TVGGGS VN+SASIKTP  VLREW E H + LFG+  Y  AMD V 
Sbjct  319   LPTVDGNLMILAGATVGGGSVVNYSASIKTPESVLREWAEDHKIPLFGTQEYVSAMDVVW  378

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++ V  +C  ESFQN VLRKGC  LG  V N+P+N+  +H CG C +GC+ G K+G+  
Sbjct  379   KRISVTEKCRQESFQNQVLRKGCLNLGLKVENVPRNSSENHCCGSCCYGCRQGDKQGSDR  438

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKS  1010
             TWL+D V  G   IL  C+A ++I E+N          K  GVM       + +   I++
Sbjct  439   TWLLDAVNHG-AIILTGCKAERLILEKNMNRGVGAKKMKCSGVMANSLNGNISKKLHIEA  497

Query  1009  KVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKS--YEGAIM  836
             KVTV+A GA++TP L+I SGLKN+NIGRNLHLHPV+ AWG+FP+    + K   YEG I+
Sbjct  498   KVTVVACGAISTPPLMIKSGLKNRNIGRNLHLHPVLMAWGYFPEKETSDLKGSIYEGEIL  557

Query  835   SAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARD  656
             ++++ VV +   +   A+I+TPAL P  F+A+ PW SG + K RM +Y+RTAH+  + RD
Sbjct  558   TSINKVV-SYQDSEVRAIIETPALGPSSFAAVCPWISGLDMKNRMIKYSRTAHLLTIVRD  616

Query  655   KGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR  476
             +GSGE  +   V Y +DKTD+EN+  GL + LRIL +A A E+G +   G   K K    
Sbjct  617   RGSGEIKTEGRVKYVVDKTDKENIVAGLRQSLRILISARAVEVGTHRSDGQRFKCKGMDE  676

Query  475   EEFERFVK----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFV  308
             +  E F+     E+ + SL +   +  SAHQMGSCR+G + +   ++P GE+WE EGLFV
Sbjct  677   KAIEEFLDTVTAEDGASSLTEKWAVYGSAHQMGSCRIGENEEEGALDPNGESWEAEGLFV  736

Query  307   GDGSVLPTALGVNPMVTIMSVSYCISQSV  221
              DGSVLP+A+GVNPM+TIM+ SY IS  +
Sbjct  737   CDGSVLPSAIGVNPMITIMATSYGISTGI  765



>ref|XP_010532671.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Tarenaya hassleriana]
Length=741

 Score =   515 bits (1327),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 306/743 (41%), Positives = 445/743 (60%), Gaps = 51/743 (7%)
 Frame = -3

Query  2344  QMETLSALCNTFLPAINEALPETTD------ASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
             +ME+L+A+C T LP ++     T +       ++ +F+  S + +   HQ A +I +R  
Sbjct  20    EMESLAAVCETILPPLSPEYSNTDEDDHPNKEALRSFYSGSGSQSHVLHQAAELITKRGL  79

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-L  2006
                +  + L+L  LS+R+GTL+LCG   L   +PF+ RF  +S +KRER++  W  S  L
Sbjct  80    IEVVLVMRLVLVLLSSRLGTLVLCGTHCLVPNWPFVERFGSLSLEKRERVLQKWFRSKIL  139

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               IR  F  +K + L  FF+ V+  G+NP+W+AI Y             Q + +  +   
Sbjct  140   AAIRVAFVHIKIVFLFCFFSWVNTNGENPAWEAIQY-------------QVNLEESESSN  186

Query  1825  ELLFGPLYKGII------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsg  1664
              L   PL KG++      D  LPE      L++ G  V       P   I+CD V++GSG
Sbjct  187   ILKERPLEKGMVETVKETDSTLPES-----LSEKGLEVTSGSNHDP-IKIKCDVVIIGSG  240

Query  1663  cgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLA  1484
              GGGV + VLA++  KV++LEKG Y+A +  S  EG   D+++  GG+L T D + +++A
Sbjct  241   SGGGVAAAVLASSDLKVVILEKGRYFAPSEYSPFEGHGFDQLYESGGVLPTLDGNAMIIA  300

Query  1483  GSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDE  1304
             G+TVGGGSAV+WSA IKTP  VL+EW + H +  FG+  Y  AMD VC ++GV   C +E
Sbjct  301   GATVGGGSAVSWSACIKTPESVLQEWVKDHRIPFFGTQEYVSAMDAVCKRIGVTYRCNEE  360

Query  1303  SFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNG  1124
             SFQN VLRKGC  LG  V N+P+N+  +HYCG C +GC+ G KKG+  TWL+D V  G  
Sbjct  361   SFQNQVLRKGCHNLGLKVENVPRNSSENHYCGSCCYGCRQGDKKGSDRTWLLDAVNHG-A  419

Query  1123  AILPECEALQVIHERN----------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTT  974
              +L  C+A ++I E+N          K  GVM       + +   I++KVTV+A GAL T
Sbjct  420   VVLTGCKAERLILEKNMNRGVGAKKMKCLGVMAKCLNGNISRNLQIEAKVTVMACGALLT  479

Query  973   PSLLINSGLKNKNIGRNLHLHPVVFAWGHFP--DTPGENKKSYEGAIMSAMSTVVLNVNG  800
             P L+I S LKN+NIGRNLHLH    AWG+FP  +T     K YEG I+++ + V+     
Sbjct  480   PPLMIRSSLKNRNIGRNLHLHLAQVAWGYFPEKETSHLKGKIYEGGIITSANKVL--SKD  537

Query  799   TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
             +   A+I+TPAL P LF+AL PW+SG + K RM++Y+RTA++  + RD+GSGE  +   +
Sbjct  538   SEVRALIETPALGPSLFTALSPWSSGLDMKNRMTKYSRTANLVTIVRDRGSGEIKAEGRI  597

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK----  452
              Y LDKTD+EN+  GL + LRIL +AGA E+G +   G +LK K    +  E F+     
Sbjct  598   KYALDKTDKENIVAGLRQSLRILISAGAVEVGTHRSDGQSLKCKGIDEKAIEEFLDTVTA  657

Query  451   EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  272
             E+   S  +   +  +  QMGSCR+GV+ +   ++P GE+WE E LFV DGSVLP+A+GV
Sbjct  658   EDGPGSFTEKWMVYGTTQQMGSCRIGVNEEEGALDPNGESWEAEKLFVCDGSVLPSAIGV  717

Query  271   NPMVTIMSVSYCISQSVLEFLKT  203
             NPM+T+M+ +YCIS  + + ++T
Sbjct  718   NPMITVMATAYCISTGIAKSIRT  740



>gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica 
Group]
Length=784

 Score =   516 bits (1329),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 309/745 (41%), Positives = 431/745 (58%), Gaps = 31/745 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             T  L  +QM  L A+C   +PA+     +      D  V  F+  +AA +  P +VA + 
Sbjct  28    THGLGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELT  87

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
               R        + ++LW L+TR+GTL LCG+  +S +FP++ RF ++  ++RE  +    
Sbjct  88    MTRCIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMPVERREAALKRSR  147

Query  2017  TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS-ekqkkqkhhdh  1841
             +S      +  ++      ++ +  VD+  +NPSWKAIGY  P      +K++  +    
Sbjct  148   SSLPSSRSSATSSSTPRFQVLIYHIVDENLENPSWKAIGYSVPAAEEEPQKEEPTEATPT  207

Query  1840  eddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSV--AKPKPPGPSFVIECDAvvvg  1670
                       PL  G+++   L +  +   L + G ++      P      + CDAVVVG
Sbjct  208   PAPATAPPCRPLDNGVVETKQLDDNALLMSLAEKGLALKTGASSPSAHHHTVLCDAVVVG  267

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV + VLA+AGYKV+V+EKG+Y+A  + S LEGP+M++++  GG+  T ++   +
Sbjct  268   SGCGGGVAAAVLASAGYKVVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTM  327

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
              AG+TVGGGSAVNWSA I+TP  VL+EW   HGL LFG   Y +AMD VC ++GV   C 
Sbjct  328   FAGATVGGGSAVNWSACIRTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCR  387

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E FQN  +R+GC  LG  V  + +N+   H+CG C  GC  G K+GT  TWLVD V  G
Sbjct  388   EEGFQNKAVRRGCEALGLRVEAVSRNSSEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRG  447

Query  1129  NGAILPECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
                IL  C+A + I E N            GV+      G+ +   I++KV+V A GAL 
Sbjct  448   -AVILTGCKAERFILETNTGGGGGRRKKCVGVVAKCLGKGITKKLRIEAKVSVSACGALM  506

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNG  800
             TP LL NSGLKN++IGRNLHLHPV  AWG+FPD+  E   KSYEG I+++M  V      
Sbjct  507   TPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKSYEGGIITSMHRVTDRT--  564

Query  799   TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
                  +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V
Sbjct  565   -----IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRV  619

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS  440
              +   + D   L+ GL + LRIL AAGA E+G N   GL L+ K A  E+ E F+ E S 
Sbjct  620   RFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSV  679

Query  439   QSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
             +    HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+G
Sbjct  680   EKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVG  739

Query  274   VNPMVTIMSVSYCISQSVLEFLKTH  200
             VNPM+TI SV+YC+++ + E L + 
Sbjct  740   VNPMITIESVAYCVAKGIAESLASR  764



>ref|XP_009369442.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Pyrus x bretschneideri]
Length=749

 Score =   515 bits (1326),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 316/740 (43%), Positives = 438/740 (59%), Gaps = 40/740 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPETTD-----ASVTNFFQTSAASTGTPHQVAWVIN  2195
              S +Q+++L+A+C   LP ++ E +P+  +      S +++   SA+    P +VA ++ 
Sbjct  25    FSSAQIQSLAAICEALLPPLSPEDIPDDHNPLHSSFSSSSYCTASASQPPIPDEVAELMV  84

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWAT  2015
             +R     +  + + L  LS R+GT LLCGK     ++PF+ +F E+S  KRE +   W+ 
Sbjct  85    KRTLPEVVGGVRVFLKMLSLRLGTFLLCGKSCFDWKWPFIHKFSEMSLDKRELVRKKWSR  144

Query  2014  SSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhe  1838
               L   IR  F  +K      FF+ VD+   NP+WKAIGY              +    E
Sbjct  145   QKLVITIRLMFMVIKMFCFYTFFSRVDENSRNPAWKAIGY--------------ELDRKE  190

Query  1837  ddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgc  1661
               I+     PL KGII+     +      LTK G  +           I+CD V+VGSGC
Sbjct  191   KLIKTPKQRPLEKGIIETAYESDSTLVESLTKKGLDLTD-DAVNNIHKIKCDVVIVGSGC  249

Query  1660  gggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAG  1481
             GGGV + +LA +G KV+VLEKGNY+   + S LEGPSM++++  GG++ + D  +++LAG
Sbjct  250   GGGVAAAILAQSGQKVVVLEKGNYFVPKDYSSLEGPSMNELYESGGIMSSVDGMVMILAG  309

Query  1480  STVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDES  1301
             STVGGGSAVNWSASIKTP  VLR+W   H + L+ S+ Y+ AMD VC ++GV   C +E+
Sbjct  310   STVGGGSAVNWSASIKTPDNVLRDWSVDHKIPLYASEDYKSAMDIVCKRIGVTESCTEEN  369

Query  1300  FQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA  1121
             F N +LRKGC  LG  V  +P+N+ +DHYCG+C +GC  G KKGT  TWLVD VK G   
Sbjct  370   FPNQILRKGCENLGLKVDAVPRNSSADHYCGFCNYGCPTGDKKGTDSTWLVDAVKFG-AV  428

Query  1120  ILPECEALQVIHE-------RNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLL  962
             IL  C+A + I E       R +  GV  T     +K+   I++ VT+ A G+L TP L+
Sbjct  429   ILTGCKAEKFILENDNEGGIRKQCLGVQATSLSKNIKRKLQIEANVTISACGSLCTPPLM  488

Query  961   INSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTG-YG  788
             I+SGLKN+NIGRNLHLHPV+ AWG+FP+   E K KSYEG I++++  V   V+GT    
Sbjct  489   ISSGLKNRNIGRNLHLHPVLLAWGYFPEHEPEFKGKSYEGGIITSLHKV---VSGTANVR  545

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
              +I+T  L P  FS L PW S  + K  M +YARTA++FA+ RD+GSG       + Y L
Sbjct  546   TIIETAVLGPATFSTLFPWTSRLDMKDTMDKYARTANLFAMVRDRGSGTVKREGRIHYTL  605

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFER----FVKEESS  440
             D+ D+ENLQ GL + LRIL AAGA E+G     G  +K K    E+ E      V     
Sbjct  606   DQLDKENLQVGLRQTLRILIAAGAVEVGTYRNDGQRMKCKGVEEEDLEEFLDTVVAAAGP  665

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              S  +     +SAHQMGSCRMG   +   V+  GE+WE +GLFV DGS+LPTA+GVNPM+
Sbjct  666   SSREELWTTYSSAHQMGSCRMGTTEEDGGVDENGESWEAKGLFVCDGSLLPTAVGVNPMI  725

Query  259   TIMSVSYCISQSVLEFLKTH  200
             TI S +YCIS+ + + L+  
Sbjct  726   TIESTAYCISKRIAQSLEKQ  745



>ref|XP_006412936.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
 gb|ESQ54389.1| hypothetical protein EUTSA_v10024496mg [Eutrema salsugineum]
Length=756

 Score =   514 bits (1325),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 310/745 (42%), Positives = 437/745 (59%), Gaps = 31/745 (4%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  2210
             +K +        S SQ+++L+ +C T LP           A + +F   S A      +V
Sbjct  18    KKRQGGYYNHGFSSSQIQSLAVICQTLLPPPPPVTTTEQQA-LDSFNVASRAQPPFSDEV  76

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             A +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+ +F E+   KRE ++
Sbjct  77    AEMIVKNGRSQAVKILRIILTILSFRFGTLLLCGSLCLDKDWPFVHKFSELPLDKREEVL  136

Query  2029  HSWATSS--LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
               W+  S  L  +R  F   K   L  FF+  D+   NP+ +AIGY       S  + ++
Sbjct  137   RKWSRQSGFLLPLRITFFLTKFYTLFYFFSQTDENLKNPALEAIGYSIATTETSSNKTRK  196

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
             +              PL  GII+     +  +   L + G  VA+    G    I CDAV
Sbjct  197   EEGTRR---------PLEAGIIETKHETDITITQSLIEKGVHVARDDDNGV-HRIRCDAV  246

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSG GGGV +  LA AG KVLVLEKGNY+A  + S LEGPSM +++  GGL+ T D  
Sbjct  247   IVGSGSGGGVAAANLAKAGLKVLVLEKGNYFAAQDYSALEGPSMQELYEKGGLMTTVDGK  306

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
              ++LAGSTVGGG+AVNWSASI+TP +VL+EW E   +E FGS  YQ AMD V  ++GV  
Sbjct  307   FMILAGSTVGGGTAVNWSASIRTPDHVLQEWSERSKIEFFGSQEYQSAMDEVTRRIGVTE  366

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C  E FQN VLR+GC  LG  VV++P+N+P DHYCG C +GC++G K GT  TWLVD V
Sbjct  367   RCVKEGFQNQVLREGCERLGLKVVSVPRNSPEDHYCGSCGYGCREGYKNGTDRTWLVDAV  426

Query  1138  KSGNGAILPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
             ++G   IL   +A + I        +ER K   GV+ +     +++  +I+++VTV + G
Sbjct  427   ENG-AVILTGVKAERFILVENTNSGNERKKRCVGVIASSVGGKMEKKFMIEARVTVSSAG  485

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLN  809
             +L TP L+++SGL+N+NIGRNL LHPV+  WG+FP+   E + K YEG I++++  +  N
Sbjct  486   SLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYFPEESSEFSGKMYEGGIITSVHHI--N  543

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                 G  A+++ P + P  F+ L PW SG + + RM +Y RTAH+FAL RD GSGE    
Sbjct  544   DGEKGCRAILENPLIGPASFAGLSPWVSGADLEERMMKYGRTAHVFALVRDNGSGEVMKE  603

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
             + V Y   K D+ENL+ G+ + LR+L AAGA EIG     G  +K +  +RE  E F+  
Sbjct  604   SEVRYRTSKKDKENLRVGIRQALRVLVAAGAVEIGTYRSDGQRMKCEGVTREAVEEFLDR  663

Query  448   ESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
               +     + R++     SAHQMGSCRMG   +   V+  GE+WE EGLFV DGSVLP+A
Sbjct  664   VDADGGVSTNREYWTTYFSAHQMGSCRMGHTEEEGAVDENGESWEAEGLFVCDGSVLPSA  723

Query  280   LGVNPMVTIMSVSYCISQSVLEFLK  206
             +GVNPM+TI S +YCIS+ +++ L+
Sbjct  724   VGVNPMITIQSAAYCISKRIVDSLQ  748



>ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp. 
lyrata]
Length=748

 Score =   514 bits (1323),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 316/739 (43%), Positives = 437/739 (59%), Gaps = 42/739 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETT-DASVTNFFQTSAASTGTP--HQVAWVINQRM  2186
              SPSQ+++L+ +C T LP      PETT +    N F   A+ST  P   +VA +I +  
Sbjct  27    FSPSQIQSLAVICQTLLP------PETTAEQQALNSFNV-ASSTQPPFTEEVAEMIVKNG  79

Query  2185  KHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-  2009
             +   +  L ++L  LS R GTLLLCG   L   +PF+L+F ++   KRE I+  W+  S 
Sbjct  80    RSEAVKVLKIILIILSFRFGTLLLCGSLCLDKSWPFVLKFSQLPLDKREEILRKWSRQSG  139

Query  2008  --LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
               L F   FF A K   L  FF+  D+   NP+ + IGYC      S  +K +       
Sbjct  140   FLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALETIGYCLDGIETSSNKKSEADKRRR-  197

Query  1834  dieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcg  1658
                     PL  GII+    E  V    + +G  V   +  G +   I CDAVVVGSG G
Sbjct  198   --------PLETGIIETT-HESDVTITQSLIGKGVHVARDDGDNVHRIRCDAVVVGSGSG  248

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV +  LA AG+KVLVLEKGNY+A  + S LEGPSM +++   GLL T D   +LLAGS
Sbjct  249   GGVAAANLAKAGFKVLVLEKGNYFAPQDYSGLEGPSMLELYEKSGLLTTVDGKFMLLAGS  308

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             TVGGG+AVNWSASI+TP +VL+EW E   ++ FGS  YQ AMD V  ++GV   C  + F
Sbjct  309   TVGGGTAVNWSASIRTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVMTRIGVTERCVKDGF  368

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAI  1118
             QN VLRKGC  LG  V ++P+N+P DHYCG C +GC+ G K GT  TWLVD V++G   I
Sbjct  369   QNQVLRKGCERLGLQVESVPRNSPEDHYCGLCGYGCRAGAKNGTDRTWLVDAVENG-AVI  427

Query  1117  LPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
             L   +A + +        +ER K   GV+ +     + +  +I++++T  + G+L TP L
Sbjct  428   LTGIKAERFVLVDNTSSSNERKKRCVGVIASSVGGKIGKKFIIEARMTASSAGSLLTPPL  487

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYG  788
             +++SGLKN NIGRNL LHPV+  WG+FP+   E + K YEG I++++    +N   +G  
Sbjct  488   MLSSGLKNPNIGRNLKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHH--MNDAESGCR  545

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
             A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE    + VTY  
Sbjct  546   AILENPLIGPASYAGLSPWVSGADLKERMIKYGRTAHVFALVRDIGSGEVMKESEVTYRT  605

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----  440
              K D ENL+ GL + LR+  AAGA E+G     G  +K +  ++E  E F+ E  +    
Sbjct  606   TKKDRENLRAGLRQALRVSVAAGAVEVGTYRSDGQRMKCEGITKEAMEEFLDEVDAVGGV  665

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
              +  ++     SAHQMGSCRMG   +   ++  GE+WE EGLFV DGSVLP+A+GVNPM+
Sbjct  666   STKGEYWTTYFSAHQMGSCRMGATAEEGALDEIGESWEAEGLFVCDGSVLPSAVGVNPMI  725

Query  259   TIMSVSYCISQSVLEFLKT  203
             TI S +YCIS  +++ L++
Sbjct  726   TIQSTAYCISSKIVDSLQS  744



>ref|XP_011080081.1| PREDICTED: long-chain-alcohol oxidase FAO2 [Sesamum indicum]
Length=742

 Score =   513 bits (1322),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 305/727 (42%), Positives = 452/727 (62%), Gaps = 31/727 (4%)
 Frame = -3

Query  2344  QMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlns  2165
             Q+++L+A+C T +P +     +  DA++ +    S   +  P +VA ++ +R     +  
Sbjct  28    QIQSLAAICQTLIPPLPLDDNDNDDANLLHQPNHSFYKSSGPDEVAELLVKRGIPAAVFI  87

Query  2164  lllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNF  1988
             + L+L FLS+R+GTLLLCG   L  ++PF+  F E++ KKRE I+  W+  +L   +R  
Sbjct  88    VSLVLKFLSSRLGTLLLCGWICLDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIA  147

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGP  1808
             F  +K + L VFF+  D+   NP+W+AIGY     +I  + K++K              P
Sbjct  148   FLLLKIMCLFVFFSWTDENSSNPAWEAIGY--QVEAIERETKREKER------------P  193

Query  1807  LYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLA  1631
             L KGII+ +N  E  +   L + G ++A+ +     + I+CD V++GSGCGGGV + VLA
Sbjct  194   LEKGIIEIMNEDELSLKKSLVQKGINIAEDENEN-VYKIKCDVVIIGSGCGGGVAAAVLA  252

Query  1630  TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  1451
              +G KVL+LEKG+Y+   + S LEGP+  +++  GG+L T D  ++++AG+ +GGGS++N
Sbjct  253   KSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTTDGKIMVMAGTALGGGSSIN  312

Query  1450  WSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1271
             WSA I+TP Y+L+EW   + + LFGS  YQ A+D VC ++GV   C  E FQN VLR+GC
Sbjct  313   WSACIRTPDYILKEWSTENKIHLFGSHEYQSAVDAVCERIGVTENCVQEGFQNQVLRRGC  372

Query  1270  RELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPEC--EAL  1097
               LG  V  +P+N+ + HYCG C +GC+ G KKGT  TWLVD VK+ +  IL  C  EAL
Sbjct  373   ENLGLKVEPVPRNSSTYHYCGSCCYGCRRGDKKGTDSTWLVDAVKN-SAVILTGCKAEAL  431

Query  1096  QVI-----HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNI  932
              ++      +R +  GV+ T +   +++   I+++VTV A G+L TP LLI+SGL+NKNI
Sbjct  432   MLVTDNKEKDRKRCLGVIATAENKNIRKKLQIEARVTVSACGSLLTPPLLISSGLQNKNI  491

Query  931   GRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPG  755
             G+NLHLHPV   WG+FP++  E K KS+EG I++++   V +   +   A+++  AL PG
Sbjct  492   GKNLHLHPVSLVWGYFPESLVELKGKSFEGGILTSLHK-VQSEQESDIQAIVEAAALGPG  550

Query  754   LFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRG  575
              F AL PW S ++   RM++YARTA +FAL RD GSGE      + Y L   D+ENL+ G
Sbjct  551   SFGALFPWVSRRDMNDRMTKYARTAVLFALPRDHGSGEVRKQGHIKYRLSAVDKENLKTG  610

Query  574   LEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKHPNLKA  407
             L + LRIL  AGA E+G     G  ++ K    E+ E F+   ++    +S  ++  L  
Sbjct  611   LRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDTVTAVGGPRSRSEYWTLYC  670

Query  406   SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ  227
             SAHQMGSCRMG + +   V+  GE WE +GLFV DGSVLP+A+GVNPM+TI S +YCIS+
Sbjct  671   SAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPSAVGVNPMITIQSTAYCISK  730

Query  226   SVLEFLK  206
              + + LK
Sbjct  731   RLADSLK  737



>ref|XP_006306477.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
 gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
Length=752

 Score =   513 bits (1322),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 307/747 (41%), Positives = 437/747 (59%), Gaps = 52/747 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
              S S ++ LSA+C   LP +       +  L      ++ +FF++S  S   P +VA ++
Sbjct  23    FSQSDLQALSAICEAILPPVPLQSLDLDMKLKVLRSDALLSFFKSSPGSHIRPDEVAELL  82

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHSW  2021
               +     +  + ++L  L+ R+GTLLLCG  SL  + +PFLL+F +IS +KRE+++  W
Sbjct  83    ATKAIPVTVKVVRVVLRILTFRLGTLLLCGLVSLDKENWPFLLKFSDISLEKREKVLQRW  142

Query  2020  ATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkqk  1853
              T       R  F  +KA+ L  +FT  ++  +NP+W AIGY    G +  +  K++   
Sbjct  143   NTQWYNPLARLGFMMIKAIFLFYYFTWTNENTENPAWDAIGYRVDMGENEGMEHKER---  199

Query  1852  hhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                           PL KGII+   + E  +  R+   G  V + +    ++ IECDAV+
Sbjct  200   --------------PLEKGIIETAEVDEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVI  244

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             VGSGCGGGV +  LA +G KV+VLEKGNY+   + S LEGPS  ++F    LLMT D   
Sbjct  245   VGSGCGGGVAAANLAKSGLKVVVLEKGNYFVPRDYSALEGPSTFELFESNSLLMTHDGRF  304

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
               +AGSTVGGGS VNW+AS+ TP  ++ EW    G+ +F S+ Y+ AMD VC ++GV  +
Sbjct  305   RFMAGSTVGGGSVVNWAASLNTPDAIIEEWSVQRGIAIFSSEKYKAAMDRVCKRIGVTEK  364

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
                E FQN +LRKGC +LG  V  +P+N+   HYCG C+FGC  G K+GT  TWLVD V 
Sbjct  365   IIREGFQNTILRKGCEKLGLDVTTVPRNSTDKHYCGSCSFGCPTGEKRGTDSTWLVDAVN  424

Query  1135  SGNGAILPECEALQVIHERNKAK------------GVMFTFQRDGVKQTAVIKSKVTVIA  992
             + N  IL  C+A +VI   N A             GV  +   +  ++   I +KVT+IA
Sbjct  425   N-NAVILTRCKAEKVILADNDAHKRKESGRKKRCLGVTASLS-NRTRKKLEINAKVTIIA  482

Query  991   GGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVV  815
              G+L TP LL +SGLKN NIGR LH+HP++ AWG+FP+   + K  ++EG IM+++   V
Sbjct  483   CGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFKGAAHEGEIMTSLH-YV  541

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
               ++ T     ++TPA+ PG F++L+PW SG + K R+++Y RT+HIF + RD+G GE  
Sbjct  542   HPMDSTTPNITLETPAIGPGTFASLIPWVSGSDIKERLAKYTRTSHIFVMVRDEGVGEVK  601

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
                 V Y L K DEENL  GL++ L+IL AAGA E+G     G  +K     REE E F+
Sbjct  602   GDI-VKYRLTKADEENLTIGLKQALQILVAAGATEVGTYRSDGQRIKCDGIKREELEAFL  660

Query  454   KEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLP  287
                ++     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLP
Sbjct  661   HTVNAPAGVVSMSKHWTHSFTAHQMGCCRMGASEKEGAIDGKGESWEAEDLYVCDASVLP  720

Query  286   TALGVNPMVTIMSVSYCISQSVLEFLK  206
             TALGVNPM+T+ S +YCIS  + E +K
Sbjct  721   TALGVNPMITVQSTAYCISNRIAELMK  747



>gb|KFK29401.1| hypothetical protein AALP_AA7G128800 [Arabis alpina]
Length=745

 Score =   513 bits (1320),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 312/750 (42%), Positives = 437/750 (58%), Gaps = 43/750 (6%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPH  2216
             L  K      +   S SQ+++L+ +C T LP      P +  A   +F   S +      
Sbjct  13    LRSKKREGGYSHGFSHSQIQSLAVICQTLLP------PPSQQAINDSFKVASGSQPPFTD  66

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             +VA +I +  +   +  L ++L  LS R+GTLLLCG   L   +PF+L+F ++    RE 
Sbjct  67    EVADMIVKNGRGEAVKVLRIILMILSFRLGTLLLCGSLCLDKNWPFVLKFSQLPLDTREE  126

Query  2035  IVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekq  1865
             I+  W+T S   L F   FF A K   L  FF+  D+   NP+ +AIGYC  D S S+K 
Sbjct  127   ILRKWSTQSGFLLPFRITFFLA-KFYTLFYFFSQTDENLKNPALEAIGYC-VDTSSSKKS  184

Query  1864  kkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIEC  1688
             +  +              PL  GII+     +    + L + G  VA+         I C
Sbjct  185   QVDEKRP-----------PLESGIIETKHENDITITKSLIEKGLHVARDDN---VHRIRC  230

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             DAVVVGSG GGGV +  LA AG+KV+VLEKGNY+A  + S LE PSM +++   GLL T 
Sbjct  231   DAVVVGSGSGGGVAAANLAKAGFKVVVLEKGNYFAAQDYSGLEAPSMLELYEKSGLLTTI  290

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             D   ++LAGSTVGGG+AVNWSASI+TP +VL+EW E   L+ FGS  YQ AMD V  ++G
Sbjct  291   DGKFMILAGSTVGGGTAVNWSASIRTPDHVLQEWSEESKLKFFGSQEYQSAMDEVTRRIG  350

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V   C  + FQN +LRKGC  LG  V ++P+N+P DHYCG C +GC+ G K GT  TWLV
Sbjct  351   VTERCVKDGFQNQILRKGCERLGLEVDSVPRNSPDDHYCGSCGYGCRTGEKNGTDRTWLV  410

Query  1147  DLVKSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVI  995
             D +++G   IL   +A + I E N         +  GV+ +     + +  +I+++VTV 
Sbjct  411   DAIENG-AVILTGIKAERFILEDNTSSSNGRKKRCVGVIASSIGGKIGKKLMIEARVTVS  469

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTV  818
             + G+L TP L+++SGL+N+NIGRNL LHPV+  WG+FP+   E + K YEG I++++   
Sbjct  470   SAGSLLTPPLMLSSGLENRNIGRNLRLHPVLMTWGYFPEKGSEFSGKMYEGGIITSVHH-  528

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
              +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE 
Sbjct  529   -MNDTESGCRAILENPLMGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDSGSGEV  587

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                + VTY   K D ENL+ GL + LR+L AAGA E+G     G  +K +  S+E  E F
Sbjct  588   MKESEVTYRTTKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGISKEAMEEF  647

Query  457   VKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +    +     +  ++     SAHQMGSCRMG   +   ++  GE+WE EGLFV DGSVL
Sbjct  648   LDGVDAVGGVSTKGEYWTSYFSAHQMGSCRMGHSTEEGALDDNGESWEAEGLFVCDGSVL  707

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             P+A+GVNPM+TI S +YCIS  ++  L+T 
Sbjct  708   PSAVGVNPMITIQSTAYCISTRIVHLLQTR  737



>emb|CDP03771.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   513 bits (1321),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 306/742 (41%), Positives = 458/742 (62%), Gaps = 43/742 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN---EALPET-------TDASVTNFFQTSAASTGTPHQVA  2207
              SPSQ++ LSA+C  FLP+++   +A+  +        +A++  +++ S + +  P +VA
Sbjct  28    FSPSQIQALSAVCEAFLPSLSPPSDAISHSQGDPQLHNEAALEYYYKASGSQSPFPDEVA  87

Query  2206  WVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH  2027
              ++ +R     L+ + L+L  LSTR+GTLL+CG   L+ ++PF+ RF E+  KKRE I+ 
Sbjct  88    EILVKRGLPEGLSVVKLVLKLLSTRLGTLLVCGLICLNWKWPFVHRFSELPVKKRETILQ  147

Query  2026  SWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkh  1850
              W+T +    +R  F  +K +   VFF+  D+   + +  AIGY   D    + + +++ 
Sbjct  148   KWSTETFLIPLRIVFLMIKIMCCYVFFSWTDENYKSRTLDAIGY-NTDAREDKIKPREER  206

Query  1849  hdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvv  1673
                          PL KG+I+ L   +  +   L + G  V + +P    + I+CD V+V
Sbjct  207   -------------PLEKGVIETLYENDSTLKTSLIQKGLFVEE-EPNEDLYKIKCDVVIV  252

Query  1672  gsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMV  1493
             GSGCGGGV + +LA +G+KVLVLEKG+Y+   + S LEGPS ++++L G  L T D  ++
Sbjct  253   GSGCGGGVAAAILAASGHKVLVLEKGHYFVPEDYSGLEGPSFEELYLSGAKLTTVDGKVL  312

Query  1492  LLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQREC  1313
             LLAGSTVGGG+AVNWSASIKTP +VL+EW     +  +G+  YQ AMD V  ++GV + C
Sbjct  313   LLAGSTVGGGTAVNWSASIKTPDHVLKEWSVDRKIPFYGTSAYQSAMDEVFKRIGVTKNC  372

Query  1312  EDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKS  1133
               ESFQN ++++GC +LG     + +N+  +HYCG C +GCK G KKGT  TWLVD V +
Sbjct  373   TVESFQNEIIKQGCEKLGLEAGQVARNSSENHYCGSCGYGCKTGDKKGTHSTWLVDAVNN  432

Query  1132  GNGAILPECEALQVI-------HERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALT  977
             G   IL  C+A + I         R + +GV+   + R+  K+   I+++VT+ A G+L 
Sbjct  433   G-AVILTGCKAEKFILGNNKNEEMRRRCRGVIAAVEGRNITKRKLHIEARVTISACGSLM  491

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNG  800
             TP LL+++GLKNKNIG NLHLHPV+FAWG+FP++  + K  SYEG I++ +  V      
Sbjct  492   TPPLLVSTGLKNKNIGHNLHLHPVLFAWGYFPESKSKIKGNSYEGGIITRLHKV--QTGD  549

Query  799   TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
             +    +I++  L PG  ++L+PW SG + K +MS+YARTA IFAL RD+GSGE      V
Sbjct  550   SNNNCIIESAGLGPGACASLLPWISGNDMKDQMSKYARTARIFALIRDEGSGEVREEGRV  609

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----VK  452
             TY L++ D+E+L+ GL + LRIL AAGA E+G     G  L+     +E+ E F    V 
Sbjct  610   TYHLNEMDKEHLKLGLRQCLRILIAAGAVEVGTYRSDGQRLRCDGIKKEDVEEFLDTIVA  669

Query  451   EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGV  272
             +   +S  ++  +  SAHQ+ SCRMG   +   V+  GE+WE EGLF+ DGSV+P+A+GV
Sbjct  670   DPGPKSAAEYWTIYCSAHQLSSCRMGSTEEDGAVDENGESWEAEGLFLCDGSVIPSAIGV  729

Query  271   NPMVTIMSVSYCISQSVLEFLK  206
             NPM+TI S ++CIS+ + E LK
Sbjct  730   NPMITIQSTAFCISKKIAESLK  751



>emb|CDX92884.1| BnaC07g41420D [Brassica napus]
Length=742

 Score =   512 bits (1318),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 311/744 (42%), Positives = 434/744 (58%), Gaps = 39/744 (5%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETT--DASVTNFFQTSAASTGTPH  2216
             +K +    +   S SQ++TLS +C T LP      PETT    +V +F   S +      
Sbjct  16    KKRQEGGYSHGFSISQIQTLSVICQTLLPPP----PETTAEQNAVDSFKVASGSQPPFTD  71

Query  2215  QVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRER  2036
             +VA +I +  +   +    ++   L+ R GTL LCG   L+  +PF+L+F E+   KRE 
Sbjct  72    EVAEMIVKNGRSEAVKVFKIISTVLAYRFGTLFLCGSLCLAKDWPFVLKFSELPLDKREE  131

Query  2035  IVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             I+  W+  S  F+  R  F   K   L  FF+  D+   NP+ +AIGY     SI   + 
Sbjct  132   ILRMWSRQSGFFLPLRITFFLAKFYTLFSFFSQRDENMKNPALEAIGY-----SIDTTEM  186

Query  1861  kqkhhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECD  1685
             +++              PL +GII+  N  +  +   LT+ G  VA+         I CD
Sbjct  187   RKEDETPR---------PLERGIIETKNESDVTIRQSLTQKGVHVAREDNDNI-HRIRCD  236

Query  1684  AvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKD  1505
              V+VGSG GGGV +  LA AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D
Sbjct  237   VVIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVD  296

Query  1504  LDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGV  1325
                ++LAGSTVGGG+AVNWSASI+TP +VLREW E   +E FGS  YQ AMD V  ++GV
Sbjct  297   GKFMVLAGSTVGGGTAVNWSASIRTPDHVLREWSEESKIEFFGSQEYQLAMDEVTRRLGV  356

Query  1324  QRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVD  1145
                C  E  QN VLR GC  LG  VV++P+N+P DHYCG C +GC+ G K GT +TWLVD
Sbjct  357   TERCVKEGLQNQVLRGGCERLGLEVVSVPRNSPEDHYCGSCGYGCRGGGKNGTDKTWLVD  416

Query  1144  LVKSGNGAILPECEALQVIHERNKAK-------GVMFTFQRDGVKQTAVIKSKVTVIAGG  986
              V++G   I+   +A + +   N+ K       GV+ +     V++  +I+++VTV + G
Sbjct  417   AVENG-AVIMTGVKAERFVFTDNEGKKKKKRCVGVIASSVGGKVEKKFMIEARVTVSSAG  475

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLN  809
             +L TP L+ +SGL+N+NIGRNL LHPV+  WG+FP+   E + K YEG I++++  V  +
Sbjct  476   SLLTPPLMRSSGLENRNIGRNLKLHPVLMTWGYFPENGSEFSGKMYEGGIITSVHHV--H  533

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                +G  A+++TP   P  ++ L PW SG + K RM +Y RT+H+FAL RD GSGE    
Sbjct  534   DGESGCRAILETPLAGPASYAGLSPWVSGADLKERMMKYGRTSHLFALVRDYGSGEVLKE  593

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               VTY   K D ENL+ GL + LR+L AAGA E+G     G  +K +  +RE  E F+  
Sbjct  594   NEVTYRTSKKDRENLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGITREAMEEFLDS  653

Query  448   ESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
               +     +  ++     SAHQMGSCRMG   +   V+ KGE+WE EGLFV DGSVLP+A
Sbjct  654   VDAVGGVSTKGEYWTTYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSA  713

Query  280   LGVNPMVTIMSVSYCISQSVLEFL  209
             +GVNPM+TI S +YCIS  ++  L
Sbjct  714   VGVNPMITIQSTAYCISTRIVASL  737



>ref|XP_007144044.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
 gb|ESW16038.1| hypothetical protein PHAVU_007G124200g [Phaseolus vulgaris]
Length=741

 Score =   511 bits (1317),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 319/750 (43%), Positives = 458/750 (61%), Gaps = 47/750 (6%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAIN-EALPE--TTDASVTNFFQTSAASTGTP  2219
             R+   NT T  L  ++ME+L+++C  F P +  E L +  +   +V +F+++SA+    P
Sbjct  13    RRGSRNT-TDPLPSAEMESLTSICEAFFPPLQLEHLDKHNSKTKAVQHFWKSSASQFPIP  71

Query  2218  HQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRE  2039
              + A ++ +R     L  + L+LW LSTR+GTLLLCG   LS ++P +  F  IS   RE
Sbjct  72    QETADMLIKRALKEALIFVRLILWMLSTRLGTLLLCGTLCLSKKWPCIHNFSNISLDNRE  131

Query  2038  RIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqk  1862
             +++  W        IR  F  +K L L VFF+  D+KG NP+W+A+GY      I+++ +
Sbjct  132   KVLQKWFKHRFFTPIRLAFLYVKVLCLFVFFSQCDEKGQNPAWEAVGYKVDTDGITKQVQ  191

Query  1861  kqkhhdheddieELLFGPLYKGII------DLNLPEEHVFNRLTKLGCSVAKPKPPGPSF  1700
             K++              PL KGI+      D +LP+      L + G  V+         
Sbjct  192   KER--------------PLEKGIVEGRNESDWSLPKS-----LGEKGLEVS-VDAGNNVL  231

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              I+CD V+VGSGCGGGV +  LA++G KVLVLEKGNYY  ++ S LEGPS+++++  GG 
Sbjct  232   GIKCDVVIVGSGCGGGVAAATLASSGLKVLVLEKGNYYTSSDYSSLEGPSLNELYELGGT  291

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               + D +M +LAGSTVGGGSAVNW+ASI+TP  VL+EW + H L LF S  Y  AMD VC
Sbjct  292   FASWDGNMAILAGSTVGGGSAVNWAASIRTPDSVLKEWEKEHKLSLFSSHEYLSAMDMVC  351

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++GV  +C +E  QN VLRKGC+ LG  V  +P+N+   HYCG C +GC  G K+GT  
Sbjct  352   KRIGVTDKCVEEGLQNQVLRKGCKNLGLQVDYVPRNSSERHYCGSCNYGCTRGDKQGTEV  411

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERNKAK--------GVMFTFQRDGVKQTAVIKSKV  1004
             TWLVD V   +  IL   +A + I   NK          GVM     + +     +++KV
Sbjct  412   TWLVDAVDH-DAVILTGTKAERFILGNNKGGRVRKKKCLGVMANVLTNNITWRLKVEAKV  470

Query  1003  TVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAM  827
             TV A GAL TP L+I+SGLKNK+IG+NLH+HPV+ +WG+FPD+  + K K YEG I++++
Sbjct  471   TVSACGALLTPPLMISSGLKNKHIGKNLHMHPVLMSWGYFPDSNSDLKGKCYEGGIITSV  530

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
               VV     +   A+++TPAL P + S L+PW SG +FK RM +Y+RT H+  + RDKG 
Sbjct  531   HKVV--SEDSNVKAIVETPALGPAVLSTLLPWVSGSDFKERMLKYSRTVHLITIIRDKGC  588

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEF  467
             G   S   V YDLD++D+EN++ G+++ LRIL AAGA E+G +   G  ++    + +E 
Sbjct  589   GVVRSEGRVHYDLDESDKENIRDGVKQALRILIAAGAVEVGTHRSDGQRIECNGNNEKEL  648

Query  466   ERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDG  299
             ERFV+       S S  +  ++ +SAHQMGSC+MG+  K   V+  G +WE EGLFV D 
Sbjct  649   ERFVESIYATGGSMSQEEKWSIYSSAHQMGSCKMGMSEKEGAVDENGMSWEAEGLFVCDA  708

Query  298   SVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             S+LPTA+GVNPM+TI S +YC+++ +  FL
Sbjct  709   SLLPTAIGVNPMITIQSTAYCVAKRIAAFL  738



>ref|XP_009136067.1| PREDICTED: long-chain-alcohol oxidase FAO3-like [Brassica rapa]
Length=740

 Score =   511 bits (1316),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 307/742 (41%), Positives = 445/742 (60%), Gaps = 49/742 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPET---------TDASVTNFFQTSAASTGTPHQVAW  2204
             ++ ++ME+L++ C   LP ++   PE             ++ +FF TS + T    +   
Sbjct  15    ITTAEMESLASFCEAVLPPVSP--PEEYSGGDDHYRNKETLRSFFFTSGSRTPVVRESIE  72

Query  2203  VINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVH-  2027
             +I +R          L+L+ L+TR+GTLL+CG   L +++PF+ +F E+S +KRER++  
Sbjct  73    LITKRGTVETYLVTRLVLFLLATRLGTLLICGTECLVSRWPFVEKFSELSLEKRERVLQK  132

Query  2026  SWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhh  1847
              +    L  IR  F  +K   L  FF+ V   G+N +W+AIGY     +++  + K    
Sbjct  133   QFRNWLLTPIRAAFVYIKVAFLFCFFSRVSPNGENLAWEAIGY-----NVNTNENKPSET  187

Query  1846  dheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
               E         PL KG+++ +   E+ +   L + G    + +    +  I+CDAVVVG
Sbjct  188   HKER--------PLEKGMVETMQETEQTLVESLAQKGL---EAETDHDTIRIKCDAVVVG  236

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SG GGGV + VLA AG KV+V+EKG+YY  +     EGP M+K++  GG+L T D +M++
Sbjct  237   SGSGGGVAASVLAKAGMKVVVMEKGSYYTPSTYPSTEGPGMNKLYENGGILPTIDGNMMV  296

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             LAG+TVGGGSAVNWSA IKTP  VL+EW E   + L+ +  Y  AM+ V  ++GV   CE
Sbjct  297   LAGATVGGGSAVNWSACIKTPKSVLQEWSEDRKIPLYATKEYVSAMELVWKRIGVTETCE  356

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
              E FQN VLRKGC  LG  V N+ +N+   HYCG C +GC+ G KKG+  TWLVD V  G
Sbjct  357   LEGFQNQVLRKGCENLGINVENVARNSSERHYCGSCGYGCRQGDKKGSDRTWLVDAVSHG  416

Query  1129  NGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
                IL  C+A + I E+N         K  GVM       + +   I+++VTV A G+L 
Sbjct  417   -AVILTGCKAERFILEKNGNNVGRKKMKCLGVMAKSLNGNIAKKIKIEARVTVSAAGSLL  475

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGEN----KKSYEGAIMSAMSTVVLN  809
             TP L+I SGLKN++IG+NLHLHPV+  WG+FP+    +     +SYEG I+++MS V+  
Sbjct  476   TPPLMIKSGLKNRHIGKNLHLHPVLMTWGYFPNKESSSFNFKGRSYEGGIITSMSKVL--  533

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
                +   A+I+TPAL P  FS L PW SG + K RMSRY+RTA++  + RD+GSGE  + 
Sbjct  534   SEDSEVRAIIETPALGPASFSVLCPWISGLDMKKRMSRYSRTANLITIVRDRGSGEVRTE  593

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK-  452
               ++Y +DK D EN+  GL + LRIL AAGAEE+G +   G  L  K    +  E F+  
Sbjct  594   GRISYVVDKIDRENITAGLRQSLRILIAAGAEEVGTHRSDGQKLICKGVDEKLIEEFLDS  653

Query  451   ---EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
                EE  +++ ++ ++ +SAHQMGSCR+GVD     ++  GE+WE + LFV DGSVLP+A
Sbjct  654   VSAEEGPKAMTENWSVYSSAHQMGSCRIGVDEDEGAIDLDGESWEADKLFVCDGSVLPSA  713

Query  280   LGVNPMVTIMSVSYCISQSVLE  215
             +GVNPM+TIMS +YCIS  +++
Sbjct  714   VGVNPMITIMSTAYCISTRIVK  735



>ref|XP_006283182.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
 gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
Length=754

 Score =   511 bits (1316),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 308/739 (42%), Positives = 437/739 (59%), Gaps = 40/739 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              SPSQ+ +L+A+C T LP  ++        S  +F   S+       +VA +I +  +  
Sbjct  35    FSPSQIHSLAAICQTLLPPSDQQ-------SFDSFNVASSTQPPFTDEVAEMIVKNGRSE  87

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---L  2006
              +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   L
Sbjct  88    AVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILRKWSRKSGFLL  147

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
              F   FF + K   L  FF+  D+   NP+ +AIGY       S  +K +          
Sbjct  148   PFRITFFLS-KFYTLFYFFSQTDENQKNPALEAIGYSLDTADASSNKKTEADEKRR----  202

Query  1825  ELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL +GI++ ++  +  +   LT+ G  VAK         I CDAVVVGSG GGGV
Sbjct  203   -----PLQRGIVETMHESDITITQTLTEKGVYVAKDDGENV-HRIRCDAVVVGSGSGGGV  256

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              +  LA AG KVLVLEKGNY+A  + S LEGPSM +++  GG L + D   ++LAGS VG
Sbjct  257   AAANLAKAGLKVLVLEKGNYFAAQDYSGLEGPSMLELYEKGGFLTSVDGKFMILAGSAVG  316

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GG+A+NWSASI+TP +VL+EW E   ++ FGS  Y+ AMD V  ++GV  +C  + FQN 
Sbjct  317   GGTAINWSASIRTPDHVLQEWSEESKIKFFGSQEYKTAMDEVTTRIGVTDKCVKDGFQNQ  376

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V ++P+N+  DHYCG C +GC+ G K GT +TWLVD V++G   IL  
Sbjct  377   VLRKGCERLGLQVESVPRNSHEDHYCGLCGYGCRAGDKNGTDQTWLVDAVENG-AVILTG  435

Query  1108  CEALQVI---------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLI  959
              +A + I         +ER K   GV+ +     + +  +I+++VTV + G+L TP L++
Sbjct  436   IKAERFILVDNTDSSSNERQKRCVGVIASSVGGKIGKKFMIEARVTVSSAGSLLTPPLML  495

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGAV  782
             +SGLKN+NIGRNL LHPV+  WG+FP+   E + K YEG I++++    +N   +G  A+
Sbjct  496   SSGLKNQNIGRNLTLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLHH--MNDAESGCKAI  553

Query  781   IQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDK  602
             ++ P + P  ++ L PW SG + K RM +YARTAH+FAL RD GSGE      +TY   K
Sbjct  554   LENPLIGPASYAGLSPWVSGADLKERMMKYARTAHLFALVRDIGSGEVMKENEITYRTTK  613

Query  601   TDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QS  434
              D ENL+ GL + LR+L AAGA E+G     G  +K +  SRE  E F+ E  +     +
Sbjct  614   KDRENLRAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEGTSREAIEEFLDEVDAVGGVST  673

Query  433   LRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTI  254
               ++     SAHQM SCRMG   +   ++  GE++E EGLFV DGSVLP+A+GVNPM+TI
Sbjct  674   KGEYWTTYFSAHQMSSCRMGATAEEGALDENGESFEAEGLFVCDGSVLPSAVGVNPMITI  733

Query  253   MSVSYCISQSVLEFLKTHD  197
              S +YCIS  +++ L++ D
Sbjct  734   QSTAYCISTRIVDSLQSKD  752



>ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Fragaria vesca 
subsp. vesca]
Length=765

 Score =   511 bits (1315),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 319/748 (43%), Positives = 453/748 (61%), Gaps = 49/748 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI------------NEALPETTDASVTNFFQTSAASTGTPHQ  2213
             LS  +ME L+++C   LP +            NE L  T   +V +F+Q S A +G P +
Sbjct  27    LSSGEMEALASVCEALLPPLPFGDPASYYEGKNEELSGTK--AVQSFYQASGAQSGIPDE  84

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++ +R     +  + ++LW LSTR+G+LLLCG   L  ++PF+ +F  +  +KRER+
Sbjct  85    VADLLVKRAFTEAIILVRVVLWILSTRLGSLLLCGSLCLGDKWPFIHKFSCLPLEKRERV  144

Query  2032  VHSWATS-SLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             +  W     L  IR  F  +K L +  FF+ VD+  +NP+WKAIGY   +P+ + ++  +
Sbjct  145   LQWWFRHWFLTPIRLAFLYIKILCVFTFFSRVDENAENPAWKAIGY-EVEPAANPEKVPE  203

Query  1855  khhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
             +               L+KGII+ +   +  + + L   G  V         + I+CD V
Sbjct  204   ERS-------------LHKGIIETMYQTDTSLLDSLADKGLKVTH-DSKNNLYKIKCDVV  249

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV + VLA++G KV+VLEKGNY+  ++ S LEGPS D+++  GG+L T D  
Sbjct  250   IVGSGCGGGVAAAVLASSGQKVIVLEKGNYFTASDYSSLEGPSQDQLYESGGILATFDGK  309

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
             ++L AGSTVGGGSAVNWSA I+ P  +L+EW +   +  FG   Y  AM+ V  ++GV  
Sbjct  310   VMLQAGSTVGGGSAVNWSACIRPPDSLLQEWAKDQKIAFFGGSEYVSAMNAVWERIGVTE  369

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C +E FQN VLRKGC  LG  V   P+N+   HYCG C +GCK G KKGT  TWLVD V
Sbjct  370   SCVEEGFQNQVLRKGCETLGLDVHFTPRNSSEKHYCGSCGYGCKKGEKKGTDTTWLVDAV  429

Query  1138  KSGNGAILPECEALQVI---------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
               G   IL  C+A + +           + K  GV+     + + +   I++KVT+ A G
Sbjct  430   DHG-AVILSGCKAERFVLAKSYKSGSMRKKKCLGVVAKSLSNNITKRLQIEAKVTISACG  488

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE--NKKSYEGAIMSAMSTVVL  812
             AL TP L+I+SGLKN++IGRNLHLHPV+ AWG+FPD+       KSY+G I++++  VV 
Sbjct  489   ALLTPPLMISSGLKNRHIGRNLHLHPVLMAWGYFPDSINSEFKGKSYKGGIITSVHEVV-  547

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
                 +   A+I+TPAL PG F+AL PW SG + K RM R++RTAH+  + RDKGSG   +
Sbjct  548   -SEDSKPRAIIETPALGPGSFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSGVIRT  606

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVK  452
                 +Y+LD +D+EN++ G+ + LRIL AAGA E+G +   GL LK +   +E  E F+ 
Sbjct  607   EGRASYELDVSDKENMKAGMRQALRILIAAGAVEVGTHRSDGLRLKCEGIDKEGLEEFLD  666

Query  451   ----EESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT  284
                 EE  QSL +     +SAHQMGSCRMG++ K   V+  GE+WE EGLFV DGSVLP+
Sbjct  667   KVSAEEGPQSLVEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPS  726

Query  283   ALGVNPMVTIMSVSYCISQSVLEFLKTH  200
             A+GVNPM+TI S +Y +S+ + E L+  
Sbjct  727   AVGVNPMITIESTAYYLSKRLAESLRNQ  754



>gb|KEH23950.1| long-chain-alcohol oxidase FAO1 [Medicago truncatula]
Length=737

 Score =   509 bits (1312),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 309/731 (42%), Positives = 441/731 (60%), Gaps = 37/731 (5%)
 Frame = -3

Query  2347  SQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVA-WVINQRMKHPKl  2171
             SQM  L+++C+T  P+I      + D ++++F+ TS +    P + A  V+  +   P+ 
Sbjct  25    SQMHVLASICDTLFPSIPLNKEVSQDENLSSFYSTSGSQFPFPDEAAELVLLFKKSAPEA  84

Query  2170  n-slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS-LQFI  1997
                +  +LW LS ++GTL LCG   L  ++PF+L+F EIS +KRE I+  W+  +    +
Sbjct  85    IPLVRWILWILSFKLGTLFLCGTLCLHWKWPFVLKFSEISLEKREEILKKWSKENKWTPL  144

Query  1996  RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELL  1817
             R  F  +K +     F+  D  G NP WKAIGY                     +  +L 
Sbjct  145   RAVFVLIKIVFFYTLFSRTDVNGHNPMWKAIGY----------------KVDTREKLKLK  188

Query  1816  FGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisg  1640
               PL +G+++        +   L++ G  V + +     + I+CD V+VGSG GGGV + 
Sbjct  189   KRPLQEGLVETTYETNSTLIQSLSEKGLEVTEDEEQN-VYKIKCDVVIVGSGSGGGVAAA  247

Query  1639  VLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGS  1460
             +LA +G+KV++LEKG Y+   + S LE  +M++++  GG++ T D  M++LAGSTVGGGS
Sbjct  248   ILANSGHKVIILEKGEYFVSQDYSSLESSAMNELYESGGIMPTLDGKMMILAGSTVGGGS  307

Query  1459  AVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLR  1280
             A+NW+A ++TP  V +EW E + L LF S  YQ AMD+VC ++GV  +C  +SFQN VLR
Sbjct  308   AINWAACVRTPDSVKKEWSEKYKLPLFTSSDYQSAMDSVCRRIGVTDKCNKQSFQNQVLR  367

Query  1279  KGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEA  1100
             KGC  +G  V ++  NA  DHYCG C +GC+ G KKGT  TWLVD V++G   IL  C A
Sbjct  368   KGCERIGLKVESVAVNASEDHYCGSCCYGCRTGDKKGTDSTWLVDAVENG-AVILTGCRA  426

Query  1099  LQVIHE-------RNKAKGVM-FTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLK  944
              + I E       R    GV+  T  R  + +   I+SKVT+ + G+L TP L+I+SGL+
Sbjct  427   EKFIIENGKNETKRKNCSGVIAATSWRSKITKKLQIESKVTISSCGSLLTPPLMISSGLQ  486

Query  943   NKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPA  767
             N NIGRNLHLHPV FAWG+FP+     +  ++EG I++++   VL  N T    +I+ PA
Sbjct  487   NPNIGRNLHLHPVQFAWGYFPENMTNLSGNNHEGGIITSIHK-VLAENSTP-KIIIEAPA  544

Query  766   LHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEEN  587
             L PG FS L+PW SG + K RM++YARTA++FAL RD GSGE  S   ++Y LD+ D EN
Sbjct  545   LGPGSFSVLVPWISGLDMKDRMAKYARTANLFALVRDIGSGEVRSEGKISYRLDQMDREN  604

Query  586   LQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES----SQSLRKHP  419
             L+ GL K LRIL AAGA E+G     G  +K +    EE E F+   S     +S  +  
Sbjct  605   LRIGLRKSLRILVAAGAVEVGTYRSDGQKIKCEGIKEEELEEFLDTVSVVGGPRSRSELW  664

Query  418   NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSY  239
              + +SAHQMGSCRMG + +   V+  GE+WE +GL+V DGSVLP+A+GVNPMVTI S +Y
Sbjct  665   TMFSSAHQMGSCRMGKNEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMVTIQSTAY  724

Query  238   CISQSVLEFLK  206
             CI+  + E LK
Sbjct  725   CIASKIAESLK  735



>ref|XP_010475034.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Camelina sativa]
Length=752

 Score =   510 bits (1314),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 306/745 (41%), Positives = 435/745 (58%), Gaps = 48/745 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
              S S ++ LSA+C   LP +          L    + ++ +FF++S      P +VA V+
Sbjct  23    FSASDLQALSAICEAILPPVPLQSLDLEMKLKVLRNDALLSFFKSSPGPHVRPDEVAEVL  82

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLS-TQFPFLLRFPEISQKKRERIVHSW  2021
               +     +  + ++L  L+ R+GTLLLCG  +L    +PFLL+F EIS +KRE+++  W
Sbjct  83    ATKAIPVTVIVVRIVLRILTFRLGTLLLCGLVNLDKASWPFLLKFSEISLEKREKVLQRW  142

Query  2020  ATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY-CGPDPSISekqkkqkhh  1847
              T       R  F  +KA+ L  +FT  D+  +NP+W AIGY  G D +   + K++   
Sbjct  143   NTQWYNPLARIGFMMIKAIFLFYYFTWTDENTENPAWDAIGYSVGIDENEGMEHKER---  199

Query  1846  dheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvg  1670
                         PL KGII+ + + E  +  R+   G  V + +    ++ IECDAVVVG
Sbjct  200   ------------PLEKGIIETDKVNEMTIKQRMINKGLKVTEDRE-SDTYKIECDAVVVG  246

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV +  LA +G +V+VLEKGNY+   + S LEGPS  ++F    LLMT D     
Sbjct  247   SGCGGGVAAANLAKSGLRVVVLEKGNYFVSRDYSALEGPSTFELFESNSLLMTHDGRFRF  306

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
             +AGSTVGGGS VNW+AS+KTP  ++ EW    G+ +F S+ Y+ AMD VC ++GV     
Sbjct  307   MAGSTVGGGSVVNWAASLKTPDAIIEEWSVQRGISIFSSEKYKAAMDRVCKRIGVTERVI  366

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
              E FQN +LRKGC +LG  V  +P+N+   HYCG C+FGC  G K+GT  TWLVD V + 
Sbjct  367   REGFQNQILRKGCEKLGLDVTTVPRNSTDGHYCGSCSFGCPTGEKRGTDLTWLVDAV-NN  425

Query  1129  NGAILPECEALQVIHERNKAK------------GVMFTFQRDGVKQTAVIKSKVTVIAGG  986
             N  IL +C+A +VI   N A             GV  +   +  ++   I +KVT++A G
Sbjct  426   NAVILTQCKAEKVILAENDAHKRKESGRKKRCLGVAASLS-NRTRKKLQINAKVTIVACG  484

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLN  809
             +L TP LL +SGLKN NIGR LH+HP++  WG+FP+   + K  ++EG I++ +   V  
Sbjct  485   SLKTPELLASSGLKNPNIGRGLHIHPILMTWGYFPEKKSDFKGAAHEGEILTTLH-YVHP  543

Query  808   VNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSP  629
             ++ T     ++TPA+ PG F+AL+PW SG + K R+++Y+RT+HIF   RD+G GE    
Sbjct  544   MDSTTANITLETPAIGPGTFAALVPWVSGSDIKERLAKYSRTSHIFVTVRDEGVGEVKGG  603

Query  628   TSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKE  449
               V Y L K DEENL  GL++ L+IL AAGA E+G     G  +K      ++ E F++ 
Sbjct  604   I-VKYRLTKADEENLTIGLKQALQILVAAGAAEVGTYRSDGQRIKCDGIKHKDLEAFLET  662

Query  448   ESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTA  281
               +     S+ KH     +AHQMG CRMG   K   ++ KGE+WE E L+V D SVLPTA
Sbjct  663   VDAPAGVVSMSKHWTHSITAHQMGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTA  722

Query  280   LGVNPMVTIMSVSYCISQSVLEFLK  206
             LGVNPM+TI S +YCIS  + E +K
Sbjct  723   LGVNPMITIQSTAYCISNRIAELMK  747



>gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
Length=721

 Score =   509 bits (1311),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 293/701 (42%), Positives = 415/701 (59%), Gaps = 40/701 (6%)
 Frame = -3

Query  2266  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ  2087
             ++  FF    +    P  VA ++ +R     + ++ + L  LSTRIGTLLLCG  SL+ +
Sbjct  32    AIRAFFSAPGSRPPIPEAVAELMKRRALPEAVVAVRVALRLLSTRIGTLLLCGFRSLTWK  91

Query  2086  FPFLLRFPEISQKKRERIVHSWATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWK  1910
             +PFLL+F +I   KRE+I+ SW+  S    +R  F  +K +   VFF+  D+   NP+W+
Sbjct  92    WPFLLKFSQIQLHKREKILQSWSKQSFWTSLRVVFLLIKVVCCFVFFSQTDENSKNPAWE  151

Query  1909  AIGY------CGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLT  1748
             AIGY      C   P                        PL KGI++    +     R  
Sbjct  152   AIGYNLDSRECSTKPQEER--------------------PLQKGIVECTNTDNDNLLRSL  191

Query  1747  KLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLS  1568
             K  C           F ++CD V+VGSGCGGGV +GVLA++G KVLV+EKGNY+A  + S
Sbjct  192   KEKCVEVTEDHEKNMFKVKCDVVIVGSGCGGGVAAGVLASSGLKVLVIEKGNYFAPGDYS  251

Query  1567  LLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGL  1388
              LEGPS+D++++ GG+L T D  M+L +GSTVGGGSA+NWSASI+TP  V++EW   H L
Sbjct  252   SLEGPSLDELYVSGGMLTTLDGKMLLFSGSTVGGGSAINWSASIRTPDPVIKEWSVNHRL  311

Query  1387  ELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCG  1208
              +F S  Y+ AMD VC ++GV  +C +E FQN VLR+GC  LG  V  +P+N+  +HYCG
Sbjct  312   PIFNSSDYRLAMDEVCKRIGVTEKCTEEGFQNQVLRQGCENLGLEVEKVPRNSSENHYCG  371

Query  1207  WCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHE-------RNKAKGVMFTF  1049
              CT+GC+ G KKGT  TWLVD V+ G   +L  C+A + + E       + K  G++   
Sbjct  372   SCTYGCRLGDKKGTDTTWLVDAVEHG-AVVLTGCKAEKFVLEDVKTGTRKKKCTGIIAAV  430

Query  1048  QRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPG  869
                 V +   I+++V++ A G++ TP LL +SGL+N NIG NLHLHPV+ AWG+FP++  
Sbjct  431   SDKNVTKKLQIEARVSISACGSVLTPPLLKSSGLRNPNIGANLHLHPVLLAWGYFPESAN  490

Query  868   ENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRY  692
               K KS+EG I++++  V  +       A+I+ P L P  FS+L+PW SG++ K RM +Y
Sbjct  491   SVKGKSFEGGIITSLHKVTSDPEKRNIHAIIEAPGLGPAAFSSLIPWVSGRDMKERMVKY  550

Query  691   ARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHG  512
              RTA++FAL RD+ +GE+      +      D++NL+ GL + LRIL AAGA E+G    
Sbjct  551   DRTANLFALVRDQSTGESQRRGKDSISFKDFDKQNLKIGLRQCLRILIAAGAAEVGTYRS  610

Query  511   TGLTLKVKDASREEFERF----VKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNP  344
              G  ++ K     E E F    +     +S  +   + ASA QMGS RMG   +   V+ 
Sbjct  611   DGQRMRCKGVKAGELEEFLDTVIAPGGPRSRTEEWPIYASALQMGSFRMGDAAETGPVDS  670

Query  343   KGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV  221
              GE+WE EGL+V DGS LPTA GVNPM+TI S +YCIS ++
Sbjct  671   NGESWEPEGLYVCDGSFLPTAFGVNPMITIQSTAYCISSAI  711



>ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
Length=724

 Score =   509 bits (1310),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 303/739 (41%), Positives = 428/739 (58%), Gaps = 46/739 (6%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             M+ L A+C+T +P++     +  +++   FF+ SA+ +G   +VA +I       +   +
Sbjct  1     MKVLDAICDTLVPSLPVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYFLI  60

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
              +    LSTR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F 
Sbjct  61    YIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLNWSRSIFHKLQMLFK  120

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
              +K   L  F++  D KG NP+WKAIGY  P+P +  ++               L  PL 
Sbjct  121   VVKCYTLFKFYSRADKKGRNPAWKAIGYEVPEPVLEHEEP--------------LPSPLE  166

Query  1801  KGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPP---GPSFVIECDAvvvgsgcgg  1655
             + ++D   P+    +RL +LGC++         +  P    G  F I+CD VVVGSG GG
Sbjct  167   RRLVDAKAPDFQ--SRLAELGCAMLDKVDHLEERNDPSTASGKDFGIKCDVVVVGSGSGG  224

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
              VI+  LA  G+KV+VLEKG Y+ R  LSLLEGPSM  M+   G L T+D  ++LLAG+T
Sbjct  225   SVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSGALTTEDGSVILLAGTT  284

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             +GGGSAVNW+AS+KTP +VL EW  +     FG   YQ AM+ VC ++GVQ  C +ESFQ
Sbjct  285   LGGGSAVNWAASLKTPKHVLDEWTSLGLENRFGGPEYQHAMEAVCQRLGVQDGCTEESFQ  344

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG---RKKGTAETWLVDLVKSGNG  1124
             N VLR+GC E GY V +IP+NA  DH CG+C FGC      RK+   +TWL D   +G  
Sbjct  345   NRVLRRGCTEKGYSVGDIPRNAARDHGCGFCGFGCPAAAAVRKQSACDTWLCDAATAG-A  403

Query  1123  AILPECEALQVIHERNKAKGVMFTFQRDGVKQTA-----VIKSKVTVIAGGALTTPSLLI  959
              ++  C   +++      +G   +++  G+   A      ++S+VTV A GAL TP LL 
Sbjct  404   VVVTGCRVDRIVTAPQGGQGER-SYRARGISSRAGEARFYVESRVTVAACGALFTPPLLR  462

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
              SG +N +IGR+L +HPVV AWG+FP        SY G IM+A S+     + TGYG+++
Sbjct  463   RSGGRNPHIGRHLSVHPVVAAWGYFPREDILPGNSYTGGIMTAFSSEAARWDTTGYGSIL  522

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS----VTYD  611
             +TP +HPG ++ L PW SG + K +M R+ RTA I  L RD+G G           + Y 
Sbjct  523   ETPCVHPGNYAVLAPWRSGVDAKRQMLRFPRTATIIVLNRDRGRGTVDETPGGKLILDYP  582

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA----SRE-EFERFVKEE  446
             L  +D E+L  G E  +R L AAGAE +G +   G    V  +     RE E E F+K  
Sbjct  583   LCFSDRESLVEGTELAVRALVAAGAEAVGLHSVAGEIFSVDQSWTPLQREKELEIFLKRV  642

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +  ++      SAHQMGSCRMG D + SVV+P  E+WEVEGLFVGDGSVLPTA GVNP
Sbjct  643   LGRMFQRLSTPIISAHQMGSCRMGTDQRCSVVDPNCESWEVEGLFVGDGSVLPTASGVNP  702

Query  265   MVTIMSVSYCISQSVLEFL  209
             M+TI S+++  +  +   L
Sbjct  703   MITIQSIAHSTATRIARSL  721



>gb|EPS66779.1| hypothetical protein M569_07992, partial [Genlisea aurea]
Length=724

 Score =   508 bits (1308),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 297/746 (40%), Positives = 440/746 (59%), Gaps = 48/746 (6%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGT  2222
             +K     ++   S SQ+++L+A+C T +P +    N+A P ++      FF + + S   
Sbjct  8     KKQPRRRSSHGFSSSQIQSLAAICQTLIPPLADHGNKAAPHSS------FFDSPSGS---  58

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFP-FLLRFPEISQKK  2045
               +VA ++ +R     +  + L+LW LSTR+GTLLLCG   L  + P FL  F E+   K
Sbjct  59    -EEVAELLVKRGVPQAVFVVGLVLWVLSTRLGTLLLCGFTCLDWRSPPFLPTFSELQLSK  117

Query  2044  RERIVHSWATSSLQFI--RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISe  1871
             RE ++  W+     F+  R  F  +K +    FF+  D+   NP+W++IGY    P +  
Sbjct  118   REAVLQRWSRQGGTFLPLRITFLLVKIMSFFTFFSRTDENSQNPAWESIGYHIETPVV--  175

Query  1870  kqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFV-I  1694
                             L   PL  GII     E    + L + G  V   +     ++ +
Sbjct  176   ------------VERPLQRRPLQNGII-----ETITESSLRQKGLRVITEEDDDDDYLNV  218

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
             +CD VVVGSGCGG V + +LA +G+KV+VLEKG+Y+A  + S LEGPS+ +++  G +L 
Sbjct  219   DCDVVVVGSGCGGSVAAAILAKSGHKVVVLEKGHYFAAQDYSGLEGPSLSELYESGAVLS  278

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T   +++++AGSTVGGGSA+NWSA I+TP ++L EW + H L L+ +  YQ AMD VC +
Sbjct  279   TLGGELMIMAGSTVGGGSAINWSACIRTPDHILDEWSKTHNLPLYRTREYQSAMDAVCER  338

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             +GV   C++E FQN VLR+GC  LG  V ++P+N+PSDHYCG C +GC+ G K+G   TW
Sbjct  339   IGVTDACDEEGFQNQVLRRGCESLGLKVDSVPRNSPSDHYCGSCGYGCRRGAKRGADSTW  398

Query  1153  LVDLVKSGNGAILPECEALQVI-----HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAG  989
             LVD V + +  I+  C+A + I     +E+ + + +      + +++   I ++VT+ A 
Sbjct  399   LVDAVDN-SAVIMTGCKAERFILAKDENEKTRKRCIGVIATAENIEKKLKINARVTISAC  457

Query  988   GALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVL  812
             G+L+TP LLI+SGLKNKNIGRNLHLHPV F WG+FP+T    K  SYEG I++++  V  
Sbjct  458   GSLSTPPLLISSGLKNKNIGRNLHLHPVSFIWGYFPETDTRLKGTSYEGGIITSIHKVQS  517

Query  811   NVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFS  632
                     A+++  +L PG FS+L PW S      RM +Y+RTA +F L RD+GSGE   
Sbjct  518   EERKPAVQAIVEAASLGPGAFSSLFPWTSRNNMDDRMRKYSRTAVLFTLVRDEGSGEVKK  577

Query  631   PTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVK----DASREEFE  464
                + Y L + D+ENL+ G+ + LRIL AAGA E G     G  +  K    DA  E  +
Sbjct  578   LKQIQYKLSEVDKENLKTGMRRALRILIAAGATEAGTFRSDGQRIWCKGTNDDAVEEFLD  637

Query  463   RFVKEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPT  284
               V  +  ++     N+  SAHQMGSCRMG +     V+ +GE+WE +GLFV DGS+LPT
Sbjct  638   TVVAADGPRTKSMFWNIYGSAHQMGSCRMGRNEDEGAVDERGESWEAKGLFVCDGSLLPT  697

Query  283   ALGVNPMVTIMSVSYCISQSVLEFLK  206
             A+GVNPMV+I++ +YC++  + E +K
Sbjct  698   AVGVNPMVSILATAYCVANRIAESMK  723



>ref|XP_002272123.2| PREDICTED: long-chain-alcohol oxidase FAO2-like [Vitis vinifera]
Length=749

 Score =   509 bits (1310),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 314/736 (43%), Positives = 448/736 (61%), Gaps = 35/736 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALP-ETTDASVTNFFQTSAASTGTPHQVAWVINQRMK  2183
              S SQ++ L+++C T +P ++ E++  E    ++ +F++ S +    P + A ++ +R  
Sbjct  29    FSSSQIQALASICETLIPPLHLESISKENPPEALYSFYKASGSQFPVPDEAAELLKKRGL  88

Query  2182  HPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
                +  + ++L  LSTR+GTLLLCG   L  ++PF+L+F EIS +KRE+++ +W+     
Sbjct  89    PEGVMLVSIVLKILSTRLGTLLLCGFLCLGWKWPFILKFSEISLEKREQVLKNWSRQRFL  148

Query  2002  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
             F +R FF  MK     +FF+  DD  +NP+W AIGY        +K  K++         
Sbjct  149   FPLRLFFAIMKIFCFFIFFSRTDDNLENPAWDAIGYHVETKEYVKKPPKER---------  199

Query  1825  ELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  P+ KGI++     +      L++ G  V + +       I+CD V++GSGCGGGV
Sbjct  200   -----PIRKGIVETMYENDSTLVQSLSQRGIKVIEDQKN--ICKIKCDVVIIGSGCGGGV  252

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + VLA++GYKVL+LEKGNY+   + S LEGPSM + +  GG++ T D  +++LAGSTVG
Sbjct  253   TAAVLASSGYKVLILEKGNYFEPEDYSSLEGPSMSEQYESGGVMSTIDAKVMILAGSTVG  312

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGSAVNWSA+IKTP  +LREW   H L LFGS  Y  AMDTV  ++GV  +C +E FQN 
Sbjct  313   GGSAVNWSAAIKTPNSILREWSTDHKLPLFGSSEYLSAMDTVWKRIGVTEKCTEEGFQNQ  372

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V +IP+N+  +HYCG C +GC  G K+GT  TWLVD V  G   IL  
Sbjct  373   VLRKGCENLGLDVESIPRNSSENHYCGSCAYGCTRGDKQGTQSTWLVDAVGCG-AVILTG  431

Query  1108  CEALQVI-------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSG  950
             C+A ++I        +R K  GV+       V +   I+++VTV A G+L TP LL++SG
Sbjct  432   CKAEKLIFKEKKNGRKRRKCSGVIVASSSKNVTKKLQIEARVTVSACGSLLTPPLLLSSG  491

Query  949   LKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQT  773
             L+N +IG+NLHLHPV+  WG+FP++  G   K +EG +++++  VV     +   A+++ 
Sbjct  492   LENPHIGKNLHLHPVLMVWGYFPESQSGIKGKCFEGGLLTSLHKVV--SEESRVQAIVEP  549

Query  772   PALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDE  593
              AL P  F+A+ PW SG + K RM +Y+RTA +FALARDKG+GE      + Y L   D+
Sbjct  550   TALGPASFAAIHPWVSGLDMKERMVKYSRTATLFALARDKGAGEVKVERRIKYRLHPADK  609

Query  592   ENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF----VKEESSQSLRK  425
             ENL+ GL + LRIL AAGA E+G     G ++K K    E  E F    V      S   
Sbjct  610   ENLRVGLRQALRILIAAGAVEVGTYRSDGQSIKCKGVKEEAVEEFLDGVVAGGGPCSRGD  669

Query  424   HPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSV  245
             H  L  SAHQMGSCRMG   +   V+  GETWE +GLFV DGSVLP+A+G+NPM+TI + 
Sbjct  670   HWTLYCSAHQMGSCRMGATEEEGAVDENGETWEAKGLFVCDGSVLPSAVGINPMITIQTT  729

Query  244   SYCISQSVLEFLKTHD  197
             +YCIS+ + E LK  +
Sbjct  730   AYCISKRIAESLKKQE  745



>emb|CDY51703.1| BnaA03g58930D [Brassica napus]
Length=737

 Score =   508 bits (1309),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 307/731 (42%), Positives = 426/731 (58%), Gaps = 33/731 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S SQ++TLS +C T LP            +V +F   S +      +VA +I +  +  
Sbjct  20    FSISQIQTLSFICQTLLPPPPPPESTAEQEAVDSFNVASGSQPPFTDEVAEMIVKNGRSE  79

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
              +  L ++L  LS R GTL LCG   L+  +PF+L+F ++   KRE I+  W+  S  F+
Sbjct  80    AVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVLKFSDLPLDKREEILRMWSRQSGLFL  139

Query  1996  --RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieE  1823
               R  F   K   L  FF+  D    NP+ +AIGY      +S+  +  +          
Sbjct  140   PLRITFFLAKFYTLFSFFSQRDQNMKNPALEAIGYSIDTTEMSKDDEAPR----------  189

Query  1822  LLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvi  1646
                 PL KGII+  N  +  +   LT+ G  VA+         I CD V+VGSG GGGV 
Sbjct  190   ----PLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNI-HRIRCDVVIVGSGSGGGVA  244

Query  1645  sgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  1466
             +  LA AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D   ++LAGSTVGG
Sbjct  245   AANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGG  304

Query  1465  GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMV  1286
             G+AVNWSASI+TP +VL+EW E   +E FGS  YQ AMD V  ++GV   C  E  QN V
Sbjct  305   GTAVNWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQV  364

Query  1285  LRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPEC  1106
             LR+GC  LG  VV++P+N+P DHYCG C +GC++G K GT +TWLVD V++G   I+   
Sbjct  365   LREGCERLGLEVVSVPRNSPEDHYCGSCGYGCREGGKNGTDKTWLVDAVENG-AVIMTGV  423

Query  1105  EALQVIHERNKAK-------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             +A + +   N+ K       GV+ +     +++  +I+++VTV + G+L TP L+  SGL
Sbjct  424   KAERFVFTDNEGKKKKKRCVGVIASSVGGKIEKKFMIEARVTVSSAGSLLTPPLMRTSGL  483

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             +N+NIGRNL LHPV+  WG+FP+   E + K YEG I+S++  V  +   +G  A+++TP
Sbjct  484   ENRNIGRNLKLHPVLMTWGYFPEKGSEFSGKMYEGGIISSVHHV--HDGESGCRAILETP  541

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
                P  ++ L PW SG + K RM +Y RT+H+FAL RD GSGE      VTY   K D E
Sbjct  542   LAGPASYAGLSPWVSGADLKDRMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRE  601

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKH  422
             NL+ GL + LR+L AAGA E+G     G  +K +  +RE  E F+    +     +  ++
Sbjct  602   NLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGITREAMEEFLDGVDAVGGVSTKGEY  661

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
                  SAHQM SCRMG   +   V+ KGE+WE EGLFV DGSVLPTA+GVNPM+TI S +
Sbjct  662   WTTYFSAHQMCSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTA  721

Query  241   YCISQSVLEFL  209
             YCIS  ++  L
Sbjct  722   YCISTRIVASL  732



>emb|CDX89850.1| BnaA10g02320D [Brassica napus]
Length=752

 Score =   509 bits (1310),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 307/754 (41%), Positives = 436/754 (58%), Gaps = 47/754 (6%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSA  2237
             L    +  T +   S S ++ LSA+C   +P +       +  L    + ++ +FF++S 
Sbjct  15    LRWSTKQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSG  74

Query  2236  ASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLL-RFP  2063
             +    P +VA V+  +     +  + ++L  L+ R+GTLLLCG   L  + + FLL +F 
Sbjct  75    SHV-RPDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSFLLLKFS  133

Query  2062  EISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---C  1895
             +IS +KRE+++  W         R  F  +KA+ L  +FT  ++  +NP+W AIGY    
Sbjct  134   DISLEKREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIGYKVDI  193

Query  1894  GPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP  1715
             G +  I  KQ+                 PL KGII+    +E    +L        K   
Sbjct  194   GENEDIKRKQR-----------------PLEKGIIETAKEDEATIKQLMINKGLKLKEDK  236

Query  1714  PGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  1535
                +F IECDAVV+GSGCGGGV +  LA +G KV+V+EKGNY+   + S LEGPSM +MF
Sbjct  237   ESNTFKIECDAVVIGSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMF  296

Query  1534  LGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKA  1355
                GLLMT D     +AGST+GGGS VNW+AS+KTP  ++ EW    G+  F  + Y  A
Sbjct  297   EANGLLMTHDGRFRFMAGSTLGGGSVVNWAASLKTPDAIIEEWSVDRGIATFAREGYTAA  356

Query  1354  MDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRK  1175
             M++VC ++ V      E FQN +LRKGC +LG  V  +P+N+  +HYCG C+FGCK G K
Sbjct  357   MESVCKRICVTERVIREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDK  416

Query  1174  KGTAETWLVDLVKSGNGAILPECEALQVI-------HERNKAKGVMFTFQRDGVKQTAVI  1016
             +GT  TWLVD V + N  IL +C A ++I         + +  GV  +     + +   I
Sbjct  417   RGTDITWLVDAVDN-NAVILTQCRAEKLIFADTESGRRKKRCLGVTVSISNTTINKIE-I  474

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAI  839
              +KVTV+A G+L TP LL +SGLKN NIGR LH+HP++ AWG+FP+     N  ++EG I
Sbjct  475   NAKVTVVACGSLMTPGLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSNFNGAAHEGEI  534

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             M+++   V  ++ T     ++TPAL PG F+AL+PW SG++ K+R+++YART+HIF + R
Sbjct  535   MTSLH-YVFEIDSTTPNITLETPALGPGTFAALIPWVSGKDTKVRLAKYARTSHIFVMVR  593

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+G GE      V Y L K DEENL  GL + LRIL AAGAEE+G     G  LK     
Sbjct  594   DEGVGEVKGGI-VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVK  652

Query  478   REEFERFVKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
              E+ E+F++   +     S+ +      +AHQMG CRMG   +   V+  GE+WE EGL+
Sbjct  653   EEDLEKFLETVDAPAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLY  712

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             V D SVLPTALGVNPMVTI S +YCIS+ + E +
Sbjct  713   VCDASVLPTALGVNPMVTIQSTAYCISKRLAELM  746



>ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
Length=724

 Score =   508 bits (1307),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 302/739 (41%), Positives = 430/739 (58%), Gaps = 46/739 (6%)
 Frame = -3

Query  2341  METLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnsl  2162
             M+ L+A+C+T +P++     +  +++   FF+ SA+ +G   +VA +I       +   +
Sbjct  1     MKVLNAICDTLVPSLPVEASKQDNSAKAKFFELSASESGIVPEVAGMICAWTTAQQYFLI  60

Query  2161  llllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFT  1982
              +    LSTR+GTLLL G   ++T+FPF+  FP +   KRE+I+ +W+ S    ++  F 
Sbjct  61    YIAFLMLSTRLGTLLLAGFSCVTTEFPFVQPFPLLELGKREKILLTWSRSIFHKLQMLFK  120

Query  1981  AMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLY  1802
              +K   L  F++  D KG NP+WKAIGY  P+P +  ++               L  PL 
Sbjct  121   VVKCYTLFKFYSRADKKGRNPAWKAIGYEVPEPVLEHQEP--------------LPSPLE  166

Query  1801  KGIIDLNLPEEHVFNRLTKLGCSV--------AKPKPP---GPSFVIECDAvvvgsgcgg  1655
             + ++D   P+    +RL +LGC++         +  P    G  F I+CD VVVGSG GG
Sbjct  167   RRLVDAKAPDFQ--SRLAELGCAMLDNVDHLEERNDPSTASGKDFGIKCDVVVVGSGSGG  224

Query  1654  gvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGST  1475
              VI+  LA  G+KV+VLEKG Y+ R  LSLLEGPSM  M+   G L T+D  ++LLAG+T
Sbjct  225   SVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSGALTTEDGSVILLAGTT  284

Query  1474  VGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQ  1295
             +GGGSAVNW+AS+KTP +VL EW  +   + FG   YQ AM+ VC ++GVQ  C +ESFQ
Sbjct  285   LGGGSAVNWAASLKTPKHVLDEWTSLGLEDRFGGPEYQHAMEAVCQRLGVQDVCTEESFQ  344

Query  1294  NMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDG---RKKGTAETWLVDLVKSGNG  1124
             N VLR+GC + GY V +IP+NA  DH CG+C FGC      RK+   +TWL D   +G  
Sbjct  345   NRVLRRGCTKKGYSVGDIPRNAARDHGCGFCGFGCPAAAAVRKQSACDTWLCDAATAG-A  403

Query  1123  AILPECEALQVIHERNKAKGVMFTFQRDGVKQTA-----VIKSKVTVIAGGALTTPSLLI  959
              ++  C   +++      +G   +++  G+   A      ++S+VTV A GAL TP LL 
Sbjct  404   VVVTGCRVDRILTAPQGGQGER-SYRARGISSRAGEARFYVESRVTVAACGALFTPPLLR  462

Query  958   NSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
              SG +N +IGR+L +HPVV AWG+FP        SY G IM+A S+     + TGYG+++
Sbjct  463   RSGGRNPHIGRHLSVHPVVAAWGYFPREDILPGNSYTGGIMTAFSSEAARWDTTGYGSIL  522

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS----VTYD  611
             +TP +HPG ++ L PW SG + K +M R+ RTA I  L RD+G G           + Y 
Sbjct  523   ETPCVHPGNYAVLAPWRSGVDAKRQMLRFPRTATIIVLNRDRGRGTVDETPGGKLILEYP  582

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDA----SRE-EFERFVKEE  446
             L  +D E+L  G E  +R L AAGAE +G +   G    V  +     RE E E F+K  
Sbjct  583   LCFSDRESLVEGTELAVRALVAAGAEAVGLHSVAGEIFSVDQSWTPLQREKELEIFLKRV  642

Query  445   SSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               +  ++      SAHQMGSCRMG D + SVV+P  E+WEVEGLFVGDGSVLPTA GVNP
Sbjct  643   LGRMFQRLSTPIISAHQMGSCRMGTDQRCSVVDPNCESWEVEGLFVGDGSVLPTASGVNP  702

Query  265   MVTIMSVSYCISQSVLEFL  209
             M+TI S+++  +  +   L
Sbjct  703   MITIQSIAHSTATRIARSL  721



>ref|XP_006418179.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
 gb|ESQ36532.1| hypothetical protein EUTSA_v10006882mg [Eutrema salsugineum]
Length=763

 Score =   506 bits (1304),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 304/759 (40%), Positives = 442/759 (58%), Gaps = 58/759 (8%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSA  2237
             L   ++  + T   S S ++ LSA+C   +P +       +  L    + ++ +FF++S+
Sbjct  17    LRWSVKQESFTHGFSRSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSS  76

Query  2236  ASTGT-PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLLRFP  2063
               +   P +VA V+  +     +  + ++L  L+ R+GTLLLCG   L  + +PFLL+F 
Sbjct  77    DQSHVRPDEVAEVMATKAMPVTVKVVRIVLRLLTFRLGTLLLCGFVCLDKKNWPFLLKFS  136

Query  2062  EISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC---  1895
             +IS  KRE+++  W+T      +R  F  +KA+ L  +FT  ++  + P+W AIGY    
Sbjct  137   DISLDKREKVLQKWSTQWYNPLVRIAFMMIKAIFLFYYFTWTNENSETPAWDAIGYSVNL  196

Query  1894  GPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEE-HVFNRLTKLGCSVAKPK  1718
             G +  +  +++                 PL KGII+    +E  +  RL   G  V + K
Sbjct  197   GENEDMEHRER-----------------PLEKGIIETAKEDEMSIKQRLINKGLIVTEDK  239

Query  1717  PPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKM  1538
                 S+ IECDAVVVGSGCGGGV +  LA +G +V++LEKGNY+   + S LEGPS  ++
Sbjct  240   E-SDSYKIECDAVVVGSGCGGGVAAANLAKSGLRVVILEKGNYFVPRDYSALEGPSTFEL  298

Query  1537  FLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQK  1358
             F    LLMT D     +AGSTVGGGS VNW+AS+KTP  ++ EW    G+ +F  + Y  
Sbjct  299   FEAHSLLMTHDGRFRFMAGSTVGGGSVVNWAASLKTPDAIINEWSVDRGIAIFAREEYTA  358

Query  1357  AMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGR  1178
             AM+ VC ++GV  +   E FQN +LRKGC +LG  V  +P+N+   HYCG C+FGC+ G 
Sbjct  359   AMERVCKRIGVTEKIIKEGFQNQILRKGCEKLGLDVTVVPRNSSEKHYCGSCSFGCRTGD  418

Query  1177  KKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAKGVMFTFQRDGVKQTAV-------  1019
             K+GT  TWLVD V + N  IL +C A ++I   N A+    T ++ G K+  +       
Sbjct  419   KRGTDSTWLVDAV-NNNAVILTQCRAEKLILADNDAQ----TRKQSGRKKICLGVTACPS  473

Query  1018  --------IKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-  866
                     I +KVTV+A G+L TP LL +SGL+N NIGR LH+HP++  WG+FP+   + 
Sbjct  474   NRTRKKLQINAKVTVVACGSLMTPGLLASSGLRNPNIGRGLHIHPILMVWGYFPEKNSDF  533

Query  865   NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYAR  686
             N  ++EG I++++  V    + T     ++TPA+ PG F+AL+PW SG + K R+++YAR
Sbjct  534   NGAAHEGEIVTSLHYVFEIDSTTTPNITLETPAIGPGTFAALIPWVSGSDMKNRLAKYAR  593

Query  685   TAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTG  506
             T+HIFA+ RD+G GE      V Y L K DEENL  GL++ LRIL AAGAEE+G     G
Sbjct  594   TSHIFAMIRDEGVGEVKGGL-VKYRLTKADEENLAIGLKQALRILVAAGAEEVGTYRSDG  652

Query  505   LTLKVKDASREEFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKG  338
               +K K    E+ E F++       + S+ KH     +AHQMG CRMG   K   ++  G
Sbjct  653   QRIKCKGIKEEDLEAFLRTVNVPAGAVSMSKHWTHSFTAHQMGCCRMGATEKEGAIDGYG  712

Query  337   ETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSV  221
             E+WE + L+V D SVLPTALGVNPM+TI S +YCIS  +
Sbjct  713   ESWEAQDLYVCDASVLPTALGVNPMITIQSTAYCISNRI  751



>ref|XP_010433200.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Camelina sativa]
Length=748

 Score =   504 bits (1299),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 307/747 (41%), Positives = 429/747 (57%), Gaps = 42/747 (6%)
 Frame = -3

Query  2389  RKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQV  2210
             ++ E        SPSQ+++L+ +C T LP        +   S  +F   S+       +V
Sbjct  18    KREEEEGYNHGFSPSQIQSLAVICQTLLPP-------SPKQSFDSFNVVSSTQPPFTDEV  70

Query  2209  AWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIV  2030
             A +I +  +   +  L ++L  LS R GTLLLCG       +PF+L+F E+   +RE I+
Sbjct  71    AEMIVKNGRSEAVKVLRIILMVLSFRFGTLLLCGSLCFDKSWPFVLKFSELPLDRREEIL  130

Query  2029  HSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYC--GPDPSISekq  1865
               W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG+C    D SIS K+
Sbjct  131   RKWSRQSGYLLPFRITFFLA-KFYTLFYFFSHTDENMKNPALEAIGFCLDPKDSSISNKK  189

Query  1864  kkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIEC  1688
              +                PL  GII+ L+  +  +   L + G   A+         I C
Sbjct  190   SEADEKRR----------PLESGIIETLHESDITITQSLIEKGVHAARDDDENV-HRIRC  238

Query  1687  DAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTK  1508
             D VVVGSG GGGV +  LA AG KVLVLEKGNY+   + S LEGPSM +++  GG L T 
Sbjct  239   DVVVVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTV  298

Query  1507  DLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMG  1328
             D   ++LAGS VGGG+A+NWSASI+TP +VL+EW E   ++ FGS  Y+ AMD V  ++G
Sbjct  299   DGKFMVLAGSAVGGGTAINWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDQVTTRIG  358

Query  1327  VQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLV  1148
             V  +C  + FQN VLRKGC  LG  V ++P+N+  DHYCG C +GC+ G K GT  TWLV
Sbjct  359   VTEKCVKDGFQNQVLRKGCERLGLQVESVPRNSSEDHYCGLCGYGCRAGHKNGTDRTWLV  418

Query  1147  DLVKSGNGAILPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVI  995
             D V++G   IL   +A + I         ER K   GV+ +     + +  +I+++VTV 
Sbjct  419   DAVENG-AVILTGIKAERFILVDNTSSSKERQKRCVGVIASSVGGKIGKKFIIEARVTVS  477

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTV  818
             + G+L TP L+++SGLKN+NIGRNL LHPV+  WG+FP+   E + K YEG I++++   
Sbjct  478   SAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLH--  535

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
              +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE 
Sbjct  536   YMNDAESGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEV  595

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  VTY   K D ENL+ GL + LR+L AAGA E+G     G  +K +  +RE  E F
Sbjct  596   MKENEVTYRTTKKDRENLRAGLRQALRVLIAAGAVEVGTYRSDGQRMKCEGTTRESIEEF  655

Query  457   VKEES----SQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             + E        +  ++     SAHQM SCRMG   +   ++  GE+WE EGLFV DGSVL
Sbjct  656   LDEVDVVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVL  715

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFL  209
             P+A+GVNPM+TI S +YCI+  ++  L
Sbjct  716   PSAVGVNPMITIQSTAYCIATRIVNSL  742



>ref|XP_009119340.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Brassica rapa]
Length=761

 Score =   504 bits (1299),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 305/754 (40%), Positives = 434/754 (58%), Gaps = 47/754 (6%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSA  2237
             L    +  T +   S S ++ LSA+C   +P +       +  L    + ++ +FF++S 
Sbjct  22    LRWSTKQETFSHGFSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSG  81

Query  2236  ASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLL-RFP  2063
             +    P +VA V+  +     +  + ++L  L+ R+GTLLLCG   L  + + FLL +F 
Sbjct  82    SHV-RPDEVAEVMATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSFLLLKFS  140

Query  2062  EISQKKRERIVHSWATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---C  1895
             +IS +KRE+++  W         R  F  +KA+ L  +FT  ++  +NP+W AIGY    
Sbjct  141   DISLEKREKVLQKWNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIGYKVDI  200

Query  1894  GPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKP  1715
             G +  I  KQ+                 PL KGII+    +E    +L        K   
Sbjct  201   GENEDIERKQR-----------------PLEKGIIETAKEDEATIKQLMINKGLKLKEDK  243

Query  1714  PGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMF  1535
                +F IECDAVV+GSGCGGGV +  LA +G KV+V+EKGNY+   + S LEGPSM +MF
Sbjct  244   ESNTFKIECDAVVIGSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMF  303

Query  1534  LGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKA  1355
                GLLMT D     +AGST+GGGS VNW+AS+KTP  ++ EW    G+  F  + Y  A
Sbjct  304   EANGLLMTHDGRFRFMAGSTLGGGSVVNWAASLKTPDAIIEEWSVDRGIATFDREGYTAA  363

Query  1354  MDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRK  1175
             M++VC ++ V      E FQN +LRKGC +LG  V  +P+N+  +HYCG C+FGCK G K
Sbjct  364   MESVCKRICVTERVIREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDK  423

Query  1174  KGTAETWLVDLVKSGNGAILPECEALQVI-------HERNKAKGVMFTFQRDGVKQTAVI  1016
             +GT  TWLVD V + N  IL +C A ++I         + +  GV  +     + +   I
Sbjct  424   RGTDITWLVDAVDN-NAVILTQCRAEKLIFAETESGRRKKRCLGVTTSISNTAINKIE-I  481

Query  1015  KSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAI  839
              +KVTV+A G+L TP LL +SGLKN NIGR LH+HP++ AWG+FP+     N  ++EG I
Sbjct  482   NAKVTVVACGSLMTPGLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSNFNGAAHEGEI  541

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             M+++   V  ++ T     ++TPAL PG F+AL+PW SG++ K R+++Y+RT+HIF + R
Sbjct  542   MTSLH-YVFEIDSTTPNITLETPALGPGTFAALIPWVSGKDTKERLAKYSRTSHIFVMVR  600

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+G GE      V Y L K DEENL  GL + LRIL AAGAEE+G     G  LK     
Sbjct  601   DEGVGEVKGGI-VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLKCGGVK  659

Query  478   REEFERFVKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLF  311
              E+ E+F++   +     S+ +      +AHQMG CRMG   +   V+  GE+WE EGL+
Sbjct  660   EEDLEKFLETVDAPAGVVSMSRRWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLY  719

Query  310   VGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             V D SVLPTALGVNPMVTI S +YCIS+ +   +
Sbjct  720   VCDASVLPTALGVNPMVTIQSTAYCISKRLAALM  753



>ref|XP_009137800.1| PREDICTED: long-chain-alcohol oxidase FAO4B [Brassica rapa]
Length=744

 Score =   502 bits (1292),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 308/731 (42%), Positives = 428/731 (59%), Gaps = 34/731 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              S SQ++TLS +C T LP          +A V +F   S +      +VA +I +  +  
Sbjct  28    FSISQIQTLSFICQTLLPPPPPETTAEQNA-VDSFNVASGSQPPFTDEVAEMIVKNGRSE  86

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFI  1997
              +  L ++L  LS R GTL LCG   L+  +PF+ +F ++   KRE I+  W+  S  F+
Sbjct  87    AVKVLRIILTILSYRFGTLFLCGSLCLAKDWPFVHKFSDLPLDKREEILRMWSRQSGLFL  146

Query  1996  --RNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieE  1823
               R  F   K   L  FF+  D    NP+ +AIGY     SI   + ++           
Sbjct  147   PLRITFFLAKFYTLFSFFSQRDQNMKNPALEAIGY-----SIDTTEMRKDDEAPR-----  196

Query  1822  LLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvi  1646
                 PL KGII+  N  +  +   LT+ G  VA+         I CD V+VGSG GGGV 
Sbjct  197   ----PLEKGIIETKNESDVTIRQSLTQKGVHVARDDNDNI-HRIRCDVVIVGSGSGGGVA  251

Query  1645  sgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGG  1466
             +  LA AG KVLVLEKGNY+   + S LEGPSM +++  G L+ T D   ++LAGSTVGG
Sbjct  252   AANLAKAGLKVLVLEKGNYFTSRDYSGLEGPSMLELYEKGALMTTVDGKFMVLAGSTVGG  311

Query  1465  GSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMV  1286
             G+AVNWSASI+TP +VL+EW E   +E FGS  YQ AMD V  ++GV   C  E  QN V
Sbjct  312   GTAVNWSASIRTPDHVLKEWSEESKIEFFGSQEYQLAMDEVVRRLGVTERCVKEGLQNQV  371

Query  1285  LRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPEC  1106
             LR+GC  LG  VV++P+N+P DHYCG C +GC++G K GT +TWLVD V++G   IL   
Sbjct  372   LREGCERLGLKVVSVPRNSPEDHYCGSCGYGCREGGKNGTDKTWLVDAVENG-AVILTGV  430

Query  1105  EALQVIHERNKAK-------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGL  947
             +A + +   N+ K       GV+ +     +++  +I+++VTV + G+L TP L+ +SGL
Sbjct  431   KAERFVFTDNEGKKKKKRCVGVIASSVGGKIEKKVMIEARVTVSSAGSLLTPPLMRSSGL  490

Query  946   KNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTP  770
             +N+NIGRNL LHPV+  WG+FP+   E + K YEG I++++  V  +   +G  A+++TP
Sbjct  491   ENRNIGRNLKLHPVLMTWGYFPEKGSEFSGKMYEGGIITSVHHV--HDAESGCRAILETP  548

Query  769   ALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEE  590
                P  ++ L PW SG + K RM +Y RT+H+FAL RD GSGE      VTY   K D E
Sbjct  549   LAGPASYAGLSPWVSGADLKERMMKYGRTSHLFALVRDYGSGEVLKENEVTYRTSKKDRE  608

Query  589   NLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKH  422
             NL+ GL + LR+L AAGA E+G     G  +K +  +RE  E F+    +     +  ++
Sbjct  609   NLRVGLRQALRVLVAAGAVEVGTYRSDGQRIKCEGMTREAMEEFLDGVDAVGGVSTKGEY  668

Query  421   PNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVS  242
                  SAHQMGSCRMG   +   V+ KGE+WE EGLFV DGSVLP+A+GVNPM+TI S +
Sbjct  669   WTTYFSAHQMGSCRMGRTAEEGAVDEKGESWEAEGLFVCDGSVLPSAVGVNPMITIQSTA  728

Query  241   YCISQSVLEFL  209
             YCIS  ++  L
Sbjct  729   YCISTRIVASL  739



>ref|XP_010447958.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=750

 Score =   501 bits (1290),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 306/731 (42%), Positives = 423/731 (58%), Gaps = 37/731 (5%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHP  2177
              SPSQ+++L+ +C T LP        +   S  +F   S+       +VA +I +  +  
Sbjct  30    FSPSQIQSLAVICQTLLPP-------SGKQSFDSFNVVSSTQPPFTDEVAEMIVKNGRSE  82

Query  2176  KlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSS---L  2006
              +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +RE I+  W+  S   L
Sbjct  83    AVKVLRIILMVLSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRREEILRKWSRQSGFLL  142

Query  2005  QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
              F   FF A K   L  FF+  D+   NP+ +AIG+C      S    K+   D +    
Sbjct  143   PFRITFFLA-KFYTLFYFFSHTDENLKNPALEAIGFCLDTKDSSSNSNKKSEADEKRR--  199

Query  1825  ELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSF-VIECDAvvvgsgcgggv  1649
                  PL  GII+  L E  +    T +G  V   +    +   I CD V+VGSG GGGV
Sbjct  200   -----PLESGIIE-TLHESDITITQTLIGKGVHAARDDDENVHRIRCDVVIVGSGSGGGV  253

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              +  LA AG KVLVLEKGNY+   + S LEGPSM +++  GG L T D   ++LAGS VG
Sbjct  254   AAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLTTVDGKFMVLAGSAVG  313

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GG+A+NWSASI+TP YVL EW E   ++ FGS  Y+ AMD V  ++GV  +C  E FQN 
Sbjct  314   GGTAINWSASIRTPDYVLEEWSEGSKIKFFGSKEYKTAMDEVTTRIGVTEKCVKEGFQNQ  373

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  LG  V ++P+N+  DHYCG C +GC  G K GT  TWLVD V++G   IL  
Sbjct  374   VLRKGCERLGLKVESVPRNSREDHYCGLCGYGCTAGHKNGTDGTWLVDAVENG-AVILTG  432

Query  1108  CEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
              +A + I         ER K   GV+ +     + +  +I+++VTV + G+L TP L+++
Sbjct  433   IKAERFILVDNNSSSKERQKRCVGVIASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLS  492

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNGTGYGAVI  779
             SGLKN+NIGRNL LHPV+  WG+FP+   + + K YEG I++++    +N   +G  A++
Sbjct  493   SGLKNQNIGRNLRLHPVLMTWGYFPEKDSDFSGKMYEGGIITSLH--YMNDAESGCKAIL  550

Query  778   QTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKT  599
             + P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSGE      VTY   K 
Sbjct  551   ENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSGEVMKENEVTYRTTKK  610

Query  598   DEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSL  431
             D ENL+ GL + LR+L AAGA E+G     G  +K +  +RE  E F+ E  +     + 
Sbjct  611   DRENLRAGLRQALRVLIAAGAVEVGTYRSDGQRMKCEGTTREAMEEFLDEVDAVGGVSTK  670

Query  430   RKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIM  251
              ++     SAHQM SCRMG   +   ++  GE+WE EGLFV DGSVLP+A+GVNPM+TI 
Sbjct  671   GEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGSVLPSAVGVNPMITIQ  730

Query  250   SVSYCISQSVL  218
             S +YCIS  ++
Sbjct  731   STAYCISTRIV  741



>gb|AAL31024.1|AC078948_8 putative alcohol oxidase [Oryza sativa Japonica Group]
Length=756

 Score =   500 bits (1287),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 306/745 (41%), Positives = 418/745 (56%), Gaps = 68/745 (9%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI----NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
             T  L  +QM  L A+C   +PA+     +      D  V  F+  +AA +  P +VA + 
Sbjct  37    THGLGAAQMGALRAMCGALIPALPAEEEDGARGGGDMDVERFYLATAAESTVPDEVAELT  96

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWA  2018
               R        + ++LW L+TR+GTL LCG+  +S +FP++ RF ++             
Sbjct  97    MTRCIWEAGVLVRIILWILATRVGTLALCGRRCVSGEFPYVRRFADMP------------  144

Query  2017  TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSIS-ekqkkqkhhdh  1841
                                      VD+  +NPSWKAIGY  P      +K++  +    
Sbjct  145   -------------------------VDENLENPSWKAIGYSVPAAEEEPQKEEPTEATPT  179

Query  1840  eddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSV--AKPKPPGPSFVIECDAvvvg  1670
                       PL  G+++   L +  +   L + G ++      P      + CDAVVVG
Sbjct  180   PAPATAPPCRPLDNGVVETKQLDDNALLMSLAEKGLALKTGASSPSAHHHTVLCDAVVVG  239

Query  1669  sgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVL  1490
             SGCGGGV + VLA+AGYKV+V+EKG+Y+A  + S LEGP+M++++  GG+  T ++   +
Sbjct  240   SGCGGGVAAAVLASAGYKVVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTM  299

Query  1489  LAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECE  1310
              AG+TVGGGSAVNWSA I+TP  VL+EW   HGL LFG   Y +AMD VC ++GV   C 
Sbjct  300   FAGATVGGGSAVNWSACIRTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCR  359

Query  1309  DESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSG  1130
             +E FQN  +R+GC  LG  V  + +N+   H+CG C  GC  G K+GT  TWLVD V  G
Sbjct  360   EEGFQNKAVRRGCEALGLRVEAVSRNSSEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRG  419

Query  1129  NGAILPECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVIKSKVTVIAGGALT  977
                IL  C+A + I E N            GV+      G+ +   I++KV+V A GAL 
Sbjct  420   -AVILTGCKAERFILETNTGGGGGRRKKCVGVVAKCLGKGITKKLRIEAKVSVSACGALM  478

Query  976   TPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVNG  800
             TP LL NSGLKN++IGRNLHLHPV  AWG+FPD+  E   KSYEG I+++M  V      
Sbjct  479   TPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDSTAELPGKSYEGGIITSMHRVTDRT--  536

Query  799   TGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSV  620
                  +I+TPAL PG F+A++PW SG++ K RM RYARTAH   L RD+ +G       V
Sbjct  537   -----IIETPALGPGAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTVGGEGRV  591

Query  619   TYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS  440
              +   + D   L+ GL + LRIL AAGA E+G N   GL L+ K A  E+ E F+ E S 
Sbjct  592   RFTPSRGDAGELRAGLRRALRILVAAGAAEVGTNRSDGLRLRCKGARDEDVEAFLDEVSV  651

Query  439   QSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
             +    HP      L ASAHQMGSCRMG   K   V+  GE+WE EGL+V DGS+LPTA+G
Sbjct  652   EKGPMHPGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVG  711

Query  274   VNPMVTIMSVSYCISQSVLEFLKTH  200
             VNPM+TI SV+YC+++ + E L + 
Sbjct  712   VNPMITIESVAYCVAKGIAESLASR  736



>ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp. 
lyrata]
Length=760

 Score =   499 bits (1285),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 298/748 (40%), Positives = 443/748 (59%), Gaps = 52/748 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGT-PHQVAWV  2201
              S S ++ LSA+C+  +P +          L    + ++ +FF++S + +   P +VA +
Sbjct  29    FSQSDLQALSAICDAIMPPVPLESLNLEMKLKVLRNDALLSFFKSSTSESHVRPDEVAEL  88

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHS  2024
             +  +     +  + ++L  L+ R+GTLLLCG   L  + +PFLL+F E+S +KRE+++  
Sbjct  89    LATKAIPLTVLVVRIVLRILTFRLGTLLLCGLVCLDMKNWPFLLKFSEMSLEKREKVLQR  148

Query  2023  WATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkq  1856
             W T       R  F  +KA+ L  +FT  ++  +NP+W AI Y    G +  + +K++  
Sbjct  149   WNTQWYNPLARIGFMMIKAIFLFYYFTWTNENTENPAWDAINYRVEIGENEGMEQKER--  206

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL +GII+    +E     R+   G  V + +    ++ IECDAV
Sbjct  207   ---------------PLDQGIIETAKEDEMTIKQRMINKGLKVTEDRD-SDTYKIECDAV  250

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             VVGSGCGGGV + +LA +G +V+V+EKGNY+   + S LEGPSM ++F    LLMT D  
Sbjct  251   VVGSGCGGGVAAAILAKSGLRVVVIEKGNYFVPRDYSALEGPSMFELFESNSLLMTHDGR  310

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
                +AGSTVGGGS VNW+AS+KTP  ++ EW    G+ ++ S+ Y+ AMD V  ++GV  
Sbjct  311   FRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISVYSSEKYKAAMDRVLKRLGVTE  370

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
             +   E FQN +LRKGC +LG  V  +P+N+   H CG C+FGC  G K+GT  TWLVD V
Sbjct  371   KINSEGFQNRILRKGCEKLGLDVTIVPRNSTEKHNCGSCSFGCPTGEKRGTDSTWLVDAV  430

Query  1138  KSGNGAILPECEALQVI------HERNKAK------GVMFTFQRDGVKQTAVIKSKVTVI  995
              + N  IL +C+A ++I      H+R ++       GV  +   +  ++   I +KVT++
Sbjct  431   -NNNAVILTQCKAEKLILADNNAHQREESGRRKRCLGVTASLS-NRTRKKLQINAKVTIV  488

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTV  818
             A G+L TP LL +SGLKN NIGR LH+HP++ AWG+FP+   + +  ++EG I++++  V
Sbjct  489   ACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFQGAAHEGEIVTSLHYV  548

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
                 + T     ++TPA+ PG F+AL PW SG + K R+++YART+HIF + RD+G GE 
Sbjct  549   HPMEDSTTPNITLETPAIGPGTFAALAPWVSGPDMKERLAKYARTSHIFVMVRDEGVGEV  608

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K     +E+ E F
Sbjct  609   KGDI-VKYRLTKADEENLTTGLKQALRILVAAGAAEVGTYRSDGQRMKCSGIKQEDVEAF  667

Query  457   VKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             ++  ++     S+ KH     +AHQMG CRMG   KA  ++ KGE+WE E L+V D SVL
Sbjct  668   LQAVNAPAGVVSMSKHWTQSFTAHQMGCCRMGATEKAGAIDGKGESWEAEDLYVCDASVL  727

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PTALGVNPM+T+ S +YCIS  + E +K
Sbjct  728   PTALGVNPMITVQSTAYCISNRIAELMK  755



>ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
Length=773

 Score =   499 bits (1286),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 315/763 (41%), Positives = 436/763 (57%), Gaps = 64/763 (8%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI----------------NEALPETTDASVTNFFQTSAA  2234
             T   S SQM  L+ALC   +P++                        D  V  F   SAA
Sbjct  23    THGFSASQMTALTALCGALVPSLPPDRRNGHQQQEDGGRGGGSGGNKDKVVEEFLLASAA  82

Query  2233  STGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCG-KGSLSTQFPFLLRFPEI  2057
                 P +VA  ++++     L  +  +LW L TR+G+L LCG +  LS +FPF+ RF E+
Sbjct  83    DPPVPGEVAEQMSRKCLPEALALVRTVLWLLGTRLGSLALCGARSCLSWRFPFVRRFDEL  142

Query  2056  SQKKRERIVHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGP---  1889
               ++RE  +  W+  +L   +R FF  +KA+ L VF++  D+   NP W+AIGY  P   
Sbjct  143   PLEQREAALRRWSRQTLLLPLRMFFVIIKAICLHVFYSWTDENSKNPHWRAIGYSPPLAD  202

Query  1888  -DPSISekqkkqkhhdheddieELLFGPLYKGII------DLNLPEEHVFNRLTKLGCSV  1730
              +P+ +E ++ +K              PL  G++      D +LP       L   G +V
Sbjct  203   DEPAPAESERPEKR-------------PLDDGVVETTKETDASLPA-----LLAAKGLTV  244

Query  1729  AKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPS  1550
             A         V ECD V+VGSGCGGGV + VLA AG+KV+V+EKGNY+   + + +E PS
Sbjct  245   ADDSAQNVCRV-ECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTAIEAPS  303

Query  1549  MDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSD  1370
             M++++ GGG + T     ++LAGSTVGGG+AVNWSA IKTP  V  EW    GL LF +D
Sbjct  304   MEQLYEGGGAVSTLSGSALVLAGSTVGGGTAVNWSACIKTPDDVREEWASDQGLPLFATD  363

Query  1369  VYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGC  1190
              Y  AMD V  ++GV   C +E  QN VLRKGC +LGY V ++ +N+   HYCG C +GC
Sbjct  364   EYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCEKLGYKVESVSRNSSEGHYCGSCGYGC  423

Query  1189  KDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHER-------NKAK---GVMFTFQRD  1040
             + G K+GT  TWLVD V  G   IL  C+A +++ ER       ++AK   GV+      
Sbjct  424   RSGDKRGTDRTWLVDAVSRG-AVILTGCKAEKLLLERTGTGGAESRAKRCVGVVARSTNP  482

Query  1039  GVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGEN  863
              + +T  ++++VTV A G+L TP LL  SGL N++IG+NLHLHP    WG+FPDT P   
Sbjct  483   TITRTLEVRARVTVSACGSLLTPVLLRGSGLSNRHIGKNLHLHPTALVWGYFPDTMPDLK  542

Query  862   KKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYART  683
              K+YEG I++++  V     G    A+++TPA+       L PW SG + K RM RY RT
Sbjct  543   GKTYEGGIITSLHKVE-GAPGAPARAILETPAMGLAGAGTLFPWVSGSDLKERMLRYGRT  601

Query  682   AHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGL  503
              H+F+L RD+GSG       V Y LD TD EN++ GL + LRILAAAGA EIG +   G 
Sbjct  602   VHLFSLVRDRGSGSVLGERRVAYHLDATDAENMREGLRRALRILAAAGAAEIGTHRSDGQ  661

Query  502   TLKVKDASREEFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGE  335
                 + A+    E F+         QS  +  +L  +AHQMGSCRMGV  +   V+ +GE
Sbjct  662   RFACRGATEAALEEFLDGVDVVRGPQSKAEAWSLCCTAHQMGSCRMGVTARDGAVDARGE  721

Query  334   TWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             +WEVE L+V DGSVLP+A+GVNPMVTI SV+YC++  + E L+
Sbjct  722   SWEVESLYVCDGSVLPSAVGVNPMVTIQSVAYCLATGIAESLR  764



>ref|XP_010438427.1| PREDICTED: long-chain-alcohol oxidase FAO4B-like [Camelina sativa]
Length=745

 Score =   498 bits (1281),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 304/749 (41%), Positives = 427/749 (57%), Gaps = 38/749 (5%)
 Frame = -3

Query  2401  YSLHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGT  2222
             + L R  +        SPSQ+ +L+ +C T LP        +   S  +F   S+     
Sbjct  11    HRLLRSKKREGYNHGFSPSQIHSLAVICQTLLPP-------SGKQSFDSFNVVSSTQPPF  63

Query  2221  PHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKR  2042
               +VA +I +  +   +  L ++L  LS R GTLLLCG   L   +PF+L+F E+   +R
Sbjct  64    TDEVAEMIVKNGRSEAVKVLRIILMILSFRFGTLLLCGSLCLDKSWPFVLKFSELPLDRR  123

Query  2041  ERIVHSWATSS---LQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISe  1871
             E I+  W+  S   L F   FF A K   L  FF+  D+   NP+ +AIG+C      S 
Sbjct  124   EEILKKWSRQSGYLLPFRITFFLA-KFYTLFYFFSHTDENLKNPALEAIGFCLDTKDSSS  182

Query  1870  kqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVI  1694
               KK +  +           PL  GI++ L+  +  +   L + G   A+         I
Sbjct  183   SNKKIEADEKRR--------PLESGIVETLHESDITITQTLIEKGVHAARDDDENV-HRI  233

Query  1693  ECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLM  1514
              CD ++VGSG GGGV +  LA AG KVLVLEKGNY+   + S LEGPSM +++  GG L 
Sbjct  234   RCDVIIVGSGSGGGVAAANLAKAGLKVLVLEKGNYFTAQDYSGLEGPSMLELYEKGGFLT  293

Query  1513  TKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGK  1334
             T D   ++LAGS VGGG+A+NWSASI+TP +VL+EW E   ++ FGS  Y+ AMD V  +
Sbjct  294   TVDGKFMVLAGSAVGGGTAINWSASIRTPDHVLQEWSEGSKIKFFGSQEYKTAMDEVKTR  353

Query  1333  MGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETW  1154
             +GV  +C  + FQN VLRKGC  LG  V ++P+N+  DHYCG C +GC+ G K GT  TW
Sbjct  354   IGVTEKCVKDGFQNQVLRKGCERLGLKVESVPRNSREDHYCGLCGYGCRAGHKNGTDRTW  413

Query  1153  LVDLVKSGNGAILPECEALQVI--------HERNK-AKGVMFTFQRDGVKQTAVIKSKVT  1001
             LVD V++G   IL   +A + I         ER K   GV+ +     + +  +I+++VT
Sbjct  414   LVDAVENG-AVILTGIKAERFILVDNTSSSKERQKRCVGVIASSVGGKIGKKFIIEARVT  472

Query  1000  VIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMS  824
             V + G+L TP L+++SGLKN+NIGRNL LHPV+  WG+FP+   E + K YEG I++++ 
Sbjct  473   VSSAGSLLTPPLMLSSGLKNQNIGRNLRLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLH  532

Query  823   TVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSG  644
                +N   +G  A+++ P + P  ++ L PW SG + K RM +Y RTAH+FAL RD GSG
Sbjct  533   N--MNDAESGCKAILENPLIGPASYAGLSPWVSGADLKERMMKYGRTAHLFALVRDIGSG  590

Query  643   EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFE  464
             E      VTY     D ENL+ GL   LR+L AAGA E+G     G  +K +  +RE  E
Sbjct  591   EVMKENEVTYRTTTKDRENLRAGLRLALRVLIAAGAVEVGTYRSDGQRIKCEGTTREAME  650

Query  463   RFVKEESS----QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGS  296
              F+ E  +     +  ++     SAHQM SCRMG   +   ++  GE+WE EGLFV DGS
Sbjct  651   EFLDEVDAVGGVSTKGEYWTSYFSAHQMSSCRMGATEEEGALDENGESWEAEGLFVCDGS  710

Query  295   VLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             VLP+A+GVNPM+TI S +YCIS  ++  L
Sbjct  711   VLPSAVGVNPMITIQSTAYCISTRIVNSL  739



>gb|EEC73620.1| hypothetical protein OsI_08118 [Oryza sativa Indica Group]
Length=770

 Score =   497 bits (1279),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 294/699 (42%), Positives = 413/699 (59%), Gaps = 26/699 (4%)
 Frame = -3

Query  2266  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLS-T  2090
             +V +F   SAA    P +VA ++ +      L  +  +LW L TR+GTL LCG   +S  
Sbjct  80    AVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWLLGTRLGTLALCGGRCVSWG  139

Query  2089  QFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSW  1913
             ++PF+L F E+  ++RE  +  W+  + L  +R FF  +K   L VF++ +D+  +NP W
Sbjct  140   RWPFVLTFAEMPVERREEALRRWSRVTVLPPLRAFFLVVKVFCLYVFYSWIDESSENPHW  199

Query  1912  KAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGC  1736
             +AIGY  P      ++  +               PL  G+++ +NL +  + + L + G 
Sbjct  200   RAIGYSPPTDEPPAEEHTEATKR-----------PLDDGVVETINLTDASLPSSLAEKGL  248

Query  1735  SVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEG  1556
             +V          V ECD  +VGSGCGGGV + VLA AG+KV+V+EKGNY+   + +  EG
Sbjct  249   AVTDDAARNVCRV-ECDVAIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTSRDYTSFEG  307

Query  1555  PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1376
             PS+++++  GG + T +   +LLAGSTVGGGSAVNWSA +KTP +V REW   HGL LF 
Sbjct  308   PSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACLKTPEFVRREWAAAHGLPLFA  367

Query  1375  SDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTF  1196
             S  Y  AMD V  ++GV   C +E  QN VLRKGC +LGY V  + +N+   HYCG C F
Sbjct  368   SPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGYKVDAVARNSSEGHYCGSCGF  427

Query  1195  GCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAK-----GVMFTFQRDGVK  1031
             GC+ G K+GT  TWLVD V  G   IL  C+A +++ ER  A+     GV+       + 
Sbjct  428   GCRTGDKRGTDTTWLVDAVGRG-AVILTGCKAEKLVLERGGARGRRCVGVVARSTNPAIT  486

Query  1030  QTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKS  854
             +T  +++KVTV A G+L TP LL  SGL N +IG+NLHLHP   AWG+FPDT P    K+
Sbjct  487   KTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLHPTALAWGYFPDTMPDLKGKA  546

Query  853   YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI  674
             YEG I+++M  V  +  G  + A+++TP +        MPW SG++ K RM R+ART HI
Sbjct  547   YEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMPWLSGRDSKERMLRFARTVHI  606

Query  673   FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK  494
             F+L RD+GSG       V Y LD  D E+++ GL + LR+L AAGA E+G +   G  L+
Sbjct  607   FSLVRDRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRSDGQRLR  666

Query  493   VKDASREEFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE  326
              +  + E  E F+         QS  +   L  SAH MGSCRMG       V+ +GE+WE
Sbjct  667   CEGLTEESLEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDARGESWE  726

Query  325   VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
              E L+V DGSVLPTA+GVNPM+TI SV+YC++  + + L
Sbjct  727   AERLYVCDGSVLPTAVGVNPMITIQSVAYCLANGIADSL  765



>sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName: Full=Long-chain 
fatty alcohol oxidase 2 [Lotus japonicus]
 emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
Length=750

 Score =   496 bits (1277),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 315/743 (42%), Positives = 445/743 (60%), Gaps = 42/743 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI---NEALPETTDASVTNFFQTSAASTGTPHQVAWVINQ--  2192
             LS SQM  ++A+C    P+    ++    + D +++ F+  S +    P + A ++ +  
Sbjct  27    LSSSQMHVIAAICEALFPSQPLDSQNNQSSVDKALSAFYTASGSQAPLPDEAAELLFKFN  86

Query  2191  RMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATS  2012
             R     L+ +  +L  LS R+GTLLLCG   L  ++PF+ +F EI  +KRE I+  W+  
Sbjct  87    RSFPEALSLVSWVLLILSFRLGTLLLCGTLCLDWRWPFIHKFSEIPLEKREEILKRWSRE  146

Query  2011  SLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdhed  1835
                  +R  F   K +     F+  D  G NP WKAIGY      +  ++K  +      
Sbjct  147   KCWIPLRLVFVLTKLVCFYNLFSRADVNGHNPIWKAIGY-----QVDTREKLTQKKR---  198

Query  1834  dieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcg  1658
                     PL +G+I+ +   +  +   LT+ G  V +       + I+CDAV+VGSGCG
Sbjct  199   --------PLQEGLIETMYETDSTLIQSLTEKGLEVTEDLEQN-MYKIKCDAVIVGSGCG  249

Query  1657  ggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGS  1478
             GGV + VLA +G+KV++LEKG Y+   + S LEGPSM++++  GG+L + D  M++LAGS
Sbjct  250   GGVAAAVLANSGHKVIILEKGEYFVSHDYSSLEGPSMNELYESGGILPSLDGKMMILAGS  309

Query  1477  TVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESF  1298
             T+GG SA+NWSA I+TP  VLREW E H + LF S  YQ AMDTVC ++GV   C  ESF
Sbjct  310   TLGGXSAINWSACIRTPDSVLREWSEKHKIPLFASPDYQSAMDTVCRRIGVTENCNKESF  369

Query  1297  QNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGA-  1121
             QN +LR+GC ++G+ V  +  N+ +DHYCG C +GC+ G KKGT  TWLVD V  GNGA 
Sbjct  370   QNQILRQGCAKIGFKVEPVAINSSADHYCGSCCYGCRTGDKKGTESTWLVDAV--GNGAV  427

Query  1120  ILPECEALQVIH---------ERNKAKGVMFTFQ-RDGVKQTAVIKSKVTVIAGGALTTP  971
             IL  C+A ++           +R    GV+ +   R  V +   I+SKVT+ A G+L+TP
Sbjct  428   ILTGCKAEKLNFTLKDGDNGTKRKTCSGVIASATWRSKVTKKLQIESKVTISACGSLSTP  487

Query  970   SLLINSGLKNKNIGRNLHLHPVVFAWGHFP-DTPGENKKSYEGAIMSAMSTVVLNVNGTG  794
              L+I+SGLKN NIG+NLHLHP  FAWG+FP D    +  +YEG I++++  V    + + 
Sbjct  488   PLMISSGLKNPNIGKNLHLHPCQFAWGYFPEDMTNFSGNNYEGGIITSIHKVFEEDSTST  547

Query  793   YGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTY  614
                +I+ PAL PG FSAL+PW SG + K RM +YARTA++FAL RD GSGE  +   ++Y
Sbjct  548   PRIIIEAPALGPGSFSALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEVKAEGRISY  607

Query  613   DLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK---VKDASREEFERFVKEES  443
              LDK D E+LQ GL K LRIL AAGA E+G     G  +K   +K++  EEF   V+   
Sbjct  608   KLDKIDRESLQTGLRKALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFLDSVRVVG  667

Query  442   SQSLRKHP-NLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNP  266
               S R     +  SAHQM SCRM    +   V+  GE+WE +GL+V DGSVLP+A+GVNP
Sbjct  668   GPSSRNEVWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNP  727

Query  265   MVTIMSVSYCISQSVLEFLKTHD  197
             M+TI S +YCI+ ++ E LK  +
Sbjct  728   MITIQSTAYCIASNIAESLKKQN  750



>ref|XP_011080082.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Sesamum indicum]
Length=742

 Score =   495 bits (1275),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 299/727 (41%), Positives = 440/727 (61%), Gaps = 31/727 (4%)
 Frame = -3

Query  2344  QMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKHPKlns  2165
             Q+++L+A+C T +P +     +  DA++ +    S   +  P +VA ++ +R     +  
Sbjct  28    QIQSLAAICQTLIPPLPLDDNDNDDANLLHQPNHSFYKSSGPDEVAELLVKRGIPAAVFI  87

Query  2164  lllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQF-IRNF  1988
             + L+L FLS+R+GTLLLCG      ++PF+  F E++ KKRE I+  W+  +L   +R  
Sbjct  88    VSLVLKFLSSRLGTLLLCGWICSDWKWPFVHSFCELTLKKREAILQKWSRETLFLPLRIA  147

Query  1987  FTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGP  1808
             F  +K + L VFF+  D+   NP+W+AIGY      +   +++ K+             P
Sbjct  148   FLLLKIMCLFVFFSWTDENSSNPAWEAIGY-----QVEATERETKYEKER---------P  193

Query  1807  LYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLA  1631
             L KGII+ +N  E  +   L + G + A+ +     + I+CDAV++GSGCGGGV + VLA
Sbjct  194   LEKGIIEIMNEDESSLKESLMQKGINFAEDEDEN-VYKIKCDAVIIGSGCGGGVTAAVLA  252

Query  1630  TAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVN  1451
              +G KVL+LEKG+Y+   + S LEGP+  +++  GG+L T+D  ++++AG+TVGGGS +N
Sbjct  253   KSGQKVLILEKGHYFVPEDYSGLEGPAFSELYESGGMLTTQDGKIMVMAGTTVGGGSYMN  312

Query  1450  WSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGC  1271
              S  I+TP Y+L+EW     + LFGS  YQ AMD VC ++GV   C  E FQN VLR+GC
Sbjct  313   LSHWIRTPDYILKEWSTESKIHLFGSHEYQSAMDAVCERIGVTENCVQEGFQNQVLRRGC  372

Query  1270  RELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQV  1091
               LG  V  +P+N+  DHYCG C   C+ G KKGT  TWLVD VK+G   IL  C+A  +
Sbjct  373   ENLGLNVEPVPRNSSPDHYCGSCCSDCRRGDKKGTGSTWLVDAVKNG-AVILTGCKAETL  431

Query  1090  I-------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNI  932
             +        +R    GV+   +   +++   I+++VT+ A G+L TP LLI+SGL+NKNI
Sbjct  432   MLVSDKKEKDRKSCLGVIAAAENKNIRKKIQIEARVTISACGSLLTPPLLISSGLENKNI  491

Query  931   GRNLHLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPG  755
              +NLHLHPV   WG+FP++  E K KS+ G I +++   V +   +   A++Q  AL P 
Sbjct  492   RKNLHLHPVSLVWGYFPESLVELKGKSFGGGISTSLHK-VQSEEKSDIQAIVQAGALGPA  550

Query  754   LFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRG  575
             LF+ L PW S  +   RM++YARTA +FAL+RD GSGE      + Y L   D+ENL+ G
Sbjct  551   LFATLFPWVSRNDMNDRMTKYARTAVLFALSRDYGSGEVRKQGHIKYRLSAVDKENLKTG  610

Query  574   LEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS----QSLRKHPNLKA  407
             L + LRIL  AGA E+G     G  ++ K    E+ E F+   ++    ++  ++  L  
Sbjct  611   LRRALRILVGAGAAEVGTFRSDGQRIRCKGTKNEDLEEFLDAVTAVGGPRTRSEYWTLYC  670

Query  406   SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ  227
             SAHQMGSCRMG + +   V+  GE WE +GLFV DGSVLPTA+GVNPM+TI S +YCIS+
Sbjct  671   SAHQMGSCRMGANEEDGAVDENGECWEAKGLFVCDGSVLPTAVGVNPMITIQSTAYCISK  730

Query  226   SVLEFLK  206
              + + LK
Sbjct  731   RLADSLK  737



>ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japonica Group]
 dbj|BAD21547.1| putative alcohol oxidase [Oryza sativa Japonica Group]
 dbj|BAF09378.1| Os02g0621800 [Oryza sativa Japonica Group]
Length=770

 Score =   495 bits (1275),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 293/699 (42%), Positives = 413/699 (59%), Gaps = 26/699 (4%)
 Frame = -3

Query  2266  SVTNFFQTSAASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLS-T  2090
             +V +F   SAA    P +VA ++ +      L  +  +LW L TR+GTL LCG   +S  
Sbjct  80    AVRDFLLASAADPPVPDEVAELMTRMCLREALALVRAVLWLLGTRLGTLALCGGRCVSWG  139

Query  2089  QFPFLLRFPEISQKKRERIVHSWA-TSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSW  1913
             ++PF+L F E+  ++RE  +  W+  + L  +R FF  +K   L VF++ +D+  +NP W
Sbjct  140   RWPFVLTFAEMPVERREEALGRWSRVTVLPPLRAFFLVVKVFCLYVFYSWIDESSENPHW  199

Query  1912  KAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGC  1736
             +AIGY  P      ++  +               PL  G+++ +NL +  + + L + G 
Sbjct  200   RAIGYSPPTDEPPAEEHTEATKR-----------PLDDGVVETINLTDASLPSSLAEKGL  248

Query  1735  SVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEG  1556
             +V          V ECD  +VGSGCGGGV + VLA AG+KV+V+EKGNY+   + +  EG
Sbjct  249   AVTDDAARNVCRV-ECDVAIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTSRDYTSFEG  307

Query  1555  PSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFG  1376
             PS+++++  GG + T +   +LLAGSTVGGGSAVNWSA +KTP +V REW   HGL LF 
Sbjct  308   PSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACLKTPEFVRREWAAAHGLPLFA  367

Query  1375  SDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTF  1196
             +  Y  AMD V  ++GV   C +E  QN VLRKGC +LGY V  + +N+   HYCG C F
Sbjct  368   TPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGYKVDAVARNSSEGHYCGSCGF  427

Query  1195  GCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERNKAK-----GVMFTFQRDGVK  1031
             GC+ G K+GT  TWLVD V  G   IL  C+A +++ ER  A+     GV+       + 
Sbjct  428   GCRTGDKRGTDTTWLVDAVGRG-AVILTGCKAEKLVLERGGARGRRCVGVVARSTNPAIT  486

Query  1030  QTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-PGENKKS  854
             +T  +++KVTV A G+L TP LL  SGL N +IG+NLHLHP   AWG+FPDT P    K+
Sbjct  487   KTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLHPTALAWGYFPDTMPDLKGKA  546

Query  853   YEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHI  674
             YEG I+++M  V  +  G  + A+++TP +        MPW SG++ K RM R+ART HI
Sbjct  547   YEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMPWLSGRDSKERMLRFARTVHI  606

Query  673   FALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLK  494
             F+L RD+GSG       V Y LD  D E+++ GL + LR+L AAGA E+G +   G  L+
Sbjct  607   FSLVRDRGSGTVHGERRVAYRLDAADREDIRDGLRRALRVLVAAGAAEVGTHRSDGQRLR  666

Query  493   VKDASREEFERFVKE----ESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWE  326
              +  + E  E F+         QS  +   L  SAH MGSCRMG       V+ +GE+WE
Sbjct  667   CEGLTEEALEEFLDGVTVVRGPQSRSETWGLFCSAHHMGSCRMGATAGDGAVDARGESWE  726

Query  325   VEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
              E L+V DGSVLPTA+GVNPM+TI SV+YC++  + + L
Sbjct  727   AERLYVCDGSVLPTAVGVNPMITIQSVAYCLANGIADSL  765



>ref|XP_007035186.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 ref|XP_007035187.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
Length=657

 Score =   491 bits (1264),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 276/593 (47%), Positives = 380/593 (64%), Gaps = 32/593 (5%)
 Frame = -3

Query  1942  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID-LNLPEEH  1766
             V +  DNP+W+AIGY   +   S++  K++              PL KG+I+ ++  +  
Sbjct  81    VGENNDNPAWEAIGYQVDNVENSKQVSKER--------------PLQKGMIETMHEKDST  126

Query  1765  VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYY  1586
             +   LT+ G  V +       + I+CDAV+VGSGCGGGV + +LA++G KV+VLEKG+Y+
Sbjct  127   LLQSLTQKGLQVTEDTERN-VYKIKCDAVIVGSGCGGGVAAAILASSGLKVVVLEKGSYF  185

Query  1585  ARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREW  1406
             A ++ S  EGPSMD+++  GG+L + D  M++LAGSTVGGGSA+NWSASIKTP  +L+EW
Sbjct  186   APSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASIKTPKSILQEW  245

Query  1405  CEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAP  1226
              E   L LFGS  Y  AMD VC ++GV   C++E FQN +LRKGC+ LG  V N+P+N+ 
Sbjct  246   AEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGLEVENVPRNSS  305

Query  1225  SDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN--------KA  1070
               HYCG C FGC+ G KKGT  TWLVD V +G   IL  C+A + I E+N        K 
Sbjct  306   ESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNG-AVILTGCKAEKFILEKNKICSKRKLKC  364

Query  1069  KGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWG  890
              GV+       + +   I++KVT+ A GAL TP L+ +SGLKN+NIGRNLHLHPV+ AWG
Sbjct  365   LGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNLHLHPVLMAWG  424

Query  889   HFPDTPGENK-KSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEF  713
             +FPD+  E K K YEG I++++  VV   N     A+I+TP+L P  ++AL PW SG + 
Sbjct  425   YFPDSDSEFKGKVYEGGIITSVHKVVAADNKV--RAIIETPSLGPAQYAALCPWESGLDM  482

Query  712   KMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAE  533
             K RM  ++RTAH+  + RD+GSG+  +   VTY  D  D +N+Q GL + LRIL AAGA 
Sbjct  483   KRRMLNFSRTAHMITIIRDQGSGKVHAGGRVTYKFDALDRQNMQSGLRQALRILVAAGAV  542

Query  532   EIGCNHGTGLTLKVKDASREEFERFVKEESSQSLRKHPNLK----ASAHQMGSCRMGVDP  365
             E+G +   G +++ K  S +E E F++  S       P  K     SAHQMGSCRMG++ 
Sbjct  543   EVGTHRSDGQSIRCKGISNKELEEFLESVSPVEGPMFPAEKWVTHTSAHQMGSCRMGINE  602

Query  364   KASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLK  206
             K   V+  GE+WE EGLFV D SVLP A+GVNPM+T+ S +YC+S+ + E L+
Sbjct  603   KEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTAYCLSKRIAESLR  655



>ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
Length=738

 Score =   492 bits (1267),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 306/738 (41%), Positives = 443/738 (60%), Gaps = 44/738 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAINEALPETTDASVTNFFQTSAASTGTPHQVAWVINQRMKH-  2180
             LS SQM  ++++C+T  P++      + +  +++F+  S +    P + A  +    K  
Sbjct  22    LSTSQMHVMASICDTLFPSLPLNKHISQNQILSSFYSASGSHFPFPDEAAESLMLFKKSI  81

Query  2179  PKln-slllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQ  2003
             PK    +  +L  LS R+GTLLLCG   L  ++PF+L+F EIS +KRE+I+++W+     
Sbjct  82    PKAMPLVRWILLILSFRLGTLLLCGTLCLHWKWPFVLKFTEISLEKREKILNNWSREKFW  141

Query  2002  F-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddie  1826
               +R  F  +K +     F+ VD  G NP WKAIGY      +  ++K ++         
Sbjct  142   IPLRVVFVLIKLVFFFTLFSRVDVNGHNPMWKAIGY-----KVDTREKLKQKKR------  190

Query  1825  ELLFGPLYKGIIDLNLPEEH-VFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggv  1649
                  PL +G+I+     +  +   LT+ G  V +       + I+CD  +VGSG GGGV
Sbjct  191   -----PLQEGLIETTYESDSTLIQSLTEKGLEVTEDVDHNL-YKIKCDVAIVGSGSGGGV  244

Query  1648  isgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVG  1469
              + +LA +G+KV+VLEKG Y+   + S LE  SM +++  GG++ T D   ++LAGSTVG
Sbjct  245   AAAILANSGHKVIVLEKGEYFVSHDYSSLESSSMKELYESGGMMPTVDGKTMILAGSTVG  304

Query  1468  GGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNM  1289
             GGS++NW+A ++TP  V +EW + + L LF +  Y+ AMD+VC ++GV  +C  ESFQN 
Sbjct  305   GGSSINWAACVRTPDSVTKEWSKKYKLSLFATSDYRSAMDSVCRRIGVTEKCNKESFQNQ  364

Query  1288  VLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPE  1109
             VLRKGC  +G  V ++  N+  DHYCG C FGC+ G KKGT  TWLVD V +G   I+  
Sbjct  365   VLRKGCEGIGLKVESVAVNSSEDHYCGSCCFGCRTGDKKGTDSTWLVDAVNNG-AVIITG  423

Query  1108  CEALQVIHE--------RNKAKGVMFTF-QRDGVKQTAVIKSKVTVIAGGALTTPSLLIN  956
             C A + I E        R    GV+     +  + +   I+SKVT+ + G+L TP L+I+
Sbjct  424   CNAEKFILENGKNGTIKRKNCSGVIAAASNKSKITKKLQIESKVTISSCGSLFTPPLMIS  483

Query  955   SGLKNKNIGRNLHLHPVVFAWGHFPDT----PGENKKSYEGAIMSAMSTVVLNVNGTGYG  788
             SGL+N NIGRNLHLHPV FAWG+FP+      G N   YEG I++++   +L  N T   
Sbjct  484   SGLQNSNIGRNLHLHPVQFAWGYFPEEMTNLIGNN---YEGGIITSIHK-ILAENSTP-K  538

Query  787   AVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDL  608
              +I+ PAL PG FSAL+PW SG + K R+ +YARTA++FAL RDKGSGE  +   V+Y L
Sbjct  539   IIIEAPALGPGSFSALIPWTSGLDMKERLVKYARTANLFALVRDKGSGEIKTEGRVSYRL  598

Query  607   DKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES----S  440
             DK D+ENL+ GL + LRIL AAGA E+G     G  +K +    ++ E F+   +     
Sbjct  599   DKIDKENLRVGLRQSLRILVAAGAVEVGTYRSDGQRIKCRGIKDKDLEEFLDNVAVVGGP  658

Query  439   QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMV  260
             +S  +   + +SAHQMGSCRMG + +   V+  GE+WE +GLFV DGSVLP+A+GVNPM+
Sbjct  659   RSRGEVWTVFSSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMI  718

Query  259   TIMSVSYCISQSVLEFLK  206
             TI S +YCI+  + E LK
Sbjct  719   TIQSTAYCIASKIAESLK  736



>ref|XP_004982882.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X1 [Setaria 
italica]
Length=762

 Score =   493 bits (1269),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 302/752 (40%), Positives = 423/752 (56%), Gaps = 58/752 (8%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI---------NEALPETTDASVTNFFQTSAASTGTPHQ  2213
             T  L P QME L A+C   +P++         +      +   V  F+  SAA    P +
Sbjct  30    THGLRPPQMEALRAMCGALIPSLPVVEGHHGGDADHGRGSKDVVERFYLASAADGTIPDE  89

Query  2212  VAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERI  2033
             VA ++  R     +  + ++LW LSTR+GTL LCG+  +S +FP++ +F ++  ++RE  
Sbjct  90    VAELVT-RCVWEAVVLVNVVLWILSTRVGTLALCGRLCMSGKFPYVRKFADMPVERREEA  148

Query  2032  VHSWATSSLQF-IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkq  1856
             +  W  +   F ++  F  +K L    F+T V++  DNP WKAIGY  PD     +    
Sbjct  149   LGRWNKARWLFPLKITFVVIKVLSHYAFYTMVNENSDNPCWKAIGYSVPDMEEPREAPSP  208

Query  1855  khhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAv  1679
             +               L  G+++   L +  +   L   G  V           ++CD V
Sbjct  209   RS--------------LDNGVVETKALNDTTLLRSLVDKGLVVRTDA--STYHTVQCDVV  252

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             +VGSGCGGGV +  LA+AG+KV+V+EKG Y+   + S +EGPSM++++  GG+  T ++ 
Sbjct  253   IVGSGCGGGVAAAALASAGHKVVVVEKGEYFTAEDYSSVEGPSMERLYEKGGIFCTSNVT  312

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
              VL  GS VGGGSAVNWSASI+TP  V +EW   HGL +F S  Y +AMD VC ++ V  
Sbjct  313   TVLFTGSMVGGGSAVNWSASIRTPEEVRQEWAREHGLPVFASPGYVEAMDAVCARLAVTD  372

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
              C +E FQN  +R+GC  LG     +P+N+   H+CG C  GC  G K+GT  TWLVD V
Sbjct  373   GCREEGFQNKAVRRGCEALGLRADAVPRNSSEGHFCGSCHLGCPTGDKRGTDTTWLVDSV  432

Query  1138  KSGNGAILPECEALQVIHERN---------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
               G   IL  C+A   I E N         K  G++ T    GV +   I++KV++ A G
Sbjct  433   ARG-AVILTGCKAECFILESNSGENARRSRKCVGLVATCMVAGVTKKLRIEAKVSIAACG  491

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT-------PGENKKSYEGAIMSAM  827
             AL TP LL NSGLKN++IGRNLHLHPV  AWG+FP+        P    K YEG I++ M
Sbjct  492   ALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPENKQQEPQPPPLTGKCYEGGIITTM  551

Query  826   STVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGS  647
               V           +++TPAL PG F++++PW SG++ K RM RYARTAH FAL RD+G+
Sbjct  552   HRVTERT-------IVETPALGPGCFASMVPWESGRDMKDRMRRYARTAHAFALVRDRGA  604

Query  646   GEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASR-EE  470
             G       V Y   + D + L+ GL + LRIL AAGA E+G +   G  L+     R +E
Sbjct  605   GTVDGEGRVCYSPARDDVDELRNGLRRALRILVAAGAAEVGTHRSDGHRLRCDGGVRDDE  664

Query  469   FERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVG  305
              + F+ E +  +    P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL+V 
Sbjct  665   LDAFLDEVTVATGPMLPGSDKWALLCSAHQMGSCRMGSSPRDGAVDGRGESWEAEGLYVC  724

Query  304   DGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             DGS+LPTA+GVNPM+TI S +YC+S+ + E L
Sbjct  725   DGSLLPTAVGVNPMITIQSTAYCLSEGIAESL  756



>gb|EEC67160.1| hypothetical protein OsI_34014 [Oryza sativa Indica Group]
Length=710

 Score =   490 bits (1262),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 296/742 (40%), Positives = 415/742 (56%), Gaps = 85/742 (11%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI------NEALPETTDASVTNFFQTSAASTGTPHQVAWVIN  2195
             + P+QME L A+C   +P++       E      D  +  F+  SAA +  P +VA ++ 
Sbjct  21    MHPAQMEALRAMCGALIPSLPVDADGGEGGRRPGDKDLERFYLASAADSSIPDEVAELLV  80

Query  2194  QRMKHPKlnslllllwfLSTRIGTLLLCGKGSLST----QFPFL--LRFPEISQKKRERI  2033
              R     +    ++LW LSTR GTLLLCG+ S++      FPF+   RF ++   +RE  
Sbjct  81    TRCIWEAVALTWVVLWALSTRAGTLLLCGRDSVAAVDGGGFPFVSVRRFADMPAARREAA  140

Query  2032  VHSWATSSLQF--IRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkk  1859
             +  W+ +   F  +R  F   K L   VF++ V++  +NP WKAIGY   +P     +  
Sbjct  141   LRRWSGARWLFFPLRIAFAIAKILCHYVFYSMVNENSENPYWKAIGYRVEEPRRDRAESM  200

Query  1858  qkhhdheddieELLFGPLYKGIIDLN-LPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDA  1682
                         L       G+++   L +  +   L   G SV +P        + CDA
Sbjct  201   PSPSPSPASRRPL-----DNGVVETRALTDTTLLRSLAAKGLSV-RPGASDEHHTVRCDA  254

Query  1681  vvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDL  1502
             V+VGSGCGGGV + VLA+AGYKV+V+EKG+Y+ + + S +EGPSM+++F  GG+  T ++
Sbjct  255   VIVGSGCGGGVAAAVLASAGYKVVVVEKGDYFTKEDYSSIEGPSMERLFERGGVFCTSNV  314

Query  1501  DMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQ  1322
               ++  G+TVGGGSAVNWSASI+TP  V++EW   HGL +F S  Y +AMD VC ++GV 
Sbjct  315   TTMIFTGATVGGGSAVNWSASIRTPAGVMQEWSREHGLAVFASPGYARAMDAVCERLGVT  374

Query  1321  RECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDL  1142
               C +E FQN V+R+GC  LG     +P+N+   H+CG C FGC  G KKGT  TWLVD 
Sbjct  375   DACREEGFQNKVVRRGCDGLGLRADAVPRNSSEGHFCGSCNFGCPTGDKKGTDTTWLVDA  434

Query  1141  VKSGNGAILPECEALQVIHERN--------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGG  986
             V+ G   IL  C+A   I E N        +  G++ T   +G+ +   +++KV++ A G
Sbjct  435   VERG-AVILTGCKAEHFIVESNGGGGGRSKRCVGLVATCMSNGITKKLRVEAKVSISASG  493

Query  985   ALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDT---PGENKKSYEGAIMSAMSTVV  815
             AL TP LL NSGLKN++IGRNLHLHPV  AWG+FPD    P    K YEG I+++M  V 
Sbjct  494   ALMTPPLLRNSGLKNRHIGRNLHLHPVSMAWGYFPDNTPEPHIPGKCYEGGIITSMHRVT  553

Query  814   LNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAF  635
                       +I+TPAL PG F+AL+PW SG++ K RM RYARTAH FAL RD+G+G   
Sbjct  554   ERT-------IIETPALGPGAFAALVPWESGRDMKERMRRYARTAHAFALVRDRGAGSVD  606

Query  634   SPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFV  455
                 V Y   + D E L+ GL + LRIL AAGA E+G                       
Sbjct  607   GEGRVRYAPSRDDAEELRAGLRRALRILVAAGAAEMG-----------------------  643

Query  454   KEESSQSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
                                   SCRMG  P+   V+  GE+WE EGL+V DGS+LPTA+G
Sbjct  644   ----------------------SCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVG  681

Query  274   VNPMVTIMSVSYCISQSVLEFL  209
             VNPM+TI S++YC+++ + + +
Sbjct  682   VNPMITIQSIAYCVAKGIADSM  703



>ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain 
fatty alcohol oxidase FAO1 [Medicago truncatula]
Length=606

 Score =   486 bits (1250),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 280/607 (46%), Positives = 380/607 (63%), Gaps = 35/607 (6%)
 Frame = -3

Query  1966  VLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIID  1787
             +   F  +VD+ GDNP+WKAIGY      +S   +K  +   +         PL KGII+
Sbjct  10    IYYFFNLAVDENGDNPAWKAIGY-----EVSTADEKMINDTKKR--------PLEKGIIE  56

Query  1786  LNLPEEHVFNR-LTKLGCSVAKPKPPGPSFVIECDAvvvgsgcgggvisgVLATAGYKVL  1610
             +    +    + L+  G +V           I+CDAVVVGSGCGGGV + VL+ AGYKV+
Sbjct  57    IMHEHDTTLQQSLSNKGLNVT-LDSKNNILKIKCDAVVVGSGCGGGVAASVLSKAGYKVV  115

Query  1609  VLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKT  1430
             VLEKGNY+   + S LEGPSMD+ +  GG+L + D  +VL AGSTVGGGSAVNWSA I+T
Sbjct  116   VLEKGNYFVPKDYSSLEGPSMDQQYEKGGMLASVDSRIVLFAGSTVGGGSAVNWSACIRT  175

Query  1429  PPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPV  1250
             P  VL+EW + H L LF +  Y  AM+TVC ++GV   C  E FQN VLRKGC+ LG  V
Sbjct  176   PQNVLKEWSDEHKLPLFETLEYLSAMETVCERIGVNENCTQEGFQNQVLRKGCQNLGLKV  235

Query  1249  VNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVIHERN--  1076
               +P+N+P +HYCG C +GC  G K+GT  TWLVD V  G   I+  C+A + + + N  
Sbjct  236   DYVPRNSPGNHYCGSCGYGCPKGEKQGTQATWLVDAVDKG-AVIITGCKAERFLFDNNYK  294

Query  1075  --------KAKGVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNL  920
                     K  GV+       V     I++KVT+ AGGA+ TP LLI+SGLKNKNIGRNL
Sbjct  295   NANTRKKKKCLGVLAKTLNSRVTMKLQIEAKVTISAGGAILTPPLLISSGLKNKNIGRNL  354

Query  919   HLHPVVFAWGHFPDTPGENK-KSYEGAIMSAMSTVVLNVNG---TGYGAVIQTPALHPGL  752
             HLHPV+  WG+FP++  + K K YEG I++++  V  ++N    +   A+I+TP L P  
Sbjct  355   HLHPVLMTWGYFPESKSDLKGKIYEGGIITSVHKVSSSLNDHSISDTRAIIETPLLGPSS  414

Query  751   FSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYDLDKTDEENLQRGL  572
             F+++ PW SG +FK RM +Y RTAH+  + RDK SG+  +   ++Y L+  D EN++ GL
Sbjct  415   FASIYPWESGLDFKQRMLKYPRTAHLITIIRDKASGQVKTEGRISYKLNSIDRENMRAGL  474

Query  571   EKLLRILAAAGAEEIGCNHGTGLTLKVKDASRE-EFERFVKE----ESSQSLRKHPNLKA  407
             ++ LRIL AAGA E+G +   G  +K  + + E E E F+      E +    ++ NL  
Sbjct  475   QQGLRILIAAGAVEVGTHRSDGQRIKCNENTGEKEIEEFIDSVYPMEGALWPGENWNLYT  534

Query  406   SAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQ  227
             SAHQMGSCRMGV+ K   V+  GE+WE EGLFV D SVLPTA+GVNPM+TI S ++CIS 
Sbjct  535   SAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAFCISN  594

Query  226   SVLEFLK  206
              +++FL+
Sbjct  595   RIVDFLR  601



>emb|CDY18199.1| BnaC05g02220D [Brassica napus]
Length=752

 Score =   490 bits (1262),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 294/743 (40%), Positives = 426/743 (57%), Gaps = 48/743 (6%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAI-------NEALPETTDASVTNFFQTSAASTGTPHQVAWVI  2198
              S S ++ LSA+C   +P +       +  L    + ++ +FF++S +    P +VA V+
Sbjct  28    FSQSDLQALSAICEAIMPPVPLLSLDLDMKLKVLRNDALLSFFKSSGSHV-RPDEVAEVM  86

Query  2197  NQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ--FPFLLRFPEISQKKRERIVHS  2024
               +     +  + ++L  L+ R+GTLLLCG   L  +     LL+F +IS +KRE+++  
Sbjct  87    ATKAMPVTVTVVRIVLRLLTFRLGTLLLCGFVCLDKKNWSSLLLKFSDISLEKREKVLQK  146

Query  2023  WATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkq  1856
             W         R  F  +KA+ L  +FT  ++  +NP+W AIGY    G +     KQ+  
Sbjct  147   WNKQWYNPLARIAFMMIKAIFLFYYFTWTNENTENPAWDAIGYKVDIGENEDTEHKQR--  204

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvv  1676
                            PL KGII+    +E    +L        K      +F IECDAVV
Sbjct  205   ---------------PLEKGIIETAKEDEATIKQLMISKGLKLKEDKESNTFKIECDAVV  249

Query  1675  vgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDM  1496
             +GSGCGGGV +  LA +G KV+V+EKGNY+   + S LEGPSM +MF   GLL+T D   
Sbjct  250   IGSGCGGGVAAANLAKSGLKVIVVEKGNYFVPQDYSTLEGPSMFEMFEANGLLVTHDGRF  309

Query  1495  VLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRE  1316
               +AG+T+GGGS VNW+AS+KTP  ++ EW    G+  F  + Y  AM++VC ++GV   
Sbjct  310   RFMAGATLGGGSVVNWAASLKTPDAIIEEWSVDKGIATFAREGYTAAMESVCKRIGVTER  369

Query  1315  CEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVK  1136
                E FQN +LRKGC +LG  V  +P+N+  +HYCG C+FGCK G K+GT  TWLVD V 
Sbjct  370   VIREGFQNQILRKGCEKLGLDVTVVPRNSSEEHYCGSCSFGCKTGDKRGTNITWLVDAVD  429

Query  1135  SGNGAILPECEALQVI--------HERNKAKGVMFTFQRDGVKQTAVIKSKVTVIAGGAL  980
             + +  IL +C A ++I         ++ +  GV  +     + +   I +KVTV+A G+L
Sbjct  430   N-SAVILTQCRAEKLILADTETGRRKKKRCLGVTASISNKTINKIE-INAKVTVVACGSL  487

Query  979   TTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTVVLNVN  803
              TP LL +SGLKN NIGR LH+HP++ AWG+FP+     N  ++EG IM+++   V  ++
Sbjct  488   MTPRLLSSSGLKNHNIGRGLHIHPILMAWGYFPEKNSSFNGAAHEGEIMTSLH-YVFEID  546

Query  802   GTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTS  623
              T     ++TPAL PG F+AL+PW SG++ K R+++YART+HIF + RD+          
Sbjct  547   STTPNITLETPALGPGTFAALVPWVSGKDMKERLAKYARTSHIFVMVRDE-GVGEVKGGV  605

Query  622   VTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEES  443
             V Y L K DEENL  GL + LRIL AAGAEE+G     G  L+      E+ E+F++   
Sbjct  606   VKYKLTKADEENLTTGLRRALRILVAAGAEEVGTYRSDGQRLRCDGVEEEDLEKFLETVD  665

Query  442   SQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALG  275
             +     S+ +      +AHQMG CRMG   +   V+  GE+WE EGL+V D SV+PTALG
Sbjct  666   APPGVVSMSRWWTHSFTAHQMGCCRMGATEEEGAVDGYGESWEAEGLYVCDASVMPTALG  725

Query  274   VNPMVTIMSVSYCISQSVLEFLK  206
             VNPM+T  S +YCIS+ +   +K
Sbjct  726   VNPMITTQSTAYCISKRLAALMK  748



>dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=759

 Score =   489 bits (1259),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 302/739 (41%), Positives = 424/739 (57%), Gaps = 33/739 (4%)
 Frame = -3

Query  2365  TKTLSPSQMETLSALCNTFLPAI-----NEALPETTDASVTNFFQTSAASTGTPHQVAWV  2201
             T   S +QM  L+A+C   +P++     + A+ +   A V  F   SAA    P +VA +
Sbjct  27    THGFSATQMMALTAVCGALVPSLPPDGHHLAMADNGKA-VREFLLASAADPPVPDEVAQL  85

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSW  2021
             ++       L  +  +LW L TR+GTL LCG   LS   PF+ RF E+   +RE  +  W
Sbjct  86    MSAMCLREALALVRTVLWLLGTRLGTLALCGARCLSWSSPFVHRFAEMPVDRREDALRRW  145

Query  2020  ATSSL-QFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSISekqkkqkhhd  1844
             +  ++   +R FF  +K   L VF++  DD  +NP W+AIGY  P    +E++++     
Sbjct  146   SRETMIPPLRLFFLLVKVYCLYVFYSWTDDNSENPHWQAIGYSPPTDEAAEQEEQASIKR  205

Query  1843  heddieELLFGPLYKGIID-LNLPEEHVFNRLTKLGCSVAKPKPPGPSFVIECDAvvvgs  1667
                        PL  G+++ ++  +  +   L + G +V +         IECD V+VGS
Sbjct  206   -----------PLEDGVVETIHQTDASLPTSLAEKGLAVTEDAARNVCR-IECDVVIVGS  253

Query  1666  gcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLL  1487
             GCGGGV + VLA AG+KV+V+EKGNY+   + + +EGPSM +++  GG + T     +LL
Sbjct  254   GCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTSIEGPSMSQLYEYGGFMSTLSGSGLLL  313

Query  1486  AGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECED  1307
             AGSTVGGGSAVNWSA IKTP  V +EW   HGL LF    Y  AMD V  ++GV   C++
Sbjct  314   AGSTVGGGSAVNWSACIKTPDSVRKEWAAAHGLPLFDKSEYTAAMDVVFKRLGVTSGCKE  373

Query  1306  ESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGN  1127
             E  QN VLRKGC +LGY V  + +N+   H+CG C +GC+ G K+GT  TWLVD V  G 
Sbjct  374   EGRQNKVLRKGCEKLGYNVEPVSRNSSEGHFCGSCGYGCRTGDKRGTDTTWLVDAVSRG-  432

Query  1126  GAILPECEALQVIHERNKAK------GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSL  965
               IL   +A +++      K      GV+       + +   +++KVTV AGG+L TP L
Sbjct  433   AVILTGSKAEKLLFTDAAGKRGKRCAGVVAASSNPAITRKLEVRAKVTVAAGGSLLTPVL  492

Query  964   LINSGLKNKNIGRNLHLHPVVFAWGHFP--DTPGENKKSYEGAIMSAMSTVVLNVNGTGY  791
             L  SGLKN +IG+NLHLHP+  AWG+FP    P    K YEG I++++  V  + +G  +
Sbjct  493   LRGSGLKNPHIGKNLHLHPIAMAWGYFPPDKMPELKGKMYEGGIITSLHKVEADGDGLPH  552

Query  790   GAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEAFSPTSVTYD  611
              A+++TP + P       PW SG++ K RM  Y RT HIF+L RD GSG       + Y 
Sbjct  553   RAILETPLMGPAAAGTQFPWVSGRDMKERMLNYGRTVHIFSLVRDHGSGTVHGERRIAYH  612

Query  610   LDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERFVKEESS---  440
             LD  D EN + GL + LRIL AAGA E+G +   G  L+ K A+ EE E F+   S    
Sbjct  613   LDPVDRENQREGLRRALRILVAAGATEVGTHRSDGQKLRCKGATDEEVEEFLDGVSGVRG  672

Query  439   -QSLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPM  263
              QS  +  +L  +AHQMGSCRM        V+ +GE+WEVE L+V DGSVLP A+GVNPM
Sbjct  673   PQSKSEKWSLCCTAHQMGSCRMAATAGDGAVDTRGESWEVERLYVCDGSVLPGAVGVNPM  732

Query  262   VTIMSVSYCISQSVLEFLK  206
             +TI SV+YC++  + E L+
Sbjct  733   ITIQSVAYCLATGIAEQLR  751



>ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
 sp|Q9ZWB9.2|FAO1_ARATH RecName: Full=Long-chain-alcohol oxidase FAO1; AltName: Full=Long-chain 
fatty alcohol oxidase 1 [Arabidopsis thaliana]
 gb|AEE27643.1| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
Length=758

 Score =   489 bits (1259),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 301/748 (40%), Positives = 438/748 (59%), Gaps = 53/748 (7%)
 Frame = -3

Query  2356  LSPSQMETLSALCNTFLPAIN-EALPET-------TDASVTNFFQTSAASTGTPHQVAWV  2201
              S S ++ LS++C+  +P +  E+L           DA ++ F  +S+ S   P +VA +
Sbjct  28    FSKSDLQALSSICDAIMPPVPLESLNLEMKLKVLRNDALLSFFKSSSSESHVRPDEVAEL  87

Query  2200  INQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQ-FPFLLRFPEISQKKRERIVHS  2024
             +  +     +  + ++L  L+ R+GTLLLCG   L  + +PFLL+F E+S +KRE+++  
Sbjct  88    LATKAIPLTVLVVRIVLRILTFRLGTLLLCGLVCLDKKHWPFLLKFSEMSLEKREKVLQR  147

Query  2023  WATSSLQ-FIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGY---CGPDPSISekqkkq  1856
             W T       R  F  +KA+ L  +FT  ++  +NP W AI Y    G +  + +K++  
Sbjct  148   WNTQWYNPLARIGFMMIKAIFLFYYFTWTNENSENPVWDAINYSVEIGENEDMEQKER--  205

Query  1855  khhdheddieELLFGPLYKGIIDLNLPEEHVF-NRLTKLGCSVAKPKPPGPSFVIECDAv  1679
                            PL +GII+    +E     R+   G  V + +    ++ IECDAV
Sbjct  206   ---------------PLDEGIIETAKEDEMTIKQRMINKGLKVTEDRERD-TYKIECDAV  249

Query  1678  vvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGLLMTKDLD  1499
             VVGSGCGGGV + +LA +G +V+V+EKGNY+A  + S LEGPSM ++F    L+MT D  
Sbjct  250   VVGSGCGGGVAAAILAKSGLRVVVIEKGNYFAPRDYSALEGPSMFELFESNSLMMTHDGR  309

Query  1498  MVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVCGKMGVQR  1319
                +AGSTVGGGS VNW+AS+KTP  ++ EW    G+ ++ S+ Y+ AM  VC ++GV  
Sbjct  310   FRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISIYSSEKYKAAMGIVCKRLGVTE  369

Query  1318  ECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAETWLVDLV  1139
             +   E FQN +LRKGC +LG  V  +P+N+   HYCG C++GC  G K+GT  TWLVD V
Sbjct  370   KIIREGFQNQILRKGCEKLGLDVTIVPRNSTEKHYCGSCSYGCPTGEKRGTDSTWLVDAV  429

Query  1138  KSGNGAILPECEALQVIHERNKAK------------GVMFTFQRDGVKQTAVIKSKVTVI  995
              + N  IL +C+A ++I   N A             GV  +      K+   I +KVT++
Sbjct  430   -NNNAVILTQCKAEKLILADNDANKREESGRRKRCLGVAASLSHQTRKKLQ-INAKVTIV  487

Query  994   AGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGE-NKKSYEGAIMSAMSTV  818
             A G+L TP LL +SGLKN NI R LH+HP++ AWG+FP+   E    ++EG I++++   
Sbjct  488   ACGSLKTPGLLASSGLKNSNISRGLHIHPIMMAWGYFPEKNSELEGAAHEGEIVTSLH-Y  546

Query  817   VLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALARDKGSGEA  638
             V  ++ T     ++TPA+ PG F+AL PW SG + K RM++YARTAHIFA+ RD+G GE 
Sbjct  547   VHPMDSTTPNITLETPAIGPGTFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEV  606

Query  637   FSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDASREEFERF  458
                  V Y L K DEENL  GL++ LRIL AAGA E+G     G  +K     +++ E F
Sbjct  607   KGDI-VKYRLTKADEENLTIGLKQALRILVAAGAAEVGTYRSDGQRMKCDGIKQKDLEAF  665

Query  457   VKEESSQ----SLRKHPNLKASAHQMGSCRMGVDPKASVVNPKGETWEVEGLFVGDGSVL  290
             +   ++     S+ KH     +AHQ+G CRMG   K   ++ KGE+WE E L+V D SVL
Sbjct  666   LDTVNAPPGVVSMSKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVL  725

Query  289   PTALGVNPMVTIMSVSYCISQSVLEFLK  206
             PTALGVNPM+T+ S +YCIS  + E +K
Sbjct  726   PTALGVNPMITVQSTAYCISNRIAELMK  753



>ref|XP_002981110.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
 gb|EFJ17811.1| hypothetical protein SELMODRAFT_114089, partial [Selaginella 
moellendorffii]
Length=656

 Score =   484 bits (1247),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 269/658 (41%), Positives = 395/658 (60%), Gaps = 22/658 (3%)
 Frame = -3

Query  2122  LLLCGKGSLSTQFPFLLRFPEISQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTS  1943
             LLLCG  S    +P+  +F E+  ++RE++++ WA S     R  F   K  +L   ++ 
Sbjct  1     LLLCGAESTDKAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTVYSK  60

Query  1942  VDDKGDNPSWKAIGYCGPDPSISekqkkqkhhdheddieELLFGPLYKGIIDLNLPEEHV  1763
             VD KG NP+W+AIGY GPDP+  +     K    +  + ++   P  +G+  L      +
Sbjct  61    VDAKGYNPTWEAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRGV--LKHTGYTL  118

Query  1762  FNRLTKLGCSV--AKPKPPGPSFV-IECDAvvvgsgcgggvisgVLATAGYKVLVLEKGN  1592
              + ++ L  ++  +     G   + I+CD ++VG+G GG V + VL+TAG KVL+LEKG 
Sbjct  119   LDDISHLKPALLPSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGR  178

Query  1591  YYARTNLSLLEGPSMDKMFLGGGLLMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLR  1412
             Y+AR +LSLLE P+  +++  GG L T D+   L++ + VGGG+ +NW+AS +TPP+V +
Sbjct  179   YFAREDLSLLEQPTFSELYEEGGFLATDDVAYSLMSAAVVGGGTCINWAASFQTPPHVRQ  238

Query  1411  EWCEVHGLELFGSDVYQKAMDTVCGKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQN  1232
             EW E  GL +F S+ YQ+A+D +C K+GVQ     ESFQN VLRKGC ELG    NIP+N
Sbjct  239   EWAEECGLPMFTSEKYQQALDLICKKIGVQPNATVESFQNAVLRKGCVELGLHSANIPRN  298

Query  1231  APSDHYCGWCTFGCKDGRKKGTAETWLVDLVKSGNGAILPECEALQVI-----HERNKAK  1067
             A  +HYCG C  GC+ G K+ T ETWLV+   +G   IL   + LQV+      +  KA 
Sbjct  299   ASPEHYCGCCNMGCRRGMKQATTETWLVEAAAAG-ATILTGTKGLQVLFTDGTKKEKKAI  357

Query  1066  GVMFTFQRDGVKQTAVIKSKVTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGH  887
             GV+ T   D  K+  +I++K T+++ G++ TP LLI SGL N NIG++ H+HPV+  WG+
Sbjct  358   GVLATTLGDQPKKL-IIEAKATIVSTGSIMTPPLLIRSGLTNPNIGKHFHIHPVLGVWGY  416

Query  886   FPDTPGENKKSYEGAIMSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKM  707
             FPD       S+EG IM+A S V    +  GYG V+ TP+ HPG +++++ W SG + K 
Sbjct  417   FPDEEKNPGASFEGGIMTAFSAVSARWDTVGYGPVLMTPSFHPGQYASVVTWKSGAQHKE  476

Query  706   RMSRYARTAHIFALARDKGSG-----EAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAA  542
              M R+ R + +    RDKG+G     +     ++ Y LD  DEE    G EK LR+L AA
Sbjct  477   AMRRFRRVSQVVLFTRDKGAGSIGVDKKTDEITIEYTLDPYDEEVCLEGAEKGLRVLKAA  536

Query  541   GAEEIGCNH--GTGLTLKVKDASREE---FERFVKEESSQSLRKHPNLKASAHQMGSCRM  377
             GA E+G +H      T     + +EE   FE ++    S+ L+ +     S H +GSCRM
Sbjct  537   GAVEVGTHHHDAESFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLPMVSYHLLGSCRM  596

Query  376   GVDPKASVVNPKGETWEVEGLFVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFLKT  203
             G  P+ SV++ KGETW+ EGLF+ D SV PT  G+NPMVTI S++YC +Q+V+E +K+
Sbjct  597   GSSPENSVIDAKGETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCTAQNVVEHVKS  654



>ref|XP_004982885.1| PREDICTED: long-chain-alcohol oxidase FAO1-like isoform X2 [Setaria 
italica]
Length=729

 Score =   487 bits (1253),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 300/755 (40%), Positives = 419/755 (55%), Gaps = 77/755 (10%)
 Frame = -3

Query  2395  LHRKMENNTATKTLSPSQMETLSALCNTFLPAINEALPETTDA-------SVTNFFQTSA  2237
             L R+ +    T  L P QME L A+C   +P++    P   D         V  F++ SA
Sbjct  19    LLRRCKRERYTHGLRPPQMEALRAMCGALIPSLPVEGPFHGDKHGGGNKDDVERFYRASA  78

Query  2236  ASTGTPHQVAWVINQRMKHPKlnslllllwfLSTRIGTLLLCGKGSLSTQFPFLLRFPEI  2057
             A    P +VA +     +   +  + ++LW LST++GT +LCG   +S++FP++ +F ++
Sbjct  79    ADGAIPDEVAEMATGCARE-AMLLVRVILWMLSTKVGTFVLCGWLCVSSRFPYVFKFADM  137

Query  2056  SQKKRERIVHSWATSSLQFIRNFFTAMKALVLLVFFTSVDDKGDNPSWKAIGYCGPDPSI  1877
               ++RE   HS                                DNPSWKAIGY  PD   
Sbjct  138   PLERREE--HS--------------------------------DNPSWKAIGYSVPDVDR  163

Query  1876  SekqkkqkhhdheddieELLFGPLYKGIIDL-NLPEEHVFNRLTKLGCSVAKPKPPGPSF  1700
              ++   +               PL  G+++  +L +  +   L   G +V K    GP  
Sbjct  164   PQEDLSEAAPSPSPR-------PLDSGVVETRSLDDAALLRSLMDKGLAV-KADVSGPHH  215

Query  1699  VIECDAvvvgsgcgggvisgVLATAGYKVLVLEKGNYYARTNLSLLEGPSMDKMFLGGGL  1520
              ++CD V+VGSGCGGGV + VLA AG+KV+V+EKG+Y+   + S +EGPSM++++  GG+
Sbjct  216   TVQCDVVIVGSGCGGGVAAAVLAAAGHKVVVVEKGDYFTAEDYSSIEGPSMERLYEKGGI  275

Query  1519  LMTKDLDMVLLAGSTVGGGSAVNWSASIKTPPYVLREWCEVHGLELFGSDVYQKAMDTVC  1340
               T +   ++  G+TVGGGSA+NWSASI+TP +V +EW   HGL +FGS  Y  AMD VC
Sbjct  276   FCTSNASTIMFTGATVGGGSAINWSASIRTPEWVTQEWAREHGLPVFGSPEYAHAMDAVC  335

Query  1339  GKMGVQRECEDESFQNMVLRKGCRELGYPVVNIPQNAPSDHYCGWCTFGCKDGRKKGTAE  1160
              ++ V   C +E FQN  LR GC  LG     +P+N    H+CG C  GC  G K+GT  
Sbjct  336   TRLAVTSGCREEGFQNKALRNGCEALGLRADAVPRNTSEGHFCGSCHLGCPTGEKRGTDT  395

Query  1159  TWLVDLVKSGNGAILPECEALQVIHERNKAK---------GVMFTFQRDGVKQTAVIKSK  1007
             TWLVD V  G   +L  C+A + + E N  K         G++     DG+ +   I++K
Sbjct  396   TWLVDAVAQG-AVVLTGCKAERFVLESNPGKNGCRSKRCVGLVAKCMGDGITRKLRIEAK  454

Query  1006  VTVIAGGALTTPSLLINSGLKNKNIGRNLHLHPVVFAWGHFPDTPGENK----KSYEGAI  839
             V++ A GAL TP LL  SGLKN++IGRNLHLHPV  AWG+FPD   E +    K YEG I
Sbjct  455   VSISACGALMTPPLLRRSGLKNRHIGRNLHLHPVSMAWGYFPDGTPEPRPLTGKCYEGGI  514

Query  838   MSAMSTVVLNVNGTGYGAVIQTPALHPGLFSALMPWNSGQEFKMRMSRYARTAHIFALAR  659
             ++ +  V           ++QTPAL PG  ++L+PW SG++ K RM RYARTAH FAL R
Sbjct  515   ITTLHRVTART-------IVQTPALGPGSMASLIPWESGRDMKERMLRYARTAHAFALVR  567

Query  658   DKGSGEAFSPTSVTYDLDKTDEENLQRGLEKLLRILAAAGAEEIGCNHGTGLTLKVKDAS  479
             D+G+G       V Y     D E L+ GL + LRIL AAGA E+G +   GL L+ +   
Sbjct  568   DRGAGTVGREGRVRYVPSSEDVEELRNGLRRALRILVAAGAAEVGTHRSDGLRLRCEGLR  627

Query  478   REEFERFVKEESSQSLRKHPN-----LKASAHQMGSCRMGVDPKASVVNPKGETWEVEGL  314
              E+ E F+ E +       P      L  SAHQMGSCRMG  P+   V+ +GE+WE EGL
Sbjct  628   DEDLEAFLNEVTVAKGPMIPGSDTWALLCSAHQMGSCRMGSRPRDGAVDGRGESWEAEGL  687

Query  313   FVGDGSVLPTALGVNPMVTIMSVSYCISQSVLEFL  209
             +V DGS+LPTA+GVNPM+TI S +Y +S+ + E L
Sbjct  688   YVCDGSLLPTAVGVNPMITIQSTAYYVSKGIAESL  722



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7644743386336