BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81641_g1_i1 len=1547 path=[1:0-1546]

Length=1547
                                                                      Score     E

ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    450   6e-151   
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...    449   1e-150   
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...    449   1e-150   
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    447   1e-149   
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                   444   1e-148   
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    436   1e-145   
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...    433   2e-144   
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19               432   5e-144   Gossypium hirsutum [American cotton]
gb|ACL36352.1|  fascilin-like arabinogalactan protein                   431   2e-143   Gossypium hirsutum [American cotton]
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg             429   6e-143   
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    429   8e-143   
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg             427   1e-142   
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...    428   1e-142   
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                   429   2e-142   
emb|CDP18905.1|  unnamed protein product                                426   2e-141   
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...    421   5e-140   
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    421   1e-139   
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...    420   3e-139   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...    419   3e-139   
gb|KDP29933.1|  hypothetical protein JCGZ_18502                         420   4e-139   
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...    418   3e-138   
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...    417   3e-138   
ref|XP_010088447.1|  hypothetical protein L484_018219                   417   6e-138   
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    416   1e-137   
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    415   1e-137   
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2                416   3e-137   
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...    414   2e-136   
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg             411   7e-136   
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...    410   1e-135   
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                    410   2e-135   
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19               407   2e-135   
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...    410   3e-135   
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    409   3e-135   
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    409   4e-135   
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    410   4e-135   
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2              407   4e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2      407   5e-134   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65777.1|  putative pollen surface protein                         406   9e-134   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g             405   2e-133   Populus trichocarpa [western balsam poplar]
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...    405   2e-133   Trifolium pratense [peavine clover]
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154             405   3e-133   
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    405   4e-133   
emb|CDY37904.1|  BnaA06g19130D                                          404   4e-133   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...    404   4e-133   
emb|CDX87001.1|  BnaC03g52710D                                          404   5e-133   
emb|CDX68507.1|  BnaC01g25850D                                          403   1e-132   
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g             403   1e-132   
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    402   2e-132   
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg                402   3e-132   
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...    402   3e-132   
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    401   6e-132   
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein             402   8e-132   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg             400   1e-131   
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    400   3e-131   
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    399   4e-131   
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...    400   5e-131   
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                     397   1e-130   
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...    398   1e-130   
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...    397   2e-129   
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    395   2e-129   
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    395   3e-129   
gb|ADP88924.1|  fasciclin-like AGP                                      394   3e-129   
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...    394   4e-129   
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    394   9e-129   
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...    391   7e-128   
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...    391   8e-128   
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    391   1e-127   
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10               390   2e-127   Gossypium hirsutum [American cotton]
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1                389   4e-127   
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...    389   5e-127   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    389   5e-127   
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    388   6e-127   
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11               389   6e-127   Gossypium hirsutum [American cotton]
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...    387   2e-126   Vitis vinifera
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...    387   3e-126   
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                       387   5e-126   
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                        387   7e-126   
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    386   8e-126   
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1           384   4e-125   
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...    383   1e-124   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g             382   3e-124   Populus trichocarpa [western balsam poplar]
emb|CAN61077.1|  hypothetical protein VITISV_012919                     381   4e-124   Vitis vinifera
gb|KDP39270.1|  hypothetical protein JCGZ_01027                         381   5e-124   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...    380   8e-124   Vitis vinifera
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...    380   1e-123   
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g             380   1e-123   Populus trichocarpa [western balsam poplar]
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    380   1e-123   
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...    379   6e-123   
ref|XP_002522745.1|  conserved hypothetical protein                     378   8e-123   Ricinus communis
ref|XP_010104070.1|  hypothetical protein L484_014256                   376   1e-122   
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    377   2e-122   
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    376   4e-122   
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...    377   3e-121   
emb|CBI28444.3|  unnamed protein product                                376   3e-121   
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g             371   5e-120   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    370   1e-119   
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...    369   3e-119   
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg             368   3e-119   
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...    368   4e-119   
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg                369   4e-119   
emb|CDP13717.1|  unnamed protein product                                367   1e-118   
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein        367   2e-118   Salicornia europaea [chicken-claws]
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...    365   6e-118   
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830          365   7e-118   
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...    365   1e-117   
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...    364   3e-117   
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                   362   1e-116   
gb|EPS66997.1|  hypothetical protein M569_07779                         362   1e-116   
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...    362   1e-116   
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg             362   7e-116   
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    357   1e-114   
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    354   1e-112   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    346   3e-110   
ref|XP_002534396.1|  conserved hypothetical protein                     342   8e-110   Ricinus communis
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                  344   2e-109   
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg                343   3e-109   
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    343   3e-109   
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    342   1e-108   
emb|CDY28643.1|  BnaC09g32320D                                          341   2e-108   
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...    341   2e-108   
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    337   3e-108   
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...    340   5e-108   
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    340   1e-107   
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...    353   9e-107   
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    337   1e-106   
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...    337   1e-106   
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1              332   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg             332   3e-104   
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659             327   7e-103   
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...    328   2e-102   
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                    325   5e-102   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    323   5e-101   
emb|CDY20747.1|  BnaA02g08870D                                          322   1e-100   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg             320   5e-100   
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...    316   8e-99    
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg                300   2e-94    
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...    288   2e-88    
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...    281   2e-85    
dbj|BAK00054.1|  predicted protein                                      281   2e-85    
ref|NP_001062666.1|  Os09g0248100                                       278   3e-84    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061532.1|  Os08g0321000                                       278   3e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...    275   4e-83    
gb|ABK24724.1|  unknown                                                 274   2e-82    Picea sitchensis
gb|ABR16637.1|  unknown                                                 273   3e-82    Picea sitchensis
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380          272   5e-82    Sorghum bicolor [broomcorn]
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    272   1e-81    
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...    271   1e-81    
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...    270   7e-81    
ref|XP_002511740.1|  conserved hypothetical protein                     270   1e-80    Ricinus communis
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    268   3e-80    
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    268   6e-80    
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                       266   7e-80    
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...    267   8e-80    
gb|ABI95418.1|  fasciclin-like protein FLA28                            266   9e-80    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg             266   1e-79    
gb|EMT28749.1|  hypothetical protein F775_29839                         265   1e-79    
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             266   1e-79    
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...    266   2e-79    
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    266   2e-79    
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         266   2e-79    
gb|ABR16344.1|  unknown                                                 265   2e-79    Picea sitchensis
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              266   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|AAM66074.1|  endosperm-specific protein-like protein                 266   2e-79    Arabidopsis thaliana [mouse-ear cress]
gb|EAZ42295.1|  hypothetical protein OsJ_26868                          265   3e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g             265   6e-79    
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             265   8e-79    
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    264   9e-79    
dbj|BAJ90388.1|  predicted protein                                      264   1e-78    
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor     264   1e-78    Zea mays [maize]
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                    263   2e-78    
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             263   2e-78    
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    265   2e-78    
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    263   4e-78    
emb|CDY18927.1|  BnaC04g04230D                                          262   8e-78    
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    261   2e-77    Populus trichocarpa [western balsam poplar]
emb|CDX74743.1|  BnaA05g04890D                                          260   3e-77    
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    260   3e-77    
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...    260   3e-77    
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...    260   4e-77    Vitis vinifera
emb|CAN65447.1|  hypothetical protein VITISV_011425                     259   6e-77    Vitis vinifera
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein                 259   7e-77    
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    259   7e-77    
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    259   1e-76    
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...    259   1e-76    
gb|ABI95393.1|  fasciclin-like protein FLA3                             258   2e-76    Triticum aestivum [Canadian hard winter wheat]
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg             258   4e-76    
emb|CDP17792.1|  unnamed protein product                                258   7e-76    
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    255   3e-75    
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    255   4e-75    
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...    253   1e-74    
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg             253   2e-74    
ref|XP_002878353.1|  AT3g60900/T4C21_310                                250   2e-73    
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    250   3e-73    
gb|EMT07250.1|  hypothetical protein F775_26198                         249   4e-73    
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...    249   4e-73    
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    248   1e-72    
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    248   1e-72    
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                           248   2e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10             248   2e-72    Arabidopsis thaliana [mouse-ear cress]
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               247   2e-72    
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    247   3e-72    
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8           246   9e-72    
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13               246   9e-72    Gossypium hirsutum [American cotton]
ref|XP_010092859.1|  hypothetical protein L484_022454                   246   1e-71    
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...    249   1e-71    
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg                245   3e-71    
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    244   5e-71    
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    243   9e-71    
gb|AIY35292.1|  fasciclin-like arabinogalactan 12                       243   1e-70    
gb|AFK41095.1|  unknown                                                 243   1e-70    
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12               241   4e-70    Gossypium hirsutum [American cotton]
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg             240   1e-69    
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    239   5e-69    
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...    239   5e-69    
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...    238   7e-69    
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...    238   2e-68    
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790          237   2e-68    
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4       234   2e-68    
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700          236   3e-68    Sorghum bicolor [broomcorn]
emb|CDX71771.1|  BnaC08g31030D                                          236   4e-68    
emb|CDY66159.1|  BnaCnng49680D                                          236   5e-68    
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    236   7e-68    
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein             234   2e-67    
emb|CDY52341.1|  BnaA09g38900D                                          234   2e-67    
gb|ACN30673.1|  unknown                                                 234   3e-67    Zea mays [maize]
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...    234   3e-67    
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                  234   3e-67    
ref|NP_001147121.1|  rat frizzled homolog1                              234   4e-67    Zea mays [maize]
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    232   2e-66    
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...    231   2e-66    
gb|KHN11149.1|  Fasciclin-like arabinogalactan protein 1                229   3e-66    
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...    230   1e-65    
emb|CDX86346.1|  BnaA06g30630D                                          228   3e-65    
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...    228   3e-65    
gb|ABI95395.1|  fasciclin-like protein FLA5                             226   3e-64    Triticum aestivum [Canadian hard winter wheat]
emb|CDX67846.1|  BnaA07g18860D                                          226   4e-64    
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...    226   5e-64    
emb|CDY37043.1|  BnaA04g26210D                                          224   1e-63    
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...    224   1e-63    
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    224   3e-63    
dbj|BAJ88864.1|  predicted protein                                      221   8e-63    
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...    222   1e-62    
ref|NP_001053617.1|  Os04g0574200                                       221   4e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...    219   5e-62    
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...    219   1e-61    
gb|EMS60835.1|  hypothetical protein TRIUR3_26630                       214   1e-60    
gb|AAM78213.1|  putative pollen surface protein                         209   3e-60    Gossypioides kirkii
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...    214   8e-60    
gb|ACU21313.1|  unknown                                                 205   5e-59    Glycine max [soybeans]
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330          211   9e-59    Sorghum bicolor [broomcorn]
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein          210   2e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...    211   2e-58    
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...    207   2e-57    
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030          208   3e-57    Sorghum bicolor [broomcorn]
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10         206   1e-56    
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...    205   2e-56    Zea mays [maize]
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...    205   3e-56    
gb|EAZ25443.1|  hypothetical protein OsJ_09260                          199   1e-54    Oryza sativa Japonica Group [Japonica rice]
gb|AAM78211.1|  putative pollen surface protein                         194   1e-54    Gossypium barbadense [Egyptian cotton]
gb|AAM78209.1|  putative pollen surface protein                         194   1e-54    Gossypium herbaceum [Arabian cotton]
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...    199   1e-53    
gb|AAM78210.1|  putative pollen surface protein                         191   2e-53    Gossypium raimondii
ref|NP_001131728.1|  endosperm specific protein precursor               198   3e-53    Zea mays [maize]
ref|NP_001105408.1|  endosperm specific protein1 precursor              196   3e-53    Zea mays [maize]
gb|AAM78212.1|  putative pollen surface protein                         190   5e-53    Gossypium barbadense [Egyptian cotton]
ref|XP_010229273.1|  PREDICTED: fasciclin-like arabinogalactan pr...    193   5e-52    
gb|AAG24276.1|AF195889_1  fasciclin-like arabinogalactan protein ...    190   8e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009629435.1|  PREDICTED: fasciclin-like arabinogalactan pr...    188   1e-51    
ref|XP_010313936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    187   2e-51    
gb|ABI95391.1|  fasciclin-like protein FLA1                             189   1e-50    Triticum aestivum [Canadian hard winter wheat]
gb|EMT18770.1|  hypothetical protein F775_29041                         187   3e-50    
ref|XP_009771026.1|  PREDICTED: fasciclin-like arabinogalactan pr...    184   5e-50    
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...    184   1e-49    
gb|KHN43978.1|  Fasciclin-like arabinogalactan protein 2                179   4e-49    
ref|XP_010446130.1|  PREDICTED: fasciclin-like arabinogalactan pr...    180   1e-48    
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1                175   4e-48    
dbj|BAJ90216.1|  predicted protein                                      182   5e-48    
ref|XP_010279320.1|  PREDICTED: fasciclin-like arabinogalactan pr...    173   3e-47    
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500          180   1e-46    Sorghum bicolor [broomcorn]
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10     169   2e-45    
emb|CBI39739.3|  unnamed protein product                                175   2e-45    
ref|XP_009616570.1|  PREDICTED: fasciclin-like arabinogalactan pr...    166   9e-45    
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10     167   9e-45    
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10     166   1e-44    
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10     166   2e-44    
gb|ABI95392.1|  fasciclin-like protein FLA2                             171   5e-44    
gb|EMS64953.1|  hypothetical protein TRIUR3_19371                       169   6e-44    
ref|XP_009414021.1|  PREDICTED: fasciclin-like arabinogalactan pr...    165   4e-43    
emb|CDY36762.1|  BnaA03g11240D                                          160   2e-42    
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   3e-40    
gb|KGN56023.1|  hypothetical protein Csa_3G047840                       154   2e-39    
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...    155   2e-39    
ref|NP_001169235.1|  uncharacterized protein LOC100383093 precursor     157   2e-39    
ref|XP_006576093.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   3e-39    
ref|NP_001151124.1|  fasciclin-like arabinogalactan protein 10 pr...    153   8e-39    
gb|AFW65138.1|  fasciclin-like arabinogalactan protein 10               153   8e-39    
ref|XP_004973769.1|  PREDICTED: fasciclin-like arabinogalactan pr...    153   8e-39    
gb|ABI95394.1|  fasciclin-like protein FLA4                             152   2e-38    
ref|XP_008449190.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   2e-38    
ref|XP_006660241.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-38    
ref|NP_001063464.1|  Os09g0476800                                       151   4e-38    
dbj|BAD09671.1|  putative arabinogalactan protein                       150   6e-38    
gb|EAZ09483.1|  hypothetical protein OsI_31755                          150   1e-37    
ref|XP_004987197.1|  PREDICTED: fasciclin-like arabinogalactan pr...    152   2e-37    
ref|XP_004957112.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   9e-37    
gb|ABI95413.1|  fasciclin-like protein FLA23                            146   2e-36    
ref|XP_010232543.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   2e-36    
gb|EMT00417.1|  hypothetical protein F775_14876                         146   2e-36    
dbj|BAK07384.1|  predicted protein                                      146   3e-36    
ref|XP_006838924.1|  hypothetical protein AMTR_s00002p00270100          150   4e-36    
ref|XP_010931257.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   6e-36    
gb|ABI95423.1|  fasciclin-like protein FLA33                            145   6e-36    
ref|XP_002488894.1|  hypothetical protein SORBIDRAFT_2276s002020        147   7e-36    
gb|EAY87366.1|  hypothetical protein OsI_08770                          144   9e-36    
ref|NP_001047988.1|  Os02g0726000                                       144   9e-36    
ref|XP_002992353.1|  hypothetical protein SELMODRAFT_45227              147   1e-35    
dbj|BAK07804.1|  predicted protein                                      144   2e-35    
ref|XP_002460398.1|  hypothetical protein SORBIDRAFT_02g027510          143   4e-35    
ref|XP_002979355.1|  hypothetical protein SELMODRAFT_55277              145   4e-35    
ref|XP_009402266.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   1e-34    
ref|XP_009402265.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   1e-34    
emb|CDM84950.1|  unnamed protein product                                144   2e-34    
ref|XP_006607004.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   3e-34    
ref|NP_001132327.1|  hypothetical protein precursor                     143   3e-34    
ref|XP_002445967.1|  hypothetical protein SORBIDRAFT_07g028780          140   3e-34    
ref|XP_006644987.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   4e-34    
ref|XP_004961853.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   4e-34    
tpg|DAA61934.1|  TPA: fasciclin-like arabinogalactan protein 8          139   4e-34    
ref|XP_008649714.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   6e-34    
emb|CDY06556.1|  BnaC02g12800D                                          139   8e-34    
ref|NP_001142020.1|  hypothetical protein precursor                     139   8e-34    
ref|XP_002458743.1|  hypothetical protein SORBIDRAFT_03g039440          142   8e-34    
ref|XP_003574684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   2e-33    
ref|XP_010922339.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   2e-33    
ref|XP_003576645.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   2e-33    
ref|XP_008674840.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   2e-33    
gb|AFW82220.1|  hypothetical protein ZEAMMB73_194344                    140   3e-33    
gb|AFW77203.1|  fasciclin-like arabinogalactan protein 8                138   3e-33    
ref|XP_008776771.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   4e-33    
ref|XP_002439922.1|  hypothetical protein SORBIDRAFT_09g022560          140   6e-33    
ref|XP_008802746.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   7e-33    
ref|XP_004970532.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   8e-33    
ref|XP_004970533.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   9e-33    
ref|XP_002976460.1|  hypothetical protein SELMODRAFT_55113              139   9e-33    
ref|XP_002987261.1|  hypothetical protein SELMODRAFT_41608              137   2e-32    
dbj|BAJ87487.1|  predicted protein                                      138   2e-32    
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   2e-32    
ref|NP_001055752.1|  Os05g0459700                                       138   2e-32    
gb|EEC71769.1|  hypothetical protein OsI_04379                          138   2e-32    
ref|NP_001044764.1|  Os01g0841100                                       137   5e-32    
gb|ABI95412.1|  fasciclin-like protein FLA22                            137   7e-32    
ref|XP_006595456.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   7e-32    
ref|XP_009416691.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   8e-32    
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g             134   1e-31    
ref|XP_009384845.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   1e-31    
ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   2e-31    
ref|XP_007220745.1|  hypothetical protein PRUPE_ppa025122mg             127   3e-31    
ref|XP_009595320.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   3e-31    
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   3e-31    
ref|XP_010450108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   5e-31    
emb|CAN66163.1|  hypothetical protein VITISV_008126                     131   6e-31    
ref|XP_010040489.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   6e-31    
ref|XP_011089459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   6e-31    
ref|XP_010263713.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   7e-31    
gb|EMS55677.1|  hypothetical protein TRIUR3_04850                       131   1e-30    
gb|EEE63981.1|  hypothetical protein OsJ_18808                          136   2e-30    
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   2e-30    
emb|CDP09050.1|  unnamed protein product                                131   6e-30    
gb|ABK28554.1|  unknown                                                 127   6e-30    
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             127   7e-30    
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   1e-29    
ref|XP_011089814.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   2e-29    
ref|XP_002982122.1|  hypothetical protein SELMODRAFT_421625             130   2e-29    
dbj|BAJ87325.1|  predicted protein                                      129   2e-29    
ref|XP_009803549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-29    
ref|XP_009777822.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   3e-29    
gb|EPS65223.1|  hypothetical protein M569_09558                         126   3e-29    
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                     125   4e-29    
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190          128   4e-29    
ref|XP_004236212.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   4e-29    
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   5e-29    
gb|EEE55648.1|  hypothetical protein OsJ_04030                          128   6e-29    
emb|CAN62804.1|  hypothetical protein VITISV_011795                     127   6e-29    
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   7e-29    
gb|EYU18962.1|  hypothetical protein MIMGU_mgv1a021336mg                127   1e-28    
ref|XP_009625004.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   1e-28    
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   2e-28    
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-28    
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-28    
gb|EMT22661.1|  hypothetical protein F775_43710                         120   2e-28    
ref|XP_004241229.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   2e-28    
ref|XP_006350767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   3e-28    
ref|XP_006344402.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   7e-28    
gb|ABI95410.1|  fasciclin-like protein FLA20                            124   1e-27    
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-27    
ref|XP_002325084.2|  hypothetical protein POPTR_0018s10600g             123   2e-27    
emb|CDY42162.1|  BnaC05g40570D                                          120   3e-27    
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   4e-27    
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   5e-27    
ref|XP_002308439.2|  hypothetical protein POPTR_0006s18920g             122   7e-27    
ref|XP_011018137.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   1e-26    
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   1e-26    
gb|KHN29436.1|  Fasciclin-like arabinogalactan protein 10               117   1e-26    
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   1e-26    
gb|KDP44232.1|  hypothetical protein JCGZ_05699                         121   1e-26    
ref|XP_010043558.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   2e-26    
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   2e-26    
emb|CDY08417.1|  BnaA05g26530D                                          117   3e-26    
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   3e-26    
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   4e-26    
gb|KHN20463.1|  Fasciclin-like arabinogalactan protein 10               116   7e-26    
ref|XP_006424821.1|  hypothetical protein CICLE_v10028444mg             119   9e-26    
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg             116   9e-26    
ref|XP_006488318.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   9e-26    
gb|AAM67371.1|  unknown                                                 114   9e-26    
ref|XP_010102851.1|  hypothetical protein L484_004423                   116   1e-25    
gb|KDO72861.1|  hypothetical protein CISIN_1g044183mg                   118   1e-25    
ref|XP_010685765.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   1e-25    
ref|XP_010252126.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   2e-25    
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   2e-25    
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   2e-25    
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                     115   2e-25    
ref|XP_006488317.1|  PREDICTED: fasciclin-like arabinogalactan pr...    118   2e-25    
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   2e-25    
ref|XP_004305460.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-25    
ref|XP_009341418.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   3e-25    
ref|XP_007208574.1|  hypothetical protein PRUPE_ppa023463mg             116   3e-25    
ref|XP_002283909.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   3e-25    
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   3e-25    
ref|XP_002512774.1|  Glycoprotein X precursor, putative                 115   3e-25    
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   4e-25    
gb|ABV27480.1|  fasciclin-like arabinogalactan protein 9                117   4e-25    
emb|CAN72469.1|  hypothetical protein VITISV_006797                     117   4e-25    
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...    115   4e-25    
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625             114   4e-25    
dbj|BAF00394.1|  GPI-anchored protein                                   113   4e-25    
ref|XP_008223499.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   5e-25    
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   6e-25    
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   7e-25    
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g             114   7e-25    
gb|ABV27479.1|  fasciclin-like arabinogalactan protein 8                115   1e-24    
ref|XP_010034413.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   1e-24    
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   1e-24    
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   1e-24    
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                    112   1e-24    
ref|NP_001130104.1|  hypothetical protein precursor                     113   2e-24    
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   2e-24    
ref|NP_001062112.1|  Os08g0490600                                       110   2e-24    
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg             112   2e-24    
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3                112   2e-24    
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850          112   3e-24    
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   3e-24    
ref|XP_002527970.1|  conserved hypothetical protein                     112   3e-24    
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-24    
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   4e-24    
gb|KEH37333.1|  fasciclin-like arabinogalactan protein                  114   5e-24    
ref|XP_003566183.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   5e-24    
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   6e-24    
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   6e-24    
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   8e-24    
ref|XP_010106469.1|  hypothetical protein L484_025226                   114   9e-24    
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   9e-24    
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   9e-24    
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23    
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg             110   1e-23    
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   1e-23    
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23    
gb|AFK40899.1|  unknown                                                 109   2e-23    
gb|EMT17229.1|  hypothetical protein F775_11240                         109   2e-23    
ref|XP_004488227.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   2e-23    
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                       109   2e-23    
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   2e-23    
ref|XP_006382179.1|  putative surface family protein                    109   3e-23    
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...    109   3e-23    
emb|CDY00793.1|  BnaC03g37770D                                          108   3e-23    
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   3e-23    
ref|XP_003560811.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   3e-23    
ref|XP_006418888.1|  hypothetical protein EUTSA_v10002543mg             111   4e-23    
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   4e-23    
ref|XP_004150187.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   4e-23    
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   4e-23    
gb|KHN08266.1|  Fasciclin-like arabinogalactan protein 2                104   4e-23    
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   5e-23    
ref|XP_009353683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   6e-23    
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   6e-23    
ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   7e-23    
ref|XP_010542651.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   8e-23    
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg             108   8e-23    
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22    
gb|KEH39774.1|  fasciclin domain protein                                107   1e-22    
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   1e-22    
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   1e-22    
ref|NP_001046792.1|  Os02g0461500                                       107   2e-22    
emb|CDY52668.1|  BnaC01g38580D                                          106   2e-22    
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-22    
ref|XP_008385122.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-22    
ref|XP_006371803.1|  putative surface family protein                    106   2e-22    
emb|CDX73808.1|  BnaA03g32390D                                          105   3e-22    
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   3e-22    
ref|XP_004305605.1|  PREDICTED: uncharacterized protein LOC101308896    110   4e-22    



>ref|XP_006357643.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Solanum 
tuberosum]
Length=409

 Score =   450 bits (1157),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 223/313 (71%), Positives = 265/313 (85%), Gaps = 2/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T Y  NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITV  ++NAAMN +L+KH   
Sbjct  21    TTTYAHNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNALLEKHLPT  80

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT+KN+LS HV ADYFG KKLH + KG+TLTATMFQATG+APGTSGY+N+T +KGGKVGF
Sbjct  81    YTLKNVLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGF  140

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             A EDN G F +TFVKSV+E PY ISVIQISH L+S+ AEAP + P+D+N+TTLMAKQGCK
Sbjct  141   ANEDNDGHFAATFVKSVVEMPYNISVIQISHILTSAAAEAPVAAPSDLNVTTLMAKQGCK  200

Query  848   AFADLLDSTGADA-TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             +F+DLL S    A TFA NV++GLTVFCPTD VI  FMPK+KNL+KDG+ SLLLYHG+P 
Sbjct  201   SFSDLLKSHPDVAKTFAENVQSGLTVFCPTDGVISAFMPKFKNLTKDGQASLLLYHGIPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y ++GM +SN NG++NTLAT G  KYDFTVQN G+DV LET+VVTA I+GT+YDEEPLSV
Sbjct  261   YNSMGMLKSN-NGLMNTLATEGKKKYDFTVQNDGDDVKLETKVVTATISGTLYDEEPLSV  319

Query  491   FKVDKVLLPRELF  453
             +KVDKVLLPRELF
Sbjct  320   YKVDKVLLPRELF  332



>ref|XP_009799147.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
sylvestris]
Length=407

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 230/334 (69%), Positives = 276/334 (83%), Gaps = 3/334 (1%)
 Frame = -1

Query  1451  MKFSATAAvvlslyvyvilLFSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQT  1272
             MKFS  AA +    + ++L  +T    NIT+ILAKH +FSTFN YLT+THLAAEINRRQT
Sbjct  1     MKFSP-AAPLSLSLLLLLLFSATTSAHNITKILAKHPEFSTFNHYLTVTHLAAEINRRQT  59

Query  1271  ITVLVLNNAAMNDILDKHYSLYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATG  1092
             ITV  ++NAAMN++L+KH   YT+KN+LS HV ADYFG KKLH + KG+TLTATMFQATG
Sbjct  60    ITVCAIDNAAMNELLEKHLPTYTLKNVLSLHVFADYFGAKKLHQITKGSTLTATMFQATG  119

Query  1091  DAPGTSGYVNMTALKGGKVGFAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAE  912
             +APGTSGY+N+T +KGGKVGFA EDN G F +TFVK+VLE PY ISVIQISH L+S+ AE
Sbjct  120   EAPGTSGYINITNMKGGKVGFANEDNDGHFTATFVKTVLEMPYNISVIQISHVLTSAAAE  179

Query  911   APASGPTDVNITTLMAKQGCKAFADLLDS-TGADATFALNVETGLTVFCPTDKVIQGFMP  735
             AP + P+D+NITTLM++QGCKAF+DLL S      TFA NVE+GLTVFCPTD V+ GFMP
Sbjct  180   APVAAPSDLNITTLMSEQGCKAFSDLLKSHLDVSKTFAENVESGLTVFCPTDGVLNGFMP  239

Query  734   KYKNLSKDGKMSLLLYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTL  555
             K+K L+KDG+ SLLLYHGVP Y +LGM +SN NG++NTLAT G NKYDFTVQN G+DV L
Sbjct  240   KFKKLTKDGQASLLLYHGVPVYNSLGMLKSN-NGLMNTLATEGKNKYDFTVQNDGDDVML  298

Query  554   ETEVVTAKITGTMYDEEPLSVFKVDKVLLPRELF  453
             +T+VVTA I+GT+YDEEPLSV+KVDKVLLPRELF
Sbjct  299   KTKVVTATISGTLYDEEPLSVYKVDKVLLPRELF  332



>ref|XP_009606546.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
tomentosiformis]
Length=407

 Score =   449 bits (1155),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 221/307 (72%), Positives = 264/307 (86%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITV  ++NAAMN++L+KH   YT+KN+
Sbjct  27    NITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNELLEKHLPTYTLKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HV ADYFG KKLH + KG+TLTATMFQATG+APGTSGY+N+T +KGGKVGFA EDN 
Sbjct  87    LSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANEDND  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G F +TFVK+VLE PY ISVIQISH L+S+ AEAP + P+D+N+TTLM+KQGCKAF+DLL
Sbjct  147   GHFAATFVKTVLEMPYNISVIQISHILTSAAAEAPVAAPSDLNVTTLMSKQGCKAFSDLL  206

Query  830   DS-TGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              S      TFA NVE+GLTVFCPTD V+ GFMPK+KNL+KDG+ SLLLYHGVP Y +LGM
Sbjct  207   KSHPDVSKTFAENVESGLTVFCPTDGVLNGFMPKFKNLTKDGQASLLLYHGVPVYNSLGM  266

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG++NTLAT G NKYDFTVQN G+DV L+T+VVTA I+GT+YDEEPLSV+K+DKV
Sbjct  267   LKSN-NGLMNTLATEGKNKYDFTVQNDGDDVMLKTKVVTATISGTLYDEEPLSVYKIDKV  325

Query  473   LLPRELF  453
             L+PRELF
Sbjct  326   LMPRELF  332



>ref|XP_010323900.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum 
lycopersicum]
Length=409

 Score =   447 bits (1149),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 222/310 (72%), Positives = 263/310 (85%), Gaps = 2/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             Y  NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITV  ++NAAMN +L+KH   YT+
Sbjct  24    YAHNITKILAKHPEFSTFNHYLTVTHLAAEINRRQTITVCAIDNAAMNVLLEKHLPTYTL  83

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS HV ADYFG KKLH + KG+TLTATMFQATG+APGTSGY+N+T +KGGKVGFA E
Sbjct  84    KNVLSLHVFADYFGAKKLHQITKGSTLTATMFQATGEAPGTSGYINITNMKGGKVGFANE  143

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             DN G F +TFVKSV+E PY ISVIQISH L+S+ AEAP + P+D+N+TTLMAKQGCK+F+
Sbjct  144   DNDGHFAATFVKSVVEMPYNISVIQISHILTSAAAEAPVAAPSDLNVTTLMAKQGCKSFS  203

Query  839   DLLDSTGADA-TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             DLL S    A TFA NV++GLTVFCPTD VI  FMPK+KNL+KDG+ SLLLYHG+P Y +
Sbjct  204   DLLKSHPDVAKTFAENVQSGLTVFCPTDGVITAFMPKFKNLTKDGQASLLLYHGIPVYNS  263

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             +GM +SN NG++NTLAT G  KYDFTVQN G+DV LET+VVTA I+GT+YDEEPLSV+KV
Sbjct  264   MGMLKSN-NGLMNTLATEGKKKYDFTVQNDGDDVKLETKVVTATISGTLYDEEPLSVYKV  322

Query  482   DKVLLPRELF  453
             DKVLLPRELF
Sbjct  323   DKVLLPRELF  332



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score =   444 bits (1141),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 217/354 (61%), Positives = 276/354 (78%), Gaps = 8/354 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T+   NIT+ILAKH +FSTFN YLT THLA+EINRRQTITVL L+NAAM+ +LDK  SL
Sbjct  24    TTSNAHNITRILAKHPEFSTFNHYLTTTHLASEINRRQTITVLALDNAAMSALLDKQLSL  83

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT+KN+LS HVL DYFG+KKLH +  GT LT+TMFQATG APG+SGY+N+T LKGGKVGF
Sbjct  84    YTVKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGAAPGSSGYINITDLKGGKVGF  143

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ D+ +VKSV E PY ISV+QIS  L+S+ AEAP + P+ +N+T +M+KQGCK
Sbjct  144   GAEDNNGKLDAVYVKSVAEIPYNISVLQISQVLNSAEAEAPTAEPSQLNLTEIMSKQGCK  203

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL ++GADATF  N++ GLTVFCPTD VI+GFMPKY+NL+   K+SL LYHG+P Y
Sbjct  204   AFADLLKASGADATFNENIDGGLTVFCPTDPVIKGFMPKYENLTAAQKVSLQLYHGIPVY  263

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q++   +S+ NG++NTLAT G+NK+DFTVQN GE VTL+T+V+TAKITGT+ DEEPL V+
Sbjct  264   QSMQTLKSS-NGIVNTLATDGANKFDFTVQNDGEVVTLKTKVMTAKITGTLKDEEPLIVY  322

Query  488   KVDKVLLPRELFkaagksgsessggapgpnSD-------DDGVPSDQAAGHRNG  348
             K+DKVLLPRELFK    + +  +  +    +D        +  P+DQ+A   NG
Sbjct  323   KIDKVLLPRELFKTVEAAEAPKASKSKHKAADAPESDAPAESDPADQSADDENG  376



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score =   436 bits (1122),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/363 (60%), Positives = 273/363 (75%), Gaps = 17/363 (5%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLT+THLAAEINRR+TITV  ++NA M+++L KH S+Y IKN+
Sbjct  28    NITRILAKHPEFSTFNHYLTVTHLAAEINRRETITVCAVDNAGMSELLSKHLSIYAIKNV  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF  E N 
Sbjct  88    LSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGAEAND  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G+ DSTFVKS+ E PY IS+IQIS  L SS AEAP  GP+++N+T+LM+K+GCK FAD L
Sbjct  148   GKIDSTFVKSIQEIPYNISIIQISKILPSSEAEAPTPGPSELNLTSLMSKKGCKVFADTL  207

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++GA  TF  NV+ GLTVFCPTD V + F+PKYKNL+K+GK +LLL+HGVP Y ++ M 
Sbjct  208   AASGAGQTFYDNVDGGLTVFCPTDDVFKNFLPKYKNLTKEGKAALLLFHGVPVYNSMPML  267

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NG++NTLAT G+NKYDFTVQN GEDVTL+T++VTAKITGT+ DE+PL+V+ +DKVL
Sbjct  268   KSN-NGLMNTLATDGANKYDFTVQNDGEDVTLKTKIVTAKITGTLLDEQPLAVYTIDKVL  326

Query  470   LPRELFk----------------aagksgsessggapgpnSDDDGVPSDQAAGHRNGGVR  339
             LP+ELFK                 A K  ++    +P      DG P+DQ A  +N GVR
Sbjct  327   LPKELFKAALTPAPAPAPEAESPKASKKKTKHHAASPPEPLSPDGEPADQVAADQNAGVR  386

Query  338   RSG  330
               G
Sbjct  387   FDG  389



>ref|XP_011100491.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Sesamum 
indicum]
Length=409

 Score =   433 bits (1114),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 206/308 (67%), Positives = 258/308 (84%), Gaps = 3/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YL+ THLAAEINRR+TITV  ++NAAMN++L KHYSL TIKNI
Sbjct  32    NITRILAKHPEFSTFNHYLSTTHLAAEINRRRTITVCAVDNAAMNELLAKHYSLPTIKNI  91

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+ ADYFG KKLH + KG+T T+++FQATG+A GTSGYVN+T +KGGKVGF+P DN 
Sbjct  92    LSLHIFADYFGAKKLHQITKGSTTTSSLFQATGEAAGTSGYVNITDIKGGKVGFSPVDND  151

Query  1010  --GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
               GR  +T+VKS+ E+ Y ISVIQISH LSS  AEAP +GP+D+N+T+LMAKQGCKAF+D
Sbjct  152   GGGRPMATYVKSIEEQAYVISVIQISHILSSPEAEAPTAGPSDLNVTSLMAKQGCKAFSD  211

Query  836   LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L+ + GAD TF  +VE GLT+FCP+D+ +  FMP+YKNL+ DGK SLLLYHG+P Y +LG
Sbjct  212   LITAQGADETFQQSVEGGLTIFCPSDESLDSFMPRYKNLTADGKTSLLLYHGIPVYNSLG  271

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             M RS+ NG++NTLAT G+ K+DFTVQN G+DV LET+VVTA I GT+ DE+PL+V+K+DK
Sbjct  272   MLRSS-NGLMNTLATEGAKKFDFTVQNDGDDVKLETKVVTATIEGTLIDEDPLAVYKIDK  330

Query  476   VLLPRELF  453
             VLLP+ELF
Sbjct  331   VLLPKELF  338



>gb|ABV27490.1| fasciclin-like arabinogalactan protein 19 [Gossypium hirsutum]
Length=398

 Score =   432 bits (1111),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 259/312 (83%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST+   NIT+ILAKH +FSTFN YLTLTHLA+EINRR+TITVL LNNAAM+ +L K  SL
Sbjct  17    STSNAHNITRILAKHPEFSTFNHYLTLTHLASEINRRETITVLALNNAAMSSLLSKQLSL  76

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT+KN+LS HVL DYFG+KKLH +  GT LT+TMFQA+G APG+SGY+N+T LKGGKVGF
Sbjct  77    YTLKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGF  136

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               E+N G  D+ +VKSV E PY ISV+QIS  L+S+ AEAP + P+ +N+T +M+KQGCK
Sbjct  137   GAENNDGNLDAVYVKSVAEIPYNISVLQISQVLNSAEAEAPTAEPSKLNLTEIMSKQGCK  196

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             +FADLL S+GADATF  N++ GLTVFCPTD VI+ FMPKYKNL+   K SLLLYHGVP Y
Sbjct  197   SFADLLISSGADATFNENIDGGLTVFCPTDPVIKDFMPKYKNLTASKKASLLLYHGVPVY  256

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q++ M +SN NG++NTLAT G+NKYDFT+QN GE VTLET+V+TAKITGT+ DEEPL V+
Sbjct  257   QSMQMLKSN-NGIMNTLATDGANKYDFTIQNDGEVVTLETKVMTAKITGTLKDEEPLIVY  315

Query  488   KVDKVLLPRELF  453
             K++KVLLPREL+
Sbjct  316   KINKVLLPRELY  327



>gb|ACL36352.1| fascilin-like arabinogalactan protein [Gossypium hirsutum]
Length=397

 Score =   431 bits (1107),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 211/312 (68%), Positives = 259/312 (83%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST+   NIT+ILAK+ +FSTFN YLTLTHLA+EINRR+TITVL LNNAAM+ +L K  SL
Sbjct  16    STSNAHNITRILAKNPEFSTFNHYLTLTHLASEINRRETITVLALNNAAMSSLLSKQLSL  75

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT+KN+LS HVL DYFG+KKLH +  GT LT+TMFQA+G APG+SGY+N+T LKGGKVGF
Sbjct  76    YTLKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQASGAAPGSSGYINITDLKGGKVGF  135

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               E+N G  D+ +VKSV E PY ISV+QIS  L+S+ AEAP + P+ +N+T +M+KQGCK
Sbjct  136   GAENNDGNLDAVYVKSVAEIPYNISVLQISQVLNSAEAEAPTAEPSKLNLTEIMSKQGCK  195

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL S+GADATF  N++ GLTVFCPTD VI+ FMPKYKNL+   K SLLLYHGVP Y
Sbjct  196   AFADLLISSGADATFNENIDGGLTVFCPTDPVIKDFMPKYKNLTASKKASLLLYHGVPVY  255

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q++ M +SN NG++NTLAT G+NKYDFT+QN GE VTLET+V+TAKITGT+ DEEPL V+
Sbjct  256   QSMQMLKSN-NGIMNTLATDGANKYDFTIQNDGEVVTLETKVMTAKITGTLKDEEPLIVY  314

Query  488   KVDKVLLPRELF  453
             K++KVLLPREL+
Sbjct  315   KINKVLLPRELY  326



>ref|XP_006447810.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
 gb|ESR61050.1| hypothetical protein CICLE_v10015469mg [Citrus clementina]
Length=403

 Score =   429 bits (1104),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 255/312 (82%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + ++  NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITVL L+N+AM+ +L K  S+
Sbjct  24    TASHAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSV  83

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT++N+LS HVL DYFG+KKLH +  GT LT++MFQATG APG+SGYVN+T LKGGKVGF
Sbjct  84    YTLRNVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGF  143

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ D+T+VKSV E PY ISV+QISH L+S  AEAP  GP+ +N+T +MAKQGCK
Sbjct  144   GAEDNDGKLDATYVKSVAEFPYNISVLQISHVLNSDEAEAPTPGPSGLNLTAIMAKQGCK  203

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL +TGA  TF  N++ GLTVFCPTD V+  FMPKYKNL++  K+SLLLYHG P Y
Sbjct  204   AFADLLIATGAHTTFEENLDGGLTVFCPTDAVVNDFMPKYKNLTEAHKVSLLLYHGTPVY  263

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   +S+ NGV+NTLAT G++KYDFTVQN GE VTL+T+  TAKITGT+ DEEPL ++
Sbjct  264   QSLQTLKSS-NGVMNTLATDGASKYDFTVQNDGEIVTLKTKATTAKITGTLKDEEPLVIY  322

Query  488   KVDKVLLPRELF  453
             K++KVLLP ELF
Sbjct  323   KINKVLLPIELF  334



>ref|XP_006469451.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Citrus 
sinensis]
Length=403

 Score =   429 bits (1103),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 255/312 (82%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + ++  NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITVL L+N+AM+ +L K  S+
Sbjct  24    TASHAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSV  83

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT++N+LS HVL DYFG+KKLH +  GT LT++MFQATG APG+SGYVN+T LKGGKVGF
Sbjct  84    YTLRNVLSLHVLTDYFGSKKLHQVTNGTALTSSMFQATGSAPGSSGYVNITDLKGGKVGF  143

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ D+T+VKSV E PY ISV+QISH L+S  AEAP  GP+ +N+T +MAKQGCK
Sbjct  144   GAEDNDGKLDATYVKSVAEFPYNISVLQISHVLNSDEAEAPTPGPSGLNLTAIMAKQGCK  203

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL +TGA  TF  N++ GLTVFCPTD V+  FMPKYKNL++  K+SLLLYHG P Y
Sbjct  204   AFADLLIATGAHTTFEENLDGGLTVFCPTDAVVNDFMPKYKNLTEAHKVSLLLYHGTPVY  263

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   +S+ NGV+NTLAT G++KYDFTVQN GE VTL+T+  TAKITGT+ DEEPL ++
Sbjct  264   QSLQTLKSS-NGVMNTLATDGASKYDFTVQNDGEIVTLKTKATTAKITGTLKDEEPLVIY  322

Query  488   KVDKVLLPRELF  453
             K++KVLLP ELF
Sbjct  323   KINKVLLPIELF  334



>ref|XP_007215592.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
 gb|EMJ16791.1| hypothetical protein PRUPE_ppa007675mg [Prunus persica]
Length=359

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/310 (66%), Positives = 252/310 (81%), Gaps = 1/310 (0%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+ILAKH + S+FN YLTLTHLA EINRRQTITVL ++NAAM+ +L K  S+Y
Sbjct  24    TSQAHNITRILAKHPELSSFNHYLTLTHLATEINRRQTITVLAIDNAAMSSLLSKGLSVY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN+LS HVL DYFG KKLH +  GTTL ++MFQATG A GTSGYVN+T LKGGKVGF 
Sbjct  84    TIKNVLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              +DN G+ +S +VKSV E PY ISV+QIS  L+S+ AEAP +GP+ +N+T +++KQGCKA
Sbjct  144   AQDNDGKLNSFYVKSVQEIPYNISVLQISQVLTSAEAEAPTAGPSQLNLTAILSKQGCKA  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FADLL S+GAD TF  N++ GLTVFCPTD VI GF+PKYKNL+   K+SLLLYHG+P YQ
Sbjct  204   FADLLISSGADTTFETNIDGGLTVFCPTDAVINGFLPKYKNLTTSQKVSLLLYHGIPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L M +SN NG++NTLAT  +NK+DFTVQN GE V+LETEVVTAKITGT+ DEEPL ++K
Sbjct  264   SLQMLKSN-NGLVNTLATDKANKFDFTVQNDGEVVSLETEVVTAKITGTLIDEEPLVIYK  322

Query  485   VDKVLLPREL  456
             V+KVL P EL
Sbjct  323   VNKVLQPTEL  332



>ref|XP_008229928.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Prunus mume]
Length=394

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 206/311 (66%), Positives = 252/311 (81%), Gaps = 1/311 (0%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+ILAKH + S+FN YLTLTHLA EINRRQTITVL ++NAAM+ +L K   +Y
Sbjct  24    TSQAHNITRILAKHPELSSFNHYLTLTHLATEINRRQTITVLAIDNAAMSSLLSKGLPVY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN+LS HVL DYFG KKLH +  GTTL ++MFQATG A GTSGYVN+T LKGGKVGF 
Sbjct  84    TIKNVLSLHVLVDYFGAKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              +DN G+ +S +VKSV E PY ISV+QIS  L+S+ AEAP +GP+ +N+T +++KQGCKA
Sbjct  144   AQDNDGKLNSFYVKSVQEIPYNISVLQISQVLTSAEAEAPTAGPSQLNLTAILSKQGCKA  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FADLL S+GAD TF  N++ GLTVFCPTD VI GF+PKYKNL+   K+SLLLYHG+P YQ
Sbjct  204   FADLLISSGADTTFETNIDGGLTVFCPTDAVINGFLPKYKNLTTSQKVSLLLYHGIPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L M +SN NG++NTLAT  +NK+DFTVQN GE V+LETEVVTAKITGT+ DEEPL ++K
Sbjct  264   SLQMLKSN-NGLVNTLATDKANKFDFTVQNDGEVVSLETEVVTAKITGTLIDEEPLVIYK  322

Query  485   VDKVLLPRELF  453
             V+KVL P ELF
Sbjct  323   VNKVLQPTELF  333



>gb|KDO38095.1| hypothetical protein CISIN_1g013841mg [Citrus sinensis]
Length=435

 Score =   429 bits (1103),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 255/312 (82%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T++  NIT+ILAKH +FSTFN YLT+THLAAEINRRQTITVL L+N+AM+ +L K  S+
Sbjct  56    TTSHAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRQTITVLALDNSAMSSLLSKQLSV  115

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT++N+LS HVL DYFG+KKLH +  GT LT++MFQATG APG+SGYVN+T LKGGKVGF
Sbjct  116   YTLRNVLSLHVLTDYFGSKKLHQITNGTALTSSMFQATGSAPGSSGYVNVTDLKGGKVGF  175

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ D+T+VKSV E PY ISV+QIS  L+S  AEAP  GP+ +N+T +MAKQGCK
Sbjct  176   GAEDNDGKLDATYVKSVAEFPYNISVLQISQVLNSDEAEAPTPGPSGLNLTAIMAKQGCK  235

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL +TGA  TF  N++ GLTVFCPTD V+  FMPKYKNL++  K+SLLLYHG P Y
Sbjct  236   AFADLLIATGAHTTFEENLDGGLTVFCPTDAVVNDFMPKYKNLTEAHKVSLLLYHGTPVY  295

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   +S+ NGV+NTLAT G++KYDFTVQN GE VTL+T+  TAKITGT+ DEEPL ++
Sbjct  296   QSLQTLKSS-NGVMNTLATDGASKYDFTVQNDGEIVTLKTKATTAKITGTLKDEEPLVIY  354

Query  488   KVDKVLLPRELF  453
             K++KVLLP ELF
Sbjct  355   KINKVLLPIELF  366



>emb|CDP18905.1| unnamed protein product [Coffea canephora]
Length=412

 Score =   426 bits (1094),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/313 (67%), Positives = 252/313 (81%), Gaps = 4/313 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A   NIT+ILAKH +FSTFN YLT THLA EINRR+TITV V++NA M+D+L KH SL +
Sbjct  25    AQSHNITRILAKHPEFSTFNHYLTTTHLADEINRRRTITVCVVDNAGMSDLLAKHLSLPS  84

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +KN+LS HV ADYFG +KLH ++KG+T T+T+FQATG+A GT+GYVN+T +KGGKVGFA 
Sbjct  85    LKNVLSLHVFADYFGARKLHQISKGSTTTSTLFQATGEAAGTAGYVNITDMKGGKVGFAT  144

Query  1022  EDNTGRF---DSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
              +N G +    STFVKSV E PY ++VIQISH L S  AEAP SGP  +N+TTLM KQGC
Sbjct  145   GNNEGEYGDLTSTFVKSVDEIPYVVAVIQISHVLLSPDAEAPVSGPGALNVTTLMEKQGC  204

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAFADLL S+GA+ TF  NVE GLTVFCP+D V+  FMP YKNL+ +GK+SLLLYHG P 
Sbjct  205   KAFADLLKSSGAEETFVQNVEAGLTVFCPSDGVLSSFMPSYKNLTSEGKVSLLLYHGTPT  264

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y++LGM RS  NG +NTLAT G+NKYD TVQN GEDV L+T VVTA ITGT+ DE+P++V
Sbjct  265   YKSLGMLRSK-NGKMNTLATEGANKYDVTVQNDGEDVKLDTNVVTATITGTVIDEDPVAV  323

Query  491   FKVDKVLLPRELF  453
             FK+DKVLLPRELF
Sbjct  324   FKIDKVLLPRELF  336



>ref|XP_008342240.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=391

 Score =   421 bits (1083),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/348 (61%), Positives = 260/348 (75%), Gaps = 2/348 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+IL +H   STFN YL+LTHLA EINRRQTITVL L+NAAM+ ++ K  S+Y
Sbjct  24    TSQAHNITRILDQHPSLSTFNHYLSLTHLATEINRRQTITVLTLDNAAMSSLISKGLSVY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN+LS HVL DYFG KKLH L  GTTL ++MFQATG A GTSGYVN+T LKGGKVGF 
Sbjct  84    TIKNVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              EDN G  +S +VKSVLE PY ISV+QIS  L+S+ AEAP +GP+ +N+T +++KQGCKA
Sbjct  144   AEDNGGTLNSFYVKSVLEMPYNISVLQISQALTSAEAEAPTAGPSQLNLTAIISKQGCKA  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FADLL + GAD+TF  N++ GLTVFCPTD V+  F+PKYKNL+   K+SLLLYHGVP YQ
Sbjct  204   FADLLIAAGADSTFETNIDGGLTVFCPTDSVVNAFLPKYKNLTASQKVSLLLYHGVPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L   +SN NG++NTLAT  + K++FTVQN GE V+LET+VVTAKITGT+ D+EPL V+K
Sbjct  264   SLQDLKSN-NGLVNTLATDKAKKFEFTVQNDGEVVSLETQVVTAKITGTVIDQEPLVVYK  322

Query  485   VDKVLLPRELFkaagksgsessggapgpnSDDDGVPSDQAAGHRNGGV  342
             V+KVL P ELFK       +     P     DD  P+DQ A     GV
Sbjct  323   VNKVLQPTELFKETVAPAPKEVAAGPADAPSDD-TPADQTADSEKNGV  369



>ref|XP_009351261.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Pyrus x 
bretschneideri]
Length=391

 Score =   421 bits (1081),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 260/348 (75%), Gaps = 2/348 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+IL +H   STFN YL LTHLA EINRRQTITVL L+NAAM+ ++ K  S+Y
Sbjct  24    TSQAHNITRILDQHPSLSTFNHYLGLTHLATEINRRQTITVLALDNAAMSSLISKGLSVY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN+LS HVL DYFG KKLH L  GTTL ++MFQATG A GTSGYVN+T LKGGKVGF 
Sbjct  84    TIKNVLSLHVLVDYFGAKKLHQLTHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              EDN G  +S +VKSVLE PY ISV+QIS  L+S+ AEAP +GP+ +N+T +++KQGCKA
Sbjct  144   AEDNGGTLNSFYVKSVLEMPYNISVLQISQALTSAEAEAPTAGPSQLNLTAIISKQGCKA  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FADLL + GAD+TF  N++ GLTVFCPTD V+  F+PKYKNL+   K+SLLLYHGVP YQ
Sbjct  204   FADLLIAAGADSTFETNIDGGLTVFCPTDSVVNAFLPKYKNLTASQKVSLLLYHGVPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L   +SN NG++NTLAT  + K++FTVQN GE V+LET+VVTAKITGT+ D+EPL V+K
Sbjct  264   SLQDLKSN-NGLVNTLATDKAKKFEFTVQNDGEVVSLETQVVTAKITGTVIDQEPLVVYK  322

Query  485   VDKVLLPRELFkaagksgsessggapgpnSDDDGVPSDQAAGHRNGGV  342
             V+KVL P ELFKA      +     P     DD  P+DQ A     GV
Sbjct  323   VNKVLQPTELFKATVAPAPKEVAAGPADAPSDD-TPADQTADSEKNGV  369



>ref|XP_004303568.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Fragaria 
vesca subsp. vesca]
Length=406

 Score =   420 bits (1080),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/342 (64%), Positives = 269/342 (79%), Gaps = 1/342 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST+   NIT+ILAKH   STFN YLTLTHLAAEINRRQTITVL ++NAAM+ IL KH+S+
Sbjct  25    STSQAHNITRILAKHPSLSTFNHYLTLTHLAAEINRRQTITVLAIDNAAMDAILAKHFSI  84

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS HVL DYFG KKLH L  GTTLTATMFQ+TG A GTSGYVN+T LKGGKVGF
Sbjct  85    PTLKNVLSLHVLVDYFGAKKLHQLTGGTTLTATMFQSTGTADGTSGYVNITNLKGGKVGF  144

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ +S + KSV E PY ISV+QIS  L+S+ AEAP +GP+DVN+T+++AKQGCK
Sbjct  145   GTEDNDGKLNSFYEKSVQEIPYNISVLQISQVLTSAEAEAPTAGPSDVNLTSILAKQGCK  204

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AF+DLL STGAD TF  NV+ GLTVFCPTD V+  F PK+KNL+   K++L+LYHG+P Y
Sbjct  205   AFSDLLISTGADTTFQNNVDGGLTVFCPTDAVVSAFAPKFKNLTAPQKLALVLYHGIPVY  264

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L M +SN NGV+NTLAT  +NKYDFTVQN GE+V+LET+VVTAKITGT+ D++PL ++
Sbjct  265   QSLQMLKSN-NGVINTLATDKANKYDFTVQNDGEEVSLETKVVTAKITGTVLDQDPLVIY  323

Query  488   KVDKVLLPRELFkaagksgsessggapgpnSDDDGVPSDQAA  363
             KV+KVL P+ELFK      + S   A  P+ DD   PS+  A
Sbjct  324   KVNKVLQPKELFKVVKTKAAPSPKKAAAPSEDDADAPSEDDA  365



>ref|XP_009616556.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
tomentosiformis]
Length=389

 Score =   419 bits (1077),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 210/355 (59%), Positives = 264/355 (74%), Gaps = 12/355 (3%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NITQILAKH +FSTFNRYLTLTHLA+EINRRQTITV  ++NAAM+D+LDKH S+YT+KN+
Sbjct  28    NITQILAKHREFSTFNRYLTLTHLASEINRRQTITVCAVDNAAMDDLLDKHLSIYTLKNV  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HV ADYF +KKLH +  GTTLTAT+FQATG+APGT+GY+N+T  KG KVGF  EDN 
Sbjct  88    LSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTTGYINITNTKGKKVGFTTEDNN  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G F ++FVKSV E PY ISVIQIS+ + SS AEAP S P +++I  LM  +GCK FA LL
Sbjct  148   GHFSASFVKSVQEIPYNISVIQISNIIQSSEAEAPVSAPAEIDIIDLMTNKGCKEFAKLL  207

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
             +++    TF   +E GLTVFCP DKV+  F+PKYKNL+K+G+ SLLLYHG+P Y +LGM 
Sbjct  208   ENSKITKTFTDIMENGLTVFCPIDKVVNSFLPKYKNLTKNGQTSLLLYHGIPDYHSLGML  267

Query  650   RSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             RS  NG +NT+AT  G +NKYDF+V+N G++V L+T +VTAKITGT+ DEEPL+V+K+DK
Sbjct  268   RSK-NGFINTMATTKGKNNKYDFSVKNDGDNVKLDTNIVTAKITGTLLDEEPLAVYKIDK  326

Query  476   VLLPRELFkaagksgsessggapgpnSDDDG---VPSDQAAGHRNGG-VRRSGAW  324
             VL P ELFKA     +         + D+D    VP+D      NG  +  +  W
Sbjct  327   VLQPSELFKAQSIINNSEDTAPEPSSGDNDNDGDVPAD-----NNGAMIMSANGW  376



>gb|KDP29933.1| hypothetical protein JCGZ_18502 [Jatropha curcas]
Length=408

 Score =   420 bits (1079),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 212/311 (68%), Positives = 254/311 (82%), Gaps = 2/311 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T    NIT+ILAKH  FSTFN YLT+THLAAEINRRQTITVL L+NAAM+ +L K  S+Y
Sbjct  23    TCCAHNITRILAKHPAFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLLAKQLSVY  82

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             T++N+LS HVL DYFG KKLH +  GTTLT+TMFQATG A GTSGYVN+T LKGGKV F 
Sbjct  83    TLRNVLSLHVLVDYFGAKKLHQITDGTTLTSTMFQATGSATGTSGYVNITDLKGGKVAFG  142

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              EDN G+ D+ +VKS+ E PY ISV+QIS  L+S+ AEAP + PT +N+T +M+KQGCKA
Sbjct  143   SEDNNGKLDAVYVKSLEEIPYNISVMQISQALNSAEAEAPTAAPT-LNLTEIMSKQGCKA  201

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             F DLL +TGA  TF  N++ GLTVFCPTD VI GFMPKYKNL+   K+SLLLYHG+P YQ
Sbjct  202   FTDLLKATGAVKTFEENLDGGLTVFCPTDTVINGFMPKYKNLTAAKKVSLLLYHGIPVYQ  261

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L M +S+ NG++NTLAT G+NKYDFTVQN GED+TLET+V+TAKITGT+ DEEPL V+K
Sbjct  262   SLQMLKSS-NGLMNTLATDGANKYDFTVQNDGEDITLETKVMTAKITGTIKDEEPLVVYK  320

Query  485   VDKVLLPRELF  453
             +DKVLLPRELF
Sbjct  321   IDKVLLPRELF  331



>ref|XP_010252769.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=412

 Score =   418 bits (1074),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 265/373 (71%), Gaps = 25/373 (7%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILAK+ DFS FN++LTLTHLA EIN+R+TIT+  ++N  M+D+L K  S+YTIKN+
Sbjct  27    NITSILAKNPDFSIFNQFLTLTHLAVEINQRETITICTVDNGGMSDLLSKQLSIYTIKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG +KLH +  GT LTATMFQATG APG+SG+VN+T LKGGKVGF  E N 
Sbjct  87    LSLHVLLDYFGAQKLHQITNGTALTATMFQATGSAPGSSGFVNITDLKGGKVGFGAESNH  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G  D+TFVKSV E PY ISVIQIS  ++S+ AEAP  GP+ +N+T+LM+KQGCK FAD L
Sbjct  147   GNLDATFVKSVEEIPYNISVIQISKIMASAEAEAPTPGPSQLNLTSLMSKQGCKVFADTL  206

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++GA+ TF  N+  GLTVFCPTD+  + FMPKYKNL+ DGK SLLLYHG+P Y ++ M 
Sbjct  207   VASGAEQTFDDNIVGGLTVFCPTDQAFKDFMPKYKNLTADGKNSLLLYHGIPVYYSMPML  266

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NGV+NTLAT G+N YDFT+QN GE VTLET++VTAKITGT+ D++P++++ +DKVL
Sbjct  267   KSN-NGVVNTLATDGANNYDFTIQNDGELVTLETKIVTAKITGTLLDKQPVAIYTIDKVL  325

Query  470   LPRELFkaa-----------------------gksgsessggapgpnSDDDGVPSDQAAG  360
             +P+EL KA+                            +            DG P+DQ   
Sbjct  326   VPKELVKASPTPTPAPAPAPKVAKSSKAPTKHAPPPPQVPESMSPEPMSPDGEPADQTVA  385

Query  359   HRNGGVRRSGA-W  324
               NGGVR +GA W
Sbjct  386   DDNGGVRFNGARW  398



>ref|XP_009792211.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Nicotiana 
sylvestris]
Length=414

 Score =   417 bits (1073),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/355 (62%), Positives = 269/355 (76%), Gaps = 9/355 (3%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NITQILAKH +FSTFNRYLTLTHLA+EINRRQTITV  ++NAAM+D+LDKH S+YT+KN+
Sbjct  50    NITQILAKHHEFSTFNRYLTLTHLASEINRRQTITVCAVDNAAMDDLLDKHLSIYTLKNV  109

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HV ADYF +KKLH +  GTTLTAT+FQATG+APGTSGY+N+T  KG  VGF  E+N 
Sbjct  110   LSLHVFADYFSSKKLHKITNGTTLTATLFQATGEAPGTSGYINITNTKGKNVGFTTEEND  169

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G F ++FVKSV E PY ISVIQIS+ + SS AEAP S P +++I  LM  +GCK FA LL
Sbjct  170   GHFSASFVKSVQEIPYNISVIQISNIIQSSEAEAPVSAPAEIDIIDLMTNKGCKEFAKLL  229

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
             + +    TF   +E GLTVFCP DKV+  F+PKYKNL+K+G+ SLLLYHG+P Y +LGM 
Sbjct  230   EKSNITKTFTDIMENGLTVFCPIDKVVNTFLPKYKNLTKNGQTSLLLYHGIPDYHSLGML  289

Query  650   RSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             RS  NG +NT+AT  G +NKYDF+V+N G++V L+T +VTAKITGT+ DEEPL+V+K+DK
Sbjct  290   RSK-NGFINTMATTKGKNNKYDFSVKNDGDNVKLDTNIVTAKITGTLLDEEPLAVYKIDK  348

Query  476   VLLPRELFkaagksgsessggapgpnS-DDDG-VPSDQAAGHRNGGVRRSGA--W  324
             VL P ELFKA     + S   AP PNS DDDG VP+D  A   N GV   G   W
Sbjct  349   VLQPSELFKAQSIFNNNSEDTAPEPNSGDDDGDVPADATAD--NNGVMIIGVNGW  401



>ref|XP_010088447.1| hypothetical protein L484_018219 [Morus notabilis]
 gb|EXB36062.1| hypothetical protein L484_018219 [Morus notabilis]
Length=417

 Score =   417 bits (1072),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 246/306 (80%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLTLTHLA EINRR TITVL ++NAAM+DIL K+ S+YT+KNI
Sbjct  26    NITKILAKHPEFSTFNHYLTLTHLAPEINRRTTITVLAIDNAAMSDILGKNPSIYTVKNI  85

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L+ATMFQATG APG++G+VN+T  +GGKVGFAPEDN 
Sbjct  86    LSLHVLLDYFGAKKLHQITNGTALSATMFQATGSAPGSTGFVNITDQRGGKVGFAPEDND  145

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G F S F+KSV E PY ISVIQISH L S+ AEAP  GP ++NIT +M+  GCK FAD L
Sbjct  146   GTFSSHFLKSVQEIPYNISVIQISHALPSAAAEAPTPGPAELNITGIMSAHGCKLFADTL  205

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A  TF  N+  GLTVFCP D   + F+PKYKNL+K GK+SLL YHGVP YQ+L M 
Sbjct  206   LASEAIGTFTDNLAGGLTVFCPLDDAFKAFLPKYKNLTKSGKVSLLEYHGVPVYQSLAML  265

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +S+ NG++NTLAT G+NKYDFTVQN GE+VTL+T++ TA+ITGT+ DE+P++++ +DKVL
Sbjct  266   KSS-NGIINTLATDGANKYDFTVQNDGEEVTLKTKIDTARITGTLIDEQPVAIYTIDKVL  324

Query  470   LPRELF  453
              PRELF
Sbjct  325   RPRELF  330



>ref|XP_010542030.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=397

 Score =   416 bits (1068),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 211/352 (60%), Positives = 261/352 (74%), Gaps = 6/352 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK  DFSTFN YLT THLA +INRRQTITVL ++NA M+ IL K YSLYTI+NI
Sbjct  29    NITRILAKDPDFSTFNHYLTATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIRNI  88

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GTT T+TMFQATG APGTSGYVN+T LKGGKV F  +D+ 
Sbjct  89    LSLHVLVDYFGAKKLHQITHGTTSTSTMFQATGSAPGTSGYVNITDLKGGKVAFGVQDDD  148

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              +  S +VKSV EK Y ISV+QIS  ++S  AEAP   P+D N+TT++ KQGCKAFAD+L
Sbjct  149   NKLTSHYVKSVYEKAYNISVLQISQVMTSPEAEAPTPSPSDFNLTTILDKQGCKAFADML  208

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              STGAD TF   ++ GLTVFCPTD  +  FM K+K ++   + +L+LYHG+P YQ+L M 
Sbjct  209   TSTGADKTFQDTIDGGLTVFCPTDGAVNKFMAKFKAMTAANRTALVLYHGIPVYQSLQML  268

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             RS GNG +NTLATGG +KYDFTVQN G+DVTLET+VVTAK+TGT+ D+EPL V+K+DKVL
Sbjct  269   RS-GNGAINTLATGGDSKYDFTVQNDGDDVTLETDVVTAKLTGTLKDQEPLIVYKIDKVL  327

Query  470   LPRELFkaagksgsessggapgpnSDDDG-VPSD----QAAGHRNGGVRRSG  330
             LPRE+FKA+ K            + ++D   P+D    Q A ++NG    +G
Sbjct  328   LPREIFKASVKEAPSPKPSKNKKSPEEDADAPTDDYDAQVADNKNGVASTNG  379



>ref|XP_011085650.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 2 [Sesamum indicum]
Length=390

 Score =   415 bits (1067),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 271/358 (76%), Gaps = 12/358 (3%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             Y  NIT+ILA+H DFSTFN YLT THLAAEINR +T+ V+  +NAAMN++L KH+SLYTI
Sbjct  19    YAHNITRILAQHPDFSTFNHYLTTTHLAAEINRHRTMXVV--DNAAMNNLLSKHFSLYTI  76

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS H+ ADYFG+KKLH + KG+T T+++FQATG+A GTSGYVN+T +KGGK GF+P 
Sbjct  77    KNILSLHIFADYFGSKKLHQITKGSTTTSSLFQATGEAAGTSGYVNITDMKGGKXGFSPV  136

Query  1019  D-NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             D ++ +  +T+VKS+ E PY ISVIQISH LSS  AEAP +   D+N+T+LMAKQGCK F
Sbjct  137   DSDSDQPMATYVKSIEELPYNISVIQISHILSSPEAEAPTAVLIDLNLTSLMAKQGCKTF  196

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             +DL+ + G D TF  +VE GLT+FCP+D  I  FMP+YKNL+ +GK SLLLYHG P Y +
Sbjct  197   SDLITAQGTDKTFTQSVEGGLTIFCPSDDTIASFMPRYKNLTAEGKTSLLLYHGXPVYNS  256

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             LGM RS+ NG++NTLAT G+NK+DFTVQN GEDV +ET+VVTA I GT+ DE+PL+V+K+
Sbjct  257   LGMLRSS-NGLMNTLATKGANKFDFTVQNDGEDVKIETKVVTATIRGTLVDEDPLAVYKI  315

Query  482   DKVLLPRELFkaagksgsessggapgpnSDD------DGVPSDQAAGHRNGGVRRSGA  327
             DKVLLPRELFK A  +    S  +   +  D      D VP+D+ +   N G+R  G 
Sbjct  316   DKVLLPRELFKVAPSAPGTKSAKSRAQDEADAPGPAGDEVPADENSS--NDGMRLVGC  371



>gb|KHG10798.1| Fasciclin-like arabinogalactan protein 2 [Gossypium arboreum]
Length=417

 Score =   416 bits (1068),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 201/306 (66%), Positives = 253/306 (83%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT++LAK+  FSTFN YLT THLA++INRRQTITVL L+N AM+ +L KHYSLYT+KNI
Sbjct  60    NITRLLAKYPQFSTFNHYLTTTHLASQINRRQTITVLALDNTAMSSLLAKHYSLYTLKNI  119

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG+KKLH ++KG+TLT+TMFQATG APGTSGYVN+T LKGGKVGF  EDN 
Sbjct  120   LSLHVLVDYFGSKKLHRISKGSTLTSTMFQATGAAPGTSGYVNITNLKGGKVGFGAEDNE  179

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G+ D+TFVKS+ E PY IS++QISH L+S+ AEAP + P+ +N+T +M+KQGCKAFADLL
Sbjct  180   GKLDATFVKSIKEIPYNISIVQISHALNSAEAEAPTAAPSQLNLTEIMSKQGCKAFADLL  239

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++GAD  F  N++ GLTVFCPTD  ++GFMPKYKNL+   K+SLLLYHG+P + +L M 
Sbjct  240   TASGADDKFNENMDAGLTVFCPTDSAVKGFMPKYKNLTASKKVSLLLYHGIPVFMSLQML  299

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             ++N NGV+NTLAT G+N YDF+V N  E V+LET VVTAK+ G + +EEPL VFK++KVL
Sbjct  300   KTN-NGVMNTLATDGANSYDFSVSNEDEVVSLETTVVTAKVLGILKEEEPLIVFKINKVL  358

Query  470   LPRELF  453
             +P+ELF
Sbjct  359   MPKELF  364



>ref|XP_008380005.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Malus domestica]
Length=448

 Score =   414 bits (1065),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/348 (60%), Positives = 259/348 (74%), Gaps = 4/348 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+IL KH   +TFN YL+LTHLA EINRRQTITVL L+NAAM+ ++ K   +Y
Sbjct  83    TSQAHNITRILDKHPSLTTFNHYLSLTHLATEINRRQTITVLALDNAAMSSLISKGLPIY  142

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN+LS HVL DYFG+KKLH +  GTTL ++MFQATG A GTSGYVN+T LKGGKVGF 
Sbjct  143   TIKNVLSLHVLVDYFGSKKLHQITHGTTLASSMFQATGVAAGTSGYVNITNLKGGKVGFG  202

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              EDN G+ +S +VKSVLE PY ISV+QIS  L+S+ AEAP +GP+ +N+T +++KQGCKA
Sbjct  203   AEDNDGKLNSFYVKSVLEMPYNISVLQISQVLTSAEAEAPTAGPSQLNLTAIISKQGCKA  262

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FADLL ++GAD TF  N++ GLTVFCPTD V+  F+PKYK L+   K+SLLLYHGVP YQ
Sbjct  263   FADLLKASGADFTFETNIDGGLTVFCPTDSVVNAFLPKYKKLTASQKLSLLLYHGVPVYQ  322

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             +L   +SN NG++NTLAT  + K+DFTVQ+ GE V LETEVVTAKITGT+ D+EPL V+K
Sbjct  323   SLQDLKSN-NGLVNTLATDKAKKFDFTVQSDGEVVNLETEVVTAKITGTVIDQEPLVVYK  381

Query  485   VDKVLLPRELFkaagksgsessggapgpnSDDDGVPSDQAAGHRNGGV  342
             V+KVL P ELFKA      +    +    SDD     DQ A     GV
Sbjct  382   VNKVLQPTELFKATVAPAPKEVDDSAEAPSDDS---EDQTADSEKNGV  426



>ref|XP_006415013.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
 gb|ESQ56466.1| hypothetical protein EUTSA_v10025352mg [Eutrema salsugineum]
Length=405

 Score =   411 bits (1057),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS +   NIT+ILAK  DFSTFN YLT THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  21    FSLSNAHNITKILAKDPDFSTFNHYLTATHLADEINRRQTITVLAVDNSAMNSILSKGYS  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  GTT TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  81    LYTIRNILSLHVLVDYFGAKKLHQITDGTTSTASMFQSTGSATGTSGYVNITDIKGGKVA  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  141   FGVQDDDSKLTAQYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  200

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  I  +MPK+K LS   K +L+LYHG+P 
Sbjct  201   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAIGKYMPKFKALSAANKTALVLYHGMPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G NK+DFTVQN GE+VTLET+VVTAKITGT+ D+EPL V
Sbjct  261   YQSLQMLRS-GNGAVNTLATEGDNKFDFTVQNDGEEVTLETDVVTAKITGTLKDQEPLIV  319

Query  491   FKVDKVLLPRELF  453
             +K+DK+LLPRE++
Sbjct  320   YKIDKILLPREIY  332



>ref|XP_006352015.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Solanum 
tuberosum]
Length=393

 Score =   410 bits (1055),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 204/308 (66%), Positives = 250/308 (81%), Gaps = 3/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILAKH +FSTFNRYLTLTHLA+EINRRQTITV  +NNAAM D+LDKH S+YT+KN+
Sbjct  28    NITLILAKHPEFSTFNRYLTLTHLASEINRRQTITVCAVNNAAMGDLLDKHMSIYTLKNV  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HV ADYFG+K+LH + KGTTLTAT+FQATG+APGTSGYVN+T +KG KVGFA EDN 
Sbjct  88    LSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNITNMKGKKVGFATEDND  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G F S FVKS+ E PY ISVIQ+S+ ++S  AEAP + P DV++  LM+K+GCK FA LL
Sbjct  148   GHFSSNFVKSIQEIPYNISVIQLSNIITSPAAEAPVAAPADVDLIDLMSKKGCKEFAKLL  207

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              +T     F   +E GLTVFCP DKV+  F+PKYKNL+K+G++SLLLYHG+P Y +LGM 
Sbjct  208   QNTQISKQFIDLMENGLTVFCPIDKVVNNFLPKYKNLTKNGQISLLLYHGIPDYHSLGML  267

Query  650   RSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             RS  NG +NT+AT  G +NKYDF+++N G++V LET VVTAKITGT+ DEEPL+V+K+DK
Sbjct  268   RSK-NGFINTMATTKGKNNKYDFSIKNDGDNVKLETNVVTAKITGTLLDEEPLAVYKIDK  326

Query  476   VLLPRELF  453
             VL P ELF
Sbjct  327   VLQPSELF  334



>gb|KFK32403.1| hypothetical protein AALP_AA6G237100 [Arabis alpina]
Length=397

 Score =   410 bits (1054),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 210/367 (57%), Positives = 262/367 (71%), Gaps = 13/367 (4%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS +   NIT+ILAK  +FSTFN YLT THLA EINRRQTITVL ++N+AM+ IL K YS
Sbjct  17    FSLSNAHNITKILAKDPEFSTFNHYLTATHLADEINRRQTITVLAVDNSAMSSILSKGYS  76

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFGTKKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  77    LYTIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  136

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+     + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  137   FGVQDDDSELTARYVKSIFEKAYNISVVHISQVLTSPEAEAPTASPSDIVLTTILEKQGC  196

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K LSK  K +L+LYHG+P 
Sbjct  197   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKALSKANKTALVLYHGMPV  256

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G NK+DFTVQN G +VTLETEVVTAKI GT+ D+EPL +
Sbjct  257   YQSLQMLRS-GNGAVNTLATEGDNKFDFTVQNDGTEVTLETEVVTAKIMGTLKDQEPLII  315

Query  491   FKVDKVLLPRELFkaagksgsessgga---pgpnSDDDG------VPSD---QAAGHRNG  348
             +K+DKVLLPRE++KA   S               +D+D        P D   + A  +NG
Sbjct  316   YKIDKVLLPREIYKAVKASAPAPKSSKHKPKNAAADEDANGPAADAPGDDDGEVADDKNG  375

Query  347   GVRRSGA  327
              V RS +
Sbjct  376   AVSRSSS  382



>gb|EPS69372.1| fasciclin-like arabinogalactan protein 19, partial [Genlisea 
aurea]
Length=327

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 251/312 (80%), Gaps = 2/312 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+   NIT+ILA H   STFN YLT+THLA EI+RR+TITV V++NAAM+D+L KH+ L 
Sbjct  14    TSDAHNITRILADHPSLSTFNHYLTITHLAGEIDRRRTITVCVVDNAAMDDLLSKHFPLP  73

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKNILS HV ADYF  KKLH + +G+T T+++FQATG+A GTSGYVN+T +KGGKVGF+
Sbjct  74    TIKNILSLHVFADYFNAKKLHQVTQGSTTTSSLFQATGEAAGTSGYVNITDMKGGKVGFS  133

Query  1025  PEDNTGRFD-STFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             P D++ +   +T+VKS+ E PY I+VIQISH LSS  AEAP   PTD+N T+LMAKQGCK
Sbjct  134   PVDSSSQGPVATYVKSIAELPYDIAVIQISHILSSPEAEAPTGSPTDLNATSLMAKQGCK  193

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              F+DL+ + GADATFA +V+ GLT+FCP+   ++ FMPKYKNLS D K S++LYHGVP Y
Sbjct  194   EFSDLIIAQGADATFAQSVQGGLTIFCPSGDALKSFMPKYKNLSNDDKTSIILYHGVPIY  253

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
              +LGM +S+ NG++NTLAT G+ K+DFTVQN+G+ V LET+VVTA ITGT+ DE+PL+VF
Sbjct  254   NSLGMLKSS-NGLVNTLATEGAKKFDFTVQNNGDTVQLETKVVTATITGTLIDEDPLAVF  312

Query  488   KVDKVLLPRELF  453
             K+DKVL P ELF
Sbjct  313   KIDKVLQPTELF  324



>ref|XP_010557720.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
 ref|XP_010557721.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Tarenaya 
hassleriana]
Length=409

 Score =   410 bits (1054),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK   FSTFN YL+ THLA +INRRQTITVL ++NA M+ IL K YSLYTI+NI
Sbjct  28    NITRILAKDPSFSTFNHYLSATHLADDINRRQTITVLAVDNAGMSSILSKGYSLYTIRNI  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GTT T+TMFQATG A GTSGYVN+T LKGGKV F  +D+ 
Sbjct  88    LSLHVLVDYFGAKKLHQITDGTTSTSTMFQATGSATGTSGYVNITDLKGGKVAFGVQDDD  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              +  + ++KSV EK Y ISV+QIS  L+S  AEAP   P D+N+T+++ KQGCKAFAD++
Sbjct  148   SKLTAHYIKSVFEKAYNISVLQISQVLTSPEAEAPTPSPGDLNLTSILDKQGCKAFADMM  207

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              STGAD TF   ++ GLTVFCPTD  +  FMPK+K+LS   K +L+LYHG+P YQ+L M 
Sbjct  208   TSTGADKTFQDTIDGGLTVFCPTDGAVSKFMPKFKSLSAANKTALVLYHGIPVYQSLQML  267

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             RS GNG +NTLAT G NKYDFTVQN GEDVTLET+VVTA++TGT+ D+EPL V+K+DKVL
Sbjct  268   RS-GNGAVNTLATEGDNKYDFTVQNDGEDVTLETDVVTAQVTGTLKDQEPLIVYKIDKVL  326

Query  470   LPRELF  453
             +PRE+F
Sbjct  327   MPREIF  332



>ref|XP_011011127.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Populus 
euphratica]
Length=397

 Score =   409 bits (1052),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 202/312 (65%), Positives = 249/312 (80%), Gaps = 2/312 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT+ILAKH  FSTFN YLT+THLAAEINRRQTITVL L+NAAM+ ++ K  S+
Sbjct  21    TTVNAHNITRILAKHPQFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLISKQLSV  80

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT++N+LS HVL DYFGT+KLH +  GT LTATMFQATG APG SGYVN+T LKGGKV F
Sbjct  81    YTLRNVLSLHVLVDYFGTRKLHQITNGTELTATMFQATGSAPGASGYVNITDLKGGKVAF  140

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ D+ +VKS+ E PY IS++QIS  L+S+ AEA  +    +N+T +++ QGCK
Sbjct  141   GAEDNDGKLDAVYVKSLEEIPYNISILQISQPLNSAEAEA-PTAAPTLNVTAILSNQGCK  199

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AF+DLL ++GA  TF  NV+ GLTVFCPTD VI GFMPKYKNL+   K+SLLLYHG+P Y
Sbjct  200   AFSDLLIASGAHTTFEENVDGGLTVFCPTDPVINGFMPKYKNLTAPQKVSLLLYHGIPIY  259

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L M +++ NG++NTLAT G+NKYDFTVQN GE VTLET+V TA ITGT+ DEEPL V+
Sbjct  260   QSLQMLKTS-NGIMNTLATNGANKYDFTVQNDGEAVTLETKVTTATITGTVKDEEPLMVY  318

Query  488   KVDKVLLPRELF  453
             K++KVLLPRELF
Sbjct  319   KINKVLLPRELF  330



>ref|XP_004251538.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Solanum 
lycopersicum]
Length=387

 Score =   409 bits (1050),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 202/314 (64%), Positives = 253/314 (81%), Gaps = 3/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T+   NIT IL KH +FSTFNRYLTLTHLA+EINRRQTITV  +NNAAM+D+LDKH S+
Sbjct  18    TTSSAHNITLILTKHPEFSTFNRYLTLTHLASEINRRQTITVCAVNNAAMDDLLDKHLSI  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT+KN+LS HV ADYFG+K+LH + KGTTLTAT+FQATG+APGTSGYVN+T +KG KVGF
Sbjct  78    YTLKNVLSLHVFADYFGSKQLHRITKGTTLTATLFQATGEAPGTSGYVNITNMKGKKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             A EDN G F S FVKS+ E PY ISVIQ+S+ ++S  AEAP + P DV++  LM+K+GCK
Sbjct  138   ATEDNDGHFSSNFVKSIQEIPYNISVIQLSNIITSPAAEAPVAAPADVDLIDLMSKKGCK  197

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              FA LL +T     F   +E GLTVFCP DKV+  F+PKYKNL+K+G++SLLLYHG+P Y
Sbjct  198   EFAKLLQNTQISKQFIDLMENGLTVFCPIDKVVNNFLPKYKNLTKNGQISLLLYHGIPDY  257

Query  668   QNLGMFRSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              +LGM R+  NG +NT+AT  G +NKYDF+++N G++V LET VVTAKITGT+ DEEP++
Sbjct  258   HSLGMLRAK-NGFINTMATTKGKNNKYDFSIKNDGDNVKLETNVVTAKITGTLLDEEPIA  316

Query  494   VFKVDKVLLPRELF  453
             V+K+DKVL P ELF
Sbjct  317   VYKIDKVLQPSELF  330



>ref|XP_004491619.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cicer 
arietinum]
Length=413

 Score =   410 bits (1053),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 243/306 (79%), Gaps = 2/306 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH DFSTFN YLT+THLA EINRRQTIT+L ++NAAM+ +LDKH S+ T+KN+
Sbjct  33    NITRILAKHPDFSTFNHYLTVTHLADEINRRQTITILAIDNAAMSSLLDKHLSVSTLKNV  92

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GTTL ++MFQATG A GT+GYVN+T LKGGKVGFA EDN 
Sbjct  93    LSLHVLVDYFGAKKLHQITNGTTLVSSMFQATGSAAGTAGYVNVTNLKGGKVGFAAEDND  152

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   S +VKSV E PY ISV+QIS  LSS+ AEAP + P+D+++ ++M+KQGCKAFADLL
Sbjct  153   G-LHSFYVKSVQEIPYVISVLQISQPLSSADAEAPTASPSDIDLISIMSKQGCKAFADLL  211

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
               + A  TF   V+ GLTVFCPTD  + GF  KYKNL+   K+SLLLYHGVP YQ+L M 
Sbjct  212   RVSKALPTFKETVDGGLTVFCPTDSAVNGFSTKYKNLTDSQKVSLLLYHGVPVYQSLQML  271

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NG++NTLAT G+NKYDFTVQN GEDV LET+V TA I GT+ D++P  V+K+ KVL
Sbjct  272   KSN-NGIMNTLATEGANKYDFTVQNDGEDVNLETKVNTANIIGTLIDQDPFVVYKISKVL  330

Query  470   LPRELF  453
             +PRELF
Sbjct  331   MPRELF  336



>ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
 sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana]
 emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana]
 gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana]
 gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana]
 dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana]
 gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
Length=403

 Score =   407 bits (1045),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL   YS
Sbjct  21    LSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYS  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LY I+NILS HVL DYFGTKKLH +  G+T TA+MFQ+TG A GTSGY+N+T +KGGKV 
Sbjct  81    LYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVA  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKSV EKPY ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  141   FGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  200

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K+LS   K +L+LYHG+P 
Sbjct  201   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKSLSPANKTALVLYHGMPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL V
Sbjct  261   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLIV  319

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  320   YKIDKVLLPREIY  332



>gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana]
Length=403

 Score =   407 bits (1045),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL   YS
Sbjct  21    LSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYS  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LY I+NILS HVL DYFGTKKLH +  G+T TA+MFQ+TG A GTSGY+N+T +KGGKV 
Sbjct  81    LYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVA  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKSV EKPY ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  141   FGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  200

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K+LS   K +L+LYHG+P 
Sbjct  201   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKSLSPANKTALVLYHGMPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL V
Sbjct  261   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLIV  319

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  320   YKIDKVLLPREIY  332



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score =   406 bits (1043),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL   YS
Sbjct  21    LSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSNGYS  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LY I+NILS HVL DYFGTKKLH +  G+T TA+MFQ+TG A GTSGY+N+T +KGGKV 
Sbjct  81    LYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTGSATGTSGYINITDIKGGKVA  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKSV EKPY ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  141   FGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  200

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K+LS   K +L+LYHG+P 
Sbjct  201   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKSLSPANKTALVLYHGMPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL V
Sbjct  261   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLIV  319

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  320   YKIDKVLLPREIY  332



>ref|XP_002320524.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa]
 gb|EEE98839.2| hypothetical protein POPTR_0014s16610g [Populus trichocarpa]
Length=397

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/312 (64%), Positives = 248/312 (79%), Gaps = 2/312 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT+ILAKH  FSTFN YLT+THLAAEINRRQTITVL L+NAAM+ ++ K  S+
Sbjct  21    TTVNAHNITRILAKHPQFSTFNHYLTVTHLAAEINRRQTITVLALDNAAMSSLISKQLSV  80

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YT++N+LS HVL DYFGT+KLH +  GT LTATMFQATG APG SGYVN+T L GGKV F
Sbjct  81    YTLRNVLSLHVLVDYFGTRKLHQITNGTELTATMFQATGSAPGASGYVNITDLNGGKVAF  140

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G+ ++ +VKS+ E PY IS++QIS  L+S+ AEA  +    +N+T +++ QGCK
Sbjct  141   GAEDNDGKLNAVYVKSLEEIPYNISILQISQPLNSAEAEA-PTAAPTLNVTAILSNQGCK  199

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AF+DLL ++GA  TF  NV+ GLTVFCPTD VI GFMPKYKNL+   K+SLLLYHG+P Y
Sbjct  200   AFSDLLIASGAHTTFEENVDGGLTVFCPTDPVINGFMPKYKNLTAPQKVSLLLYHGIPIY  259

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L M +++ NG++NTLAT G+NKYDFTVQN GE VTLET+V TA ITGT+ DEEPL V+
Sbjct  260   QSLQMLKTS-NGIMNTLATNGANKYDFTVQNDGEVVTLETKVTTATITGTVKDEEPLVVY  318

Query  488   KVDKVLLPRELF  453
             K++KVLLPRELF
Sbjct  319   KINKVLLPRELF  330



>dbj|BAE71278.1| putative fasciclin-like arabinogalactan protein FLA2 [Trifolium 
pratense]
Length=418

 Score =   405 bits (1042),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 245/312 (79%), Gaps = 2/312 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T+   NIT+ILAKH  FSTFN YLT+THLA EINRRQTIT+L ++NAAM+ +LDKH S+
Sbjct  28    ATSGSHNITRILAKHPGFSTFNHYLTITHLADEINRRQTITILAIDNAAMSSLLDKHLSV  87

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS HVL DYFG KKLH +  GTTL ++MFQATG A GT+GYVN+T LKGGKVGF
Sbjct  88    STLKNVLSLHVLVDYFGAKKLHQITNGTTLVSSMFQATGSAAGTAGYVNVTNLKGGKVGF  147

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             A EDN G   S +VKS+ E PY ISV++IS  LSS+ AEAP + P+D+++  +M+KQGCK
Sbjct  148   AAEDNDG-LHSFYVKSIEELPYVISVLEISQPLSSADAEAPTAAPSDIDLIAIMSKQGCK  206

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL  + A  TF   V+ GLTVFCPTD  + GF  KYKNL+   K+SLLLYHGVP Y
Sbjct  207   AFADLLRVSKALPTFKETVDGGLTVFCPTDSAVNGFSAKYKNLTDSKKVSLLLYHGVPVY  266

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L M +SN NG++NTLAT G+NKYDFTVQN GEDV LET+V TA I GT+ D++P  V+
Sbjct  267   QSLQMLKSN-NGIMNTLATEGANKYDFTVQNDGEDVNLETKVNTANIIGTLIDQDPFVVY  325

Query  488   KVDKVLLPRELF  453
             K++KVL+PRELF
Sbjct  326   KINKVLMPRELF  337



>ref|XP_002863317.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39576.1| hypothetical protein ARALYDRAFT_497154 [Arabidopsis lyrata subsp. 
lyrata]
Length=403

 Score =   405 bits (1040),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 244/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL K YS
Sbjct  21    LSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYS  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  81    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  141   FGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  200

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K LS   K +L+LYHG+P 
Sbjct  201   KAFSDILKSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKALSPANKTALVLYHGMPV  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL V
Sbjct  261   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLIV  319

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  320   YKIDKVLLPREIY  332



>ref|XP_010496525.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   405 bits (1040),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL + YS
Sbjct  41    FSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSRGYS  100

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DY+G KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  101   LYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  160

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  161   FGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  220

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K LS+  K  L+LYHG+P 
Sbjct  221   KAFSDVLKSTGADKTFQDTVDGGLTVFCPSDSAVSKFMPKFKTLSQANKTVLVLYHGMPV  280

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL +
Sbjct  281   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLII  339

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  340   YKIDKVLLPREIY  352



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score =   404 bits (1038),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 244/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ +   NIT+ILAK  +FSTFN YL+ THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  18    FTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYS  77

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  78    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  137

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +++  R  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  138   FGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  F PK+K LS   K +L+LYHG+P 
Sbjct  198   KAFSDMLKSTGADKTFQDTVDGGLTVFCPSDSAVGKFAPKFKALSAANKTALVLYHGMPV  257

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAKI GT+ D+EPL +
Sbjct  258   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKIMGTLKDQEPLII  316

Query  491   FKVDKVLLPRELF  453
             +KVDKVLLPRE++
Sbjct  317   YKVDKVLLPREIY  329



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score =   404 bits (1038),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 244/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ +   NIT+ILAK  +FSTFN YL+ THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  18    FTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYS  77

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  78    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  137

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +++  R  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  138   FGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  F PK+K LS   K +L+LYHG+P 
Sbjct  198   KAFSDMLKSTGADKTFQDTVDGGLTVFCPSDSAVGKFAPKFKALSAANKTALVLYHGMPV  257

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAKI GT+ D+EPL +
Sbjct  258   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKIMGTLKDQEPLII  316

Query  491   FKVDKVLLPRELF  453
             +KVDKVLLPRE++
Sbjct  317   YKVDKVLLPREIY  329



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score =   404 bits (1038),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 243/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  18    FTLSNAHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYS  77

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  78    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  137

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +++  R  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +T ++ KQGC
Sbjct  138   FGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTAILEKQGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  F PK+K LS   K +L+LYHG+P 
Sbjct  198   KAFSDMLKSTGADKTFQDTVDGGLTVFCPSDSAVGKFAPKFKALSAANKTALVLYHGMPV  257

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAKI GT+ D+EPL +
Sbjct  258   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKIMGTLKDQEPLII  316

Query  491   FKVDKVLLPRELF  453
             +KVDKVLLPRE++
Sbjct  317   YKVDKVLLPREIY  329



>emb|CDX68507.1| BnaC01g25850D [Brassica napus]
Length=401

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 245/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK+ DFSTFN YL+ THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  19    LSLSNAHNITKILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  79    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + ++KS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  139   FGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  198

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L +TGAD TF   V+ GLTVFCP+D  +  F PK+K LS   K +L+LYHG+P 
Sbjct  199   KAFSDMLKTTGADKTFQDTVDGGLTVFCPSDSAVGKFAPKFKALSAANKTALVLYHGMPV  258

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GE+VTLET+VVTAK+TGT+ D+EPL +
Sbjct  259   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEEVTLETDVVTAKLTGTLKDQEPLII  317

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  318   YKIDKVLLPREIY  330



>ref|XP_007142534.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
 gb|ESW14528.1| hypothetical protein PHAVU_008G288800g [Phaseolus vulgaris]
Length=403

 Score =   403 bits (1035),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+IL KH  FSTFN YL+ THLA EINRRQTITVL ++N AMN +LDKH SL T+KN+
Sbjct  24    NITRILEKHPGFSTFNHYLSATHLADEINRRQTITVLAIDNGAMNSLLDKHLSLPTLKNV  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +N  TTL ++MFQATG A GTSGYVN+T LKGGKVGFA EDN 
Sbjct  84    LSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGAAAGTSGYVNITNLKGGKVGFAAEDND  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   S +VKSV E PY ISV+QIS+ +SS+ AEAP + P+ +++ ++M+KQGCKAFADLL
Sbjct  144   GSLHSFYVKSVQEFPYYISVLQISNPISSADAEAPTAAPSAIDLISIMSKQGCKAFADLL  203

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
               + A  +F  +++ GLTVFCPTD  + GF PKYKNL+   K+SLLLYHGVP YQ+L M 
Sbjct  204   RGSKALPSFKESIDGGLTVFCPTDSAVNGFAPKYKNLTDSQKVSLLLYHGVPVYQSLQML  263

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +S+ NG++NTLAT G+NKYDFTVQN GEDV+L+T+V T  I GT+ D++P   +K++KVL
Sbjct  264   KSS-NGIINTLATEGANKYDFTVQNDGEDVSLKTKVNTVSIIGTLIDQDPFVAYKINKVL  322

Query  470   LPRELF  453
             +PRELF
Sbjct  323   MPRELF  328



>ref|XP_009151619.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
 emb|CDX83056.1| BnaA01g20560D [Brassica napus]
Length=401

 Score =   402 bits (1034),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 244/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AMN IL K YS
Sbjct  19    LSLSNAHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMNSILSKGYS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DYFG KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  79    LYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + ++KS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +T+++ KQGC
Sbjct  139   FGVQDDDSQLTARYIKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTSILEKQGC  198

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  F PK+K LS   K +L+LYHG+P 
Sbjct  199   KAFSDMLKSTGADKTFQDTVDGGLTVFCPSDSAVGKFAPKFKALSAANKTALVLYHGMPV  258

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GE+VTLET+VVTAK+TGT+ D+EPL +
Sbjct  259   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEEVTLETDVVTAKLTGTLKDQEPLII  317

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  318   YKIDKVLLPREIY  330



>gb|EYU42817.1| hypothetical protein MIMGU_mgv1a007557mg [Erythranthe guttata]
Length=403

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 197/307 (64%), Positives = 248/307 (81%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             N+T +LAKH DFSTFN YLT THLA EINRR+TITV  ++NAAMN++L KHYSLYT+KNI
Sbjct  27    NVTHMLAKHPDFSTFNHYLTTTHLADEINRRRTITVCAVDNAAMNELLSKHYSLYTLKNI  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED-N  1014
             LS HV ADYFG KKLH + K +T T+++FQATG+A GTSGYVN+T +KGG+VGF P D +
Sbjct  87    LSLHVFADYFGAKKLHQITKSSTTTSSLFQATGEADGTSGYVNITDMKGGRVGFTPVDSD  146

Query  1013  TGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
               +  +TFVKS+ E PY I+VIQISH LSS  AEAP +GP D N+T LMA+QGCKAF+DL
Sbjct  147   ADQPMATFVKSIEELPYDIAVIQISHILSSPEAEAPTAGPGDTNLTVLMARQGCKAFSDL  206

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             + + GA  TFA +VE GLT+FCP+D+ +  F P YKNL+ DGK S+LLYHGVP Y +LGM
Sbjct  207   ITADGAADTFAQSVEGGLTIFCPSDEALAAFAPTYKNLTADGKTSILLYHGVPIYYSLGM  266

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              RS+ NG++NTLAT G+ KYDFTVQN G +V L+T++VTA I GT+ +E+PL+V+K+DKV
Sbjct  267   LRSS-NGLMNTLATEGAKKYDFTVQNDGNEVKLKTKIVTAAIKGTLINEDPLAVYKIDKV  325

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  326   LLPKELF  332



>ref|XP_010435371.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   402 bits (1034),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 243/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS +   NIT+ILAK  DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL K YS
Sbjct  41    FSLSSAHNITRILAKDPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYS  100

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DY+G KKLH +  G+T TA+MFQ+TG A GTSGYVN+T  KGGKV 
Sbjct  101   LYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDTKGGKVA  160

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D+  +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  161   FGVQDDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  220

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+D+L STGAD TF   V+ GLTVFCP+D  +  FMPK+K LS   K  L+LYHG+P 
Sbjct  221   KAFSDVLKSTGADKTFQDTVDGGLTVFCPSDSAVSKFMPKFKTLSPANKTVLVLYHGMPV  280

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G+NK+DFTVQN GEDVTLET+VVTAK+ GT+ D+EPL +
Sbjct  281   YQSLQMLRS-GNGAVNTLATEGNNKFDFTVQNDGEDVTLETDVVTAKVMGTLKDQEPLII  339

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  340   YKIDKVLLPREIY  352



>ref|XP_003519683.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=406

 Score =   401 bits (1031),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT++LAKH  FSTFN YL+LTHLA EINRRQTITVL L+NAAM+ +LDKH SL TIKN+
Sbjct  24    NITRMLAKHPGFSTFNHYLSLTHLAEEINRRQTITVLALDNAAMSSLLDKHLSLPTIKNV  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +N  TTL ++MFQATG A GT+GYVN+T LK GKVGFA EDN 
Sbjct  84    LSLHVLVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGFAAEDND  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   S +VKSV E PY ISV+QIS  +SS+ AEAP + P+ +++ ++M+KQGCKAFADLL
Sbjct  144   GSLHSFYVKSVQEMPYYISVLQISAAISSADAEAPTAAPSAIDLISIMSKQGCKAFADLL  203

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
               + A   F  NV+ GLTVFCPTD  I GF PKYKNL++  K+SLLLYH  P Y++L M 
Sbjct  204   RGSKALPAFKENVDGGLTVFCPTDSAISGFAPKYKNLTEAQKVSLLLYHATPVYESLQML  263

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +S+ NG++NTLAT G+NKYDFTV++ GEDV+L+T+V TA I GT+ D++P   +K+++VL
Sbjct  264   KSS-NGIMNTLATEGANKYDFTVKSEGEDVSLKTKVNTASIVGTLIDQDPFVAYKINRVL  322

Query  470   LPRELF  453
             +PRELF
Sbjct  323   MPRELF  328



>ref|XP_003618047.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AET01006.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=421

 Score =   402 bits (1032),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 244/312 (78%), Gaps = 2/312 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T+   NIT+ILAKH  FSTFN YLT+THLA EINRRQTIT+L ++NAAM+ +LDKH S+
Sbjct  29    ATSGNHNITRILAKHPGFSTFNHYLTITHLADEINRRQTITILAIDNAAMSSLLDKHLSI  88

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS HVL DYFG KKLH +  GTTL ++MFQATG A GT+GYVN+T LKGGKVGF
Sbjct  89    TTLKNVLSLHVLVDYFGAKKLHQITDGTTLVSSMFQATGSAAGTAGYVNITNLKGGKVGF  148

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G   S +VKSV E PY ISV+QIS+ LSS+ AEAP + P+D+++  +M+KQGC+
Sbjct  149   GAEDNDG-LHSYYVKSVEELPYVISVLQISNPLSSADAEAPTAAPSDIDLIGIMSKQGCQ  207

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             +FADLL  + A  TF  +V+ GLTVFCPTD  + GF  KYKNL+   K+SLLLYHGVP Y
Sbjct  208   SFADLLRVSKALPTFKESVDGGLTVFCPTDTAVSGFSAKYKNLTDSQKVSLLLYHGVPVY  267

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L M +SN NGV+NTLAT G NKYDFTVQN GEDV LET+V TA I GT+ D++P  V+
Sbjct  268   QSLQMLKSN-NGVMNTLATEGHNKYDFTVQNDGEDVNLETKVNTANIVGTLIDQDPFVVY  326

Query  488   KVDKVLLPRELF  453
             K+ KVL+PRELF
Sbjct  327   KISKVLMPRELF  338



>ref|XP_006286070.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
 gb|EOA18968.1| hypothetical protein CARUB_v10007603mg [Capsella rubella]
Length=402

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 190/306 (62%), Positives = 242/306 (79%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK+ DFSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL K YSLYTI+NI
Sbjct  28    NITRILAKNPDFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYSLYTIRNI  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+G KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV F  +++ 
Sbjct  88    LSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVAFGVQEDD  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGCKAF+D+L
Sbjct  148   SKLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGCKAFSDIL  207

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              STGAD TF   V+ GLTVFCP+D  +  FMPK+K LS   K +L+LYHG+P YQ+L M 
Sbjct  208   KSTGADKTFQDTVDGGLTVFCPSDSAVGKFMPKFKALSPANKTALVLYHGMPVYQSLQML  267

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             RS GNG +NTLAT G NK+DFTVQN GEDVTLET+VVTA++ GT+ D+EPL ++K+DKVL
Sbjct  268   RS-GNGAVNTLATEGDNKFDFTVQNDGEDVTLETDVVTAEVMGTLKDQEPLIIYKIDKVL  326

Query  470   LPRELF  453
             LPRE++
Sbjct  327   LPREIY  332



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score =   400 bits (1027),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 239/306 (78%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH  FSTFN YLT THLA EINRRQTIT+  ++NA M+D+L KH S+Y +KN+
Sbjct  27    NITRILAKHPQFSTFNHYLTTTHLAYEINRRQTITICAVDNAGMSDLLSKHLSIYAMKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS+HVL DYFG KKLH +  GT L ATMFQATG A G+SG+VN+T LKGGKV F+P D  
Sbjct  87    LSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNLKGGKVVFSPADYD  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   + FVKSV E PY ISVIQIS  L S+ AEAP  GP+ +N+T+LM+  GCK FA+ L
Sbjct  147   GPPPAKFVKSVEEIPYNISVIQISTILPSAEAEAPTPGPSQMNLTSLMSAHGCKVFAETL  206

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A+ TF  NV+ GLT+FCP D  ++ F PK+KNL+ +GK SLL YHGVP YQ++   
Sbjct  207   LASPAEKTFEDNVDGGLTIFCPGDDAMKNFSPKFKNLTAEGKQSLLEYHGVPIYQSISSL  266

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NGV+NTLAT G+ KYDFTVQN GEDVTL+T+VVTAKITGT+ DE+PL++F +DKVL
Sbjct  267   KSN-NGVMNTLATDGAKKYDFTVQNDGEDVTLKTKVVTAKITGTLVDEQPLAIFSLDKVL  325

Query  470   LPRELF  453
             LP+ELF
Sbjct  326   LPKELF  331



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score =   399 bits (1026),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 241/306 (79%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             +IT+ILAKH  FSTFN YLT THLA EINRRQTITV  ++NA M+D+L KH S+Y +KN+
Sbjct  27    DITRILAKHPQFSTFNHYLTTTHLANEINRRQTITVFAVDNAGMSDLLSKHLSIYAMKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS+HVL DYFG KKLH +  GT L ATMFQATG A G+SG+VN+T +KGGKV F+P D  
Sbjct  87    LSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNVKGGKVVFSPADYD  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   + FVKSV E PY ISVIQIS  L S+ AEAP  GP+ +N+T+LM+  GCK FA+ L
Sbjct  147   GPPPAKFVKSVEEIPYNISVIQISTILPSAEAEAPTPGPSQMNLTSLMSAHGCKVFAETL  206

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A+ TF  NV+ GLT+FCP D  ++ F+PK+KNL+ +GK SLL YHGVP YQ++   
Sbjct  207   LASPAEKTFEDNVDGGLTIFCPGDDAMKNFLPKFKNLTAEGKQSLLEYHGVPIYQSISSL  266

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NGV+NTLAT G+ KYDFTVQN+GEDVTL+T+VVTAKITGT+ DE+PL++F +DKVL
Sbjct  267   KSN-NGVMNTLATDGAKKYDFTVQNNGEDVTLKTKVVTAKITGTLVDEQPLAIFSLDKVL  325

Query  470   LPRELF  453
             LP+ELF
Sbjct  326   LPKELF  331



>ref|XP_003545484.2| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Glycine 
max]
Length=443

 Score =   400 bits (1028),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 243/312 (78%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT++LA H  FSTFN YL++THLA EINRRQTITVL L+NAAM+ +LDKH SL
Sbjct  56    ATVPAHNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQTITVLALDNAAMSSLLDKHLSL  115

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              TIKN+LS H+L DYFG KKLH +N  TTL ++MFQATG A GT+GYVN+T LK GKVGF
Sbjct  116   PTIKNVLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGF  175

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             A EDN G   S +VKSV E PY ISV+QIS  +SS+ AEAP + P+ +++ ++M+KQGCK
Sbjct  176   AAEDNDGSLHSFYVKSVKEMPYYISVLQISAAISSADAEAPTAAPSAIDLISIMSKQGCK  235

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL  + A  +F  NV+ GLTVFCPTD  + GF PKYKNL++  K+SLLLYH  P Y
Sbjct  236   AFADLLRGSKALPSFKENVDGGLTVFCPTDSAVSGFAPKYKNLTEAQKVSLLLYHATPVY  295

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             ++L M +S+ NG++NTLAT G+NKYDFTVQ+ GEDV+L+T+V TA I GT+ D++P   +
Sbjct  296   ESLQMLKSS-NGIMNTLATEGANKYDFTVQSEGEDVSLKTKVNTASIVGTLIDQDPFVAY  354

Query  488   KVDKVLLPRELF  453
             K+++VL+PRELF
Sbjct  355   KINRVLMPRELF  366



>gb|KCW58153.1| hypothetical protein EUGRSUZ_H00875 [Eucalyptus grandis]
Length=391

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 200/306 (65%), Positives = 247/306 (81%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLT+THLAAEINRR TITVL ++NAAMN ILDKH S+ T+KN+
Sbjct  32    NITRILAKHPEFSTFNHYLTITHLAAEINRRLTITVLAVDNAAMNAILDKHLSVGTLKNV  91

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFGTKKLH ++ GTTLT+TMFQATG A GT+GYVN+T LKGGKVGF  EDN 
Sbjct  92    LSLHVLVDYFGTKKLHQISNGTTLTSTMFQATGAAAGTAGYVNITDLKGGKVGFGAEDNG  151

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
                ++ FVKSV E PY ISV+ IS  L+S  AEAP   P+++NIT +++KQGCK+FADL+
Sbjct  152   SDLNAVFVKSVDEIPYNISVLHISQVLTSPEAEAPTPSPSNLNITAILSKQGCKSFADLI  211

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++GA  TF  N+E GLT+FC +D  +  FMPKYKNL+   K+S +LYHGVP YQ+L M 
Sbjct  212   SASGALKTFDDNLEGGLTIFCASDAAVSAFMPKYKNLTNAQKVSFVLYHGVPVYQSLQML  271

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NGV+NTLAT G++KYDFT+QN GEDV L+T+VVTA ITGT+ D++PL V+K+DKVL
Sbjct  272   KSN-NGVMNTLATDGASKYDFTIQNDGEDVKLKTKVVTATITGTVIDQDPLIVYKIDKVL  330

Query  470   LPRELF  453
              PRELF
Sbjct  331   QPRELF  336



>ref|XP_010479980.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Camelina 
sativa]
Length=420

 Score =   398 bits (1023),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/313 (61%), Positives = 243/313 (78%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS +   NIT+ILAK  +FSTFN YL+ THLA EINRRQTITVL ++N+AM+ IL K YS
Sbjct  41    FSLSSAHNITRILAKDPEFSTFNHYLSATHLADEINRRQTITVLAVDNSAMSSILSKGYS  100

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             LYTI+NILS HVL DY+G KKLH +  G+T TA+MFQ+TG A GTSGYVN+T +KGGKV 
Sbjct  101   LYTIRNILSLHVLVDYYGAKKLHQITDGSTSTASMFQSTGSATGTSGYVNITDIKGGKVA  160

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +++  +  + +VKS+ EK Y ISV+ IS  L+S  AEAP + P+D+ +TT++ KQGC
Sbjct  161   FGVQEDDSKLTAHYVKSIFEKAYNISVLHISQVLTSPEAEAPTASPSDLILTTILEKQGC  220

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             KAF+++L STGAD TF   V+ GLTVFCP+D  +  FMPK+K LS   K  L+LYHG+P 
Sbjct  221   KAFSEILKSTGADKTFQDTVDGGLTVFCPSDSAVSKFMPKFKTLSPANKTVLVLYHGMPV  280

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M RS GNG +NTLAT G NK+DFTVQN G+DVTLET+VVTAK+ GT+ D+EPL +
Sbjct  281   YQSLQMLRS-GNGAVNTLATEGDNKFDFTVQNDGDDVTLETDVVTAKVMGTLKDQEPLII  339

Query  491   FKVDKVLLPRELF  453
             +K+DKVLLPRE++
Sbjct  340   YKIDKVLLPREIY  352



>ref|XP_010069727.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Eucalyptus 
grandis]
Length=468

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 201/310 (65%), Positives = 248/310 (80%), Gaps = 1/310 (0%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A   NIT+ILAKH +FSTFN YLT+THLAAEINRR TITVL ++NAAMN ILDKH S+ T
Sbjct  89    ADAHNITRILAKHPEFSTFNHYLTITHLAAEINRRLTITVLAVDNAAMNAILDKHLSVGT  148

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +KN+LS HVL DYFGTKKLH ++ GTTLT+TMFQATG A GT+GYVN+T LKGGKVGF  
Sbjct  149   LKNVLSLHVLVDYFGTKKLHQISNGTTLTSTMFQATGAAAGTAGYVNITDLKGGKVGFGA  208

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             EDN    ++ FVKSV E PY ISV+ IS  L+S  AEAP   P+++NIT +++KQGCK+F
Sbjct  209   EDNGSDLNAVFVKSVDEIPYNISVLHISQVLTSPEAEAPTPSPSNLNITAILSKQGCKSF  268

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             ADL+ ++GA  TF  N+E GLT+FC +D  +  FMPKYKNL+   K+S +LYHGVP YQ+
Sbjct  269   ADLISASGALKTFDDNLEGGLTIFCASDAAVSAFMPKYKNLTNAQKVSFVLYHGVPVYQS  328

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             L M +SN NGV+NTLAT G++KYDFT+QN GEDV L+T+VVTA ITGT+ D++PL V+K+
Sbjct  329   LQMLKSN-NGVMNTLATDGASKYDFTIQNDGEDVKLKTKVVTATITGTVIDQDPLIVYKI  387

Query  482   DKVLLPRELF  453
             DKVL PRELF
Sbjct  388   DKVLQPRELF  397



>ref|XP_008462050.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Cucumis 
melo]
Length=421

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 246/312 (79%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S+A   NIT+ILAKH +FSTFN YLT+THLA EINRR TITVL L+N+AM+ +LDKH+S+
Sbjct  26    SSADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSV  85

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              TIKN+LS HVL DY+G KKLH L+KGTTL++T+FQATG A GTSGYVN+T ++GGKVGF
Sbjct  86    GTIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGF  145

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G  +S +VKSV+E PY IS++QIS  ++S+ AEAP + P  +N+T ++ KQGCK
Sbjct  146   GSEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAEAPTAAPVSLNLTEVLPKQGCK  205

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AF+DLL + GA  T+  NV+ GLT+FCPT+  +  F+PKYKNL+   K+SLLLYHG+P Y
Sbjct  206   AFSDLLIAAGAIETYQSNVDGGLTMFCPTEDALNAFLPKYKNLTAAHKVSLLLYHGMPIY  265

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
              +L M +SN NGV+NTLAT G  KYDF ++  GEDV ++T+VVT+ +T T+ D EPL V+
Sbjct  266   LSLQMLKSN-NGVVNTLATDGGAKYDFVIKTDGEDVMVKTKVVTSTVTATLIDSEPLIVY  324

Query  488   KVDKVLLPRELF  453
             +VDKVL P+ELF
Sbjct  325   EVDKVLQPKELF  336



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   395 bits (1014),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 237/311 (76%), Gaps = 1/311 (0%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T    NIT ILAK+  FSTFN YLT THLAAEIN R+TITV  ++NA M ++L KH S+Y
Sbjct  24    TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMEELLSKHLSIY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN++S HVL DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF 
Sbjct  84    TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
             P +N G   +TFVKSV E PY ISVIQIS  L S+ AEAP   P+ +N+T+LM+  GC+ 
Sbjct  144   PAENHGNLPATFVKSVEEIPYNISVIQISTMLPSASAEAPTPEPSQMNLTSLMSAHGCRV  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FA+ L  + A+ TF  N + GLTVFCP D  ++ FMPK+KNL+ DGK SLL YHGVP YQ
Sbjct  204   FAETLLKSPAEKTFDENADGGLTVFCPGDDAMKNFMPKFKNLTADGKQSLLEYHGVPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             ++   +SN NGV+NTLAT G+ KYDF VQN G+ VTL+T++VTAKITGT+ DE+P+++F 
Sbjct  264   SMASLKSN-NGVMNTLATDGAKKYDFVVQNDGDTVTLKTKIVTAKITGTLIDEQPIAIFT  322

Query  485   VDKVLLPRELF  453
             ++KVL+P+ELF
Sbjct  323   INKVLMPKELF  333



>gb|ADP88924.1| fasciclin-like AGP [Gunnera manicata]
Length=393

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 250/320 (78%), Gaps = 10/320 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S ++  NITQ+LAKH +FSTFN YL++THLA EINRR+TITV  ++N+ M D+L KH S+
Sbjct  11    SRSHAHNITQMLAKHPEFSTFNHYLSVTHLADEINRRRTITVCAVDNSGMADLLAKHLSI  70

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             Y+IKN+LS H++ADYFG+KKLH +  G+ L AT+FQATG A G SG+VN+T LKGGKVGF
Sbjct  71    YSIKNVLSAHIIADYFGSKKLHQITDGSVLAATVFQATGAASGISGFVNITDLKGGKVGF  130

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                D +G  D+T+VKS++E PY ISVIQ+S+ ++S  AEAPASGP  +N+T LM KQGCK
Sbjct  131   GVVD-SGTLDATYVKSLVEMPYIISVIQLSNIMTSPDAEAPASGPGPMNLTALMEKQGCK  189

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLS--------KDGKMSLL  693
             AF++LL +TGA  TF  N++ GL VFCPTD VI GF  +YKNL+          GK+SLL
Sbjct  190   AFSELLKATGAVTTFQENLDGGLAVFCPTDSVISGFSAQYKNLTAAGNRPCCSAGKLSLL  249

Query  692   LYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMY  513
             LYHGVP Y ++G  +SN NG++NTLAT G  KYDFTVQNSGE V+L+T +VTA ITGT+ 
Sbjct  250   LYHGVPVYLSMGTLKSN-NGLINTLATDGKKKYDFTVQNSGEVVSLKTTIVTATITGTLI  308

Query  512   DEEPLSVFKVDKVLLPRELF  453
             D++PL+V+K++KVLLP+ELF
Sbjct  309   DQDPLAVYKINKVLLPKELF  328



>ref|XP_004144548.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 ref|XP_004167979.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Cucumis 
sativus]
 gb|KGN43405.1| hypothetical protein Csa_7G031660 [Cucumis sativus]
Length=418

 Score =   394 bits (1013),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 247/312 (79%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S+A   NIT+ILAKH +FSTFN YLT+THLA EINRR TITVL L+N+AM+ +LDKH+S+
Sbjct  23    SSADAHNITRILAKHPEFSTFNHYLTITHLAGEINRRLTITVLALDNSAMSALLDKHFSV  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              TIKN+LS HVL DY+G KKLH L+KGTTL++T+FQATG A GTSGYVN+T ++GGKVGF
Sbjct  83    GTIKNVLSLHVLVDYYGAKKLHQLSKGTTLSSTLFQATGSATGTSGYVNITNMRGGKVGF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               EDN G  +S +VKSV+E PY IS++QIS  ++S+ AEAP + P  +N+T ++ KQGCK
Sbjct  143   GSEDNGGDLNSFYVKSVVEMPYNISILQISKVITSADAEAPTAAPVSLNLTEVLPKQGCK  202

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AF+DLL + GA  T+  NV+ GLT+FCPT+  +  F+PKYKNL+   K+SLLLYHG+P Y
Sbjct  203   AFSDLLIAAGAIETYQSNVDGGLTMFCPTEDALNAFLPKYKNLTAAHKVSLLLYHGMPIY  262

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
              +L MF+SN NGV++TLAT G  KYDF ++  GEDV ++T+VVT+ +T T+ D EPL V+
Sbjct  263   LSLQMFKSN-NGVVSTLATDGGAKYDFVIKTDGEDVMVKTKVVTSTVTATLIDSEPLIVY  321

Query  488   KVDKVLLPRELF  453
             +VDKVL P+ELF
Sbjct  322   EVDKVLQPKELF  333



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   394 bits (1011),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 188/311 (60%), Positives = 237/311 (76%), Gaps = 1/311 (0%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T    NIT ILAK+  FSTFN YLT THLAAEIN R+TITV  ++NA M ++L KH S+Y
Sbjct  24    TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMAELLSKHLSIY  83

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             TIKN++S HVL DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF 
Sbjct  84    TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
             P +N G   +TFVKSV E PY ISVIQIS  L S+ AEAP   P+ +N+T+LM+  GC+ 
Sbjct  144   PAENHGTLPATFVKSVEEIPYNISVIQISTMLPSASAEAPTPEPSQMNLTSLMSAHGCRV  203

Query  845   FADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             FA+ L  + A+ TF  N + GLTVFCP D  ++ FMPK+KNL+ DGK SLL YHGVP YQ
Sbjct  204   FAETLLKSPAEKTFDENADGGLTVFCPGDDAMKNFMPKFKNLTADGKQSLLEYHGVPVYQ  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             ++   +SN NGV+NTLAT G+ KYDF VQN G+ VTL+T++VTAKITGT+ DE+P+++F 
Sbjct  264   SMASLKSN-NGVMNTLATDGAKKYDFVVQNDGDVVTLKTKIVTAKITGTLIDEQPIAIFT  322

Query  485   VDKVLLPRELF  453
             ++KVL+P+ELF
Sbjct  323   INKVLMPKELF  333



>ref|XP_004291803.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Fragaria 
vesca subsp. vesca]
Length=407

 Score =   391 bits (1004),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 191/314 (61%), Positives = 239/314 (76%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS A+  NIT +LAKH +FSTFNRYL+LTHLAA+IN R TITV  ++N+AM+ +L KH S
Sbjct  20    FSFAHAHNITHLLAKHPEFSTFNRYLSLTHLAADINDRTTITVCAVDNSAMSALLAKHLS  79

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +Y+IKNILS HVL DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVG
Sbjct  80    IYSIKNILSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  139

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F PEDN G F + FVKSV E PY ISVI IS  L S  AEAP  GP +VN+T +M+  GC
Sbjct  140   FTPEDNDGSFAAHFVKSVEELPYNISVIHISAVLPSPAAEAPTPGPAEVNLTGIMSAHGC  199

Query  851   KAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FA+ LL +  A  T+   V+ G+TVFCP D   + F+PKYKNLS  GK +LL YH VP
Sbjct  200   KVFAETLLANPDASKTYDDAVDGGMTVFCPGDDAFKAFLPKYKNLSAPGKAALLEYHAVP  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ++ M +SN NG++NTLAT G+ KYDFTVQN G+ VTL+ ++VTAKITGT+ DE+PL+
Sbjct  260   VYQSMSMLKSN-NGLMNTLATNGAEKYDFTVQNDGQAVTLKNKLVTAKITGTLIDEQPLA  318

Query  494   VFKVDKVLLPRELF  453
             ++ ++KVL P+EL+
Sbjct  319   IYTINKVLTPKELY  332



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score =   391 bits (1004),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 238/312 (76%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST Y  NIT+IL K+ DFSTFN YLTLT LA EINRR+TITV  ++NA M+D+L KH ++
Sbjct  24    STTYAHNITRILDKYPDFSTFNHYLTLTQLAPEINRRETITVCAVDNARMSDLLSKHLNI  83

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN+LS HVL DYF +KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF
Sbjct  84    GAIKNVLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLKGGKVGF  143

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             AP+DN G   +TFVK V   PY ISVIQIS  L S  AEAPA GP+  NIT LM+  GCK
Sbjct  144   APQDNGGVVSATFVKPVEAIPYNISVIQISSILPSPEAEAPAPGPSQTNITALMSAHGCK  203

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              FA+ L +  A+ TF  NVE+GLT+FCP D  ++ FMPKYKNL+  GK SLL YHG+P Y
Sbjct  204   VFAETLLANPAEQTFEDNVESGLTIFCPGDDAMKSFMPKYKNLTAAGKQSLLEYHGIPVY  263

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   +S+ NG+ NTLAT G++K+DFTVQN G DVT+ T++VTAKI  T+ DE+PL+++
Sbjct  264   QSLAGLKSS-NGLTNTLATDGASKFDFTVQNDGTDVTIITKIVTAKIMNTLVDEQPLAIY  322

Query  488   KVDKVLLPRELF  453
             +++KVL+P+ELF
Sbjct  323   ELNKVLMPKELF  334



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 236/306 (77%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK+  FSTFN YLT THLAAEIN R+TITV  ++NA M ++L KH S+YTIKN+
Sbjct  29    NITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIKNV  88

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             +S HVL DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF P +N 
Sbjct  89    ISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAENH  148

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   +TFVK+V E PY ISVIQIS  L S+ AEAP   P+ +NIT+LM+  GCK FA+ L
Sbjct  149   GNLPATFVKAVEEIPYNISVIQISTMLPSAAAEAPTPEPSQMNITSLMSAHGCKVFAETL  208

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              S+ A+ TF  NV+ GLTVFCP D  ++ F PK+K L+ +GK SLL YHGVP YQ++   
Sbjct  209   LSSPAEKTFDDNVDGGLTVFCPGDDAMKNFAPKFKKLTAEGKQSLLEYHGVPVYQSMDSL  268

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NGV+NTLAT GS KYDF VQN G  VTL+T++VTAKITGT+ DE+PL++F ++KVL
Sbjct  269   KSN-NGVMNTLATDGSKKYDFVVQNDGNVVTLKTKIVTAKITGTLIDEQPLAIFTINKVL  327

Query  470   LPRELF  453
             +P+ELF
Sbjct  328   MPKELF  333



>gb|ABV27481.1| fasciclin-like arabinogalactan protein 10 [Gossypium hirsutum]
Length=414

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 238/314 (76%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F T+ G NIT++LAKH   STFN YLTLTHLA EINRR TITVL L+NAAM+ +L+K+ S
Sbjct  19    FQTSNGHNITRLLAKHPSLSTFNHYLTLTHLAQEINRRTTITVLALDNAAMSSLLNKNPS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +YT+KN+LS HVL DYFG KKLH +  GT L ATMFQATG APG SG+VN+T  KGGKVG
Sbjct  79    IYTMKNVLSLHVLLDYFGAKKLHQITNGTALAATMFQATGVAPGVSGFVNITDFKGGKVG  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  EDN G  DS FVKSV E PY ISVIQIS  L S+ AEAP  GP+++NIT +M+  GC
Sbjct  139   FGAEDNGGDLDSFFVKSVEELPYNISVIQISKALPSAIAEAPTPGPSELNITGIMSAHGC  198

Query  851   KAFA-DLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FA  LL +  A  T+  N+  GLTVFCP D   + F+PKYKNL+  GK S L + GVP
Sbjct  199   KVFAGTLLANPEAMGTYEDNLNGGLTVFCPLDDAFKAFLPKYKNLTASGKESFLEFFGVP  258

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ+L M +SN NG++NTLAT G++K+DFTVQN GE VTL+T++ T KITGT+ DE+P++
Sbjct  259   VYQSLSMLKSN-NGLMNTLATDGASKFDFTVQNDGEQVTLKTKINTVKITGTLLDEQPVA  317

Query  494   VFKVDKVLLPRELF  453
             ++ +DKVL+PRELF
Sbjct  318   IYTIDKVLMPRELF  331



>gb|KHG09433.1| Fasciclin-like arabinogalactan protein 1 [Gossypium arboreum]
Length=417

 Score =   389 bits (1000),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/314 (62%), Positives = 236/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F T+   NIT++LAKH   STFN YLTLTHLA EINRR TITVL L+NAAM+ +LDK+ S
Sbjct  19    FQTSNAHNITRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDNAAMSSLLDKNPS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +YTIKNILS HVL DYFG KKLH +  GT L ATMFQATG APG SG+VN+T  KGGKVG
Sbjct  79    IYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVAPGVSGFVNITDFKGGKVG  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  EDN G  +S FVKSV E PY ISVIQIS  L S  AEAP  GP+++NIT +M+  GC
Sbjct  139   FGAEDNGGSLNSFFVKSVEELPYNISVIQISKALPSVVAEAPTPGPSELNITGIMSAHGC  198

Query  851   KAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FAD LL +  +  T+  NV  GLTVFCP D   + F+PKYKNL+   K S L + GVP
Sbjct  199   KVFADTLLANPESMRTYEDNVNGGLTVFCPMDDPFKAFLPKYKNLTASKKASFLEFFGVP  258

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ+L M +SN NG++NTLAT G++K+DFTVQN GE+VTL+T V T KITGT+ DE+P++
Sbjct  259   VYQSLSMLKSN-NGLMNTLATDGASKFDFTVQNEGEEVTLKTRVNTVKITGTLIDEQPVA  317

Query  494   VFKVDKVLLPRELF  453
             ++ +DKVL+P+ELF
Sbjct  318   IYTIDKVLMPKELF  331



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/313 (61%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              STA   NIT++L KH +FSTFN YLT THLA EINRR TITV V++N+AM+D+L K  S
Sbjct  23    ISTATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAMSDLLAKQLS  82

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +Y+IKN LS HVL DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVG
Sbjct  83    IYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  142

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D +   D+ FVKSV E PY IS+IQIS  L S  AEAP   P+++N+T +M+  GC
Sbjct  143   FGLQD-SDDIDAMFVKSVEEVPYNISIIQISKILPSQVAEAPTPSPSEMNLTGIMSAHGC  201

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             K FA+ L ++ A  TF  N   GLTVFCP D V + F+PKYKNL+  GK+SLL YHG+P 
Sbjct  202   KVFAETLQASDAVKTFQENAIGGLTVFCPLDDVFKAFLPKYKNLTAAGKISLLEYHGLPV  261

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y ++ M +SN NGV NTLAT G+NKYDF VQN GE VTL+T+VVTAKITGT+ DE+P+++
Sbjct  262   YNSMSMLKSN-NGVTNTLATDGANKYDFVVQNDGEVVTLQTKVVTAKITGTLLDEQPVAI  320

Query  491   FKVDKVLLPRELF  453
             + +DKVL PRELF
Sbjct  321   YTIDKVLKPRELF  333



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 237/312 (76%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT+ILAK+  FSTFN YLT THLAAEIN R+TITV  ++NA M ++L KH S+
Sbjct  23    NTTEAHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSI  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
             YTIKN++S HVL DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKV F
Sbjct  83    YTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVAF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
              P +N G   +TFVK+V E PY ISVIQIS  L S+ AEAP   P+ +NIT+LM+  GCK
Sbjct  143   GPAENHGNLPATFVKAVEEIPYNISVIQISTMLPSAAAEAPTPEPSQMNITSLMSAHGCK  202

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              FA+ L S+ A+ TF  NV+ GLTVFCP D  ++ F PK+K L+ +GK SLL YHGVP Y
Sbjct  203   VFAETLLSSPAEKTFDDNVDGGLTVFCPGDDAMKNFAPKFKKLTAEGKQSLLEYHGVPVY  262

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q++   +SN NGV+NTLAT GS KYDF VQN G  VTL+T++VTAKITGT+ DE+PL++F
Sbjct  263   QSMDSLKSN-NGVMNTLATDGSKKYDFVVQNDGNVVTLKTKIVTAKITGTLIDEQPLAIF  321

Query  488   KVDKVLLPRELF  453
              ++KVL+P+ELF
Sbjct  322   TINKVLMPKELF  333



>ref|XP_010689281.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=402

 Score =   388 bits (997),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/308 (59%), Positives = 243/308 (79%), Gaps = 2/308 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
              FNIT+IL KH +FSTFN YLT THLA EIN RQTIT+L L+N+AM+ +L K  +L+T++
Sbjct  24    AFNITKILKKHPEFSTFNEYLTQTHLANEINHRQTITILALDNSAMSSLLSKGLTLFTLR  83

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N+LS HVL DY+G KKLH +  GTT+TA++FQ++GDA G SGYVN+T + GGKV FAP D
Sbjct  84    NVLSLHVLVDYYGAKKLHQITDGTTVTASLFQSSGDADGNSGYVNITDMHGGKVAFAPAD  143

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
              TG  +S FVK+++E PY +SVIQIS  L S+ AEAP   P+ VN+T+L+A +GCK F+ 
Sbjct  144   -TGDLNSFFVKTLVEMPYNLSVIQISAVLDSATAEAPTPEPSKVNLTSLLAAKGCKEFSR  202

Query  836   LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             LL STGAD TF  N+++GLTVFC  D  ++ FMPK++NL+   K ++LLYHGVP + ++ 
Sbjct  203   LLSSTGADKTFQENIDSGLTVFCAGDAAVKAFMPKFRNLTAGNKTAVLLYHGVPVFNSMA  262

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             M +S+ NG++NTLAT G+NKYDFTVQN  E VTL+T+VVTAKITGT+ D++P++ +K+DK
Sbjct  263   MLKSS-NGIMNTLATDGANKYDFTVQNDDETVTLKTKVVTAKITGTLVDKDPVAAYKLDK  321

Query  476   VLLPRELF  453
             VLLPRELF
Sbjct  322   VLLPRELF  329



>gb|ABV27482.1| fasciclin-like arabinogalactan protein 11 [Gossypium hirsutum]
Length=417

 Score =   389 bits (999),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 236/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F T+   N+T++LAKH   STFN YLTLTHLA EINRR TITVL L+NAAM+ +LDK+ S
Sbjct  19    FQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDNAAMSSLLDKNPS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +YTIKNILS HVL DYFG KKLH +  GT L ATMFQATG A G SG+VN+T  KGGKVG
Sbjct  79    IYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGFVNITDFKGGKVG  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  EDN G  +S FVKSV E PY ISVIQIS  L S  AEAP  GP+++NIT +M+  GC
Sbjct  139   FGAEDNGGSLNSFFVKSVEELPYNISVIQISKALPSVVAEAPTPGPSELNITGIMSAHGC  198

Query  851   KAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FAD LL +  A  T+  NV  GLTVFCP D   + F+PKYKNL+   K S L + GVP
Sbjct  199   KVFADTLLANPEAMGTYEDNVNGGLTVFCPMDDPFKAFLPKYKNLTASKKASFLEFFGVP  258

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ+L M +SN NG++NTLAT G++K+DFTVQN GE+VTL+T V TAKITGT+ DE+P++
Sbjct  259   VYQSLSMLKSN-NGLMNTLATDGASKFDFTVQNEGEEVTLKTRVNTAKITGTLIDEQPVA  317

Query  494   VFKVDKVLLPRELF  453
             ++ +DKVLLP+ELF
Sbjct  318   IYTIDKVLLPKELF  331



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 250/309 (81%), Gaps = 3/309 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT ILAK+ +FSTF+ YLT+THLA EINRRQTITVL ++NA M D+L KH S+Y I
Sbjct  25    HAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVI  84

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS HVL DYFG +KLH +  GT  +AT+FQ+TG APGT+G+VN+T LK GKVGF  +
Sbjct  85    KNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQ  144

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             D +G  ++ FVKSV+E PY ISV++IS  L+S+ AEAPA  P+ +N+T +++KQGCKAF 
Sbjct  145   D-SGHLNAYFVKSVVEIPYNISVLEISQILTSAVAEAPAEAPS-LNLTIMLSKQGCKAFG  202

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             DLL+++GA  TF  N + GLTVFCP+D VI+GFMPKYKNL+  GK+SLLLYHG+P YQ++
Sbjct  203   DLLEASGAIKTFEENADGGLTVFCPSDDVIKGFMPKYKNLTAAGKVSLLLYHGIPIYQSM  262

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M +S+ NGV NTLAT G+ KYDFTVQ  GED+TLET+VVTA++TGT+ D+EP+ ++K++
Sbjct  263   QMLKSS-NGVTNTLATDGAKKYDFTVQTEGEDITLETKVVTARVTGTVLDQEPVVLYKIN  321

Query  479   KVLLPRELF  453
             KVLLPRELF
Sbjct  322   KVLLPRELF  330



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 237/312 (76%), Gaps = 1/312 (0%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST+   NIT+ILAK  +FSTFN YLT+T LA EINRR+TITV  ++NA M D+L KH +L
Sbjct  23    STSDAHNITRILAKFPEFSTFNHYLTVTQLAPEINRRETITVCAVDNAGMADLLSKHLTL  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN+LS HVL DYF  KKLH +  GT L ATMFQATG A G+SG+VN+T LKGGKVGF
Sbjct  83    GALKNVLSLHVLLDYFDAKKLHEITDGTALAATMFQATGSATGSSGFVNITDLKGGKVGF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             +PEDN G   +TFVK+V   PY ISVIQIS  L S  AEAPA GP+ +N+T LM+  GCK
Sbjct  143   SPEDNGGVVSATFVKTVQAIPYNISVIQISTILPSPEAEAPAPGPSQMNLTALMSAHGCK  202

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              FA+ L +  A+ TF  N+E+GLT+FCP D  ++GFMPKYKNLS  GK SLL YHG+P Y
Sbjct  203   VFAETLLANPAEQTFEDNIESGLTIFCPGDDAMKGFMPKYKNLSAAGKQSLLEYHGIPIY  262

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   RS+ NG+ NTLAT G+NKYDFTVQN G DVT++T++ TAKI  T+ D +PL+++
Sbjct  263   QSLSGLRSS-NGLTNTLATDGANKYDFTVQNDGTDVTIKTKIATAKIINTLIDVQPLAIY  321

Query  488   KVDKVLLPRELF  453
             +++KVLLP+ELF
Sbjct  322   ELNKVLLPKELF  333



>gb|AIY35291.1| fasciclin-like arabinogalactan 11 [Gossypium hirsutum]
Length=417

 Score =   387 bits (993),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/314 (61%), Positives = 236/314 (75%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F T+   N+T++LAKH   STFN YLTLTHLA EINRR TITVL L+NAAM+ +LDK+ S
Sbjct  19    FQTSNAHNVTRLLAKHPSLSTFNHYLTLTHLAPEINRRTTITVLALDNAAMSSLLDKNPS  78

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +YTIKNILS HVL DYFG KKLH +  GT L ATMFQATG A G SG+VN+T  KGGKVG
Sbjct  79    IYTIKNILSLHVLLDYFGAKKLHQIRNGTALAATMFQATGVATGVSGFVNITDFKGGKVG  138

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  EDN G  +S FVKSV E PY ISVIQIS  L S  AEAP  GP+++NIT +M+  GC
Sbjct  139   FGAEDNGGSLNSFFVKSVEELPYNISVIQISKALPSVVAEAPTPGPSELNITGIMSAHGC  198

Query  851   KAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FAD LL +  A  T+  NV  GLTVFCP D   + F+PKYKNL+   K S L + GVP
Sbjct  199   KVFADTLLANPEAMGTYEDNVNGGLTVFCPMDDPFKAFLPKYKNLTASKKASFLEFFGVP  258

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ+L M +SN +G++NTLAT G++K+DFTVQN GE+VTL+T V TAKITGT+ DE+P++
Sbjct  259   VYQSLSMLKSN-SGLMNTLATDGASKFDFTVQNEGEEVTLKTRVNTAKITGTLIDEQPVA  317

Query  494   VFKVDKVLLPRELF  453
             ++ +DKVL+P+ELF
Sbjct  318   IYTIDKVLMPKELF  331



>gb|AEI98736.1| fasciclin-like arabinogalactan 2 [Pisum sativum]
Length=433

 Score =   387 bits (993),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 242/332 (73%), Gaps = 21/332 (6%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT++LA H  FSTFN YL++THLA EINRRQTITVL L+NAAM+ +LDKH SL
Sbjct  20    ATVPAHNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQTITVLALDNAAMSSLLDKHLSL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              TIKN+LS H+L DYFG KKLH +N  TTL ++MFQATG A GT+GYVN+T LK GKVGF
Sbjct  80    PTIKNVLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGYVNITNLKAGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             A EDN G   S +VKSV E PY ISV+QIS  +SS+ AEAP + P+ +++ ++M+KQGCK
Sbjct  140   AAEDNDGSLHSFYVKSVQEMPYYISVLQISAAISSADAEAPTAAPSAIDLISIMSKQGCK  199

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             AFADLL  + A   F  NV+ GLTVFCPTD  I GF PKYKNL++  K+SLLLYH  P Y
Sbjct  200   AFADLLRGSKALPAFKENVDGGLTVFCPTDSAISGFAPKYKNLTEAQKVSLLLYHATPVY  259

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDV--------------------TLET  549
             ++L M +S+ NG++NTLAT G+NKYDFTV++ GEDV                    +L+T
Sbjct  260   ESLQMLKSS-NGIMNTLATEGANKYDFTVKSEGEDVSLKTKVNTASIVGTLIDQDPSLKT  318

Query  548   EVVTAKITGTMYDEEPLSVFKVDKVLLPRELF  453
             +V TA I GT+ D++P   +K+++VL+PRELF
Sbjct  319   KVNTASIVGTLIDQDPFVAYKINRVLMPRELF  350



>ref|XP_004148925.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 ref|XP_004170859.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Cucumis 
sativus]
 gb|KGN44020.1| Fasciclin-like arabinogalactan protein 11 [Cucumis sativus]
Length=415

 Score =   386 bits (991),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 187/313 (60%), Positives = 236/313 (75%), Gaps = 2/313 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              +TA   NIT++L KH +FSTFN YLT THLA EINRR TITV V++N+AM+D+L K  S
Sbjct  23    IATATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAMSDLLAKQLS  82

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +Y+IKN LS HVL DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVG
Sbjct  83    IYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  142

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  +D +   D+ +VKSV E PY IS+IQIS  L S  AEAP   P+++N+T +M+  GC
Sbjct  143   FGLQD-SDDIDAMYVKSVEEVPYNISIIQISKILPSQVAEAPTPSPSEMNLTGIMSAHGC  201

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             K FA+ L ++ A  TF  N   GLTVFCP D V + F+PKYKNL+  GK+SLL YHG+P 
Sbjct  202   KVFAETLQASDAVKTFQENAIGGLTVFCPLDDVFKAFLPKYKNLTAAGKISLLEYHGLPV  261

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y ++ M +SN NG+ NTLAT G+NKYDF +QN GE VTL+T+VVTAKITGT+ DE+P+++
Sbjct  262   YNSMSMLKSN-NGITNTLATDGANKYDFVIQNDGEVVTLQTKVVTAKITGTLLDEQPVAI  320

Query  491   FKVDKVLLPRELF  453
             + +DKVL PRELF
Sbjct  321   YTIDKVLKPRELF  333



>ref|XP_007020499.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
 gb|EOY12024.1| Fasciclin-like arabinogalactan protein 1 [Theobroma cacao]
Length=411

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 190/312 (61%), Positives = 237/312 (76%), Gaps = 2/312 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T+ G N+T++LAKH   STFN YLTLTHLA+EINRR TITVL L+NAAM+ +L  + S+Y
Sbjct  22    TSNGHNVTRLLAKHPSLSTFNHYLTLTHLASEINRRTTITVLALDNAAMSSLLATNPSIY  81

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             T+KNILS HVL DYFGTKKLH +  GT L ATMFQATG APG +G+VN+T  KGGKVGF 
Sbjct  82    TLKNILSLHVLLDYFGTKKLHQIRNGTALAATMFQATGVAPGVAGFVNITDFKGGKVGFG  141

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
              EDN G+ DS FVKSV E PY ISVIQIS  L S+ AEAP  GP+++NIT +M+  GCK 
Sbjct  142   AEDNGGKLDSFFVKSVEELPYNISVIQISKALPSAVAEAPTPGPSELNITGIMSAHGCKV  201

Query  845   FAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             FAD LL +  A  T+  NV  GLTVFCP D   + F+PKYKNL+   + S L + GVP Y
Sbjct  202   FADTLLANHEAIGTYEDNVNGGLTVFCPLDDPFKAFLPKYKNLTASKQSSFLEFFGVPVY  261

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             Q+L   +SN NG++NTLAT G++K+DFTVQN GE+VTL+T+V T KITGT+ DE+P++++
Sbjct  262   QSLSTLKSN-NGIMNTLATDGASKFDFTVQNEGEEVTLKTKVNTVKITGTLLDEQPVAIY  320

Query  488   KVDKVLLPRELF  453
              +DKVL+P ELF
Sbjct  321   TIDKVLMPSELF  332



>ref|XP_010063266.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW70477.1| hypothetical protein EUGRSUZ_F03689 [Eucalyptus grandis]
Length=409

 Score =   383 bits (983),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/314 (60%), Positives = 236/314 (75%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + A   NIT++LAKH +FSTFN YLT THLAAEIN R TITV+ L+NAAM+ +L  H ++
Sbjct  22    TVARAHNITRLLAKHPEFSTFNHYLTETHLAAEINSRTTITVMALDNAAMSRLLAPHPTI  81

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS HVL DYFG KKLH +  GT L AT+FQATG APG++G+VN+T LKGGKVGF
Sbjct  82    ATLKNVLSLHVLLDYFGPKKLHQITNGTALAATLFQATGSAPGSTGFVNITDLKGGKVGF  141

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             APEDN GR D+ FVK + E PY IS+IQIS+ L S  A AP  GP+++N+T LM+  GCK
Sbjct  142   APEDNNGRLDTYFVKGLEEIPYNISIIQISNALPSDVAAAPTPGPSEMNLTRLMSAHGCK  201

Query  848   AFADLLDSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
              FAD LD+  ADA  T+  NVE GLT FCP D   + F+PKYKNLS  GK S L +  +P
Sbjct  202   VFADTLDA-NADAMKTYEDNVEGGLTTFCPLDDPFKQFLPKYKNLSAPGKASFLEFFAIP  260

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y ++ M +SN NG +NTLAT G++KYDFTVQN GE+VTL+T V   KITGT+ DE+PL+
Sbjct  261   MYLSMAMLKSN-NGPMNTLATDGASKYDFTVQNDGEEVTLKTRVNKVKITGTLLDEQPLA  319

Query  494   VFKVDKVLLPRELF  453
             ++ +DKVL+P+ELF
Sbjct  320   IYSIDKVLMPKELF  333



>ref|XP_002316776.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
 gb|EEE97388.2| hypothetical protein POPTR_0011s09590g [Populus trichocarpa]
Length=408

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 230/309 (74%), Gaps = 2/309 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT IL KH  FSTFN YLTLTHLA EIN R TITV  ++NAAM+++L KH S+ TIK
Sbjct  23    GHNITHILGKHPSFSTFNHYLTLTHLAGEINSRNTITVCAVDNAAMSELLSKHPSIATIK  82

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             NILS HVL DYFGTKKLH + +GT L ATMFQATG APG++G+VN+T +KGGKV F PED
Sbjct  83    NILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPED  142

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             N G  D  +VKS+ E PY ISVIQIS  L S  A AP   P+ +NIT +M+  GCK FAD
Sbjct  143   NEGNLDVFYVKSLEEIPYNISVIQISKVLPSDVAAAPTPEPSAMNITDIMSAHGCKVFAD  202

Query  836   -LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
              L+ +  A  T+  +V+ GLTVFCP D   + F PK+KNL+  GK+S L + GVP YQ+L
Sbjct  203   TLIANPEASKTYQDSVDGGLTVFCPLDDPFKAFFPKFKNLTASGKVSFLEFFGVPIYQSL  262

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M +SN NG++NTLAT G  K+DFTVQN GEDVTL+T  +TAKI GT+ DE+PL+++ +D
Sbjct  263   AMLKSN-NGIMNTLATDGEKKFDFTVQNDGEDVTLKTRSITAKIVGTLIDEQPLAIYTID  321

Query  479   KVLLPRELF  453
             KVLLP+ELF
Sbjct  322   KVLLPKELF  330



>emb|CAN61077.1| hypothetical protein VITISV_012919 [Vitis vinifera]
Length=407

 Score =   381 bits (979),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 249/309 (81%), Gaps = 3/309 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT ILAK+ +FSTF+ YLT+THLA EINRRQTITVL ++NA M D+L KH S+Y I
Sbjct  25    HAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVI  84

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS HVL DYFG +KLH +  GT  +AT+FQ+TG APGT+G+VN+T LK GKVGF  +
Sbjct  85    KNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQ  144

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             D +G  ++ FVKSV+E PY ISV++IS  L+S+ AEAPA  P+ +N+T +++KQGCKAF 
Sbjct  145   D-SGHLNAYFVKSVVEIPYNISVLEISQILTSAVAEAPAEAPS-LNLTIMLSKQGCKAFG  202

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             DLL+++GA  TF  N + GLTVF P+D VI+GFMPKYKNL+  GK+SLLLYHG+P YQ++
Sbjct  203   DLLEASGAIKTFEENADGGLTVFXPSDDVIKGFMPKYKNLTAAGKVSLLLYHGIPIYQSM  262

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M +S+ NG+ NTLAT G+ KYDFTVQ  GED+TLET+VVTA++TGT+ D+EP+ ++K++
Sbjct  263   QMLKSS-NGLTNTLATDGAKKYDFTVQTEGEDITLETKVVTARVTGTVLDQEPVVLYKIN  321

Query  479   KVLLPRELF  453
             KVLLPRELF
Sbjct  322   KVLLPRELF  330



>gb|KDP39270.1| hypothetical protein JCGZ_01027 [Jatropha curcas]
Length=404

 Score =   381 bits (978),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 185/307 (60%), Positives = 233/307 (76%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             N+T++LAKH   STFN YLT+THLA EINRR TITV  ++NAAM+++L KH S+YTIKNI
Sbjct  24    NVTRLLAKHPSLSTFNHYLTITHLAGEINRRTTITVCAVDNAAMSELLSKHPSIYTIKNI  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T +KGGKV F PEDN 
Sbjct  84    LSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPEDND  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G+    FVKSV E PY IS+IQIS  L S  AEAP   P+ +N+T +M+  GCK FAD L
Sbjct  144   GKLGVYFVKSVEEVPYNISIIQISKILPSDVAEAPTPEPSQMNLTDIMSAHGCKVFADTL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L +  A  T+  NV+ GLTVFCP D   + F+PK+KNL+  GK S L + GVP YQ+L M
Sbjct  204   LANPEAAKTYQDNVDGGLTVFCPLDDPFKAFLPKFKNLTAAGKTSFLEFFGVPIYQSLSM  263

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG++NTLAT G++K+DFTVQN GE+VTL+T+  TAKI GT+ DE+PL+++ ++KV
Sbjct  264   LKSN-NGLMNTLATDGASKFDFTVQNDGEEVTLKTKSTTAKIVGTLIDEQPLAIYTINKV  322

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  323   LLPKELF  329



>ref|XP_002267825.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Vitis vinifera]
Length=405

 Score =   380 bits (977),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 236/306 (77%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILAK+ +FSTFN YLT+THLA EIN R+TITV  ++N  M+D+L K  S+Y IKN+
Sbjct  30    NITSILAKNPEFSTFNHYLTVTHLANEINLRETITVCAVDNPGMSDLLAKGLSIYAIKNV  89

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYFG KKLH +  GT L ATM+QATG APG+SG+VN+T LKGGKVGF    N 
Sbjct  90    LSLHILLDYFGAKKLHQITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFGAGGND  149

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   +TFVKSV E PY ISVIQIS  L S  AEAP  GP++ N+T LM+  GCK FAD L
Sbjct  150   GDLTATFVKSVEEIPYNISVIQISKILPSEEAEAPTPGPSEQNLTALMSAHGCKVFADTL  209

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A  T+  N+E GLTVFCP D V + F+PKYKNL+ DGK+SLLLYHG+P YQ+L + 
Sbjct  210   VASDAQKTYEDNLEGGLTVFCPMDDVFKSFLPKYKNLTADGKLSLLLYHGIPVYQSLSLL  269

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +S+ NGV+NTLAT G+ KYDFTVQN GE VTL+T++VTA+ITGT+ DE+PL +F +DKVL
Sbjct  270   KSS-NGVMNTLATDGAKKYDFTVQNDGEVVTLKTKIVTARITGTLLDEQPLGIFTIDKVL  328

Query  470   LPRELF  453
             LP+ELF
Sbjct  329   LPKELF  334



>ref|XP_011010616.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=407

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 231/309 (75%), Gaps = 2/309 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT+IL KH  FSTFN YLTLTHLA EIN + TITV  ++NAAM+++L KH S+ TIK
Sbjct  23    GHNITRILGKHPSFSTFNHYLTLTHLAGEINSKTTITVCAVDNAAMSELLSKHPSIATIK  82

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             NILS HVL DYFGTKKLH + +GT L ATMFQATG APG++G+VN+T +KGGKV F P+D
Sbjct  83    NILSLHVLLDYFGTKKLHQIREGTALAATMFQATGSAPGSAGFVNITDVKGGKVAFGPKD  142

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             N G  D  +VKS+ E PY ISVIQIS  L S  A AP   P+ +NIT +M+  GCK FAD
Sbjct  143   NEGNLDVFYVKSLEEIPYNISVIQISKVLPSDVAAAPTPEPSAMNITDIMSAHGCKVFAD  202

Query  836   -LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
              L+ +  A  T+  N++ GLTVFCP D   + F PK+KNL+  GK+S L + GVP YQ+L
Sbjct  203   TLIANPEASKTYQDNIDGGLTVFCPLDDPFKAFFPKFKNLTASGKVSFLEFFGVPMYQSL  262

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M +SN NG++NTLAT G  K+DFTVQN GEDVTL+T  +TAKI GT+ DE+PL+++ +D
Sbjct  263   AMLKSN-NGIMNTLATDGEKKFDFTVQNDGEDVTLKTRSITAKIVGTLIDEQPLAIYTID  321

Query  479   KVLLPRELF  453
             KVLLP+ELF
Sbjct  322   KVLLPKELF  330



>ref|XP_002298869.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
 gb|EEE83674.2| hypothetical protein POPTR_0001s37650g [Populus trichocarpa]
Length=406

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 228/310 (74%), Gaps = 2/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             YG NIT IL +H   STFN YLTLTHLA EINRR TITV  ++NAAM++IL K  S+ TI
Sbjct  21    YGHNITSILGQHPSLSTFNHYLTLTHLAGEINRRTTITVCAVDNAAMSEILSKKPSISTI  80

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFGTKKLH +  GT L ATMFQATG APG++G+VN+T +KGGKV F P+
Sbjct  81    KNILSLHVLLDYFGTKKLHQIRDGTALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPK  140

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             DN G  D  +VKSV E PY ISVIQIS  L S  A AP   P+ +NIT +M+  GCK FA
Sbjct  141   DNGGNLDVFYVKSVEEIPYNISVIQISKLLPSDVAAAPTPEPSAMNITDIMSAHGCKVFA  200

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             D L+ +  A  T+   ++ GLTVFCP D   + F+PK+KNL+  GK SLL + GVP YQ+
Sbjct  201   DTLIANPDASKTYQDTIDGGLTVFCPLDDPFKAFLPKFKNLTASGKESLLQFFGVPVYQS  260

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             L M +SN NG++NTLAT G  K+DFTVQN GEDVTL+T   TAKI GT+ DE+PL+++ +
Sbjct  261   LAMLKSN-NGIMNTLATNGDKKFDFTVQNDGEDVTLKTRGTTAKIVGTLIDEQPLAIYSI  319

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  320   DKVLLPKELF  329



>ref|XP_011038795.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Populus 
euphratica]
Length=406

 Score =   380 bits (975),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 228/310 (74%), Gaps = 2/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             YG NIT IL KH   STFN YLTLTHLA EINRR TITV  ++NAAM++IL K  S+ TI
Sbjct  21    YGHNITSILGKHPSLSTFNHYLTLTHLAGEINRRTTITVCAVDNAAMSEILSKKPSISTI  80

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFGTKKLH +  G+ L ATMFQATG APG++G+VN+T +KGGKV F P+
Sbjct  81    KNILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGSAPGSTGFVNITDVKGGKVAFGPK  140

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             DN G  D  +VKSV E PY ISVIQIS  L S  A AP   P+ +NIT +M+  GCK FA
Sbjct  141   DNGGSLDVFYVKSVEEIPYNISVIQISKLLPSDVAAAPTPEPSAMNITDIMSAHGCKVFA  200

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             D L+ +  A  T+   ++ GLTVFCP D   + F+PK+KNL+  GK SLL + GVP YQ+
Sbjct  201   DTLIANPDASKTYKDTIDGGLTVFCPLDDPFKAFLPKFKNLTASGKESLLQFFGVPVYQS  260

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             L M +SN NG++NTLAT G  K+DFTVQN GEDVTL+T   TAKI GT+ DE+PL+++ +
Sbjct  261   LAMLKSN-NGIMNTLATNGDKKFDFTVQNDGEDVTLKTRGTTAKIVGTLIDEQPLAIYSI  319

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  320   DKVLLPKELF  329



>ref|XP_010943291.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=412

 Score =   379 bits (972),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 235/310 (76%), Gaps = 3/310 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT+ILA+H +FSTFN YLT THLA EINRR+TIT+LV++NA M  +L KH SLYT+K
Sbjct  24    GHNITKILAEHPEFSTFNHYLTATHLAGEINRRKTITILVVSNADMAPLLAKHLSLYTLK  83

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N+LS HVL DYFG KKLH LN G   ++T+FQATG A GT+G+VN+T  + G+V FA  D
Sbjct  84    NVLSLHVLVDYFGAKKLHQLNGGAAASSTLFQATGSAQGTAGFVNITNHRAGRVSFAAVD  143

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
               G     FVKS+ E  Y I+VIQIS  LSS  AEAP   P  VN+TTLM+K+GCK FAD
Sbjct  144   AGGAPPVNFVKSIKEISYDIAVIQISSVLSSPEAEAPTPAPAQVNLTTLMSKKGCKTFAD  203

Query  836   LLDSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             LL +TG A+ TF  NV  GLTVFCP D+ ++ FMPK+KNL+ DGK+S+LLYHG+P Y ++
Sbjct  204   LLVATGDAEKTFESNVGGGLTVFCPIDQAMKAFMPKFKNLTADGKLSVLLYHGIPVYNSI  263

Query  659   GMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
              M +SN NGV+NTLAT GS K Y+FTVQN GE VTL+T V  A ITGT+ DE+PL+V+ +
Sbjct  264   QMLKSN-NGVVNTLATDGSAKNYNFTVQNDGEVVTLKTRVTVATITGTLIDEDPLAVYTI  322

Query  482   DKVLLPRELF  453
             D+VL PRELF
Sbjct  323   DQVLEPRELF  332



>ref|XP_002522745.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39596.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   378 bits (970),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 184/307 (60%), Positives = 232/307 (76%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT++L+ H  FSTFN YLT+THLA EINRR TITV  ++N AM+ +L KH S+YTIKN+
Sbjct  28    NITRLLSHHPSFSTFNHYLTITHLADEINRRTTITVCAIDNTAMSALLSKHPSIYTIKNM  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T +KGGKV F PEDN 
Sbjct  88    LSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDIKGGKVAFGPEDND  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G     FVKS+ E PY IS+IQIS+ L S  A AP   P+ +N+T +M+  GCK FAD L
Sbjct  148   GNLGVFFVKSLEEVPYNISIIQISNFLPSDVAAAPTPEPSRMNLTDMMSAHGCKFFADTL  207

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L +  A +T+  N++ GLTVFCP D   + F+PKYKNL+  GK+S L + GVP YQ+L M
Sbjct  208   LANPEASSTYQDNIDGGLTVFCPLDDPFKAFLPKYKNLTAAGKVSFLEFFGVPIYQSLSM  267

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NGV+NTLAT G+NK+DFTVQN GEDVTL+T+  TAKI GT+ DE+PL+++ ++KV
Sbjct  268   LKSN-NGVMNTLATDGANKFDFTVQNDGEDVTLKTKTATAKIIGTLIDEQPLAIYTINKV  326

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  327   LLPKELF  333



>ref|XP_010104070.1| hypothetical protein L484_014256 [Morus notabilis]
 gb|EXB98271.1| hypothetical protein L484_014256 [Morus notabilis]
Length=369

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 192/306 (63%), Positives = 243/306 (79%), Gaps = 15/306 (5%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK+  +STFN YLT THLAAEINRR TITVLV++NAAM+ +L K YS+YTI+N 
Sbjct  28    NITRILAKYPQYSTFNSYLTKTHLAAEINRRLTITVLVVDNAAMSTLLAKGYSVYTIRN-  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
                          KLH L+KGTTL+ ++FQA+G A GT+GYVN+T LK GKVGF  EDN 
Sbjct  87    -------------KLHQLSKGTTLSPSLFQASGTATGTAGYVNITNLKAGKVGFGVEDND  133

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G  +S FVKS+ E PY ISV+QIS  L+S+ AEAP + P+++N+TT+++KQGCKAFADLL
Sbjct  134   GHLNSHFVKSIKEIPYNISVLQISQILTSAEAEAPTAAPSELNLTTILSKQGCKAFADLL  193

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              +TGAD TF  N+E GLTVFCPTD VI+GFMP+YKNL+   K SLLLYHG+P Y+++ M 
Sbjct  194   KATGADTTFQTNIEAGLTVFCPTDGVIKGFMPRYKNLTAPKKTSLLLYHGIPVYESIQML  253

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             + N NGV+NTLAT  +NKYDFTVQ  GED+TLET+VVTAK+ GT+ D+EPL+V+K++KVL
Sbjct  254   KDN-NGVVNTLATDHANKYDFTVQTDGEDLTLETKVVTAKVLGTLIDQEPLAVYKLNKVL  312

Query  470   LPRELF  453
             LP+ELF
Sbjct  313   LPKELF  318



>ref|XP_004244059.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=411

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 180/306 (59%), Positives = 231/306 (75%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILA H  FSTFN YLT THLAAEINRRQTITV  ++NA M+D+L K  S+YTIKN+
Sbjct  27    NITHILADHKQFSTFNHYLTTTHLAAEINRRQTITVCAVDNAGMSDLLSKQLSIYTIKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS+HVL DYF  KKLH +  GT L ATMFQATG A G+SG+VN+T L+GGKVG +P D  
Sbjct  87    LSFHVLLDYFDAKKLHQITNGTALAATMFQATGSATGSSGFVNITDLRGGKVGLSPADYN  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   + FVKS+ E PY ISVIQIS  L S  AEAP  GP+ +N+T+LM+ +GCK FA+ L
Sbjct  147   GPPPAKFVKSIAEIPYNISVIQISTILPSDEAEAPTPGPSQMNLTSLMSAKGCKVFAETL  206

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A+ TF  NV+ G+T+FCP D  ++ F+PK+KNL+ +GK SLL YHG+P YQ++   
Sbjct  207   LASPAEKTFEDNVDGGVTIFCPRDDAMKKFLPKFKNLTAEGKQSLLEYHGIPIYQSISNL  266

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NG +NTLAT G+ KY   +QN GEDVT++T++VTAKIT T+ D+ PL+++ +DKVL
Sbjct  267   KSN-NGDMNTLATDGAKKYAVVIQNDGEDVTIKTKIVTAKITATVVDKLPLAIYSLDKVL  325

Query  470   LPRELF  453
             LP ELF
Sbjct  326   LPEELF  331



>ref|XP_006346133.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=409

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 181/306 (59%), Positives = 233/306 (76%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILA H  FSTFN YLT THLA EINRRQTITV V++NA M+D+L KH S+ TIKN+
Sbjct  27    NITHILANHTQFSTFNHYLTTTHLATEINRRQTITVCVVDNAGMSDLLSKHLSINTIKNV  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS+HVL DYF  KKLH +  GT L AT+FQATG A G+SG+VN+T LKGGKVGF+P D  
Sbjct  87    LSFHVLLDYFDAKKLHQITNGTALAATIFQATGSATGSSGFVNITDLKGGKVGFSPADYN  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   + FVKS+ E PY ISVIQIS  L S  AEAP  GP+ +N+T+LM+ +GCK FA+ L
Sbjct  147   GPPPAKFVKSIEEIPYNISVIQISTILPSDEAEAPTPGPSQMNLTSLMSAKGCKVFAETL  206

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A+ TF  NV+ GLT+FCP D  ++ F+PK+KNL+ +GK SLL YHG+P YQ++   
Sbjct  207   LASPAEKTFDDNVDGGLTIFCPGDDAMKKFLPKFKNLTAEGKQSLLEYHGIPIYQSISNL  266

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NG +NTLAT G+ KY   +QN GE+VT++T++VTAKIT T+ D+ PL+++ +DKVL
Sbjct  267   KSN-NGDMNTLATDGAKKYAVVIQNDGEEVTIKTKIVTAKITATLVDKLPLAIYSLDKVL  325

Query  470   LPRELF  453
             LP+ELF
Sbjct  326   LPKELF  331



>ref|XP_008788906.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=481

 Score =   377 bits (967),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 233/308 (76%), Gaps = 3/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILA+H +FSTFN YLT THLA EINRR+TITVL ++N  M  +L KH  LYT+KN+
Sbjct  97    NITKILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNTGMAPLLAKHLPLYTLKNV  156

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +N GT  ++T+FQATG A GT+G+VN+T  + G+V FA ED  
Sbjct  157   LSLHVLVDYFGAKKLHQINGGTAASSTLFQATGAASGTAGFVNITNHRAGRVSFAAEDVG  216

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
                   FVKS+ E PY ++VIQIS  LSS  AEAP   P  VN+TTLM+K+GCK FADLL
Sbjct  217   DAPPVNFVKSIKEIPYDLAVIQISSVLSSPEAEAPTPAPAQVNLTTLMSKKGCKTFADLL  276

Query  830   DSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              +TG A+ TF  NV  GLTVFCP D+ ++ FMPK+KNL+ DGK+S+LLYHG+P Y ++ M
Sbjct  277   VATGDAEKTFESNVGGGLTVFCPIDQAMKAFMPKFKNLTADGKLSVLLYHGIPVYNSIQM  336

Query  653   FRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
              +SN NGV+NTLAT GS K Y+FTVQN GE VTL+T V  A ITGT+ DE+PL+V+ +D+
Sbjct  337   LKSN-NGVVNTLATDGSTKNYNFTVQNDGEVVTLKTRVTVATITGTLIDEDPLAVYTIDQ  395

Query  476   VLLPRELF  453
             VL PRELF
Sbjct  396   VLEPRELF  403



>emb|CBI28444.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 193/352 (55%), Positives = 249/352 (71%), Gaps = 22/352 (6%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT ILAK+ +FSTF+ YLT+THLA EINRRQTITVL ++NA M D+L KH S+Y I
Sbjct  138   HAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAGMADLLSKHLSVYVI  197

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS HVL DYFG +KLH +  GT  +AT+FQ+TG APGT+G+VN+T LK GKVGF  +
Sbjct  198   KNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVNITDLKHGKVGFGAQ  257

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             D +G  ++ FVKSV+E PY ISV++IS  L+S+                    QGCKAF 
Sbjct  258   D-SGHLNAYFVKSVVEIPYNISVLEISQILTSA--------------------QGCKAFG  296

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             DLL+++GA  TF  N + GLTVFCP+D VI+GFMPKYKNL+  GK+SLLLYHG+P YQ++
Sbjct  297   DLLEASGAIKTFEENADGGLTVFCPSDDVIKGFMPKYKNLTAAGKVSLLLYHGIPIYQSM  356

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M +S+ NGV NTLAT G+ KYDFTVQ  GED+TLET+VVTA++TGT+ D+EP+ ++K++
Sbjct  357   QMLKSS-NGVTNTLATDGAKKYDFTVQTEGEDITLETKVVTARVTGTVLDQEPVVLYKIN  415

Query  479   KVLLPRELFkaagksgsessggapgpnSDDDGVPSDQAAGHRNGGVRRSGAW  324
             KVLLPRELF+   +     S  A  P SDD    +       +GG    G W
Sbjct  416   KVLLPRELFEGTVEDDEAESPKAASPKSDDSEDSTADQDDENSGGRFDGGRW  467



>ref|XP_007146643.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
 gb|ESW18637.1| hypothetical protein PHAVU_006G057400g [Phaseolus vulgaris]
Length=420

 Score =   371 bits (953),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 194/307 (63%), Positives = 236/307 (77%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILA+H +FSTFN YLTLTHLA EIN R TITV  ++NAAM+++L KH S+YTIKNI
Sbjct  28    NITRILAQHPEFSTFNHYLTLTHLAPEINGRTTITVCAVDNAAMDELLSKHPSIYTIKNI  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG++G+VN+T L GGKVGF  E+N 
Sbjct  88    LSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAENND  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   STFVKSV E PY ISVIQIS  L S+ AEAPA  PT  N+T++M+K GCK FAD L
Sbjct  148   GTLTSTFVKSVEEMPYNISVIQISKILPSAAAEAPAPAPTQQNLTSIMSKHGCKVFADTL  207

Query  830   DSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              S G A  TF  N+  GLTVFCP D   + F+PK+KNL+  GK++LL +HGVP YQ+L  
Sbjct  208   SSFGDALTTFNDNLGGGLTVFCPLDDAFKAFLPKFKNLTASGKLALLEFHGVPVYQSLAT  267

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG+ NTLAT G+NK+DFTVQN GEDVTL T + TAKIT T+ D++PL+VF ++KV
Sbjct  268   LKSN-NGLQNTLATDGANKFDFTVQNDGEDVTLNTRLTTAKITDTIIDQQPLAVFAINKV  326

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  327   LLPKELF  333



>ref|XP_008809683.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=410

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 234/315 (74%), Gaps = 3/315 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
                ++G NIT+ILA H +FSTFN YLT THLA EINRR+TITVL ++NA M  +L KH +
Sbjct  20    IQVSHGHNITEILADHPEFSTFNNYLTATHLAGEINRRKTITVLAVSNAGMAPLLAKHLT  79

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +  +KN+LS HVL DYFG K LH LN GT  ++++FQATG APGT+G+VN+T  + G+V 
Sbjct  80    VSALKNVLSLHVLVDYFGAKNLHQLNGGTAASSSLFQATGTAPGTTGFVNITNHRAGRVS  139

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F+ ED        FVKS+ E  Y ++VI+IS  LSS  AEAP   P  VNITTLM+K+GC
Sbjct  140   FSAEDVADSAPVNFVKSIEEISYDLAVIEISSVLSSPEAEAPTPAPAQVNITTLMSKKGC  199

Query  851   KAFADLLDSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K FADLL +TG A+ TF  NV  GLTVFCP D+ ++ FMPK+KNL+ DGK+S+LLYHG+P
Sbjct  200   KTFADLLVATGDAEMTFESNVGGGLTVFCPIDRAMKAFMPKFKNLTADGKLSVLLYHGIP  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
              Y ++ M +SN NGV+NTLAT G+ K Y+FTVQN GE VTL+T V+ A ITGT+ DE+PL
Sbjct  260   VYNSIQMLKSN-NGVVNTLATDGTAKNYNFTVQNDGEVVTLKTTVMVATITGTLIDEDPL  318

Query  497   SVFKVDKVLLPRELF  453
             +V+ +D VL PRELF
Sbjct  319   AVYMIDAVLEPRELF  333



>ref|XP_009375067.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Pyrus x 
bretschneideri]
Length=411

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 238/307 (78%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT++LAKH +FSTFN YLTLTHLAA+IN R TITV  ++N+AM+ +L KH S+Y+IKNI
Sbjct  27    NITRLLAKHPEFSTFNHYLTLTHLAADINDRTTITVCAVDNSAMSVLLSKHLSIYSIKNI  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATMFQATG A G+SG+VN+T LKGGKVGF+PEDN 
Sbjct  87    LSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAAGSSGFVNITDLKGGKVGFSPEDND  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G F S FVKSV E PY IS+IQIS  L +  AEAP   P ++NIT +M+  GCK FAD L
Sbjct  147   GNFPSHFVKSVEEVPYNISIIQISTLLPNQAAEAPTPAPAELNITGIMSAHGCKIFADTL  206

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L ++ A  T+  N+  GLTVFCP D   + F+PK+KNL+  GK +LL YHG+P YQ++ M
Sbjct  207   LATSDAFKTYEDNLGGGLTVFCPMDDAFKAFLPKFKNLTVAGKAALLEYHGIPVYQSMSM  266

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG++NTLAT G++K+DFTVQN G+ VTL T++VTA+ITGT+ DE+P++++ +DKV
Sbjct  267   LKSN-NGLMNTLATDGASKFDFTVQNDGQQVTLRTKLVTARITGTLIDEQPVAIYTIDKV  325

Query  473   LLPRELF  453
             L P+ELF
Sbjct  326   LQPKELF  332



>ref|XP_007212310.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
 gb|EMJ13509.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
Length=398

 Score =   368 bits (945),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 239/307 (78%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLTLTHLAAEIN+  TITV  ++N+AM+ +L K  S+YTIKNI
Sbjct  27    NITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIKNI  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF P+DN 
Sbjct  87    LSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFTPQDND  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G F + FVKSV E PY ISVI IS  L S  AEAPA GP ++NIT++M+  GCK FAD L
Sbjct  147   GTFPAHFVKSVEELPYNISVIHISSILPSQAAEAPAPGPAELNITSIMSAHGCKVFADTL  206

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L +  A  T+  NV  GLTVFCP D   + F+PK+KNL++ GK +LL YHGVP YQ++  
Sbjct  207   LANPDAFKTYEDNVGGGLTVFCPMDDAFKAFLPKFKNLTRAGKAALLEYHGVPVYQSMAT  266

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG+ NTLAT G++K+DFTVQN G++VTL+T++VTAKITGT+ DE+P++++ +DKV
Sbjct  267   LKSN-NGLQNTLATDGASKFDFTVQNDGQEVTLKTKIVTAKITGTLIDEQPVAIYTIDKV  325

Query  473   LLPRELF  453
             L P+ELF
Sbjct  326   LQPKELF  332



>ref|XP_010928138.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Elaeis guineensis]
Length=399

 Score =   368 bits (945),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 235/310 (76%), Gaps = 7/310 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT+ILA+H +FSTFN YLT THLA EINRR+TITVL ++NA M  +L KH ++Y +K
Sbjct  25    GHNITEILAEHPEFSTFNHYLTATHLAGEINRRKTITVLAVSNAGMAPLLAKHLNVYALK  84

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N LS HVL DYFG +KLH LN GT  ++++FQATG APGT+G+VN+T  + G+V FA + 
Sbjct  85    NALSLHVLVDYFGAQKLHQLNGGTAASSSLFQATGAAPGTTGFVNITNHRAGRVSFAADS  144

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
                   + FVKS+ E  Y +++IQIS  LSS  AEAP   P  VN+TTLMAK+GCK FAD
Sbjct  145   A----PANFVKSIKEISYDLAIIQISSALSSPEAEAPTPAPAQVNLTTLMAKKGCKTFAD  200

Query  836   LLDSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             LL +TG A+ TF  NV  GLTVFCP D+ ++ FMPK+KNL+ DGK+S+LLYHG+P Y ++
Sbjct  201   LLVATGDAENTFESNVGGGLTVFCPIDQTMKAFMPKFKNLTADGKLSVLLYHGIPVYNSI  260

Query  659   GMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
              M +S+ NGV+NTLAT G+ K Y+FTVQN GE VTL+T V+ AKITGT+ DE+PL+V+ +
Sbjct  261   QMLKSS-NGVVNTLATDGTAKNYNFTVQNDGEVVTLKTPVMLAKITGTLIDEDPLAVYTI  319

Query  482   DKVLLPRELF  453
             D VL PRELF
Sbjct  320   DAVLEPRELF  329



>gb|EYU27439.1| hypothetical protein MIMGU_mgv1a007268mg [Erythranthe guttata]
Length=413

 Score =   369 bits (946),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 233/310 (75%), Gaps = 1/310 (0%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A   NIT IL K+ +FSTF+ YLT+T LA EINRR+TITV  ++NA M+D+L KH S+  
Sbjct  28    AKAHNITHILEKNPEFSTFSHYLTVTQLAPEINRRETITVCAVDNAGMSDLLAKHLSIGG  87

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             I+N+LS HVL DYF  KKLH +  GT L ATM+QATG+A G++G+VN+T LKGGKVGF+P
Sbjct  88    IRNVLSLHVLLDYFDAKKLHQITDGTALAATMYQATGEATGSAGFVNITDLKGGKVGFSP  147

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             +D+ G   +TFVK+V   PY ISVIQIS  L S  AEAPA GP+  NIT LM+  GCK F
Sbjct  148   QDSGGGVSATFVKTVEAIPYNISVIQISSILPSPEAEAPAPGPSQTNITALMSAHGCKVF  207

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             A+ L +  A+ TF  NVE+GLT+FCP D  ++GF+PK+KNL+ DGK SLL +HG+P YQ 
Sbjct  208   AETLLANPAEQTFETNVESGLTIFCPGDDAMKGFLPKFKNLTADGKQSLLEFHGMPIYQT  267

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             L   +S+ NG+ NTLAT G+ +YDFTVQN G +VT+ T V TAKIT T+ +E P+++++V
Sbjct  268   LQGLKSS-NGLANTLATDGARRYDFTVQNDGTEVTIVTGVATAKITNTLVEETPVAIYQV  326

Query  482   DKVLLPRELF  453
             +KVL+P+ELF
Sbjct  327   NKVLMPKELF  336



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/306 (58%), Positives = 231/306 (75%), Gaps = 2/306 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILA+  +FSTFN +LT THLA +IN R+TITV  ++NA M D+L KH S++ +KN+
Sbjct  31    NITKILAEFPEFSTFNHFLTTTHLANDINNRETITVCAVDNAGMADLLGKHLSIFALKNV  90

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG+SG+VN+T LKGGKVGF   DN 
Sbjct  91    LSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNITDLKGGKVGFGAVDN-  149

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G  D+TFVKSV E PY ISVIQIS  L S  AEAP  GP+ +NIT +M+  GCK FA+ L
Sbjct  150   GGIDATFVKSVKEIPYNISVIQISKILPSPDAEAPTPGPSQMNITGIMSAHGCKVFAETL  209

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              ++ A+ TF  +V+ GLT+FCP D  ++ F+PK+KNL+ DGK SLL +HGVP Y+     
Sbjct  210   LASPAEQTFDSSVDGGLTIFCPGDAAMKSFLPKFKNLTADGKQSLLEFHGVPIYEPESSL  269

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             +SN NG +NTLAT G+ K+   VQN G+ VTL+T +VTA+IT T++DE+PL++F++DKVL
Sbjct  270   KSN-NGPINTLATDGAKKFGLVVQNDGQQVTLKTPLVTARITSTIFDEQPLAIFELDKVL  328

Query  470   LPRELF  453
             LPRELF
Sbjct  329   LPRELF  334



>dbj|BAE75863.1| putative fasciclin-like arabinogalactan protein [Salicornia europaea]
Length=427

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/319 (57%), Positives = 231/319 (72%), Gaps = 11/319 (3%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT+ILAK  DFS+FN YLT THLA EIN RQTITVL ++NAAM  +  KH  + T+
Sbjct  24    HAHNITKILAKFPDFSSFNHYLTTTHLAPEINTRQTITVLAIDNAAMASLTSKHLPISTL  83

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP-  1023
             KNILS HVL DYFG KKLH +  G+ L ATM+QATG APGT+G+VN+T LKGGKVGFA  
Sbjct  84    KNILSLHVLLDYFGAKKLHQITDGSALAATMYQATGSAPGTAGFVNITDLKGGKVGFAAT  143

Query  1022  --------EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLM  867
                      D+T   +STF+KS+ E PY ISVIQISH LSS  AEAP+  P   NIT +M
Sbjct  144   NPASDEGDSDSTPSLNSTFIKSLKEIPYNISVIQISHILSSPTAEAPSPAPEATNITGIM  203

Query  866   AKQGCKAFADLLDS-TGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLL  690
             +  GCK FAD L S   A   F  N E GLTVFCP+D   +GF+P +KNL+K+ K SLLL
Sbjct  204   SAHGCKEFADTLTSFPDALEVFTTNTEGGLTVFCPSDDAFKGFLPNFKNLTKEEKNSLLL  263

Query  689   YHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYD  510
             +HG+P Y ++ + +++ NGV+NTLAT G NK+DFTVQN+G+ VTL+T+ VTA IT T+ D
Sbjct  264   FHGIPVYNSMALLKTS-NGVMNTLATDGKNKFDFTVQNAGQKVTLKTKAVTATITATLLD  322

Query  509   EEPLSVFKVDKVLLPRELF  453
             E+P++++ +DKVL P E+F
Sbjct  323   EDPVAIYTIDKVLKPSEIF  341



>ref|XP_003532178.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Glycine 
max]
Length=415

 Score =   365 bits (938),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 191/308 (62%), Positives = 234/308 (76%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILAKH + STFN YLTLTHLA EIN + TITV  ++NAAM+D+L KH S+YT+KN+
Sbjct  23    NITSILAKHPELSTFNHYLTLTHLAPEINGKTTITVCAVDNAAMSDLLSKHPSIYTVKNV  82

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG++G+VN+T L GGKV FAPE+N 
Sbjct  83    LSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVAFAPENND  142

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   STFVKSV E PY ISVIQIS  L S+ AEAPA  PT  N+T +M+K GCK FAD L
Sbjct  143   GTLSSTFVKSVEEIPYNISVIQISKVLPSAAAEAPAPAPTQQNLTNIMSKHGCKVFADTL  202

Query  830   DSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
              S   DA  TF  N++ GLTVFCP D   + F+PK+KNL+K GK +LL +H VP YQ+  
Sbjct  203   -SAQPDALNTFNDNLDGGLTVFCPLDDAFKAFLPKFKNLTKSGKAALLEFHAVPVYQSKA  261

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +SN NG+ NTLAT G+NK+DFTVQN GEDVTL+T++ TAKIT T+ DE+PL++F ++K
Sbjct  262   TLKSN-NGLQNTLATDGANKFDFTVQNDGEDVTLKTKLTTAKITDTLIDEQPLAIFAINK  320

Query  476   VLLPRELF  453
             VL P+ELF
Sbjct  321   VLQPKELF  328



>ref|XP_006844054.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
 gb|ERN05729.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
Length=392

 Score =   365 bits (936),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 189/313 (60%), Positives = 234/313 (75%), Gaps = 1/313 (0%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              S   G NIT+ILA+  +FS FN YL+ THLA+EINRR TITVL ++NAAM+DIL K+Y 
Sbjct  15    ISATSGHNITKILAQFHEFSKFNDYLSRTHLASEINRRTTITVLAVDNAAMDDILAKNYG  74

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             +Y IKNILS H+L DYFG KKLH +  GT L AT++Q TG APGTSG+VN+T  KGGKV 
Sbjct  75    IYEIKNILSLHILLDYFGAKKLHQITNGTALAATLYQTTGSAPGTSGFVNITDEKGGKVS  134

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                +DN G  D+++VKSV E PY ISV+Q+S  L+S  AEAPA  PT+ N+T +M K+GC
Sbjct  135   IGADDNGGVLDASYVKSVKELPYNISVLQVSKILNSPSAEAPAPAPTEQNLTAVMTKKGC  194

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             K FAD L +TGA+ TF   V  GLT FCPTD +   F+PKYKNLS D K+SLLL+HGVP 
Sbjct  195   KLFADQLTATGAEKTFVDAVSGGLTAFCPTDDIWTKFVPKYKNLSADHKVSLLLFHGVPI  254

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ++   +SN NG +NTLAT G+  Y  TVQN GE VTL+T+ VTAKITGT+ DE+PL+V
Sbjct  255   YQSMQGLKSN-NGPMNTLATDGAASYSVTVQNDGEQVTLKTKAVTAKITGTIIDEDPLAV  313

Query  491   FKVDKVLLPRELF  453
             F +DKVL P+ELF
Sbjct  314   FSIDKVLQPKELF  326



>ref|XP_008227156.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Prunus mume]
Length=412

 Score =   365 bits (937),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/307 (61%), Positives = 237/307 (77%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH +FSTFN YLTLTHLAAEIN+  TITV  ++N+AM+ +L K  S+YTIKNI
Sbjct  27    NITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIKNI  86

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYFG KKLH +  GT L ATMFQATG APG++G+VN+T LKGGKVGF P+DN 
Sbjct  87    LSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFTPQDND  146

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G F + FVKSV E PY ISVI IS  L S  AEAPA GP ++NIT++M+  GCK FAD L
Sbjct  147   GTFPAHFVKSVEELPYNISVIHISSILPSQAAEAPAPGPAELNITSIMSAHGCKVFADTL  206

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L +  A  T+  NV  GLTVFCP D   + F+PK+KNL++ GK SLL YH VP YQ++  
Sbjct  207   LANPDAFKTYEDNVGGGLTVFCPMDDAFKAFLPKFKNLTRAGKASLLEYHAVPVYQSMAT  266

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG+ NTLAT G++K+DFTVQN G++VTL+T++VT KITGT+ DE+P++++ +DKV
Sbjct  267   LKSN-NGLQNTLATDGASKFDFTVQNDGQEVTLKTKIVTGKITGTLIDEQPVAIYTIDKV  325

Query  473   LLPRELF  453
             L P+ELF
Sbjct  326   LQPKELF  332



>gb|AGV54413.1| fasciclin-like arabinogalactan protein 1-like protein [Phaseolus 
vulgaris]
Length=420

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 189/307 (62%), Positives = 234/307 (76%), Gaps = 2/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILA+H +FSTFN YLTLTHLA EIN R TITV  ++NAAM+++L KH S+YTIKNI
Sbjct  28    NITRILAQHPEFSTFNHYLTLTHLAPEINGRTTITVCAVDNAAMDELLSKHPSIYTIKNI  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG++G+VN+T L GGKVGF  E+N 
Sbjct  88    LSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSAGFVNITDLHGGKVGFGAENND  147

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G   STFVKSV E PY ISVIQIS  L S+ AEAPA  PT  N+T++M+K GCK FA+  
Sbjct  148   GTLTSTFVKSVEEMPYNISVIQISKILPSAAAEAPAPAPTQQNLTSIMSKHGCKVFAENF  207

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
                + A   F  N+  GLTVFCP D   + F+PK+KNL+  GK++LL +HGVP YQ+L  
Sbjct  208   FVHSDALNNFNENLRGGLTVFCPLDDAFKAFLPKFKNLTASGKLALLEFHGVPVYQSLAT  267

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG+ NTLAT G+NK+DFTVQN GEDVTL+T + TAKIT T+ D++PL+VF ++KV
Sbjct  268   LKSN-NGLQNTLATDGANKFDFTVQNDGEDVTLKTRLTTAKITDTIIDQQPLAVFAINKV  326

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  327   LLPKELF  333



>gb|KDO59100.1| hypothetical protein CISIN_1g015356mg [Citrus sinensis]
Length=408

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S A   NIT+ILA H  FSTFN YL++THLA EINR+ TITV  ++NA M+++L KH S+
Sbjct  18    SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSI  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS H+L DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVGF
Sbjct  78    TTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               +DN G+ D+ FVKSV EKPY ISVIQIS  LSS  AEAPA GP ++N+T +M+  GCK
Sbjct  138   GAKDNGGKLDALFVKSVEEKPYNISVIQISKVLSSDVAEAPAPGPAELNLTGIMSAHGCK  197

Query  848   AFADLLDSTGADA-TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
              FAD L +    + T+      GLTVFCP D   + F+PK+KNLS   K S L + GVP 
Sbjct  198   QFADALLANADASKTYQDAAIGGLTVFCPLDDPFKAFLPKFKNLSAADKTSFLEFLGVPV  257

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M +SN NG+LNTLAT G  K+D TVQ+ GE+VTL+T+V + KITGT+ DE+P+++
Sbjct  258   YQSLSMLKSN-NGLLNTLATDGGKKFDLTVQDEGEEVTLKTKVNSVKITGTLIDEQPVAM  316

Query  491   FKVDKVLLPRELF  453
             +  DKVL+P+ELF
Sbjct  317   YTTDKVLMPKELF  329



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   362 bits (928),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 232/310 (75%), Gaps = 1/310 (0%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A   NIT IL K+ + STFN YLT+T LA EIN R+TITV  ++NA M+D+L KH ++  
Sbjct  19    ARAHNITTILDKYPELSTFNHYLTVTQLAPEINHRETITVCAVDNAGMSDLLSKHLTIGA  78

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             IKN+L+ HVL DYF  KKLH +  GT L+ATMFQATG A G+SG+VN+T L GGKVGF+P
Sbjct  79    IKNVLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITDLAGGKVGFSP  138

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             +DN G   +TFVKSV   PY ISVIQIS+ L S  AEAPA  P+++NIT LM+  GCK F
Sbjct  139   QDNGGDVAATFVKSVEAIPYNISVIQISNILPSPEAEAPAPSPSELNITALMSAHGCKVF  198

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             A+ L S  A+ TF  N+ +G+T+FCP D  ++ F+PK+KNL+ + + SLL YHG+P YQ+
Sbjct  199   AETLLSNPAEQTFEDNLLSGVTIFCPGDDAMKAFLPKFKNLTANAQQSLLEYHGIPIYQS  258

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             L   +S+ NG+ NTLAT G++KYDFTVQN G DVT+ T++VTAKIT T+ D+ P++++++
Sbjct  259   LAGLKSS-NGLTNTLATDGASKYDFTVQNDGTDVTVITKIVTAKITNTLIDQPPVAIYEL  317

Query  482   DKVLLPRELF  453
             +KVLLP ELF
Sbjct  318   NKVLLPTELF  327



>ref|XP_006474892.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Citrus 
sinensis]
Length=408

 Score =   362 bits (929),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S A   NIT+ILA H  FSTFN YL++THLA EINR+ TITV  ++NA M+++L KH S+
Sbjct  18    SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSI  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS H+L DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVGF
Sbjct  78    TTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               +DN G+ D+ FVKSV EKPY ISVIQIS  LSS  AEAPA GP ++N+T +M+  GCK
Sbjct  138   GAKDNGGKLDALFVKSVEEKPYNISVIQISKVLSSDVAEAPAPGPAELNLTGIMSAHGCK  197

Query  848   AFADLLDSTGADA-TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
              FAD L +    + T+      GLTVFCP D   + F+PK+KNLS   K S L + GVP 
Sbjct  198   QFADALLANADASKTYQDAAIGGLTVFCPLDDPFKAFLPKFKNLSAADKTSFLEFLGVPV  257

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M +SN NG+LNTLAT G  K+D TVQ+ GE+VTL+T+V + KITGT+ DE+P+++
Sbjct  258   YQSLSMLKSN-NGLLNTLATDGGKKFDLTVQDEGEEVTLKTKVNSVKITGTLIDEQPVAM  316

Query  491   FKVDKVLLPRELF  453
             +  DKVL+P+ELF
Sbjct  317   YTTDKVLMPKELF  329



>ref|XP_006452590.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
 gb|ESR65830.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
Length=460

 Score =   362 bits (929),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 231/313 (74%), Gaps = 2/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S A   NIT+ILA H  FSTFN YL++THLA EINR+ TITV  ++NA M+++L KH S+
Sbjct  70    SAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPSI  129

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+KN+LS H+L DYFG KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVGF
Sbjct  130   TTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVGF  189

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
               +DN G+ D+ FVKSV EKPY ISVIQIS  LSS  AEAPA GP ++N+T +M+  GCK
Sbjct  190   GAKDNGGKLDALFVKSVEEKPYNISVIQISKVLSSDVAEAPAPGPAELNLTGIMSAHGCK  249

Query  848   AFADLLDSTGADA-TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
              FAD L +    + T+      GLTVFCP D   + F+PK+KNLS   K S L + GVP 
Sbjct  250   QFADALLANADASKTYQDAAIGGLTVFCPLDDPFKAFLPKFKNLSAADKTSFLEFLGVPV  309

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             YQ+L M +SN NG+LNTLAT G  K+D TVQ+ GE+VTL+T+V + KITGT+ DE+P+++
Sbjct  310   YQSLSMLKSN-NGLLNTLATDGGKKFDLTVQDEGEEVTLKTKVNSVKITGTLIDEQPVAM  368

Query  491   FKVDKVLLPRELF  453
             +  DKVL+P+ELF
Sbjct  369   YTTDKVLMPKELF  381



>ref|XP_010675939.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 235/317 (74%), Gaps = 8/317 (3%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             ++  NIT+ILAK  +FSTFN YLT THLAAEIN R TITVL ++NAAMN ++ KH  + +
Sbjct  19    SHAHNITKILAKSPEFSTFNHYLTTTHLAAEINTRLTITVLAVDNAAMNALIAKHLPISS  78

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +KN+LS HVL DYFG KKLH +  GT L ATM+QATG APGTSG+VN+T LKGGKV FA 
Sbjct  79    LKNVLSLHVLLDYFGAKKLHQITDGTALAATMYQATGSAPGTSGFVNITDLKGGKVAFAA  138

Query  1022  ------EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAK  861
                   +D T   DSTFVKS+ E PY ISVIQISH LS+  A APA  P   NIT +M+ 
Sbjct  139   TKDADSDDGTLTLDSTFVKSIKEIPYNISVIQISHVLSNPDALAPAPAPELQNITDVMSA  198

Query  860   QGCKAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYH  684
              GCK+FAD L D   A   +  NVE GLTVFCP D V + F+PK+KNL+KD K SLLL+H
Sbjct  199   HGCKSFADTLTDFPDALEVYTNNVEGGLTVFCPIDDVFKSFLPKFKNLTKDEKSSLLLFH  258

Query  683   GVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEE  504
             GVP Y ++ M +S+ NG++NTLAT G  K+DFTVQN G  VTL+T++VTAK+TGT+ DE+
Sbjct  259   GVPIYYSMQMLKSS-NGLMNTLATDGKRKFDFTVQNEGRTVTLKTKIVTAKVTGTLLDEQ  317

Query  503   PLSVFKVDKVLLPRELF  453
             P++++ +DKV+ P+E+F
Sbjct  318   PVAIYTIDKVMKPKEIF  334



>ref|XP_004516114.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Cicer arietinum]
Length=478

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 232/314 (74%), Gaps = 2/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FST+   NIT+IL KH +FSTFN YLTLTHLA EIN R TITV  ++N+AM ++L KH S
Sbjct  87    FSTSNAQNITRILEKHPEFSTFNHYLTLTHLALEINTRTTITVCAVDNSAMTNLLAKHPS  146

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             + TIKNILS HVL DYFG KKLH +  GT L AT++QATG APG+SG+VN+T L+GGKVG
Sbjct  147   ISTIKNILSLHVLLDYFGAKKLHQITNGTALAATLYQATGSAPGSSGFVNITDLRGGKVG  206

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  EDN G   + +VKSV E PY ISVIQIS  L S  AEAP   P+  N+T +M+  GC
Sbjct  207   FGAEDNNGALPALYVKSVEEIPYNISVIQISQILPSPAAEAPTPAPSQQNLTAIMSVHGC  266

Query  851   KAFADLLDS-TGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             K F D L +   A +TF  N++ GLTVFCP D   + F+PK+KNL+  GK++LL +HGVP
Sbjct  267   KIFGDTLSAFHEAYSTFTDNIDGGLTVFCPVDNAFKAFLPKFKNLTAAGKLALLEFHGVP  326

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              YQ + M +SN NG++NTLAT G+ KYDF+VQN G+ +TL+T+ VTAK+T T+ D+ PL+
Sbjct  327   VYQTIAMLKSN-NGLMNTLATDGAEKYDFSVQNDGDQITLKTKAVTAKVTDTIIDDVPLA  385

Query  494   VFKVDKVLLPRELF  453
             ++ ++KVLLP ELF
Sbjct  386   IYAINKVLLPEELF  399



>ref|XP_008797603.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Phoenix 
dactylifera]
Length=414

 Score =   346 bits (887),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 237/310 (76%), Gaps = 4/310 (1%)
 Frame = -1

Query  1373  FNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKN  1194
             +NIT+ILA+H +FSTF+ YL++T LA EINRR+TITVL ++NA M  IL KH +L +++N
Sbjct  31    YNITKILAEHPEFSTFSHYLSVTRLAGEINRRRTITVLAVDNAGMASILAKHLTLESLRN  90

Query  1193  ILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED-  1017
             +L  H+LADYFG KKLH L  G+ L ++MFQATGDAPGTSGYVN+T  + GKV F P+D 
Sbjct  91    VLRLHILADYFGAKKLHQLTGGSALASSMFQATGDAPGTSGYVNITDHRAGKVTFIPKDA  150

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             + G     FVKSV E PY +SVIQIS  L+S  AEAP + P  VN+T LM+++GCKAFAD
Sbjct  151   DDGTVPVAFVKSVKEMPYDLSVIQISAVLTSPAAEAPVAAPAPVNLTDLMSRKGCKAFAD  210

Query  836   LLDS-TGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
             LL + +  + TF  +V+ GLTVFCP D  ++ FMPK+KNL+ +GK S+LLYHGVP Y ++
Sbjct  211   LLRANSDVENTFGASVDGGLTVFCPGDAAMKAFMPKFKNLTAEGKTSILLYHGVPVYYSI  270

Query  659   GMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
              M +SN NG +NTLA+ G++K +++TVQN GE VTL+T++VTA I  T+ D++PL+VF +
Sbjct  271   QMLKSN-NGAVNTLASDGTSKSFNYTVQNDGEVVTLKTKIVTATIKSTVIDQDPLAVFVI  329

Query  482   DKVLLPRELF  453
             DKVL PRELF
Sbjct  330   DKVLEPRELF  339



>ref|XP_002534396.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF27989.1| conserved hypothetical protein [Ricinus communis]
Length=336

 Score =   342 bits (877),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 169/263 (64%), Positives = 213/263 (81%), Gaps = 2/263 (1%)
 Frame = -1

Query  1241  MNDILDKHYSLYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVN  1062
             M+ +L K  S+YT++N+LS HVL DYFG KKLH +  G+TLT++MFQATG A GTSGYVN
Sbjct  1     MSSLLSKGLSVYTLRNVLSLHVLVDYFGAKKLHQITDGSTLTSSMFQATGAAAGTSGYVN  60

Query  1061  MTALKGGKVGFAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVN  882
             +T LKGGKV F  EDN G+ D+ +VKS+ E PY IS++QIS  L+S+ AEAP + P+ +N
Sbjct  61    ITDLKGGKVAFGAEDNDGKLDAMYVKSLEEIPYNISILQISEALNSAEAEAPTAAPS-LN  119

Query  881   ITTLMAKQGCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKM  702
             +T +M+KQGCKAF DLL ++GA +TF   V+ GLTVFCPTD +I+GFMPKYKNL+   K+
Sbjct  120   LTEIMSKQGCKAFTDLLKASGAQSTFEETVDGGLTVFCPTDPIIKGFMPKYKNLTAAQKV  179

Query  701   SLLLYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITG  522
             SLLLYHGVP YQ+L M +SN NG++NTLAT G+NKYDFTVQ+ GED+ LET+VVTA ITG
Sbjct  180   SLLLYHGVPVYQSLQMLKSN-NGIMNTLATDGANKYDFTVQDDGEDIKLETKVVTATITG  238

Query  521   TMYDEEPLSVFKVDKVLLPRELF  453
             T+ DEEPL V+K+DKVLLPRELF
Sbjct  239   TVKDEEPLVVYKIDKVLLPRELF  261



>gb|KEH34088.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=421

 Score =   344 bits (882),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 233/308 (76%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAKH + STFN YL+LTHLA++I+ R TITV  ++NAAM D+L KH S+ TIKNI
Sbjct  31    NITRILAKHPELSTFNHYLSLTHLASQIDSRTTITVCAVDNAAMEDLLSKHLSINTIKNI  90

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG+SG+VN+T L+GGKVGF  E+N 
Sbjct  91    LSLHVLLDYFGAKKLHQITNGTALAATMYQATGTAPGSSGFVNITDLRGGKVGFGAENND  150

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   +++VKSV E PY ISVIQIS  L S+ AEAP   P+  N+T +M+K GCK FA+ L
Sbjct  151   GALTASYVKSVEEIPYNISVIQISSVLPSAAAEAPTPAPSQQNLTVIMSKHGCKIFAETL  210

Query  830   DSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
              ST  +A  TF   ++ GL+VFCP D   + F+PK+KNL+  GK+ LL +HGVP Y ++ 
Sbjct  211   -STFHEAFNTFTDAIDGGLSVFCPADDAFKAFLPKFKNLTMSGKIDLLEFHGVPIYNSIP  269

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
             M +SN NG+++TLAT G++ YDFTVQN GE++TL+T+ VTAKI  T+ DE+PL+++ + K
Sbjct  270   MLKSN-NGLMHTLATEGASNYDFTVQNDGEEITLKTKRVTAKIIDTIIDEQPLAIYTISK  328

Query  476   VLLPRELF  453
             VLLP+ELF
Sbjct  329   VLLPQELF  336



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score =   343 bits (880),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 223/306 (73%), Gaps = 1/306 (0%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILAK+ + STFN YLT+T LA EINRR+TITV  ++N  M D+L K  ++  I+N+
Sbjct  32    NITRILAKYPELSTFNHYLTVTQLAPEINRRETITVCAVDNGGMGDLLSKRLTIGAIRNV  91

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L  HVL DYF  KKLH +  GT L ATMFQATG APG+SG+VN+T LKGGKVGF+PE+N 
Sbjct  92    LELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKVGFSPEENG  151

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   + FVKS+   PY ISVIQIS  L S  AEAPA  P+ +N+T LM+ +GCK FA+ L
Sbjct  152   GVISAYFVKSIEAIPYNISVIQISTILPSPEAEAPAPEPSQMNLTALMSARGCKVFAEAL  211

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMF  651
              +  A+ T+  N+E+GLTVFCP D  ++ F+PK+KNL+  GK SLL YH  P YQ L   
Sbjct  212   LANPAEQTYESNLESGLTVFCPGDDAMKSFIPKFKNLTAAGKQSLLEYHATPIYQTLAGL  271

Query  650   RSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVL  471
             RSN NG+ NTLAT G  KYDFTVQN G  VT++T++VTAKI  T+ D  PL+++++DKVL
Sbjct  272   RSN-NGLTNTLATDGDKKYDFTVQNDGTGVTIKTKIVTAKIVKTLVDVNPLAIYQLDKVL  330

Query  470   LPRELF  453
             +P ELF
Sbjct  331   MPPELF  336



>ref|XP_009379991.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   343 bits (880),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 225/312 (72%), Gaps = 8/312 (3%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKH--YSLYT  1203
             G NIT+ILA+H +FSTFN YLT THLA EINRR TITVL ++N AM  +L  H   SLY+
Sbjct  25    GHNITRILAQHPEFSTFNHYLTATHLAGEINRRLTITVLAVDNPAMAALLTAHPGLSLYS  84

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +K++LS HVL DYFG KKLH L  G+ LT+T+FQA+G AP T+G+VN++  + G V F+ 
Sbjct  85    LKHLLSLHVLVDYFGAKKLHQLTGGSALTSTLFQASGAAPDTAGFVNISDYRAGHVLFSA  144

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
                     S FVKSV E PY +SVIQIS  LSS  AEAP + P  VN+T LMA++GC  F
Sbjct  145   SSLPA---SAFVKSVEEIPYNLSVIQISSALSSPAAEAPVTAPAQVNLTALMARKGCATF  201

Query  842   ADLLDSTG-ADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A LL +T  A+ TFA N++ GLT FCP D+ ++ F+PK+KNL+ DGK+SLLLYH +P Y 
Sbjct  202   AGLLAATADAEQTFASNIDGGLTAFCPLDEAMKPFLPKFKNLTADGKLSLLLYHAIPVYY  261

Query  665   NLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             ++ M ++ GNGV+NTLAT G+++ Y+ TVQN G  VTL T V  A + GT+ DE+PL+V+
Sbjct  262   SVEMLKT-GNGVVNTLATDGTSRNYNLTVQNDGNQVTLRTRVTVATLMGTLIDEDPLAVY  320

Query  488   KVDKVLLPRELF  453
              +DKVL P ELF
Sbjct  321   TIDKVLEPMELF  332



>ref|XP_010545276.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=421

 Score =   342 bits (877),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 172/311 (55%), Positives = 227/311 (73%), Gaps = 4/311 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A+  N+T++LAKH  FSTF+ YLT THLA EINRR TIT+  + N+AM+DI+ K Y++ T
Sbjct  24    AHAHNVTRLLAKHPSFSTFSHYLTQTHLADEINRRTTITICAVENSAMSDIISKGYTIST  83

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             IKNILS HVL DYFG KKLH +  G+ L AT+FQATG APGT+G+VN+T L+GGKVGF P
Sbjct  84    IKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGSAPGTTGFVNITDLRGGKVGFGP  143

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             +   G   + FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK F
Sbjct  144   DG--GDLSAFFVKSLEEVPYNISIIQISKVLPSEVAAAPTPAPAEMNLTGIMSAHGCKVF  201

Query  842   AD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A+ LL + GA  T+  +VE G+TVFCP D+ ++GFMPKYKNL+   K + + +  VP Y 
Sbjct  202   AEALLANPGASKTYQESVEGGMTVFCPGDEAMKGFMPKYKNLTGPNKEAFMEFLAVPTYY  261

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             ++ M +SN NG +NTLAT G+NK++ TVQN G+DVTL T + + KIT T+ DEEPL+++ 
Sbjct  262   SMAMLKSN-NGPMNTLATDGANKFELTVQNDGDDVTLRTRIDSVKITDTLIDEEPLAIYA  320

Query  485   VDKVLLPRELF  453
              DKVLLP+ELF
Sbjct  321   TDKVLLPKELF  331



>emb|CDY28643.1| BnaC09g32320D [Brassica napus]
Length=423

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 220/310 (71%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+FN +LT THLA EINRR TITVL ++NAAM+ +  K Y + TI
Sbjct  25    HAHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTI  84

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFG KK+H +  G+ L AT+FQATG APGT+G+VN+T L+GGKVG  P+
Sbjct  85    KNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLGPD  144

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKSV E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK FA
Sbjct  145   G--GDLSSFFVKSVEEVPYNISIIQISKVLPSETASAPTPAPAEMNLTGIMSAHGCKVFA  202

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  +VE G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  203   ETLLANPGASKTYQESVEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  262

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT GS+K++ TVQN GE VTL T + T +I  T+ DE+PL+++  
Sbjct  263   MAMLKSN-NGPMNTLATDGSSKFELTVQNDGEKVTLRTRINTVQIVDTIIDEQPLAIYAT  321

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  322   DKVLLPKELF  331



>ref|XP_009388359.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=407

 Score =   341 bits (874),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 233/312 (75%), Gaps = 3/312 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A G+NIT+ILA + +FSTFN YLT+THLA+EINRR TITVL ++N  M  +L KH S+ T
Sbjct  24    AQGYNITKILAANPEFSTFNHYLTVTHLASEINRRLTITVLAVDNTGMAGLLAKHLSVLT  83

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             I+N+L+ H+L DY+G KKLH L  G+TL +++FQ++G APGT+GY+N+T  + GKV FA 
Sbjct  84    IRNVLALHILTDYYGAKKLHQLTGGSTLASSVFQSSGHAPGTTGYINITDHRAGKVTFAA  143

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             ED+ G    +FVK+V E PY ISV+Q+S  LSS  AEAP + P  VN+T LMAK+GCKAF
Sbjct  144   EDSGGAPPVSFVKAVKEMPYNISVLQVSTILSSPEAEAPVAAPAPVNLTALMAKKGCKAF  203

Query  842   AD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             AD LL        F  N+++GLTVFCP D  ++ F PKYKNL+ DGK SLLLYHG+P Y 
Sbjct  204   ADLLLARPDVLQIFQDNLDSGLTVFCPDDAAVKAFAPKYKNLTADGKASLLLYHGMPVYY  263

Query  665   NLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             +  + ++N NGV+NTLAT GSNK +++TVQ  G D+TL+T +VTA IT T+ D++P +V+
Sbjct  264   SPQLLKAN-NGVVNTLATDGSNKNFNYTVQTDGTDITLKTRIVTATITSTLIDQDPDAVY  322

Query  488   KVDKVLLPRELF  453
              +DKVL PRELF
Sbjct  323   AIDKVLQPRELF  334



>ref|XP_006603146.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Glycine max]
Length=309

 Score =   337 bits (864),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/287 (63%), Positives = 218/287 (76%), Gaps = 4/287 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+KH +FSTFN YLTLTHLA EIN + TITV  ++NAAM+D+L KH S+YTIKNI
Sbjct  23    NITTILSKHPEFSTFNHYLTLTHLAPEINGKTTITVCAVDNAAMSDLLSKHPSIYTIKNI  82

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG KKLH +  GT L ATM+QATG APG++G+VN+T L GGKVGF  E+N 
Sbjct  83    LSLHVLLDYFGAKKLHQITNGTALAATMYQATGSAPGSAGFVNITDLHGGKVGFGAENND  142

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
             G   STFVKSV E PY ISVIQIS  L S+ AEAPA  PT  N+T +M+K GCK FAD L
Sbjct  143   GTLSSTFVKSVEEIPYNISVIQISKVLPSAAAEAPAPAPTQQNLTNIMSKHGCKVFADAL  202

Query  830   DSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
              S   DA  TF  N++ GLTVFCP D   + F+PK+KNL+K GK++LL +HGVP YQ+  
Sbjct  203   -SAQPDALNTFNDNLDGGLTVFCPLDDAFKAFLPKFKNLTKSGKVALLEFHGVPVYQSKA  261

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTM  516
               +SN NG+ NTLAT G+NK+DFTVQN GEDVTL+T++ TAKIT T+
Sbjct  262   TLKSN-NGLQNTLATDGANKFDFTVQNDGEDVTLKTKLTTAKITDTL  307



>ref|XP_010061458.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Eucalyptus 
grandis]
 gb|KCW68396.1| hypothetical protein EUGRSUZ_F02049 [Eucalyptus grandis]
Length=416

 Score =   340 bits (872),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 184/309 (60%), Positives = 228/309 (74%), Gaps = 5/309 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +LA H DFSTFN YL+ THLAAEIN R TITVL ++NAAMND+L +H +  T+KNI
Sbjct  30    NITSLLAGHPDFSTFNHYLSATHLAAEINSRTTITVLAVSNAAMNDLLAEHPTTTTLKNI  89

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYFG+KKLH L  G+ L AT+FQ+TG APG+SG+VN+T LKGGKVGFAPE+  
Sbjct  90    LSLHVLLDYFGSKKLHQLTDGSALAATLFQSTGSAPGSSGFVNITDLKGGKVGFAPEEG-  148

Query  1010  GRFDST--FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             G  D+   FVKS+ E  Y ISVI+IS  L S+ A APA  P+ VN+T +MA  GCK FAD
Sbjct  149   GSSDAGAYFVKSLEELAYNISVIEISKVLPSAIAAAPAPEPSQVNVTDVMAAHGCKEFAD  208

Query  836   -LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
              LL+S+ A  T+  NV  GLT FCP D   + F PK+ NLS   + S L +   P Y ++
Sbjct  209   ALLNSSDALKTYEDNVVGGLTAFCPLDDPFKAFRPKFDNLSAADRASFLEFFATPVYMSM  268

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
              M RSN NG++NTLAT GS K+DFTVQN G+DVTL+T+V TAKITGT+ DE+PL ++ +D
Sbjct  269   SMLRSN-NGLMNTLATDGSRKFDFTVQNDGQDVTLKTKVNTAKITGTLLDEQPLVIYTLD  327

Query  479   KVLLPRELF  453
             KVLLP+ELF
Sbjct  328   KVLLPQELF  336



>ref|XP_009120095.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
 emb|CDY17354.1| BnaA10g09880D [Brassica napus]
Length=426

 Score =   340 bits (871),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 220/310 (71%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+FN +LT THLA EINRR TITVL ++NAAM+ +  K Y + T+
Sbjct  26    HAHNVTRLLASHPSFSSFNHFLTQTHLAGEINRRTTITVLAVDNAAMSALTSKGYPISTV  85

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFG KK+H +  G+ L AT+FQATG APGT+G+VN+T L+GGKVG  P+
Sbjct  86    KNILSLHVLLDYFGAKKIHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGLGPD  145

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKSV E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK FA
Sbjct  146   G--GDLSSFFVKSVEEVPYNISIIQISKVLPSETASAPTPAPAEMNLTGIMSAHGCKVFA  203

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  +VE G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  204   ETLLANPGASKTYQESVEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  263

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G++K++ TVQN GE VTL T + T +I  T+ DE+PL+++  
Sbjct  264   MAMLKSN-NGPMNTLATDGADKFELTVQNDGEKVTLRTRINTVQIVDTIIDEQPLAIYAT  322

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  323   DKVLLPKELF  332



>ref|XP_009396657.1| PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory 
subunit A beta isoform-like [Musa acuminata subsp. malaccensis]
Length=992

 Score =   353 bits (905),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 235/313 (75%), Gaps = 3/313 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
              A G NIT+ILA+H +FSTFN YLT+THLAAEINRR TITVLV+ N+ M D+L +H SL 
Sbjct  612   VAQGHNITKILAEHLEFSTFNHYLTVTHLAAEINRRLTITVLVVGNSGMADLLARHLSLL  671

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
             T++N+LS H+L DY+G KKLH L  G+TL +++FQ++G APGT+GY+N+T  + GKV F+
Sbjct  672   TLRNVLSLHILTDYYGAKKLHQLTGGSTLASSVFQSSGHAPGTTGYINITDHRAGKVTFS  731

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
               D+ G     FVKSV E PY ISV+Q+S  LSS  AEAP + P  VN+T LM+K+GCKA
Sbjct  732   AGDDGGAPPVDFVKSVKEMPYNISVLQVSTILSSPEAEAPVAAPAPVNLTELMSKKGCKA  791

Query  845   FAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
             FAD LL       TF  N+++GLTVFCP D  ++ F PKYKNL+ DGK SLLLYHGVP Y
Sbjct  792   FADLLLARPDILQTFQDNLDSGLTVFCPVDAAVKAFAPKYKNLTADGKASLLLYHGVPVY  851

Query  668   QNLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
              +  + +SN NGV+NTLAT GSNK +++TVQN G DVTLET VVTA IT T+ D++P +V
Sbjct  852   YSPQLLKSN-NGVVNTLATDGSNKNFNYTVQNDGTDVTLETRVVTATITSTLIDQDPDAV  910

Query  491   FKVDKVLLPRELF  453
             + VDKVL PRELF
Sbjct  911   YTVDKVLEPRELF  923



>ref|XP_010942271.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Elaeis guineensis]
Length=410

 Score =   337 bits (863),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/316 (55%), Positives = 233/316 (74%), Gaps = 4/316 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              +  + +NIT+ILA H +FSTFN YL+ T LA EINRR+TITVL ++N+AM  +L KH +
Sbjct  25    LAATHTYNITKILADHPEFSTFNHYLSATRLAGEINRRRTITVLAVDNSAMAPLLAKHLT  84

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L +++N+L  H+LADY+G KKLH L  G+ + ++MFQATGDAPGTSGYVN+T  + GKV 
Sbjct  85    LESLRNVLRLHILADYYGAKKLHQLTGGSAVASSMFQATGDAPGTSGYVNITDHRAGKVT  144

Query  1031  FAPED-NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQG  855
             F  +D       ++FVKSV E PY +SVI+I+  L+S  AEAP   P  VN+T LM+K+G
Sbjct  145   FIAQDAGDSTAPASFVKSVKEMPYDLSVIEINAVLTSPEAEAPVPPPAPVNLTDLMSKKG  204

Query  854   CKAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGV  678
             CKAFAD LL     + TF   V+ GLTVFCP D  ++ FMPK+KNL+ +GK SLLLYHGV
Sbjct  205   CKAFADLLLADPDVEKTFDATVDGGLTVFCPGDAAVKAFMPKFKNLTAEGKASLLLYHGV  264

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             P Y ++ M +SN NG +NTLAT G++K +++TVQN GE VTL+T++VTA I  T+ D++P
Sbjct  265   PVYYSIQMLKSN-NGAVNTLATDGTSKSFNYTVQNDGEVVTLKTKIVTATIKSTIIDQDP  323

Query  500   LSVFKVDKVLLPRELF  453
             ++VF VDKVL PRELF
Sbjct  324   VAVFVVDKVLEPRELF  339



>ref|XP_010536730.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Tarenaya 
hassleriana]
Length=427

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 223/307 (73%), Gaps = 4/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             N+T++LAKH  FSTFN YL+ THLA EINRR TITV  ++NAAM+DI+ K Y++ T+KNI
Sbjct  31    NVTRLLAKHPSFSTFNHYLSETHLANEINRRTTITVCAVDNAAMSDIISKGYTISTVKNI  90

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYFG KKLH +  G+ +   +FQATG APGTSG+VN+T L+GGKVGF P+   
Sbjct  91    LSLHILLDYFGAKKLHQIRDGSGVCXXLFQATGSAPGTSGFVNITDLRGGKVGFGPDG--  148

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD-L  834
             G   + FVKS+ E PY ISVIQIS  L S  A AP   P ++N+T +M+  GCK FA+ L
Sbjct  149   GDLSAFFVKSLEEVPYNISVIQISKVLPSDVAAAPTPAPAEMNLTGIMSAHGCKVFAETL  208

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
             L + GA  T+  +VE G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y ++ M
Sbjct  209   LANPGASKTYQESVEGGMTVFCPGDDAMKGFLPKYKNLTAPNKEAFLEFLAVPTYYSMSM  268

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              +SN NG +NTLAT G+NK++ TVQN GEDVTL+T + T KI  T+ DE+PL+++  DKV
Sbjct  269   LKSN-NGPMNTLATDGANKFELTVQNDGEDVTLKTRIDTVKIIDTLIDEQPLAIYATDKV  327

Query  473   LLPRELF  453
             LLP+ELF
Sbjct  328   LLPKELF  334



>ref|NP_200384.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 ref|NP_001190550.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 sp|Q9FM65.1|FLA1_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK20857.1|AF333970_1 fasciclin-like arabinogalactan-protein 1 [Arabidopsis thaliana]
 dbj|BAB09240.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00897.1| putative protein [Arabidopsis thaliana]
 gb|AAP37869.1| At5g55730 [Arabidopsis thaliana]
 gb|AED96673.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
 gb|AED96674.1| fasciclin-like arabinogalactan protein 1 [Arabidopsis thaliana]
Length=424

 Score =   332 bits (851),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 224/310 (72%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+F+ +LT THLA EINRR+TITV  ++NAAM+ +  K Y+L T+
Sbjct  23    HAHNVTRLLANHPSFSSFSHFLTQTHLADEINRRRTITVCAVDNAAMSALTSKGYTLSTL  82

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFGTKKLH +  G+ L AT+FQATG APGTSG+VN+T L+GGKVGF P+
Sbjct  83    KNILSLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTSGFVNITDLRGGKVGFGPD  142

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK FA
Sbjct  143   G--GDLSSFFVKSIEEVPYNISIIQISRVLPSETAAAPTPAPAEMNLTGIMSAHGCKVFA  200

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  ++E G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  201   ETLLTNPGASKTYQESLEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  260

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL+T + T KI  T+ DE+PL+++  
Sbjct  261   MAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLKTRINTVKIVDTLIDEQPLAIYAT  319

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  320   DKVLLPKELF  329



>ref|XP_006280472.1| hypothetical protein CARUB_v10026407mg, partial [Capsella rubella]
 gb|EOA13370.1| hypothetical protein CARUB_v10026407mg, partial [Capsella rubella]
Length=443

 Score =   332 bits (850),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 169/310 (55%), Positives = 223/310 (72%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+F+ YLT THLA EINRR TITV  ++NAAM  +  K Y++ T+
Sbjct  42    HAHNVTRLLASHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTISTL  101

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFGTKKLH +  G+ L ATMFQATG APGT+G+VN+T L+GGKVGF P+
Sbjct  102   KNILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFGPD  161

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
               +G   + FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK FA
Sbjct  162   --SGDLSAFFVKSIEEVPYNISIIQISKVLPSETASAPTPAPAEMNLTGIMSAHGCKVFA  219

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  TF  ++E G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  220   ETLLTNPGASKTFQESLEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  279

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL+T + T KI  T+ DE+PL+++  
Sbjct  280   MAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLKTRINTVKIVDTLIDEQPLAIYAT  338

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  339   DKVLLPKELF  348



>ref|XP_002866110.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42369.1| hypothetical protein ARALYDRAFT_495659 [Arabidopsis lyrata subsp. 
lyrata]
Length=423

 Score =   327 bits (838),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 222/310 (72%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+F+ +LT THLA EINRR TITV  ++NAAM+ +  K Y++ T+
Sbjct  23    HAHNVTRLLANHPSFSSFSHFLTQTHLADEINRRTTITVCAVDNAAMSALTSKGYTISTL  82

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFG KKLH +  G+ L AT+FQATG APGT+G+VN+T L+GGKVGF P+
Sbjct  83    KNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGFGPD  142

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK FA
Sbjct  143   G--GDLSSFFVKSIEEVPYNISIIQISRVLPSETAAAPTPAPAEMNLTGIMSAHGCKVFA  200

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  ++E G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  201   ETLLTNPGASKTYQESLEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  260

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL+T + T KI  T+ DE+PL+++  
Sbjct  261   MAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLKTRINTVKIVDTLIDEQPLAIYAT  319

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  320   DKVLLPKELF  329



>ref|XP_009418107.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=483

 Score =   328 bits (841),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 232/315 (74%), Gaps = 3/315 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F  A G NIT+ILA+H +FSTFN YL+ THLA EINRR TITVL ++NA M+D+L KH S
Sbjct  105   FPVARGHNITKILAQHPEFSTFNHYLSATHLANEINRRLTITVLAVDNAGMSDLLAKHLS  164

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L T++N+LS H+L+DY+ ++KLH L++G+T+++++FQ++G APGT+GY+N+T  + GKV 
Sbjct  165   LLTLRNVLSLHILSDYYSSRKLHQLSRGSTISSSVFQSSGHAPGTTGYINITDHRRGKVT  224

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F  ED  G   +  VKS+ E PY IS++QIS  LSS  AEAP + P  VN+T L+AK+GC
Sbjct  225   FITEDAGGAPPAVLVKSLKEIPYNISILQISTILSSPEAEAPVAAPAPVNLTVLLAKKGC  284

Query  851   KAFAD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             KAFAD LL S      F  N++ GLTVFCP+D  ++ F PKYKNL+ DGK SLLLYHGVP
Sbjct  285   KAFADLLLASPDVLQIFEDNLDVGLTVFCPSDGAVRAFGPKYKNLTVDGKASLLLYHGVP  344

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
             AY +  + ++N NG   TLAT   NK + +TV+  G+ +T++T VVTA IT T+ D++P 
Sbjct  345   AYYSPQLLKTN-NGFFTTLATTSRNKNFHYTVRTDGDAITVKTRVVTATITSTILDQDPD  403

Query  497   SVFKVDKVLLPRELF  453
             +V+ ++KVL PRELF
Sbjct  404   AVYAINKVLQPRELF  418



>gb|KFK27162.1| hypothetical protein AALP_AA8G343200 [Arabis alpina]
Length=425

 Score =   325 bits (833),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 166/311 (53%), Positives = 222/311 (71%), Gaps = 4/311 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             ++  N+T++LA H  FS+FN +LT THLA EINRR TITV  ++N+ M+ +  K YS+ T
Sbjct  26    SHAHNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTITVCAVDNSVMSFLTSKGYSIST  85

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +KNI+S HVL DYFGTKKLH +  G+ L AT+FQATG APGT+G+VN+T L+GGKVGF P
Sbjct  86    LKNIISLHVLLDYFGTKKLHQIRDGSALAATLFQATGAAPGTTGFVNITDLRGGKVGFGP  145

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             +   G   S FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK F
Sbjct  146   DG--GDLSSFFVKSIEEVPYNISIIQISKVLPSETAAAPTPAPAEMNLTGIMSAHGCKVF  203

Query  842   AD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A+ LL + GA  T+  ++E G+TVFCP D  ++GF+PKYKNL+   K   L +  VP Y 
Sbjct  204   AETLLVNPGASKTYQDSLEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEVFLEFLAVPTYY  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             ++ M +SN NG +NTLAT G+NK++ TVQN GE VTL+T + T KI  T+ DE+PL+++ 
Sbjct  264   SMAMLKSN-NGPMNTLATDGANKFELTVQNDGEQVTLKTRLNTVKIVDTLIDEQPLAIYA  322

Query  485   VDKVLLPRELF  453
              DKVLLP+ELF
Sbjct  323   TDKVLLPKELF  333



>ref|XP_009126981.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brassica 
rapa]
Length=433

 Score =   323 bits (827),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/310 (53%), Positives = 219/310 (71%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+FN  LT THLA EINRR TIT+  +NNAAM+ +  K Y++ T+
Sbjct  26    HAHNVTRLLANHPSFSSFNHLLTKTHLADEINRRTTITICAVNNAAMSALTSKGYTISTL  85

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFG KKLH +  G+ L AT+FQAT  APGT+G+VN+T L+GGKVGF P+
Sbjct  86    KNILSLHVLLDYFGAKKLHQIGGGSALAATLFQATRAAPGTTGFVNITMLRGGKVGFRPD  145

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKS+ E PY ISVIQIS  L S  A AP + P ++NI+ +M+  GCK FA
Sbjct  146   G--GDMSSFFVKSIEEVPYNISVIQISRILPSDAASAPTTAPAEMNISGIMSAHGCKVFA  203

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  +VE G+TVFCP D  ++ F+PKYKNL+   K + L +  VP Y +
Sbjct  204   ETLLSNPGASKTYQESVEGGMTVFCPGDDAMKAFLPKYKNLTAPKKEAFLNFLAVPTYYS  263

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL T + + +I  T+ DE+PL+++  
Sbjct  264   MAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLTTRINSVQIVNTLIDEQPLAIYAT  322

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  323   DKVLLPKELF  332



>emb|CDY20747.1| BnaA02g08870D [Brassica napus]
Length=430

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 167/310 (54%), Positives = 219/310 (71%), Gaps = 4/310 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+FN  LT THLA EINRR TITV  +NNAAM+ +  K Y++ T+
Sbjct  26    HAHNVTRLLANHPSFSSFNHLLTKTHLADEINRRTTITVCAVNNAAMSALTSKGYTISTL  85

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFG KKLH +  G+ L AT+FQATG APGT+G+VN+T L+GGKVGF P+
Sbjct  86    KNILSLHVLLDYFGAKKLHQIGGGSALAATLFQATGAAPGTTGFVNITMLRGGKVGFRPD  145

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKS+ E PY ISVIQIS  L S  A AP + P ++NI+ +M+  GCK FA
Sbjct  146   G--GDMSSFFVKSLEEVPYNISVIQISRILPSDAASAPTTAPAEMNISGIMSATGCKVFA  203

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL + GA  T+  +VE G+TVFCP D  ++ F+PKYKNL+   K + L +  VP Y +
Sbjct  204   ETLLSNPGASKTYQESVEGGMTVFCPGDDAMKAFLPKYKNLTAPMKEAFLNFLAVPTYYS  263

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL T + T +I  T+ DE+ L+++  
Sbjct  264   IAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLTTRINTVQIVNTLIDEQSLAIYAT  322

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  323   DKVLLPKELF  332



>ref|XP_006401420.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
 gb|ESQ42873.1| hypothetical protein EUTSA_v10013639mg [Eutrema salsugineum]
Length=424

 Score =   320 bits (819),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 163/311 (52%), Positives = 219/311 (70%), Gaps = 4/311 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             ++  N+T++LA H  FS+FN +LT THLA EINRR T+TV  ++NAAM+ +  K Y++ T
Sbjct  24    SHAHNVTRLLANHPSFSSFNHFLTQTHLADEINRRTTVTVCAVDNAAMSALTSKGYTITT  83

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             +KNILS HVL DYFG KKLH +  G+ L AT+FQATG A G +G+VN+T L+GGKVGF P
Sbjct  84    LKNILSLHVLLDYFGAKKLHQIRDGSALAATLFQATGAAQGMTGFVNITDLRGGKVGFGP  143

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             +   G   S FVKS+ E PY IS+IQIS  L S  A AP   P ++N+T +M+  GCK F
Sbjct  144   DG--GDLSSFFVKSIEEVPYNISIIQISKVLPSESAAAPTPAPAEMNLTGIMSAHGCKVF  201

Query  842   AD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A+ LL + GA  T+  +VE G+TVFCP D  ++GF+PKYKNL+   K   L +  VP Y 
Sbjct  202   AETLLSNPGASKTYQESVEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEDFLDFFAVPTYY  261

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
             ++ M +SN NG +NTLAT G+NK++ TVQN G  VTL+T + T +I  T+ DE+PL+++ 
Sbjct  262   SMAMLKSN-NGPMNTLATDGANKFELTVQNDGAKVTLKTRINTVQIVDTIIDEQPLAIYA  320

Query  485   VDKVLLPRELF  453
              DKVLLP+ELF
Sbjct  321   TDKVLLPKELF  331



>ref|XP_009385381.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Musa acuminata 
subsp. malaccensis]
Length=416

 Score =   316 bits (810),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 227/312 (73%), Gaps = 3/312 (1%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A G NIT+ILA+H +FSTFN YL++THLA EINRR TITVL ++N+ M D+L KH S+ T
Sbjct  24    ARGHNITKILAQHPEFSTFNHYLSVTHLANEINRRLTITVLAVDNSGMGDLLAKHLSILT  83

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             ++N+L+ H+L DY+G KKLH L  G+T+++++FQ++G APGT+GY+N+T  + GKV F  
Sbjct  84    LRNVLALHILTDYYGAKKLHQLTGGSTISSSVFQSSGHAPGTTGYINITDHRRGKVTFIT  143

Query  1022  EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
             ED  G   + FVKSV E PY IS++QIS  L+S  AEAP + P  VN+T  M+++GCKAF
Sbjct  144   EDAGGAAPAVFVKSVKEIPYNISILQISTILTSPEAEAPVAAPAPVNLTEAMSRKGCKAF  203

Query  842   AD-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             AD LL       TF  N+++GLTVFCP D  +  F PKYKNL+ +GK SLL +HGVPAY 
Sbjct  204   ADMLLARRDVLQTFQDNLDSGLTVFCPDDDAVTAFAPKYKNLTAEGKASLLRFHGVPAYY  263

Query  665   NLGMFRSNGNGVLNTLATGGSNK-YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             +  + ++N    L+TLAT G +K + ++V+  G+ +TL+T +VTA IT T+ D++P +++
Sbjct  264   SPQLLKTNA-AALSTLATSGHSKNFHYSVRTDGDSITLKTHIVTATITSTVVDQDPDAIY  322

Query  488   KVDKVLLPRELF  453
              +DKVL PRELF
Sbjct  323   AIDKVLEPRELF  334



>gb|EYU43168.1| hypothetical protein MIMGU_mgv1a011668mg [Erythranthe guttata]
Length=274

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 183/233 (79%), Gaps = 6/233 (3%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILAK+ +FSTFN YLT THLAAEINRR+TITV  ++N+ M+++L  HYSLYTIKNI
Sbjct  28    NITHILAKYPEFSTFNHYLTTTHLAAEINRRRTITVCAVDNSGMSELLSGHYSLYTIKNI  87

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP----  1023
             L  H+ ADYFG+KKLHH+ KG+T T+++FQATGDA GT GYVN+T +KGGK+GF P    
Sbjct  88    LRLHIFADYFGSKKLHHITKGSTTTSSLFQATGDASGTFGYVNITNMKGGKIGFTPVVVS  147

Query  1022  -EDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKA  846
                  G+  +TFVKSV E PY ISVIQISH LSS  AEAP + PTDVNITTLMA+QGCK+
Sbjct  148   DTRPDGQPMATFVKSVEEFPYNISVIQISHILSSPDAEAPTASPTDVNITTLMAEQGCKS  207

Query  845   FADLLDS-TGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLL  690
             F+DL+ + +G   TFAL+VE GLT+FCP+D  ++ F+P YKNL+  GK SLLL
Sbjct  208   FSDLIMADSGVGDTFALSVEGGLTIFCPSDSAVKSFIPSYKNLTSGGKTSLLL  260



>ref|XP_010485145.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Camelina 
sativa]
Length=386

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 198/310 (64%), Gaps = 41/310 (13%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  N+T++LA H  FS+F+ YLT THLA EINRR TITV  ++NAAM  +  K Y++ T+
Sbjct  22    HAHNVTRLLANHPSFSSFSHYLTQTHLADEINRRTTITVCAVDNAAMAALTSKGYTITTL  81

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KNILS HVL DYFGTKKLH +  G+ L ATMFQATG APGT+G+VN+T L+GGKVGF P+
Sbjct  82    KNILSLHVLLDYFGTKKLHQIRDGSALAATMFQATGAAPGTTGFVNITDLRGGKVGFGPD  141

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                G   S FVKS+ E                                      GCK FA
Sbjct  142   G--GDLSSFFVKSIEE-------------------------------------HGCKVFA  162

Query  839   D-LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             + LL +  A  T+  ++E G+TVFCP D  ++GF+PKYKNL+   K + L +  VP Y +
Sbjct  163   ETLLTNPAASKTYQESLEGGMTVFCPGDDAMKGFLPKYKNLTAPKKEAFLDFLAVPTYYS  222

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             + M +SN NG +NTLAT G+NK++ TVQN GE VTL+T + T KI  T+ DE+PL+++  
Sbjct  223   MAMLKSN-NGPMNTLATDGANKFELTVQNDGEKVTLKTRINTVKIVDTLIDEQPLAIYAT  281

Query  482   DKVLLPRELF  453
             DKVLLP+ELF
Sbjct  282   DKVLLPKELF  291



>ref|XP_006660446.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Oryza 
brachyantha]
Length=395

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 165/313 (53%), Positives = 221/313 (71%), Gaps = 9/313 (3%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
              +NIT+ILA H +FS FN  L+ T LA +INRRQTITVL ++N+AM  +   H++L TI+
Sbjct  23    SYNITKILAAHPEFSKFNDMLSKTRLAYDINRRQTITVLAVDNSAMASL--DHFTLPTIR  80

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +ILS H+L DY+G KKLH L+ G T +++MFQATG APGT+GYVN+T+ KGGK+ F  ED
Sbjct  81    HILSLHILVDYYGAKKLHALSHGATASSSMFQATGSAPGTTGYVNITSHKGGKIDFISED  140

Query  1016  -NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
              +     S FVKSV E PY ISV+Q+S  LSSS AEAP   P  VN+T L++K+ CK+FA
Sbjct  141   ADESAKPSRFVKSVKEIPYDISVLQVSSVLSSSEAEAPVPPPAPVNLTELLSKKYCKSFA  200

Query  839   DLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL +  AD   A+N   + GLT+FCP D  +  FMP YKNL+   K ++LLYH VP Y 
Sbjct  201   GLL-AANADVFRAVNETKDNGLTLFCPVDSAVAAFMPSYKNLTAKAKTAILLYHAVPDYF  259

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L + +SN NG++ TLAT   +K D++  VQN GE VTL+T VVT+ +T T+ D EPL+V
Sbjct  260   SLQLLKSN-NGMVTTLATASESKKDYSYDVQNKGETVTLDTRVVTSAVTATVGDAEPLAV  318

Query  491   FKVDKVLLPRELF  453
             + V+K L P+EL+
Sbjct  319   YAVNKFLKPKELY  331



>dbj|BAK00054.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   281 bits (719),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 162/312 (52%), Positives = 214/312 (69%), Gaps = 9/312 (3%)
 Frame = -1

Query  1373  FNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKN  1194
             +NIT+ILA H +FS FN  L+ T LA +INRRQTITVL L+N+AM  +   HY+L T+++
Sbjct  31    YNITKILAAHPEFSKFNAMLSKTRLAYDINRRQTITVLALDNSAMAAL--DHYTLPTVRH  88

Query  1193  ILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDN  1014
             ILS HVL DY+G KKL  L++G T +A+MFQ+TG A G SGYVN+T+ KGGKV F   D 
Sbjct  89    ILSLHVLVDYYGNKKLKTLSRGATASASMFQSTGTASGMSGYVNITSHKGGKVEFVSVDA  148

Query  1013  TGRFD-STFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
                   S +VKS+ E PY ISV+QI   LSSS AEAP   P  V++  L++K+ CK+FA 
Sbjct  149   DDTVKPSRYVKSIKEIPYDISVLQIGSVLSSSEAEAPVPPPAPVDLVELLSKKHCKSFAG  208

Query  836   LLDSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             L+ S  AD   T+    + GLT+FCP D  +  FMPKYKNL+   K ++LLYHGV  Y +
Sbjct  209   LI-SGNADVFRTYNETKDNGLTIFCPVDAAVAAFMPKYKNLTAKAKTAILLYHGVSDYFS  267

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L + +SN NG+++TLAT    K D++  VQN  E+VTL T+VVT+ IT T+ D EPL+V+
Sbjct  268   LQLLKSN-NGMVSTLATTSEIKKDYSYDVQNEDEEVTLVTKVVTSTITATVGDSEPLAVY  326

Query  488   KVDKVLLPRELF  453
              V K L P+ELF
Sbjct  327   AVSKFLQPKELF  338



>ref|NP_001062666.1| Os09g0248100 [Oryza sativa Japonica Group]
 dbj|BAD19896.1| putative endosperm specific protein SC3 [Oryza sativa Japonica 
Group]
 dbj|BAD26000.1| putative endosperm specific protein SC3 [Oryza sativa Japonica 
Group]
 dbj|BAF24580.1| Os09g0248100 [Oryza sativa Japonica Group]
 gb|EAZ08273.1| hypothetical protein OsI_30524 [Oryza sativa Indica Group]
 gb|EAZ43889.1| hypothetical protein OsJ_28509 [Oryza sativa Japonica Group]
 dbj|BAG90947.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87887.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   278 bits (711),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 220/313 (70%), Gaps = 9/313 (3%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
              +NIT+ILA H +FS FN  L+ T LA +INRRQTITVL ++N+AM  +   H++L TI+
Sbjct  28    SYNITKILAAHPEFSKFNEMLSKTRLAYDINRRQTITVLAVDNSAMASL--DHFTLPTIR  85

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +ILS H+L DY+G+KKLH L+ G T +++MFQATG APGT+GYVN+T+ KGGK+ F  ED
Sbjct  86    HILSLHILVDYYGSKKLHALSHGATASSSMFQATGSAPGTTGYVNITSHKGGKIDFISED  145

Query  1016  -NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
              +     S +VKSV E PY ISV+Q+S  LSSS AEAP   P  VN+T L++K+ CK+FA
Sbjct  146   ADESAKPSRYVKSVKEIPYDISVLQVSSVLSSSEAEAPVPPPAPVNLTELLSKKYCKSFA  205

Query  839   DLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL +  AD   A+N   + GLT+FCP D  +  FMP YKNL+   K ++LLYH VP Y 
Sbjct  206   GLL-AANADVFRAVNETKDNGLTLFCPVDAAVAAFMPSYKNLTAKAKTAILLYHAVPDYF  264

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L + +SN NG++ TLAT   +K D++  VQN GE VTL+T VV + +T T+ D EPL+V
Sbjct  265   SLQLLKSN-NGMVTTLATASESKKDYSYDVQNKGETVTLDTRVVNSAVTATVGDAEPLAV  323

Query  491   FKVDKVLLPRELF  453
             + V K L P+EL+
Sbjct  324   YAVTKFLKPKELY  336



>ref|NP_001061532.1| Os08g0321000 [Oryza sativa Japonica Group]
 dbj|BAD01728.1| putative fasciclin-like arabinogalactan-protein [Oryza sativa 
Japonica Group]
 dbj|BAD03337.1| putative fasciclin-like arabinogalactan-protein [Oryza sativa 
Japonica Group]
 dbj|BAF23446.1| Os08g0321000 [Oryza sativa Japonica Group]
 gb|EAZ06523.1| hypothetical protein OsI_28769 [Oryza sativa Indica Group]
 dbj|BAG90756.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96652.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99705.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99706.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAI39894.1| fasciclin-like arabinogalactan-protein-like [Oryza sativa Indica 
Group]
Length=415

 Score =   278 bits (712),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 213/313 (68%), Gaps = 7/313 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+IL  H ++S FN+ LT T LA +INRR+TITVLV+ N  M  +   HY+L T++
Sbjct  25    GYNITKILGDHPEYSQFNKLLTETRLAGDINRRRTITVLVVANGDMGALSGGHYTLPTLR  84

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  H+L DY+G KKLH L +G T +++MFQ +G APGT+GYVN+T  +GG+V F  ED
Sbjct  85    HILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAED  144

Query  1016  NT-GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                    S+FVKSV E PY ++V+QIS  LSS  AEAP + P  VN+T L++K+ CK FA
Sbjct  145   AADSATPSSFVKSVKEIPYDLAVLQISKPLSSPEAEAPVAPPAPVNLTELLSKKYCKNFA  204

Query  839   DLLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL ++ AD    +N   + GLT+FCP D  +  F+PKYKNL+  GK ++LLYH VP Y 
Sbjct  205   GLL-ASNADVYSNINATKDNGLTLFCPVDAAVDAFLPKYKNLTAKGKAAILLYHAVPDYY  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L + +SN +G ++TLAT    K D++  V N  + V L+T+V +A +T T+ D +PL+V
Sbjct  264   SLQLLKSN-SGKVSTLATASVAKKDYSYDVSNDRDSVLLDTKVNSASVTATVKDADPLAV  322

Query  491   FKVDKVLLPRELF  453
             + + K L P+ELF
Sbjct  323   YAISKFLQPKELF  335



>ref|XP_006659292.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Oryza 
brachyantha]
Length=392

 Score =   275 bits (703),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 211/313 (67%), Gaps = 7/313 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NI +ILA H ++S FN+ LT T LA +INRR+TITVLV+ N  M  +   HY+L T++
Sbjct  25    GYNIAKILADHPEYSQFNKLLTDTRLAGDINRRRTITVLVVANGDMGALSAGHYTLPTLR  84

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  H+L DY+G KKLH L +G T +++MFQ +G APGT+GYVN+T  +GG+V F  ED
Sbjct  85    HILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAED  144

Query  1016  NT-GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                    S+FVKSV E PY ++V+QIS  LSS  AEAP + P  VN+T L++K+ CK FA
Sbjct  145   AADSATPSSFVKSVKEIPYDLAVLQISKPLSSPEAEAPVAPPAPVNLTELLSKKYCKNFA  204

Query  839   DLLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL +  AD    LN   + GLT+FCP D  +  FMPKYKNL+  GK ++LLYH VP Y 
Sbjct  205   GLL-AANADVYSNLNATKDNGLTLFCPVDAAVDAFMPKYKNLTAKGKTAILLYHAVPDYY  263

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L + +SN +G ++T AT    K D++  V N  + V L+T+V +A +T T+ D +PL+V
Sbjct  264   SLQLLKSN-SGKVSTPATASVAKKDYSYDVSNDRDSVLLDTKVNSATVTATVKDADPLAV  322

Query  491   FKVDKVLLPRELF  453
             + + K L P+ELF
Sbjct  323   YAITKFLQPKELF  335



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/309 (47%), Positives = 210/309 (68%), Gaps = 4/309 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
              FNIT+ILAK+ ++S FN  L+ T LA EIN RQTITVL L+N+ M  +      L ++K
Sbjct  22    AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSQMASL--SGLDLASLK  79

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
              +LS HV+ D+F  KKLH +  GTTL+ T++Q TG+APG +G++N+T LK GKVGF P  
Sbjct  80    RVLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAA  139

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             +  + D+T+VKSV ++ Y ISVI++S  ++++ AEAPA  P DVNIT ++ K GC+ FA 
Sbjct  140   HGAKLDATYVKSVKQEGYNISVIEVSKPITTNVAEAPAPAPADVNITAVLIKGGCRIFAT  199

Query  836   LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPK-YKNLSKDGKMSLLLYHGVPAYQNL  660
             ++ +TG   TF   V+ GLTVFCPTD    G   K  K L+ D ++S+L +HG+P Y  L
Sbjct  200   MISTTGVLKTFEDAVQGGLTVFCPTDAAFTGATNKLLKKLTSDDQVSVLEFHGLPIYSPL  259

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
             G  ++  NG + T+A+  + KY  TV +SG+ V L T V  A I+GT+ D++PL++F V+
Sbjct  260   GTLKTT-NGPIRTMASPAARKYVLTVSSSGDTVILNTGVSKATISGTLLDDQPLAIFTVN  318

Query  479   KVLLPRELF  453
             K+L P+ELF
Sbjct  319   KLLEPKELF  327



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/309 (48%), Positives = 210/309 (68%), Gaps = 4/309 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
              FNIT+ILAK+ ++S FN  L+ T LA EIN RQTITVL L+N+ M   L     L ++K
Sbjct  22    AFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSEM--ALLSGLDLASLK  79

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
              +LS HV+ D+F  KKLH +  GTTL+ T++Q TG+APG +G++N+T LK GKVGF P  
Sbjct  80    RVLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAA  139

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
             +  + D+T+VKSV ++ Y ISVI++S  ++++ AEAPA  P DVNIT ++ K GC+ FA 
Sbjct  140   HGAKLDATYVKSVKQEGYNISVIEVSKPITTNVAEAPAPAPADVNITAVLIKGGCRIFAT  199

Query  836   LLDSTGADATFALNVETGLTVFCPTDKVIQGFMPK-YKNLSKDGKMSLLLYHGVPAYQNL  660
             ++ +TG   TF   V+ GLTVFCPTD    G   K  K L+ D ++S+L +HG+P Y  L
Sbjct  200   MISTTGVLKTFEDAVQGGLTVFCPTDAAFTGATNKLLKKLTSDDQVSVLEFHGLPIYSPL  259

Query  659   GMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVD  480
             G  ++  NG + T+A+  + KY  TV +SG+ V L T V  A I+GT+ D++PL++F V+
Sbjct  260   GTLKTT-NGPIRTMASPAARKYVLTVSSSGDTVILNTGVSKATISGTLLDDQPLAIFTVN  318

Query  479   KVLLPRELF  453
             K+L P+ELF
Sbjct  319   KLLEPKELF  327



>ref|XP_002462113.1| hypothetical protein SORBIDRAFT_02g019380 [Sorghum bicolor]
 gb|EER98634.1| hypothetical protein SORBIDRAFT_02g019380 [Sorghum bicolor]
Length=405

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 213/313 (68%), Gaps = 12/313 (4%)
 Frame = -1

Query  1373  FNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKN  1194
             +NIT+ILA + ++S FN  L+ T LA +INRRQTITVL ++N+AM+ +   HYSL TI++
Sbjct  33    YNITKILAPYKEYSKFNEMLSKTRLAYDINRRQTITVLAVDNSAMSAL--DHYSLQTIRH  90

Query  1193  ILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE--  1020
             ILS HVL DY+G KKL  L  G T +++MFQATG A G SGYVN+T  K GKV F  E  
Sbjct  91    ILSLHVLVDYYGDKKLKKLAHGATASSSMFQATGSASGMSGYVNITR-KDGKVSFMTEDA  149

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
             D+T +  S +VKSV E PY I+V+Q+S  +SS+ AEAP   P  V++  L++K+ CK+FA
Sbjct  150   DDTAK-PSRYVKSVKEYPYDIAVLQVSSIISSAEAEAPVPAPAPVDLVELLSKRYCKSFA  208

Query  839   DLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL S  A+A  A N   + GLT+FCP D  +  F   YKNL+   K ++LLYH VP Y 
Sbjct  209   SLL-SADAEAFRAANESKDNGLTLFCPVDSAVASFAATYKNLTAKAKTAILLYHAVPDYF  267

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L + +SN NG++ TLAT    K D++  V+N  E VTL+T VVT+ +T T+ D EPL+V
Sbjct  268   SLQLLKSN-NGMVTTLATASEKKMDYSYDVKNKDETVTLQTRVVTSSVTATVGDMEPLAV  326

Query  491   FKVDKVLLPRELF  453
             + VDK L P+ELF
Sbjct  327   YAVDKFLQPKELF  339



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 201/310 (65%), Gaps = 4/310 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT IL    ++S F+ YL+ T LA EIN RQTITVL L+N AM+ +  K   L  IK
Sbjct  24    GHNITAILEGFPEYSLFSSYLSQTKLADEINSRQTITVLALDNGAMSALAGKK-PLSVIK  82

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N L+ HV+ DYF  +KLH + KG+TL+ T++Q TG+APG +G+VN+T L+GGKVGF    
Sbjct  83    NELAVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAA  142

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                + DS++ KSV + PY ISV+QIS   L  +   APA   +D N+T L+ K GCK FA
Sbjct  143   PGSKLDSSYTKSVKQIPYNISVLQISAPILVPAILAAPAPSASDTNVTALLEKAGCKTFA  202

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQN  663
              LL S+G   T+   +E GLTVF P D+  +   +P    LS    +SLLLYH V  Y  
Sbjct  203   GLLVSSGVIKTYQSALEKGLTVFAPNDESFKAKGVPDVSKLSNAELVSLLLYHAVADYTP  262

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             +G  +++ NG ++TLAT G+ KYDFTV+ +G+ V L+T V ++++  T+ D  P+++F V
Sbjct  263   IGSLKTS-NGPISTLATNGAGKYDFTVKTAGDSVALDTGVDSSRVASTVLDSTPVAIFTV  321

Query  482   DKVLLPRELF  453
             D VLLP ELF
Sbjct  322   DNVLLPTELF  331



>ref|XP_004956400.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Setaria 
italica]
Length=403

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/312 (50%), Positives = 212/312 (68%), Gaps = 10/312 (3%)
 Frame = -1

Query  1373  FNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKN  1194
             +NIT++L  +  +S FN  L+ T LA +INRRQTITVL ++NAAM+ +   HYSL TI++
Sbjct  32    YNITKLLEPYKQYSRFNEMLSRTRLAYDINRRQTITVLAVDNAAMSAL--DHYSLQTIRH  89

Query  1193  ILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDN  1014
             ILS HVL DY+G KKL  L +G+T +++M+QATG A G SGYVN+T  K GKV F  +D 
Sbjct  90    ILSLHVLVDYYGDKKLKKLARGSTTSSSMYQATGAASGMSGYVNITR-KDGKVSFTTDDA  148

Query  1013  TGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
                   T +VKS+ E PY I+V+++S  +SS+ AEAP   P  V++  L++K+ CK+FA 
Sbjct  149   DDTAKPTRYVKSIKEYPYDIAVLEVSSIISSADAEAPVPPPAPVDLVELLSKKYCKSFAS  208

Query  836   LLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             LL S  AD   A N   + GLT+FCP D  +  F   YKNL+   K ++LLYHGVP Y +
Sbjct  209   LL-SANADVFRAFNETKDNGLTLFCPVDSAVAAFAATYKNLTAKAKTAILLYHGVPDYFS  267

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L + +SN NG++ TLAT   NK D++  VQN GE VTL+T VVT+ +T T+ D EPL+V+
Sbjct  268   LQLLKSN-NGMVTTLATASENKKDYSYDVQNKGETVTLQTRVVTSIVTATVGDMEPLAVY  326

Query  488   KVDKVLLPRELF  453
              V+K L P+ELF
Sbjct  327   AVNKFLKPKELF  338



>ref|XP_008651121.1| PREDICTED: uncharacterized protein LOC100274054 isoform X1 [Zea 
mays]
 gb|ACG30183.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|ACN27414.1| unknown [Zea mays]
 tpg|DAA60916.1| TPA: fasciclin-like arabinogalactan protein 8 [Zea mays]
Length=410

 Score =   270 bits (689),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 215/316 (68%), Gaps = 12/316 (4%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A  +NIT+ILA + ++S FN  L+ T LA +INRRQTITVL ++N+AM+ +   HYSL T
Sbjct  34    ATKYNITKILAPYKEYSKFNDMLSKTRLAYDINRRQTITVLAVDNSAMSAL--DHYSLQT  91

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAP  1023
             I++IL  HVL DY+G KKL  L  G+T +++MFQATG A G SGYVN+T  K GKV F  
Sbjct  92    IRHILELHVLVDYYGDKKLKKLAHGSTASSSMFQATGSASGMSGYVNITR-KDGKVSFMT  150

Query  1022  E--DNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
             E  D+T +  S +VKSV E PY I+V+Q+S  +SS+ AEAP   P  V++  L++K+ CK
Sbjct  151   EDADDTAK-PSRYVKSVKEFPYDIAVLQVSSIISSAEAEAPVPPPAPVDLEELLSKRYCK  209

Query  848   AFADLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVP  675
             +FA LL S  A+   A+N   + GLT+FCP D  +  F   YKNL+   K ++LLYH VP
Sbjct  210   SFASLL-SANAEVFRAVNETKDNGLTLFCPVDSAVAAFAATYKNLTAKAKAAILLYHAVP  268

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEP  501
              Y +L + +SN NG++ TLAT    K D++  V+N GE VTL+T VVT+ +T T+ D EP
Sbjct  269   DYFSLQLLKSN-NGMVTTLATASDKKMDYSYDVKNKGETVTLQTRVVTSSVTATVGDMEP  327

Query  500   LSVFKVDKVLLPRELF  453
             L+V+ V+K L P+ELF
Sbjct  328   LAVYAVNKFLQPKELF  343



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   270 bits (689),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/308 (48%), Positives = 198/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   D+S FN+YLT T LA EIN R+TITVL L+N AM+ +  KH  L  IKN 
Sbjct  25    NITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALSNGAMSALASKH-PLSVIKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  VL DY+   KLH ++KGTTL+ T++Q TG+APG  G+VN+T L+GGKVGF      
Sbjct  84    LSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHL-SSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISVI++S  + +     APA  P+DVNIT L+ K GCK FA L
Sbjct  144   SKLDSSYTKSVKQIPYNISVIEVSAPIVAPGIFTAPAPSPSDVNITGLLEKAGCKTFAGL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   T+    + GLT+F P D+  +   +P    LS    +SLL YH    Y   G
Sbjct  204   LLSSGVLKTYQSAADKGLTIFAPNDEAFKAAGVPDLSKLSNAELVSLLEYHASVGYSPKG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+NKYD TV ++G+DVTL T V ++++  T+ D  PL +F VD 
Sbjct  264   ALKTSKDPI-STLATNGANKYDLTVSSAGDDVTLHTGVDSSRVAETVLDSTPLVIFTVDN  322

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  323   VLLPTELF  330



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   268 bits (686),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 195/308 (63%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +L  +  +S F+ YL  T LA EIN RQTITVLV++N A++ ILDKH  L  IKNI
Sbjct  24    NITDMLKDYPQYSVFSNYLQQTRLADEINSRQTITVLVVSNGALSPILDKH-PLSVIKNI  82

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H++ DY+   KLH ++ GTTL+ T++Q TG APG  G+VN+T L+GGKV F      
Sbjct  83    LSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSAVPG  142

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHL-SSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + +S++ KSV+  PY ISVI+IS  + +     APA   +DVNIT L+ K GCK FA L
Sbjct  143   SKLESSYTKSVVSMPYNISVIEISAPIVAQGILTAPAPSASDVNITALLEKAGCKTFASL  202

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S G   T+   VE GLT+F P D+  +   +P    L+    +SLLLYH +P Y  +G
Sbjct  203   IVSNGVIKTYESAVEKGLTIFAPNDEAFKADGVPDLSKLTNAEVVSLLLYHALPGYTPIG  262

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++  + + NTLATG + K+D T   +G+ VTL T V  ++I  T+ D  PL++F VD 
Sbjct  263   TLKTTKDPI-NTLATGSAGKFDITTTTAGDAVTLHTGVGPSRIADTVLDSTPLAIFSVDS  321

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  322   LLLPSELF  329



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   268 bits (684),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 198/314 (63%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YLT T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  24    STVSSHNITQILADSPDYSSFNNYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+   KLH L+KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  83    SVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA      NIT L+ K GC
Sbjct  143   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAAVSNITGLLEKAGC  202

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FADLL S+G   T+   ++ GLTVF P+D+  +   +P    L++   +SLL YH +P
Sbjct  203   KTFADLLVSSGVLKTYESAIDKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALP  262

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N +  TLAT G  K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  263   EYKPKGSLKTNKNNI-TTLATSGVGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  321

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  322   IFTVDNVLLPAELF  335



>gb|EMS65354.1| hypothetical protein TRIUR3_14037 [Triticum urartu]
Length=386

 Score =   266 bits (680),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 219/317 (69%), Gaps = 9/317 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + A  +NIT+ILA H +FS FN  L+ T LA++INRRQTITVL L+N+AM  +   HY+L
Sbjct  10    AAAKSYNITKILAAHPEFSKFNAMLSKTRLASDINRRQTITVLALDNSAMAAL--DHYTL  67

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+++ILS HVL DY+G KKL  L++G T +A+MFQ+TG A G SGYVN+T+ KGGKV F
Sbjct  68    PTVRHILSLHVLVDYYGNKKLKQLSRGATASASMFQSTGTASGMSGYVNITSHKGGKVEF  127

Query  1028  APEDNTGRFD-STFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
               +D       S +VKS+ E PY ISV++I+  LSSS AEAP   P  V++  L++K+ C
Sbjct  128   VSQDADDTVKPSRYVKSIKEIPYDISVLEIASVLSSSEAEAPVPPPAPVDLIELLSKKHC  187

Query  851   KAFADLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGV  678
             K+FA L+ S  AD    LN   + GLT+FCP D  +  FMPKYKNL+   K ++LLYHGV
Sbjct  188   KSFAGLI-SGNADVFRTLNDTKDNGLTLFCPVDAAVAAFMPKYKNLTAKAKTAILLYHGV  246

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEE  504
             P Y +L + +SN NG+++TLAT    K D++  VQN  E VTL T+VVT+ +T T+ D E
Sbjct  247   PDYFSLQLLKSN-NGMVSTLATTSEVKKDYSYDVQNDDEKVTLVTKVVTSTVTATVGDSE  305

Query  503   PLSVFKVDKVLLPRELF  453
             PL+V+ V K L P+ELF
Sbjct  306   PLAVYAVSKFLKPKELF  322



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 194/308 (63%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +L     +S F+ YL  T LA EIN RQTITVLV+ N A++ ILDKH  L  IKN+
Sbjct  24    NITDMLKDFPQYSVFSNYLQQTRLADEINSRQTITVLVVANGALSPILDKH-PLSVIKNL  82

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H++ DY+   KLH ++ GTTL+ T++Q TG APG  G+VN+T L+GGKVGF      
Sbjct  83    LSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAVPG  142

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHL-SSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + +S++ KSV+  PY ISVI+IS  + +     APA   +DVNIT L+ K GCK FA L
Sbjct  143   SKLESSYTKSVVSLPYNISVIEISAPIVAQGILTAPAPSASDVNITALLEKAGCKTFAAL  202

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S G   T+   VE GLT+F P D+  +   +P    L+    +SLLLYH +P Y  +G
Sbjct  203   IVSNGVIKTYESAVEKGLTIFAPNDEAFKADGVPDLSKLTNAEVVSLLLYHALPGYTPIG  262

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++  + + NTLATG + K+D T   +G+ VTL T V  +++  T+ D  PL++F VD 
Sbjct  263   TLKTTKDPI-NTLATGSAGKFDITTTTAGDAVTLHTGVGPSRVADTVLDSTPLAIFSVDS  321

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  322   VLLPSELF  329



>gb|ABI95418.1| fasciclin-like protein FLA28 [Triticum aestivum]
Length=402

 Score =   266 bits (681),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 219/317 (69%), Gaps = 9/317 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + A  +NIT+ILA H +FS FN  L+ T LA++INRRQTITVL L+N+AM  +   HY+L
Sbjct  26    AAAKSYNITKILAAHPEFSKFNAMLSKTRLASDINRRQTITVLALDNSAMAAL--DHYTL  83

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+++ILS HVL DY+G KKL  L++G T +A+MFQ+TG A G SGYVN+T+ KGGKV F
Sbjct  84    PTVRHILSLHVLVDYYGNKKLKQLSRGATASASMFQSTGTASGMSGYVNITSHKGGKVEF  143

Query  1028  APEDNTGRFD-STFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
               +D       S +VKS+ E PY ISV++I+  LSSS AEAP   P  V++  L++K+ C
Sbjct  144   VSQDADDTVKPSRYVKSIKEIPYDISVLEIASVLSSSEAEAPVPPPAPVDLIELLSKKHC  203

Query  851   KAFADLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGV  678
             K+FA L+ S  AD    LN   + GLT+FCP D  +  FMPKYKNL+   K ++LLYHGV
Sbjct  204   KSFAGLI-SGNADVFRTLNDTKDNGLTLFCPVDAAVAAFMPKYKNLTTKAKTAILLYHGV  262

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEE  504
             P Y +L + +SN NG+++TLAT    K D++  VQN  E VTL T+VVT+ +T T+ D E
Sbjct  263   PDYFSLQLLKSN-NGMVSTLATTSEVKKDYSYDVQNDDEKVTLVTKVVTSTVTATVGDSE  321

Query  503   PLSVFKVDKVLLPRELF  453
             PL+V+ V K L P+ELF
Sbjct  322   PLAVYAVSKFLKPKELF  338



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (64%), Gaps = 4/313 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQILA   ++S+FN YL+ T LA EIN R TIT+LVLNN AM+ +  KH  L 
Sbjct  22    TVRGHNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKN LS  VL DY+  +KLH ++KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF 
Sbjct  81    VIKNALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                +  + DS++ KSV + PY ISV++I +  ++     APA      NIT L+ K GCK
Sbjct  141   SAASGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGVLTAPAPSSAVSNITGLLEKAGCK  200

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPA  672
              FA+LL S+G   T+   +E GLTVF P+D+  +   +P    L++   +SLL YH +  
Sbjct  201   TFANLLASSGVLKTYESAIENGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALAE  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y+  G  ++N N + +TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+ +
Sbjct  261   YKPKGSLKTNKNKI-STLATSGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVVI  319

Query  491   FKVDKVLLPRELF  453
             F VD VLLP ELF
Sbjct  320   FTVDNVLLPTELF  332



>gb|EMT28749.1| hypothetical protein F775_29839 [Aegilops tauschii]
Length=386

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 219/317 (69%), Gaps = 9/317 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             + A  +NIT+ILA H +FS FN  L+ T LA++INRRQTITVL L+N+AM  +   HY+L
Sbjct  10    AAAKSYNITKILAAHPEFSKFNAMLSKTRLASDINRRQTITVLALDNSAMAAL--DHYTL  67

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              T+++ILS HVL DY+G KKL  L++G T +A+MFQ+TG A G SGYVN+T+ KGGKV F
Sbjct  68    PTVRHILSLHVLVDYYGNKKLKQLSRGATASASMFQSTGTASGMSGYVNITSHKGGKVEF  127

Query  1028  APEDNTGRFD-STFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
               +D       S +VKS+ E PY ISV++I+  LSSS AEAP   P  V++  L++K+ C
Sbjct  128   VSQDADDTVKPSRYVKSIKEIPYDISVLEINSVLSSSEAEAPVPPPAPVDLIELLSKKHC  187

Query  851   KAFADLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGV  678
             K+FA L+ S  AD    LN   + GLT+FCP D  +  FMPKYKNL+   K ++LLYHGV
Sbjct  188   KSFAGLI-SGNADVFRTLNETKDNGLTLFCPVDAAVAAFMPKYKNLTAKAKTAILLYHGV  246

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEE  504
             P Y +L + +SN NG+++TLAT    K D++  VQN  E VTL T+VVT+ +T T+ D E
Sbjct  247   PDYFSLQLLKSN-NGMVSTLATTSEVKKDYSYDVQNDDEKVTLVTKVVTSTVTATVGDSE  305

Query  503   PLSVFKVDKVLLPRELF  453
             PL+V+ V K L P+ELF
Sbjct  306   PLAVYAVSKFLKPKELF  322



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 198/314 (63%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YLT T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK  LS  VL DY+  +KLH L+KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKGALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA      NIT L+ K GC
Sbjct  140   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAALSNITGLLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA+LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  200   KTFANLLASSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N +  TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  260   EYKPKGSLKTNKNNI-TTLATNGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  318

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  319   IFTVDNVLLPAELF  332



>ref|XP_003576707.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brachypodium 
distachyon]
Length=413

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 206/312 (66%), Gaps = 6/312 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+IL +H ++S FN+ LT T LAA+IN+R+TITVLV+ N  M   L    +L TI+
Sbjct  23    GYNITKILGEHPEYSQFNKLLTQTRLAADINKRRTITVLVVANGDMG-ALAAGRTLQTIR  81

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  HVL DY+G KKLH L  G T +++MFQ +G APG SGYVN+T  +GG V F  ED
Sbjct  82    HILQMHVLVDYYGAKKLHQLAHGVTASSSMFQESGAAPGMSGYVNITQHRGGHVTFTAED  141

Query  1016  NTGRFDS-TFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
              +      +FVKSV E PY +SV+QIS  LSS  AEAP + P  VNIT L++K+ CK+FA
Sbjct  142   ASDSASPVSFVKSVKEIPYDLSVLQISKVLSSPEAEAPVAAPAPVNITELLSKKYCKSFA  201

Query  839   DLLDSTGAD-ATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
              LL +     +T     + GLT+FCP D  +  FMPKYKNL+   K ++LLYH VP Y +
Sbjct  202   GLLAADADAFSTVNATKDNGLTLFCPVDAAVASFMPKYKNLTAKAKTAILLYHAVPDYYS  261

Query  662   LGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L +  SN +G ++TLAT    K  Y F V   GE   L+T+V+TA +T T+ D++PL+V+
Sbjct  262   LQLLTSN-SGKVSTLATSSVAKKDYSFDVSKDGETAALDTKVITASVTATVKDDDPLAVY  320

Query  488   KVDKVLLPRELF  453
              V K L P+ELF
Sbjct  321   AVSKFLQPKELF  332



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 196/311 (63%), Gaps = 4/311 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT+IL+K  ++S FN YLT T LA EIN RQTITVL L N AM+D++ KH  L  I
Sbjct  19    HAHNITEILSKFPEYSEFNSYLTQTKLADEINSRQTITVLALTNGAMSDVVGKH-PLSVI  77

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS H+L DYF + KLH ++ GTTL+ T++Q TG+A G  G VN+T LKGGKVGF   
Sbjct  78    KNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNANGNLGSVNITDLKGGKVGFGSA  137

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
              +     ST+ KSV +  Y ISV++IS   ++     APA   +D NIT  + K GCK F
Sbjct  138   VSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGILTAPAPSASDFNITAALEKAGCKTF  197

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A LL  +G   T+   + TGLTVF P D+  +G  +P    L     +SLL YH VP+Y 
Sbjct  198   ASLLVQSGVLKTYQTAIATGLTVFAPNDEAFKGAKVPDLNKLKSAEVVSLLQYHAVPSYT  257

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
              +G  ++  + + +TLAT G++KYD +   +G+ VTL+T V +++I  T+ D  P  +F 
Sbjct  258   PIGTLKTKKDPI-STLATNGASKYDLSASTAGDQVTLDTGVDSSRIASTVIDSTPFCIFT  316

Query  485   VDKVLLPRELF  453
             VD VLLP ELF
Sbjct  317   VDSVLLPEELF  327



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 197/314 (63%), Gaps = 5/314 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT IL+   D+S FN+YLT T LA EIN R+TITVL LNN A++ I    + L
Sbjct  17    TTISAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNGAISSI--AKHPL  74

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKNILS  VL DY+   KLH ++KGTTL+ T++Q TG APG  G+VN+T L+GGKVGF
Sbjct  75    PVIKNILSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNITDLQGGKVGF  134

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGC  852
                    + +S++ KSV + PY ISV+++S   ++     APA  P+DVNIT L+ K GC
Sbjct  135   GSAAPGSKLESSYTKSVKQVPYNISVLEVSAPIIAPGILAAPAPSPSDVNITALLEKAGC  194

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL S+G   TF    + GLT+F P D+  +   +P    LS    +SLL YH   
Sbjct  195   KTFASLLVSSGVLKTFQSAADKGLTIFAPNDEAFKATGVPDLSKLSNADLVSLLQYHAAA  254

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y  L   +++ + + +TLAT G+ K+D TV +SG+ VTL T V ++++  T+ D  PLS
Sbjct  255   RYSPLASLKTSKDPI-STLATNGAGKFDLTVTSSGDSVTLHTGVDSSRVADTVLDSTPLS  313

Query  494   VFKVDKVLLPRELF  453
             +  VD VLLP ELF
Sbjct  314   ILTVDNVLLPSELF  327



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 203/314 (65%), Gaps = 4/314 (1%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
                A  FNIT+IL  + D+S FN  LT T LA EIN R+TITVLV+NN AM  +      
Sbjct  13    LCCANAFNITKILDAYPDYSIFNDDLTRTKLADEINSRKTITVLVVNNGAMASL--SGLD  70

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L ++K  LS HV+ D+F  +KLH +  GTTL+ T++Q TG A G +G++N+T LKGGKVG
Sbjct  71    LASVKRALSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINITDLKGGKVG  130

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F       + DST+VKSV +  + +SV+++S  +++S AEAP   P+++NIT ++ K GC
Sbjct  131   FGLSGRGAKLDSTYVKSVKQDGFNLSVVEVSQPITTSVAEAPTPSPSNMNITAVLIKGGC  190

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKN-LSKDGKMSLLLYHGVP  675
             K FA+L+ +TG   ++  +++ GL+VF PTD        K  N L  + K+S+L +H +P
Sbjct  191   KIFANLISTTGVLKSYEESIQGGLSVFAPTDAAFTSVTSKMLNKLFSEDKVSVLEFHALP  250

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y  LG  ++  NG + T+A+ G+ KY  TV +SG+ V L T +  A IT ++ D++P++
Sbjct  251   TYSPLGTLKTT-NGPIATMASTGAGKYVLTVSSSGDTVMLNTGINKATITSSLLDDQPIA  309

Query  494   VFKVDKVLLPRELF  453
             +F VDKVL P+ELF
Sbjct  310   LFSVDKVLKPKELF  323



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 201/314 (64%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+  +KLH ++KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA   +  NIT L+ K GC
Sbjct  140   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSASLSNITGLLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA+LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  200   KTFANLLVSSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N + +TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  260   EYKPKGSLKTNKNNI-STLATNGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  318

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  319   IFTVDNVLLPAELF  332



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 201/314 (64%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+  +KLH ++KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA   +  NIT L+ K GC
Sbjct  140   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSASLSNITGLLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA+LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  200   KTFANLLVSSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N + +TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  260   EYKPKGSLKTNKNNI-STLATNGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  318

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  319   IFTVDNVLLPAELF  332



>gb|EAZ42295.1| hypothetical protein OsJ_26868 [Oryza sativa Japonica Group]
Length=392

 Score =   265 bits (676),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 194/311 (62%), Gaps = 26/311 (8%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+IL  H ++S FN+ LT T LA +INRR+TITVLV+ N  M  +   HY+L T++
Sbjct  25    GYNITKILGDHPEYSQFNKLLTETRLAGDINRRRTITVLVVANGDMGALSGGHYTLPTLR  84

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  H+L DY+G KKLH L +G T +++MFQ +G APGT+GYVN+T  +GG+V F  ED
Sbjct  85    HILEMHILVDYYGAKKLHQLARGDTASSSMFQESGSAPGTTGYVNITQHRGGRVSFTAED  144

Query  1016  NT-GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                    S+FVKSV E PY ++V+QIS  LSS  AEAP + P                  
Sbjct  145   AADSATPSSFVKSVKEIPYDLAVLQISKPLSSPEAEAPVAPP------------------  186

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQNL  660
                   G      +  + GLT+FCP D  +  F+PKYKNL+  GK ++LLYH VP Y +L
Sbjct  187   ----GAGEPHRAPVQEDNGLTLFCPVDAAVDAFLPKYKNLTAKGKAAILLYHAVPDYYSL  242

Query  659   GMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
              + +SN +G ++TLAT    K D++  V N  + V L+T+V +A +T T+ D +PL+V+ 
Sbjct  243   QLLKSN-SGKVSTLATASVAKKDYSYDVSNDRDSVLLDTKVNSASVTATVKDADPLAVYA  301

Query  485   VDKVLLPRELF  453
             + K L P+ELF
Sbjct  302   ISKFLQPKELF  312



>ref|XP_007139983.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
 gb|ESW11977.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
Length=419

 Score =   265 bits (676),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 191/307 (62%), Gaps = 3/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILA    +S FN +L+ T LA EIN RQTITVLVLNNAA + + DKH  L  +KN+
Sbjct  23    NITDILAADPQYSDFNNFLSQTRLADEINTRQTITVLVLNNAAFSAVADKH-PLSVVKNL  81

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYF   KLH +  GTTL+ T++Q TG A G  G VN+T LKGGKVGF    + 
Sbjct  82    LSLHILLDYFDNNKLHQITNGTTLSTTLYQTTGTANGNVGSVNITDLKGGKVGFGSAASG  141

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              + DST+ KSV + PY ISVI+IS  + +    A      ++NIT L+ K GCK FA L+
Sbjct  142   SKLDSTYTKSVKQIPYNISVIEISAPIIAPGILAAPPPSANLNITALIEKAGCKTFASLI  201

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              + G   TF    + GLT+F P D+  +   +P    L+    +SLL YH  P Y  +G 
Sbjct  202   STNGLIKTFQSTADKGLTIFAPNDEAFKARGVPDLSKLTNAEVVSLLQYHATPKYLPVGS  261

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              ++  + + NTLA+ G+ KYDFTV  +G+ +T+ T V +++I  T+ D  PLS++ VD V
Sbjct  262   LKTTKDAI-NTLASNGAGKYDFTVSTAGDSLTIHTGVDSSRIADTILDSTPLSIYSVDSV  320

Query  473   LLPRELF  453
             LLP ELF
Sbjct  321   LLPPELF  327



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   265 bits (676),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 196/308 (64%), Gaps = 5/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL    ++S FN YLT T LA EIN RQTITVLVL N AM+D+  KH  L  IK+ 
Sbjct  22    NITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKH-PLSVIKSA  80

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  VL DY+  +KLH ++KGTTL+ T++Q TG+APG  G+VN+T L+GGKVGF    + 
Sbjct  81    LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAASG  140

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DST+ KSV + PY +SV++IS   ++     APA    DVNIT L+ K GCK FA L
Sbjct  141   SKLDSTYTKSVKQIPYNVSVLEISSPIIAPGILTAPAPS-ADVNITALLEKAGCKTFASL  199

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   TF   +  GLTVF P+D+  +   +P    L+    +SLL YH    Y  +G
Sbjct  200   LVSSGVIKTFESAISKGLTVFAPSDEAFKAAGVPDLTKLTNAEVVSLLQYHAANGYNPVG  259

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G ++TLAT G+ K+D TV  +G+ VTL T V ++++  T+ D  PL++F VD 
Sbjct  260   TLKTT-KGSISTLATNGAGKFDLTVTTAGDSVTLHTGVDSSRLADTVLDSTPLAIFTVDN  318

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  319   VLLPTELF  326



>ref|XP_003534603.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 194/313 (62%), Gaps = 3/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +TA   NIT ILA + D+S FN +L+ T LA +IN RQTITVLVLNNAA + +  KH  L
Sbjct  15    ATASAHNITDILAANPDYSDFNDFLSQTGLAGDINTRQTITVLVLNNAAFSAVAAKH-PL  73

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN+LS H+L DYF   KLH +  GTTL+ T++Q TG+A G  G VN+T LKGGKVGF
Sbjct  74    SVVKNLLSLHILLDYFDNTKLHQITNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGF  133

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                    + DS+++KSV   PY ISVI+IS  + +    A      DVNIT L+ K GCK
Sbjct  134   GSAAPGSKLDSSYIKSVKSIPYNISVIEISAPIMAPGILAAPPPSADVNITALIEKAGCK  193

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPA  672
              FA L+ S G   TF    + GLT+F P D+  +   +P    L+    +SLL YH    
Sbjct  194   TFASLISSNGLIKTFQATADKGLTIFAPNDEAFKAKGVPDLSKLTNAEVVSLLQYHAAAK  253

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y  +G  ++  + + NTLA+ G+ K+D TV  +G+ +TL T V +++I  T+ D  PLS+
Sbjct  254   YLPVGSLKTTKDSI-NTLASNGAGKFDLTVSVAGDSLTLHTGVDSSRIADTILDSSPLSI  312

Query  491   FKVDKVLLPRELF  453
             + VD VLLP+ELF
Sbjct  313   YSVDSVLLPQELF  325



>dbj|BAJ90388.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=419

 Score =   264 bits (675),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 209/313 (67%), Gaps = 7/313 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+IL ++ ++S FN+ LT T LA +IN+R+TITVLV+ N+ M  +     +L TI+
Sbjct  24    GYNITKILGEYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANSDMGSLAGGGRTLQTIR  83

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             ++L  HVL DY+G KKLH L  G T  ++MFQ +G APG SGYVN+T  +GGK  F  ED
Sbjct  84    HMLQIHVLVDYYGGKKLHQLAHGVTACSSMFQESGAAPGMSGYVNITQHRGGKATFTAED  143

Query  1016  NTGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                   S+ FVKSV E PY ++V+QIS  L+S  AEAP + P  VNIT L++K+ CK+FA
Sbjct  144   AEDSAPSSAFVKSVKEIPYDLAVLQISKVLASPEAEAPVAAPAPVNITELLSKKYCKSFA  203

Query  839   DLLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL +  A+A   +N   + GLT+FCP D  +  FMPKYKNL+  G+ ++LLYH VP Y 
Sbjct  204   GLL-AADAEAYSTINATKDNGLTLFCPVDAAVASFMPKYKNLTAKGRTAILLYHAVPDYY  262

Query  665   NLGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L +  SN +G ++TLAT    K  Y F V+  GE   L+T+V +A +T T+ D++PL+V
Sbjct  263   SLQLLTSN-SGKVSTLATSSVAKKDYSFDVEKDGETAELDTKVNSASVTYTIKDDDPLAV  321

Query  491   FKVDKVLLPRELF  453
             + + K L P+EL+
Sbjct  322   YAISKFLQPKELY  334



>ref|NP_001141906.1| uncharacterized protein LOC100274054 precursor [Zea mays]
 gb|ACF87282.1| unknown [Zea mays]
 tpg|DAA60915.1| TPA: hypothetical protein ZEAMMB73_301884 [Zea mays]
Length=416

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/322 (49%), Positives = 215/322 (67%), Gaps = 18/322 (6%)
 Frame = -1

Query  1382  AYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYT  1203
             A  +NIT+ILA + ++S FN  L+ T LA +INRRQTITVL ++N+AM+ +   HYSL T
Sbjct  34    ATKYNITKILAPYKEYSKFNDMLSKTRLAYDINRRQTITVLAVDNSAMSAL--DHYSLQT  91

Query  1202  IKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQA------TGDAPGTSGYVNMTALKGG  1041
             I++IL  HVL DY+G KKL  L  G+T +++MFQA      TG A G SGYVN+T  K G
Sbjct  92    IRHILELHVLVDYYGDKKLKKLAHGSTASSSMFQAWTCIQATGSASGMSGYVNITR-KDG  150

Query  1040  KVGFAPED--NTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLM  867
             KV F  ED  +T +  S +VKSV E PY I+V+Q+S  +SS+ AEAP   P  V++  L+
Sbjct  151   KVSFMTEDADDTAK-PSRYVKSVKEFPYDIAVLQVSSIISSAEAEAPVPPPAPVDLEELL  209

Query  866   AKQGCKAFADLLDSTGADATFALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLL  693
             +K+ CK+FA LL S  A+   A+N   + GLT+FCP D  +  F   YKNL+   K ++L
Sbjct  210   SKRYCKSFASLL-SANAEVFRAVNETKDNGLTLFCPVDSAVAAFAATYKNLTAKAKAAIL  268

Query  692   LYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGT  519
             LYH VP Y +L + +SN NG++ TLAT    K D++  V+N GE VTL+T VVT+ +T T
Sbjct  269   LYHAVPDYFSLQLLKSN-NGMVTTLATASDKKMDYSYDVKNKGETVTLQTRVVTSSVTAT  327

Query  518   MYDEEPLSVFKVDKVLLPRELF  453
             + D EPL+V+ V+K L P+ELF
Sbjct  328   VGDMEPLAVYAVNKFLQPKELF  349



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 197/313 (63%), Gaps = 4/313 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NITQILA   D+S+FN YLT T LA EIN R TIT+LVLNN AM+ +  KH  L
Sbjct  21    TTVKSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITLLVLNNGAMSSLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN LS  VL DY+  +KLH L+KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKNALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                    + +S++ +SV + PY ISV++I+  + +      ++ P   NIT L+ K GCK
Sbjct  140   GSAAPGSKLESSYTRSVKQIPYNISVLEINAPIIAPGVLTASTSPVS-NITGLLEKAGCK  198

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPA  672
              FA LL ++G   T+   +E GLTVF P D+  +    P  KNL+    +SLL YH +  
Sbjct  199   TFAGLLVTSGVLKTYESALEKGLTVFAPNDEAFKSEDAPNLKNLTNAETVSLLEYHALAE  258

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y+  G  ++N N + +TLAT G  KYD T   SG++V L T V  +++  T+ D  P+ +
Sbjct  259   YRPKGSLKTNKNKI-STLATNGVGKYDLTTSTSGDEVVLHTGVAPSRVADTVLDATPVVI  317

Query  491   FKVDKVLLPRELF  453
             F VDKVLLP ELF
Sbjct  318   FTVDKVLLPAELF  330



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   263 bits (673),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/314 (46%), Positives = 199/314 (63%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+   KLH ++KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKSALSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA      NIT L+ K GC
Sbjct  140   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGILTAPAPSAALSNITGLLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA+LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  200   KTFANLLVSSGVLKTYESAVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N + +TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  260   EYKPKGSLKTNKNNI-STLATNGAGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  318

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  319   IFTVDNVLLPAELF  332



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   265 bits (676),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 196/308 (64%), Gaps = 5/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL    ++S FN YLT T LA EIN RQTITVLVL N AM+D+  KH  L  IK+ 
Sbjct  63    NITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKH-PLSVIKSA  121

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  VL DY+  +KLH ++KGTTL+ T++Q TG+APG  G+VN+T L+GGKVGF    + 
Sbjct  122   LSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAASG  181

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DST+ KSV + PY +SV++IS   ++     APA    DVNIT L+ K GCK FA L
Sbjct  182   SKLDSTYTKSVKQIPYNVSVLEISSPIIAPGILTAPAPS-ADVNITALLEKAGCKTFASL  240

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   TF   +  GLTVF P+D+  +   +P    L+    +SLL YH    Y  +G
Sbjct  241   LVSSGVIKTFESAISKGLTVFAPSDEAFKAAGVPDLTKLTNAEVVSLLQYHAANGYNPVG  300

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G ++TLAT G+ K+D TV  +G+ VTL T V ++++  T+ D  PL++F VD 
Sbjct  301   TLKTT-KGSISTLATNGAGKFDLTVTTAGDSVTLHTGVDSSRLADTVLDSTPLAIFTVDN  359

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  360   VLLPTELF  367



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   263 bits (672),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 147/314 (47%), Positives = 196/314 (62%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA   D+S+FN YLT T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  24    STVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+   KLH L+KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  83    SVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA      NIT L+ K GC
Sbjct  143   GSAVSGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAAVSNITGLLEKAGC  202

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL S+G   T+   +E GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  203   KTFAGLLVSSGVLKTYESAIEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  262

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N +  TLAT G  K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  263   EYKPKGSLKTNKNNI-TTLATSGVGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  321

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  322   IFTVDSVLLPAELF  335



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score =   262 bits (669),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 197/314 (63%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQILA + ++S+FN YL+ T LA EIN R TIT+LVLNN AM  +  KH  L
Sbjct  21    STVRCHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN LS  VL DY+  +KLH ++ GT LT T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY ISV++I +  +S     APA      N+T L+ K GC
Sbjct  140   GSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAAVSNLTGLLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQ-GFMPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL S+G   T+   +E GLTVF P D+  +   +P    L++   +SLL YH + 
Sbjct  200   KTFAGLLVSSGVLKTYESTIEKGLTVFAPNDEAFKDDDVPDLTKLTQAEVVSLLEYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N + +TLAT G+ KYD T   SG++V L T +  +++  T+ D  P+ 
Sbjct  260   EYKPKGSLKTNKNKI-STLATNGAGKYDITTSTSGDEVVLHTGIAPSRLADTVLDATPVV  318

Query  494   VFKVDKVLLPRELF  453
             +F VDKVLLP ELF
Sbjct  319   IFSVDKVLLPPELF  332



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   261 bits (666),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 195/314 (62%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NIT IL+   ++S FN+YLT T LA EIN RQTITVL LNN AM  +  KH  L
Sbjct  19    STILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKH-PL  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN LS  V+ DY+   KLH ++KGTTL+ T++Q TG+APG  G+VN+T L+GGKVGF
Sbjct  78    SVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGC  852
                    + DS++ KSV + PY IS+++IS   ++     APA  P+ VNIT L+ K GC
Sbjct  138   GSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILTAPAPTPSSVNITALLEKAGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL ++G   T+    + GLT+F P D+  +   +P    L+    +SLL YH   
Sbjct  198   KTFASLLQTSGVIKTYQSAADKGLTIFAPNDEAFKAAGVPDLSKLTNAEIVSLLQYHATA  257

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y   G  +++ + + +TLA+ G+ K+D TV ++G+ VTL T +  +++  T+ D  PL 
Sbjct  258   TYSPFGSLKTSKDPI-STLASNGAGKFDLTVTSAGDSVTLHTGIGPSRVAETVLDSTPLV  316

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  317   IFTVDNVLLPVELF  330



>emb|CDX74743.1| BnaA05g04890D [Brassica napus]
Length=416

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/311 (46%), Positives = 196/311 (63%), Gaps = 4/311 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NITQILA + ++S+FN YL+ T LA EIN R TIT+LVLNN AM  +  KH  L  I
Sbjct  24    HSHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKH-PLSVI  82

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN LS  VL DY+  +KLH ++ GT LT T++Q TG+APG  G+VN+T LKGGKVGF   
Sbjct  83    KNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSA  142

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
              +  + DS++ KSV + PY ISV++I +  +S     APA      N+T L+ K GCK F
Sbjct  143   ASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAAVSNLTGLLEKAGCKTF  202

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQ-GFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A LL S+G   T+   +E GLTVF P D+  +   +P    L++   +SLL YH +  Y+
Sbjct  203   AGLLVSSGVLKTYESTIEKGLTVFAPNDEAFKDDDVPDLTKLTQAEVVSLLEYHALAEYK  262

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
               G  ++N N + +TLAT G+ KYD T   SG++V L T +  +++  T+ D  P+ +F 
Sbjct  263   PKGSLKTNKNKI-STLATNGAGKYDLTTSTSGDEVVLHTGIAPSRLADTVLDATPVVIFT  321

Query  485   VDKVLLPRELF  453
             VDKVLLP ELF
Sbjct  322   VDKVLLPPELF  332



>ref|XP_009143146.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=416

 Score =   260 bits (665),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 143/311 (46%), Positives = 196/311 (63%), Gaps = 4/311 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NITQILA + ++S+FN YL+ T LA EIN R TIT+LVLNN AM  +  KH  L  I
Sbjct  24    HSHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKH-PLSVI  82

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN LS  VL DY+  +KLH ++ GT LT T++Q TG+APG  G+VN+T LKGGKVGF   
Sbjct  83    KNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSA  142

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
              +  + DS++ KSV + PY ISV++I +  +S     APA      N+T L+ K GCK F
Sbjct  143   ASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGLLTAPAPSAAVSNLTGLLEKAGCKTF  202

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQ-GFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A LL S+G   T+   +E GLTVF P D+  +   +P    L++   +SLL YH +  Y+
Sbjct  203   AGLLVSSGVLKTYESTIEKGLTVFAPNDEAFKDDDVPDLTKLTQAEVVSLLEYHALAEYK  262

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
               G  ++N N + +TLAT G+ KYD T   SG++V L T +  +++  T+ D  P+ +F 
Sbjct  263   PKGSLKTNKNKI-STLATNGAGKYDLTTSTSGDEVVLHTGIAPSRLADTVLDATPVVIFT  321

Query  485   VDKVLLPRELF  453
             VDKVLLP ELF
Sbjct  322   VDKVLLPPELF  332



>ref|XP_003552347.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 191/307 (62%), Gaps = 3/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILA + D+S FN +L+ T LA EIN RQTITVLVLNNAA++ +  KH  L  +KN+
Sbjct  21    NITDILAANPDYSDFNGFLSQTGLAGEINTRQTITVLVLNNAALSAVAAKH-PLSVVKNL  79

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DYF   KLH +  GTTL+ T++Q TG+A G  G VN+T LKGGKVGF      
Sbjct  80    LSLHILLDYFDNTKLHQIPNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGFGSAAPG  139

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              + DS++ KSV + PY ISV++IS  + S    A      DVNIT L+ K GCK FA L+
Sbjct  140   SKLDSSYTKSVKQIPYNISVMEISAPIISPGILAAPPPSADVNITALIEKAGCKTFASLI  199

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              S G   TF    + GLT+F P D+  +   +P    L+    +SLL YH    Y  +G 
Sbjct  200   SSNGLIKTFQSTADKGLTIFAPNDEAFKAKGVPDLSKLTNAEVVSLLQYHAAAKYLPVGS  259

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              ++  + + NTLA+ G+ K+D TV  +G+ +TL T V +++I  T+ D  PLS++ VD V
Sbjct  260   LKTTKDSI-NTLASNGAGKFDLTVSVAGDSLTLHTGVDSSRIAETILDSTPLSIYSVDSV  318

Query  473   LLPRELF  453
             LLP ELF
Sbjct  319   LLPPELF  325



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score =   260 bits (664),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +L+   ++S +N YL+ T LA EIN RQT+T LVLNNAAM+ +  KH  L  IK  
Sbjct  22    NITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSALAGKH-PLSVIKKA  80

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L   V+ DY+  KKLH ++ GTTL+ T++Q TG+APG  G+VN+T LKGGKVGF      
Sbjct  81    LMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  140

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   ++     APA   +DVNIT L+ K GCK FA L
Sbjct  141   SKLDSSYTKSVKQIPYNISVLEISAPIIAPGLLTAPAPSASDVNITGLLEKAGCKTFASL  200

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L STG    +   VE GLTVF P D+  +   +P    L+    ++LL YH V AY  +G
Sbjct  201   LVSTGVIKIYESAVEKGLTVFAPNDEAFKADGVPDLTKLTNAELVTLLQYHAVAAYSPIG  260

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ KYD TV  +G+ VTL+T V ++++  T+ D  PL +F VD 
Sbjct  261   SLKTSKDPI-STLATSGAGKYDLTVSTAGDSVTLKTGVDSSRVADTVLDATPLCLFTVDN  319

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  320   LLLPTELF  327



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score =   259 bits (663),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +L+   ++S +N YL+ T LA EIN RQT+T LVLNNAAM+ +  KH  L  IK  
Sbjct  22    NITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSALAGKH-PLSVIKKA  80

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L   V+ DY+  KKLH ++ GTTL+ T++Q TG+APG  G+VN+T LKGGKVGF      
Sbjct  81    LMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  140

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   ++     APA   +DVNIT L+ K GCK FA L
Sbjct  141   SKLDSSYTKSVKQIPYNISVLEISAPIIAPGLLTAPAPSASDVNITGLLEKAGCKTFASL  200

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L STG    +   VE GLTVF P D+  +   +P    L+    ++LL YH V AY  +G
Sbjct  201   LVSTGVIKIYESAVEKGLTVFAPNDEAFKADGVPDLTKLTNAELVTLLQYHAVAAYSPIG  260

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ KYD TV  +G+ VTL+T V ++++  T+ D  PL +F VD 
Sbjct  261   SLKTSKDPI-STLATSGAGKYDLTVSTAGDSVTLKTGVDSSRVADTVLDATPLCLFTVDN  319

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  320   LLLPTELF  327



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score =   259 bits (662),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT +L+   ++S +N YL+ T LA EIN RQT+T LVLNNAAM+ +  KH  L  IK  
Sbjct  22    NITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSALAGKH-PLSVIKKA  80

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L   V+ DY+  KKLH ++ GTTL+ T++Q TG+APG  G+VN+T LKGGKVGF      
Sbjct  81    LMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAAPG  140

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   ++     APA   +DVNIT L+ K GCK FA L
Sbjct  141   SKLDSSYTKSVKQIPYNISVLEISAPIIAPGLLTAPAPSASDVNITGLLEKAGCKTFASL  200

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L STG    +   VE GLTVF P D+  +   +P    L+    ++LL YH V AY  +G
Sbjct  201   LVSTGVIKIYESAVEKGLTVFAPNDEAFKADGVPDLTKLTNAELVTLLQYHAVAAYSPIG  260

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ KYD TV  +G+ VTL+T V ++++  T+ D  PL +F VD 
Sbjct  261   SLKTSKDPI-STLATSGAGKYDLTVSTAGDSVTLKTGVDSSRVADTVLDATPLCLFTVDN  319

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  320   LLLPTELF  327



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   259 bits (663),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 195/314 (62%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NITQIL    D+S+FN YLT T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  24    STVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  82

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IK+ LS  VL DY+   KLH L+KGTTL+ T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  83    SVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGF  142

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
                 +  + DS++ KSV + PY IS+++I +  ++     APA      NIT L+ K GC
Sbjct  143   GSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGVLTAPAPSAAVSNITGLLEKAGC  202

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL S+G   T+   ++ GLTVF P+D+  +   +P    L++   +SLL YH + 
Sbjct  203   KTFAGLLVSSGVLKTYESAIDKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHALA  262

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y+  G  ++N N +  TLAT G  K+D T   SG++V L T V  +++  T+ D  P+ 
Sbjct  263   EYKPKGSLKTNKNNI-TTLATSGVGKFDLTTSTSGDEVILHTGVAPSRLADTVLDATPVV  321

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  322   IFTVDSVLLPAELF  335



>ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus 
euphratica]
Length=421

 Score =   259 bits (662),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 194/314 (62%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST    NIT IL+   ++S FN+YLT T LA EIN RQTITVL LNN AM  +  KH  L
Sbjct  19    STILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITVLALNNGAMTALAAKH-PL  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN LS  V+ DY+   KLH ++KGTTL+ T++Q TG+APG  G+VN+T L+GGKVGF
Sbjct  78    SVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGC  852
                    + DS++ KSV + PY IS+++IS   ++     APA  P+ VNIT L+ K GC
Sbjct  138   GSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGILTAPAPTPSSVNITALLEKAGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL ++G   T+    + GLT+F P D+  +   +P    L+    +SLL YH   
Sbjct  198   KTFASLLQTSGVIKTYQSAADKGLTIFAPNDEAFKAAGVPDLSKLTNAEIVSLLQYHATA  257

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y   G  +++ + + +TLA+ G+ K+D TV ++G+ V L T +  +++  T+ D  PL 
Sbjct  258   TYSPFGSLKTSKDPI-STLASNGAGKFDLTVTSAGDSVILHTGIGPSRVAETVLDSTPLV  316

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP ELF
Sbjct  317   IFTVDNVLLPVELF  330



>ref|XP_009379279.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Pyrus x 
bretschneideri]
Length=425

 Score =   259 bits (661),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/308 (45%), Positives = 193/308 (63%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   D+S +N YLT T LA EIN  QTITVLVLNNAA++ +  KH  L  IKN 
Sbjct  25    NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVLNNAAISALAAKH-PLAVIKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH ++ G+ LT T++Q TG APG  G+VN+T L+GGKVGF      
Sbjct  84    LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   ++     APA   +D NIT L+ K G K FA L
Sbjct  144   SKLDSSYTKSVKQIPYNISVLEISAPVIAPGILTAPAPSASDTNITALLEKAGAKKFASL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + STG   T+    + GLT+F P D+  +   +P    L+    +S+L YH +  Y  +G
Sbjct  204   IVSTGVIKTYQSAADKGLTIFAPNDEAFKAKGVPDLSKLTNAELVSILQYHAITGYSPIG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++    ++TLAT G+ KYD TV ++G+ VTL T V ++++  T+ D  PL++F VD 
Sbjct  264   SLKTS-KAPISTLATNGAGKYDLTVTSAGDQVTLHTGVGSSRVADTVLDATPLAIFTVDN  322

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  323   VLLPSELF  330



>gb|ABI95393.1| fasciclin-like protein FLA3 [Triticum aestivum]
Length=416

 Score =   258 bits (659),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 206/312 (66%), Gaps = 5/312 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+ILA + ++S FN+ LT T LA +IN+R+TITVLV+ N  M  +     +L TI+
Sbjct  23    GYNITKILAAYPEYSQFNKLLTQTRLAQDINKRRTITVLVVANGDMGSLAGGGRTLQTIR  82

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             ++L  HVL DY+G KKLH L  G T  ++MFQ +G APG SGYVN+T  +GGKV F  ED
Sbjct  83    HMLQIHVLVDYYGGKKLHQLAHGVTACSSMFQESGAAPGMSGYVNITQHRGGKVTFTAED  142

Query  1016  NTGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                   S+ FVKSV E PY ++V+QIS  L+S  AEAP + P  VNIT L++K+ CK+FA
Sbjct  143   AEDSAPSSAFVKSVKEIPYDLAVLQISKVLASPEAEAPVAAPAPVNITELLSKKYCKSFA  202

Query  839   DLLDSTGAD-ATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
              LL +     +T     + GLT+FCP D  +  FMPKYKNL+  G+ ++LLYH VP Y +
Sbjct  203   GLLAADADAYSTINATKDNGLTLFCPVDSAVASFMPKYKNLTAKGRTAILLYHAVPDYYS  262

Query  662   LGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L +  SN +G ++TLAT    K  Y F V+  GE   L+T+V +A +T T+ D++PL+V+
Sbjct  263   LQLLTSN-SGKVSTLATSNVAKKDYSFDVEKDGETAELDTKVNSASVTYTIKDDDPLAVY  321

Query  488   KVDKVLLPRELF  453
              + K L P+EL+
Sbjct  322   AISKFLQPKELY  333



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score =   258 bits (658),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 197/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+IL+   D+S +N +LT T LA EIN RQTIT+LVLNNAA++ +  KH  L  +KN 
Sbjct  25    NITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAISALAAKH-PLSVVKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH ++KG+TL+ T++Q TG APG  G+VN+T L+GGKVGF      
Sbjct  84    LSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY IS+++I+   ++     APA   +DVNIT L+ K G K FA L
Sbjct  144   SKLDSSYTKSVKQIPYNISILEINAPIIAPGILTAPAPSASDVNITALLEKAGAKTFASL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G   T+    E GLT+F P D+  +   +P    L+    +S+L +H V  Y  +G
Sbjct  204   IISSGVIKTYQSAAEKGLTIFAPNDEAFKAKGVPDLSKLTNAEVVSILQFHAVAGYTPIG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ K+D T   +G+ VTL T V ++++  T+ D  PL++F +D 
Sbjct  264   TLKTSKSPI-STLATNGAGKFDLTTTTAGDQVTLHTGVDSSRVADTVLDATPLAIFTIDN  322

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  323   VLLPLELF  330



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   258 bits (659),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 196/311 (63%), Gaps = 4/311 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             Y  NIT+IL+   ++S +N++LT T LA EIN R+TITVLVL N+AM+ +  KH  L  +
Sbjct  61    YAHNITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAMDSLAAKH-PLSVV  119

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             K  LS HV+ DY+   KLH ++ GTTL+ T++Q TG+APG  G+VN+T LKGGKVGF   
Sbjct  120   KKALSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGSA  179

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
                 + DST+ KSV + PY ISVI+IS   ++     APA   +D NIT L+ K GCK F
Sbjct  180   VPGSKLDSTYTKSVKQIPYNISVIEISAPIIAPGVLTAPAPSASDANITALLEKAGCKTF  239

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A+L+  TG   T+      GLT+F P+D+  +   +P    L+     SL LYH + +Y 
Sbjct  240   ANLIVQTGVLKTYQAAAGKGLTIFAPSDEAFKAAKLPDLSKLTSAELDSLCLYHALGSYD  299

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
               G  ++   G L TLAT G+ KY+ +V ++G+ VTL+T V ++++  T+ D  P+ +F 
Sbjct  300   PTGSLKAQ-KGSLPTLATNGAFKYELSVSSAGDTVTLDTGVDSSRLASTVLDTPPVCIFT  358

Query  485   VDKVLLPRELF  453
             VD +LLP ELF
Sbjct  359   VDSLLLPSELF  369



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score =   255 bits (652),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   ++S +N +LT T LA EIN RQTIT+LVLNNAA++ +  KH  L  +KN 
Sbjct  25    NITAILSAFPEYSQYNSFLTQTRLADEINTRQTITILVLNNAAISALAAKH-PLSVVKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH ++KG+TL+ T++Q TG APG  G+VN+T L+GGKVGF      
Sbjct  84    LSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY IS+++I+   ++     APA   +DVNIT L+ K G K FA L
Sbjct  144   SKLDSSYTKSVKQIPYNISILEINAPIIAPGLLTAPAPSASDVNITALLEKAGAKTFASL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G   T+    E GLT+F P D+  +   +P    L+    +S+L +H V  Y  +G
Sbjct  204   IISSGVIKTYQSAAEKGLTIFAPNDEAFKAKGVPDLSKLTNAEVVSILQFHAVAGYTPIG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ K+D T   +G+ VTL T V ++++  T+ D  PL++F +D 
Sbjct  264   TLKTSKSPI-STLATNGAGKFDLTTTTAGDQVTLHTGVDSSRVADTVLDATPLAIFTIDN  322

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  323   VLLPLELF  330



>ref|XP_008343059.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Malus domestica]
Length=425

 Score =   255 bits (651),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 191/308 (62%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   D+S +N YLT T LA EIN  QTITVLV NNAA++ +  KH  L  IKN 
Sbjct  25    NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVFNNAAISALAAKH-PLSVIKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH ++ G+ LT T++Q TG APG  G+VN+T L+GGKVGF      
Sbjct  84    LSLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   ++     APA   +D NIT L+ K G K FA L
Sbjct  144   SKLDSSYTKSVKQIPYNISVLEISAPVIAPGILTAPAPSASDTNITALLEKAGAKKFASL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + STG   T+    + GLT+F P D+  +   +P    L+    +S+L YH +  Y  +G
Sbjct  204   IVSTGVIKTYQSAADKGLTIFAPNDEAFKAKGVPDLSKLTNAELVSILQYHAIAGYSPIG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++    ++TLAT G+ KYD TV  +G+ VTL T V ++++  T+ D  P+++F VD 
Sbjct  264   SLKTS-KAPISTLATNGAGKYDLTVTTAGDQVTLHTGVGSSRVADTVLDATPVAIFTVDN  322

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  323   VLLPSELF  330



>ref|XP_004306902.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Fragaria 
vesca subsp. vesca]
Length=421

 Score =   253 bits (647),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 189/308 (61%), Gaps = 7/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL    ++S +N +LT T LA EIN R T+TVLVL N  M+ +  KH  L  IKN 
Sbjct  24    NITAILEATPEYSQYNSFLTQTRLADEINTRTTVTVLVLTNGVMSSLAAKH-PLSVIKNA  82

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H+L DY+   KLH ++ G+ LT T++Q TG APG  G+VN+T L GGKVGF      
Sbjct  83    LSLHILLDYYDPAKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLSGGKVGFGSAAPG  142

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY ISV++IS   L+     APA+   D NIT L+ K GCK FA L
Sbjct  143   SKLDSSYTKSVKQIPYNISVLEISAPVLAPGILNAPAA---DTNITGLLEKAGCKTFAGL  199

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   TF      GLT+F P D+  +   +P    L+    +SLL +H VP Y   G
Sbjct  200   LVSSGVIKTFETAAAKGLTLFAPNDEAFKAKGVPDLSKLTNADVVSLLQFHAVPKYTPKG  259

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +++ + + +TLAT G+ K+DFTV  SG+ VTL T V ++++  T+ D  PLSVF VD 
Sbjct  260   ALKTSKDPI-STLATNGAGKFDFTVTTSGDQVTLHTGVGSSRVADTVLDATPLSVFTVDS  318

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  319   VLLPAELF  326



>ref|XP_006402530.1| hypothetical protein EUTSA_v10005998mg [Eutrema salsugineum]
 gb|ESQ43983.1| hypothetical protein EUTSA_v10005998mg [Eutrema salsugineum]
Length=421

 Score =   253 bits (645),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 205/317 (65%), Gaps = 9/317 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G NITQILA   ++S+FN YL+ T LA EIN R TIT+LVLNN AM+ +  KH  L
Sbjct  21    STISGHNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKN LS  VL DY+  +KLH ++KGTTLT T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  80    SVIKNALSLLVLLDYYDPQKLHKISKGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQ  858
                    + DS++ KSV + PY ISV++I   + +     A AP++G    NIT L+ K 
Sbjct  140   GSAAPGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGILTAPAPSAGGIS-NITGLLEKS  198

Query  857   GCKAFADLLDSTGADATFALNVETGLTVFCPTDKVI--QGFMPKYKNLSKDGKMSLLLYH  684
             GCK FA+LL S+G   T+   VE GLTVF P+D+    QG +P    L++   +SLL YH
Sbjct  199   GCKTFANLLVSSGVLKTYESTVEKGLTVFAPSDEAFKAQG-VPDLTKLTQAEVVSLLEYH  257

Query  683   GVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEE  504
              +  Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE 
Sbjct  258   ALAEYKPKGSLKTNKDSI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVIDET  316

Query  503   PLSVFKVDKVLLPRELF  453
             P+ +F VDKVLLP ELF
Sbjct  317   PVVIFTVDKVLLPTELF  333



>ref|XP_002878353.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54612.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   250 bits (639),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 202/315 (64%), Gaps = 7/315 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL+   ++S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L 
Sbjct  22    TVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +KN LS  VL DY+   KLH L KG+TLT T++Q TG APG  G+VN+T LKGGKVGF 
Sbjct  81    VVKNALSLLVLLDYYDPLKLHQLAKGSTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQG  855
                   + DS++ KSV + PY ISV++I+  + +     A AP+SG  + N+T L+ K G
Sbjct  141   SAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAAAPSSGGVN-NLTGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA+LL S+G   T+   VE GLTVF P+D+  +   +P   NL++   +SLL YH +
Sbjct  200   CKTFANLLVSSGVLKTYESTVEKGLTVFAPSDEAFKAKGVPDLTNLTQAEVVSLLEYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPTELF  333



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score =   250 bits (638),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 137/314 (44%), Positives = 193/314 (61%), Gaps = 4/314 (1%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ++A   NIT+IL+   ++S FN  L+ T LA EIN R+ +TV VL N A++    K Y L
Sbjct  19    ASASASNITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGALSSFTGK-YPL  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               IKNIL+ HVL DYF   KLH +++G+ L+ T++Q TG+A G  G+VN+T L+GGKVGF
Sbjct  78    SVIKNILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGC  852
                      DSTF KSV + PY +SVI++S  ++ S+   APA   + VNIT L+ K GC
Sbjct  138   GSGVPGSPLDSTFTKSVKQVPYNLSVIEVSKAIAPSAVLTAPAPSASAVNITALLEKAGC  197

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL STG    +   V+ GLT+F P D+  +    P    LS    +S+L YH + 
Sbjct  198   KTFASLLVSTGVLKVYQSAVDKGLTIFAPNDEAFKAEDAPDLSKLSNAEVVSVLQYHALA  257

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
             +Y  +G  +    G + TLAT G+ KYD  V+ +G+ V+L+T V +++I  T+ D  PL 
Sbjct  258   SYTPIGTLKQT-KGTITTLATNGAAKYDLGVRTAGDSVSLDTGVDSSRIASTVLDSTPLC  316

Query  494   VFKVDKVLLPRELF  453
             +F VD +LLP ELF
Sbjct  317   IFTVDSLLLPVELF  330



>gb|EMT07250.1| hypothetical protein F775_26198 [Aegilops tauschii]
Length=416

 Score =   249 bits (636),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 203/312 (65%), Gaps = 5/312 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+ILA + ++S FN+ LT T LA +IN+R+TITVLV+       +     +L TI+
Sbjct  23    GYNITKILAAYPEYSQFNKLLTQTRLAQDINKRRTITVLVVATGDRGSLAGGGRTLQTIR  82

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             ++L  HVL DY+G KKLH L  G T  ++MFQ +G APG SGYVN+T  +GGKV F  ED
Sbjct  83    HMLQIHVLVDYYGGKKLHQLAHGVTACSSMFQESGAAPGMSGYVNITQHRGGKVTFTAED  142

Query  1016  NTGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                   S+ FVKSV E PY ++V+QIS  L+S  AEAP + P  VNIT L++K+ CK+FA
Sbjct  143   AEDSAPSSAFVKSVKEIPYDLAVLQISKVLASPEAEAPVAAPAPVNITELLSKKYCKSFA  202

Query  839   DLLDSTGAD-ATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
              LL +     +T     + GLT+FCP D  +  FMPKYKNL+  G+ ++LLYH VP Y +
Sbjct  203   GLLAADADAYSTINATKDNGLTLFCPVDSAVASFMPKYKNLTAKGRTAILLYHAVPDYYS  262

Query  662   LGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L +  S  +G ++TLAT    K  Y F V+  GE   L+T+V +A +T T+ D++PL+V+
Sbjct  263   LQLLTSI-SGKVSTLATSNVAKKDYSFDVEKDGETAELDTKVNSASVTYTIKDDDPLAVY  321

Query  488   KVDKVLLPRELF  453
              + K L P+EL+
Sbjct  322   AISKFLQPKELY  333



>ref|XP_004492650.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Cicer 
arietinum]
Length=423

 Score =   249 bits (637),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 194/316 (61%), Gaps = 9/316 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT+IL+ + D+S +N +L+ T LA EIN RQTITVLVLNNAA + I  KH  L
Sbjct  19    TTISAHNITEILSDNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSKH-PL  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN+LS  +L DYF   KLH +  GTT++ T+FQ TG+A  + G VN+T +KGGKV F
Sbjct  78    SVVKNVLSLLILLDYFDNTKLHQITNGTTISTTLFQTTGNAQNSVGSVNITDIKGGKVAF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQ  858
                    + DST+ KS+ + PY ISV++I+  + +     A  P+S   DVNIT L+ K 
Sbjct  138   GSAAPGSKLDSTYTKSIKQIPYNISVLEINAPIIAPGILTAPPPSS---DVNITALIEKA  194

Query  857   GCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHG  681
             GCK FA L+ + G   TF    + GLT+F P D+  +   +P    L+    +SLL YH 
Sbjct  195   GCKTFATLISTNGLIKTFQSTADKGLTIFAPNDEAFKARGVPDLNKLTNAEIVSLLQYHA  254

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
                Y  +G  ++  + +  TLAT G+ K+D+TV  +G+ VTL T V +++I  T+ D  P
Sbjct  255   AAKYLPVGSLKTTKDPI-TTLATNGAGKFDYTVSVAGDSVTLHTGVDSSRIADTILDSTP  313

Query  500   LSVFKVDKVLLPRELF  453
             LS++ VD VLLP ELF
Sbjct  314   LSIYSVDSVLLPPELF  329



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 194/314 (62%), Gaps = 6/314 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             STA+  NIT+IL+   ++S  N YLT T LA EIN R+TIT LVL N+AM+  L  +  L
Sbjct  23    STAH--NITEILSGFPEYSAMNDYLTRTKLADEINTRETITCLVLPNSAMS-ALAANKPL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN+L   VL DY+   KLH ++KGTTLT T++Q TGDA G  G+VN+T LKGGKVGF
Sbjct  80    SVVKNVLRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNITDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGC  852
                    + DST+ KSV + PY ISV++IS   ++     APA    DVNIT  + K GC
Sbjct  140   GSAAPGSKLDSTYTKSVKQIPYNISVLEISAPIIAPGILTAPAPSAADVNITQKLEKAGC  199

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL S+G    F   ++ GLTVF P D+  +   +P    L+    ++LL YH + 
Sbjct  200   KTFASLLVSSGVLKMFESALDKGLTVFAPNDEAFKAAGVPDLSKLTNAELVTLLQYHALA  259

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
              Y   G  ++   G ++TLAT G+ KYD TV ++G+ VTL T V ++++  T+ D+ PL 
Sbjct  260   RYNPFGSLKT-AKGPISTLATNGAGKYDLTVTSAGDSVTLHTGVDSSRVASTVVDDPPLC  318

Query  494   VFKVDKVLLPRELF  453
             +  VD +LLP ELF
Sbjct  319   ILTVDNLLLPSELF  332



>ref|XP_010469133.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=422

 Score =   248 bits (634),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 200/315 (63%), Gaps = 7/315 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL+   D+S+FN YL+ T L  EIN R TITVLVLNNAAM+ +  KH  L 
Sbjct  22    TVSGHNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +KN LS  VL DY+   KLH L+KGTTLT T++Q TG APG  G+VN+T LKGGKVGF 
Sbjct  81    VVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQG  855
                   + DS++ KSV + PY ISV++I+  + +     A AP+SG    NIT L+ K G
Sbjct  141   SAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPAPSSGGLS-NITGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH +
Sbjct  200   CKTFAGLLVSSGVLKTYVSTVEKGLTVFAPSDEAFKAKGVPDLTKLTQAEVVSLLEYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPTELF  333



>gb|AAK55685.1|AF378882_1 AT3g60900/T4C21_310 [Arabidopsis thaliana]
Length=410

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 200/315 (63%), Gaps = 5/315 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G NITQIL+   ++S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN LS  VL DY+   KLH L+KGTTLT T++Q TG A G  G+VN+T LKGGKVGF
Sbjct  80    SVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVTDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDV-NITTLMAKQG  855
                    + DS++ KSV + PY ISV++I+   ++     APA     V NIT L+ K G
Sbjct  140   GSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPAPSSAGVSNITGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA+LL S+G   TF   VE GLTVF P+D+  +   +P   NL++   +SLL YH +
Sbjct  200   CKTFANLLVSSGVIKTFESTVEKGLTVFAPSDEAFKARGVPDLTNLTQAEVVSLLEYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPAELF  333



>ref|NP_191649.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
 sp|Q9LZX4.1|FLA10_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 10; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB82694.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AAM65173.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AEE80125.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
Length=422

 Score =   248 bits (633),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 151/315 (48%), Positives = 200/315 (63%), Gaps = 5/315 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G NITQIL+   ++S+FN YL+ T LA EIN R TITVLVLNN AM+ +  KH  L
Sbjct  21    STVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAMSSLAGKH-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN LS  VL DY+   KLH L+KGTTLT T++Q TG A G  G+VN+T LKGGKVGF
Sbjct  80    SVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVTDLKGGKVGF  139

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDV-NITTLMAKQG  855
                    + DS++ KSV + PY ISV++I+   ++     APA     V NIT L+ K G
Sbjct  140   GSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPAPSSAGVSNITGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA+LL S+G   TF   VE GLTVF P+D+  +   +P   NL++   +SLL YH +
Sbjct  200   CKTFANLLVSSGVIKTFESTVEKGLTVFAPSDEAFKARGVPDLTNLTQAEVVSLLEYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPAELF  333



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 135/308 (44%), Positives = 189/308 (61%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+IL  + ++S FN  LT T LA EI+ R+ +TVL L N+ ++ I  K Y L  +K++
Sbjct  3     NITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSELSSISGK-YPLGVVKSV  61

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DYF   KLH ++ G+ L+ T+ Q TG+A G  G+VN+T L+GGKVGF      
Sbjct  62    LSLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGIAG  121

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSS-SYAEAPASGPTDVNITTLMAKQGCKAFADL  834
                DSTF KSV + PY ISVI++S  ++  +   A +  P+DVNIT L+ K GCK FA L
Sbjct  122   SPLDSTFTKSVQQIPYNISVIEVSKAIAPDAILTAASPSPSDVNITALLEKAGCKTFASL  181

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + STG    +   V+ GLT+F P D+  +    P    LS    +SLL YH + +Y  +G
Sbjct  182   IVSTGVLKVYQSAVDNGLTIFAPNDEAFKSADAPDLTKLSNADVVSLLQYHALASYSPIG  241

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               +    G ++TLAT G+ KYD  V  +G+ V+L T V +++I  T+ D  PLS+F VD 
Sbjct  242   TLK-QAKGKISTLATNGAEKYDLGVTTAGDSVSLTTGVDSSRIASTVLDSTPLSIFTVDS  300

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  301   LLLPVELF  308



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score =   247 bits (631),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 145/316 (46%), Positives = 196/316 (62%), Gaps = 13/316 (4%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL++  ++S+FN YL+ T L  EIN R TIT+LVLNN  M+ +  KH  L 
Sbjct  22    TVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +K  LS  VL DY+   KLH +++GTTL  T++Q TG A G  G+VN+T LKGGKVGF 
Sbjct  81    VVKTALSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCK  849
                   +  + + KSV + PY ISV++I+   ++     APA  P++ N+T L+ K GCK
Sbjct  141   SAAPGSKLGANYTKSVKQIPYNISVLEINAPIIAPGILTAPA--PSN-NMTELLEKAGCK  197

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF----MPKYKNLSKDGKMSLLLYHG  681
              FA +L S+G   T+   VE GLTVF P+D   +GF     P    L++   +SLL YH 
Sbjct  198   IFASMLLSSGVVKTYESTVEKGLTVFAPSD---EGFKAESAPDLTKLTQAEVVSLLEYHA  254

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             +  Y+  G  + N N V++TLAT G+ KYD T   SG++V L T V  +++  T+ DE P
Sbjct  255   LAEYKPKGSLKINKN-VISTLATNGAGKYDLTTSTSGDEVILHTGVGPSRVADTVVDETP  313

Query  500   LSVFKVDKVLLPRELF  453
             L VFKVDKVLLP ELF
Sbjct  314   LVVFKVDKVLLPIELF  329



>ref|XP_007052018.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
 gb|EOX96175.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
Length=425

 Score =   246 bits (628),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 141/313 (45%), Positives = 199/313 (64%), Gaps = 4/313 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             TA+  NIT IL    D+S +N +L+ T LA EIN R+TIT LVL+N AM+ +  KH  L 
Sbjct  20    TAHAHNITAILEGFPDYSVYNSFLSQTKLADEINSRETITCLVLSNGAMSALTAKH-PLS  78

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKNILS HVL DY+  +KLH ++KGTTLT T++Q TG+APG  G+VN+T L+GGKV F 
Sbjct  79    VIKNILSLHVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVAFG  138

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCK  849
                   + DS++ KSV + PY IS+I+IS   ++     APA   +DVNIT L+ K GCK
Sbjct  139   SAIPGSKLDSSYTKSVKQIPYNISIIEISAPIIAPGILTAPAPSASDVNITGLLEKAGCK  198

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPA  672
              FA LL S+G   T+   ++ GLT+F P+D+  +   +P    L+   +++LL YH  P 
Sbjct  199   TFASLLISSGVLKTYESALDKGLTIFAPSDEAFKAEGVPDLSKLTNSDQVTLLQYHASPE  258

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y+  G  ++  +  LNTLAT G+ K+   V  +G+ VTL T V ++++   ++D  P+ +
Sbjct  259   YKPKGTLKTTKDP-LNTLATSGAGKFHLKVTTAGDSVTLHTGVGSSRVAEAVFDSPPVVI  317

Query  491   FKVDKVLLPRELF  453
             F VD VLLP ELF
Sbjct  318   FTVDNVLLPSELF  330



>gb|ABV27484.1| fasciclin-like arabinogalactan protein 13 [Gossypium hirsutum]
Length=425

 Score =   246 bits (628),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 198/310 (64%), Gaps = 4/310 (1%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT IL    D+S +N +LT T LA EIN R+TIT LVLNN AM+ +  KH  L  +K
Sbjct  23    GHNITAILEGFPDYSVYNSFLTQTKLADEINTRETITCLVLNNGAMSALTSKH-PLSVVK  81

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             NILS HVL DY+  +KLH ++ GTTLT T++Q TG+APG  G+VN+T L+GGKVGF    
Sbjct  82    NILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAI  141

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                + DS++ KSV + PY IS+++IS   ++     APA   + VNIT L+ K GCK FA
Sbjct  142   PGSKLDSSYTKSVKQIPYNISILEISAPIIAPGILTAPAPSSSGVNITGLLEKAGCKTFA  201

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQN  663
              LL S+G   T+   ++ GLTVF P+D+  +   +P    L+   ++SLL YH  P Y+ 
Sbjct  202   SLLTSSGVLKTYESALDKGLTVFAPSDEAFKAEGVPDLSKLTNAEQVSLLEYHASPDYKP  261

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
              G  ++  + + +TLAT G+ KYD TV  +G+ +TL T V  +++   ++D  P+++F V
Sbjct  262   KGTLKTTKDPI-STLATNGAGKYDLTVTTAGDSMTLHTGVGPSRVAEAVFDSPPVAIFTV  320

Query  482   DKVLLPRELF  453
             D VLLP ELF
Sbjct  321   DNVLLPSELF  330



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   246 bits (627),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 192/308 (62%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL++  D+S +N+YLT T LA EIN R T+TVLVLNN A + +  KH +   +K +
Sbjct  26    NITAILSEFPDYSDYNKYLTQTKLADEINSRTTVTVLVLNNGAFSALASKHPA-SVLKKV  84

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS H++ DYF  +KLH L  G+TL+ T++Q TG+APG  G +N+T LKGGKVGF      
Sbjct  85    LSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAPGNLGSINITDLKGGKVGFGSAAQG  144

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DST+ K+V E PY ISV++IS   +++    APA   +DVNIT L+ K G K FA L
Sbjct  145   SKLDSTYTKTVKEIPYNISVLEISAPIIATGILTAPAPSASDVNITALLEKAGAKKFASL  204

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G   T+    E GLT+F P D+  +   +P    L+    +SLLLYH +  Y   G
Sbjct  205   ISSSGVIKTYESAAEKGLTIFAPNDEAFKAPGVPDLNKLTNAELVSLLLYHSLAGYTPKG  264

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++     L TLAT G+ KYD TV  +G+ VTL T V ++++  T+ D  PL +F VD 
Sbjct  265   SLKTT-TASLTTLATNGAGKYDITVTTAGDSVTLHTGVDSSRVADTVLDSTPLVIFTVDN  323

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  324   LLLPTELF  331



>ref|XP_010525235.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Tarenaya 
hassleriana]
Length=525

 Score =   249 bits (635),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 200/313 (64%), Gaps = 4/313 (1%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NIT ILA   D+S FN YLT T LA EIN R TITVLVLNN AM+ +  KH  L 
Sbjct  22    TVGGHNITDILAGSSDYSQFNSYLTQTKLADEINSRTTITVLVLNNGAMSALAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKN LS  VL DY+  +KLH ++KGTTLT T++Q TG+APG  G+VN+T LKGGKVGF 
Sbjct  81    VIKNALSLLVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                +  + DS++ KSV + PY ISV++I +  ++     APA     VNIT L+ K GCK
Sbjct  141   SAASGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGILTAPAPSAAGVNITGLLEKAGCK  200

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPA  672
              FA+LL ++G   T+   V+ GLTVF P+D+  +   +P    L++   +SLL YH +  
Sbjct  201   TFANLLVTSGVIKTYESTVDKGLTVFAPSDEAFKADGVPDLSKLTQAEVVSLLEYHALAE  260

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y+  G  ++N + + +TLAT G+ K+D T   SG++V L T V  +++  T+ D  P+++
Sbjct  261   YKPKGSLKTNKDSI-STLATNGAGKFDLTTSTSGDEVVLHTGVGPSRVADTVLDATPVAI  319

Query  491   FKVDKVLLPRELF  453
             F VD VLLP ELF
Sbjct  320   FTVDNVLLPTELF  332



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score =   245 bits (625),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 195/314 (62%), Gaps = 7/314 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             S A   NIT+IL  + ++S FN  L+ T LA EIN R+ +TV VL N A++    K Y L
Sbjct  19    SIAAATNITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVLPNGALSSFTGK-YPL  77

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               ++NIL+ HVL DYF   KLH +++G+ L+ T++Q TG+A G  G+VN+T LKGGKVGF
Sbjct  78    SVVENILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLGFVNITDLKGGKVGF  137

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGC  852
                      DST+ KSV + PY +SVI++S  ++ ++   AP++   DVNIT L+ K GC
Sbjct  138   GSGVAGSPLDSTYTKSVKQIPYNVSVIEVSKAIAPAAVLTAPSA---DVNITALLVKAGC  194

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA L+ S G    +   ++ GLT+F P D+  +   +P    LS    +S+L YH + 
Sbjct  195   KTFASLIVSNGVSKVYESALDKGLTIFAPNDEAFKAAGVPDLSTLSNAEVVSILQYHALA  254

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
             +Y  +G  +    G ++TLAT G+ KYD +V+ +G+ V+L+T V T++I  T+ D  PL 
Sbjct  255   SYAPIGTLKQT-KGKISTLATNGAGKYDLSVKTAGDSVSLDTGVDTSRIASTVLDSTPLC  313

Query  494   VFKVDKVLLPRELF  453
             +F VD +LLP ELF
Sbjct  314   IFTVDSLLLPVELF  327



>ref|XP_010512424.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=422

 Score =   244 bits (623),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 199/315 (63%), Gaps = 7/315 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL+   D+S+FN YL+ T L  EIN R TITVLVLNNAAM+ +  KH  L 
Sbjct  22    TVSGHNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +KN LS  VL DY+   KLH L+KGTTLT T++Q TG APG  G+VN+T LKGGKVGF 
Sbjct  81    VVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQG  855
                   + DS++ KSV + PY ISV++I+  + +     A +P+SG    NIT L+ K G
Sbjct  141   SAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPSPSSGGLS-NITGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G   T+   VE  LTVF P+D+  +   +P    L++   +SLL YH +
Sbjct  200   CKTFAGLLVSSGVLKTYVSTVEKDLTVFAPSDEAFKAKGVPDLTKLTQAEVVSLLEYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPTELF  333



>ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
sylvestris]
Length=422

 Score =   243 bits (621),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 143/311 (46%), Positives = 192/311 (62%), Gaps = 4/311 (1%)
 Frame = -1

Query  1379  YGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTI  1200
             +  NIT+IL+K  ++S FN YLT T LA EIN R TIT+L L N AM D++ KH  L  I
Sbjct  19    HAHNITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILALTNGAMADVVGKH-PLSVI  77

Query  1199  KNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPE  1020
             KN+LS H+L DYF   KLH ++ GTTLT T++Q TG+A G  G VN+T LKGGKVGF   
Sbjct  78    KNVLSLHILLDYFDNTKLHKISDGTTLTTTLYQTTGNANGNLGSVNITDLKGGKVGFGSA  137

Query  1019  DNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAF  843
              +     ST+ KSV +  Y ISV++IS   ++     APA    D NIT  + K GCK F
Sbjct  138   VSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGILTAPAPSALDFNITAALEKAGCKTF  197

Query  842   ADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQ  666
             A LL  +G   T+   + TGLTVF P D+  +G  +P    L     +SLL YH VP+Y 
Sbjct  198   ASLLVQSGVLKTYQTAIATGLTVFAPNDEAFKGKNVPDLNKLKSAEVVSLLQYHAVPSYT  257

Query  665   NLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFK  486
              +G  ++  + + +TLAT G++KYD +   +G+ VTL+T V +++I  T+ D  P  +F 
Sbjct  258   PIGTLKTKKDPI-STLATNGASKYDLSASTAGDQVTLDTGVDSSRIASTVIDSTPFCIFT  316

Query  485   VDKVLLPRELF  453
             VD VLLP ELF
Sbjct  317   VDSVLLPEELF  327



>gb|AIY35292.1| fasciclin-like arabinogalactan 12 [Gossypium hirsutum]
Length=415

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 138/308 (45%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL    D+S +N +LT T LA EIN RQTIT LVLNN AM+ +  KH  L  +KNI
Sbjct  27    NITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKH-PLSVVKNI  85

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+  +KLH ++ GTTLT T++Q TG+APG  G+VN+T L+GGKVGF      
Sbjct  86    LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAVPG  145

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY IS+++IS   ++     APA   + VNIT L+ K GCK FA+L
Sbjct  146   SKLDSSYTKSVKQVPYNISILEISAPIIAPGVLSAPAPSASGVNITGLLEKAGCKTFANL  205

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   T+   ++ GLT+F P+D+  +   +P    L+   ++SLL YH  P Y+  G
Sbjct  206   LTSSGVLKTYEAALDKGLTIFAPSDEAFKADGVPDLSKLTNADQVSLLEYHASPDYKPKG  265

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++  + +  TLAT G+ K+D TV  +G+ VTL T +  +++   ++D  P+ +F VD 
Sbjct  266   TLKTTKDPI-TTLATRGAGKFDLTVTAAGDSVTLHTGISPSRVAEAVFDSPPVVIFTVDN  324

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  325   ILLPSELF  332



>gb|AFK41095.1| unknown [Lotus japonicus]
Length=423

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 189/307 (62%), Gaps = 3/307 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+ILA + D+S++N +L+ T LA EIN RQTITVLV+ N+A + I   H  L  +KN+
Sbjct  25    NITEILAANPDYSSYNSFLSQTKLADEINSRQTITVLVIPNSAFSAITASH-PLPVVKNV  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  +L DYF   KLH L  GTTL+ T+FQ TG A G  G VN+T LKGGKV F      
Sbjct  84    LSLLILLDYFDNTKLHQLTDGTTLSTTLFQTTGTATGNVGSVNITDLKGGKVAFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLL  831
              +  ST+ KSV + PY ISV++IS  + +    +     + VN+T L+ K GCK FA L+
Sbjct  144   SKLASTYTKSVKQIPYNISVLEISAPIIAPGVLSAPPPSSSVNLTALIEKAGCKTFASLV  203

Query  830   DSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLGM  654
              S G   TF    + GLT+F P+D+  +   +P    L+    +SLL YH V  Y  +G 
Sbjct  204   LSNGLIKTFQSAADKGLTIFAPSDEAFKARGVPDLSKLTNAEVVSLLQYHAVAKYLPVGS  263

Query  653   FRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKV  474
              ++  + + +TLAT G+ K+++TV  +G+ VTL T V ++++  T+ D  PLS++ VD V
Sbjct  264   LKTTKDPI-STLATNGAGKFEYTVSVAGDSVTLHTGVDSSRVADTVLDSTPLSIYSVDSV  322

Query  473   LLPRELF  453
             LLP ELF
Sbjct  323   LLPPELF  329



>gb|ABV27483.1| fasciclin-like arabinogalactan protein 12 [Gossypium hirsutum]
Length=415

 Score =   241 bits (616),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 137/308 (44%), Positives = 196/308 (64%), Gaps = 4/308 (1%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             +IT IL    D+S +N +LT T LA EIN RQTIT LVLNN AM+ +  KH  L  +KNI
Sbjct  27    SITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKH-PLSVVKNI  85

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+  +KLH ++ GTTLT T++Q TG+APG  G+VN+T L+GGKVGF      
Sbjct  86    LSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAVPG  145

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              + DS++ KSV + PY IS+++IS   ++     APA   + VNIT L+ K GCK FA+L
Sbjct  146   SKLDSSYTKSVKQVPYNISILEISAPIIAPGVLSAPAPSASGVNITGLLEKAGCKTFANL  205

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G   T+   ++ GLT+F P+D+  +   +P    L+   ++SLL YH  P Y+  G
Sbjct  206   LTSSGVLKTYEAALDKGLTIFAPSDEAFKADGVPDLSKLTNADQVSLLEYHASPDYKPKG  265

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++  + +  TLAT G+ K+D TV  +G+ VTL T +  +++   ++D  P+ +F VD 
Sbjct  266   TLKTTKDPI-TTLATRGAGKFDLTVTAAGDSVTLHTGISPSRVAEAVFDSPPVVIFTVDN  324

Query  476   VLLPRELF  453
             +LLP ELF
Sbjct  325   ILLPSELF  332



>ref|XP_006292436.1| hypothetical protein CARUB_v10018654mg [Capsella rubella]
 gb|EOA25334.1| hypothetical protein CARUB_v10018654mg [Capsella rubella]
Length=427

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 200/315 (63%), Gaps = 7/315 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL+   D+S+FN YL+ T LA EIN R TITVLVL N AM+ +  KH  L 
Sbjct  22    TVSGHNITQILSDTPDYSSFNSYLSQTKLADEINSRTTITVLVLKNGAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +KN LS  VL DY+   KLH L++GTTLT T++Q TG+APG  G+VN+T LKGGKVGF 
Sbjct  81    VVKNALSLLVLLDYYDPLKLHQLSQGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQG  855
                   + DS++ KSV + PY ISV++I+  + +     A AP+SG    NIT L+ K G
Sbjct  141   SAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPAPSSGGLS-NITGLLEKAG  199

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G   T+   +E GLTVF P+D+  +   +P    L++   +SLL YH +
Sbjct  200   CKTFASLLVSSGVLKTYVSTIEKGLTVFAPSDEAFRAKGVPDLTKLTQAEVVSLLDYHAL  259

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  260   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVAPSRLADTVIDETPV  318

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  319   VIFTVDNVLLPTELF  333



>ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum 
lycopersicum]
Length=414

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 195/314 (62%), Gaps = 7/314 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             + +  NIT+IL K  ++S FN YL+ T LA EIN R+TITVL L N AM+ I+DKH  L 
Sbjct  15    SVHAHNITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAMSAIVDKH-PLS  73

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKN+LS HVL DYF   KLH ++ GTT + T++Q TG+A G  G VN+T LKGGKVGF 
Sbjct  74    VIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNIGSVNITDLKGGKVGFG  133

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPA-SGPTDVNITTLMAKQGC  852
                      ST+ KSV +  Y ISV+++S   ++     APA SG  D NIT  + K GC
Sbjct  134   SAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGILTAPAPSG--DFNITGALEKAGC  191

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL  +G   T+   +E GLT+F P D+  +G  +P   +LS    +SLL YH +P
Sbjct  192   KTFASLLVKSGVLKTYQTAIEKGLTIFAPNDEAFKGAKVPDLSDLSSADVVSLLQYHAIP  251

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
             +Y  +G  ++  + + +TLAT G++KYD  V   G+ VTL+T V +++I  T+ D  P  
Sbjct  252   SYTPIGTLKTTKDPI-STLATNGASKYDLAVSTEGDQVTLDTGVDSSRIASTVIDSTPFC  310

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP EL+
Sbjct  311   IFTVDSVLLPVELY  324



>ref|XP_004973191.1| PREDICTED: fasciclin-like arabinogalactan protein 2-like [Setaria 
italica]
Length=413

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 197/315 (63%), Gaps = 11/315 (3%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             GF+I QIL KHD+FS F + L  THLA +INR +TITVL + N  M  +   HYSL TI+
Sbjct  22    GFDILQILGKHDEFSQFCKLLNETHLAGDINRDRTITVLAVANGDMGHLTSAHYSLGTIR  81

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  HV+ADY+  KKL  L+ G T  +T+FQ +G APG +GYVN+T  +GGKV F  +D
Sbjct  82    HILELHVVADYYDEKKLKQLSHGATAASTLFQRSGFAPGMAGYVNITQHRGGKVTFIVDD  141

Query  1016  NTGRFDS-TFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                     TFVK +    Y  SV+Q+S  LSS  AEAP + P  VN+T L++K+ CK+FA
Sbjct  142   AADSVKPVTFVKQIESHRYDYSVLQVSSVLSSPEAEAPVAPPAPVNLTELLSKKYCKSFA  201

Query  839   DLLDSTGADA----TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
              LL    ADA    T     +T LT+FCP D  +  FMPK+KNL+   K ++LLYH VP 
Sbjct  202   GLL---AADAKAFDTINGTKDTALTLFCPVDAAVAAFMPKFKNLTAKAKTAILLYHAVPD  258

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPL  498
             Y ++   +SN  G + TLA+    K D+T   Q   + VTL+T V T+ I  T+ D++PL
Sbjct  259   YYSMQFLKSN-KGKVTTLASTSVAKKDYTYEAQTEADTVTLDTTVTTSTIQATVRDDDPL  317

Query  497   SVFKVDKVLLPRELF  453
             +++ V K L P+ELF
Sbjct  318   AIYAVSKFLQPKELF  332



>ref|XP_010418601.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Camelina 
sativa]
Length=413

 Score =   238 bits (607),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 198/315 (63%), Gaps = 18/315 (6%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             TA+G NITQIL+   D+S+FN YL+ T L  EIN R TITVLVLNNAAM+ +  KH  L 
Sbjct  22    TAFGHNITQILSDTPDYSSFNSYLSQTKLDDEINSRTTITVLVLNNAAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +KN LS  VL DY+   KLH L+KGTTLT T++Q TG APG  G+VN+T LKGGK    
Sbjct  81    VVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHAPGNLGFVNVTDLKGGK----  136

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQG  855
                     DS++ KSV + PY ISV++I+  + +     A +P+SG    NIT L+ K G
Sbjct  137   -------LDSSYTKSVKQIPYNISVLEINAPIIAPGILTAPSPSSGGLS-NITGLLEKAG  188

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH +
Sbjct  189   CKTFAGLLVSSGVLKTYVSTVEKGLTVFAPSDEAFKAKGVPDLTKLTQAEVVSLLEYHAL  248

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T V  +++  T+ DE P+
Sbjct  249   AEYKPKGSLKTNKDAI-STLATNGAGKYDLTTSTSGDEVILHTGVGPSRLADTVVDETPV  307

Query  497   SVFKVDKVLLPRELF  453
              +F VD VLLP ELF
Sbjct  308   VIFTVDNVLLPTELF  322



>ref|XP_010545153.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Tarenaya 
hassleriana]
Length=445

 Score =   238 bits (607),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 147/358 (41%), Positives = 205/358 (57%), Gaps = 46/358 (13%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKH--  1218
             FST  G NIT+IL+   D+S FN YLT T LA EIN R TITVLVL+N AM+ +  KH  
Sbjct  20    FSTVGGHNITEILSGSPDYSQFNSYLTQTRLADEINSRTTITVLVLSNGAMSALAGKHPL  79

Query  1217  -----------------------------------------YSLYTIKNILSYHVLADYF  1161
                                                      + L  +KN LS  VL DY+
Sbjct  80    SVVKNFNSYLPQTRLADEITSRTTITVLVLSNGAMSALAGKHPLSVVKNALSLLVLLDYY  139

Query  1160  GTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNTGRFDSTFVKS  981
              T+KLH ++KGTTLT T++Q TG+APG  G+VN+T LKGGKVGF    +  + DS++ KS
Sbjct  140   DTQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGSKLDSSYTKS  199

Query  980   VLEKPYKISVIQI-SHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFADLLDSTGADATF  804
             + + PY ISV++I +  +S     APA    +VNIT L+ K GCK FA+LL ++G   T+
Sbjct  200   IKQIPYNISVLEIDAPIISPGLLTAPAPSAAEVNITGLLEKAGCKTFANLLVTSGVIKTY  259

Query  803   ALNVETGLTVFCPTDKVIQG-FMPKYKNLSKDGKMSLLLYHGVPAYQNLGMFRSNGNGVL  627
                V+ GLTVF P+D+  +   +P    L++   +SLL YH +  Y+  G  ++N  G +
Sbjct  260   ESAVDKGLTVFAPSDEAFKADGVPDLSKLTQAELVSLLEYHALTEYKPKGSLKTN-KGSI  318

Query  626   NTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVLLPRELF  453
             +TLAT G+ K+  T   SG++V L T V  +++  T+ D  P+++F VD VLLP ELF
Sbjct  319   STLATNGAGKFGITTSTSGDEVVLHTGVGPSRVADTVLDATPIAIFTVDNVLLPTELF  376



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score =   237 bits (605),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 134/308 (44%), Positives = 188/308 (61%), Gaps = 6/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT++L+   D+S +N YLT T L  EIN RQT+TV VLNNAAM+  L KH  L  +KN+
Sbjct  26    NITEMLSAFPDYSLYNSYLTQTKLCDEINTRQTLTVFVLNNAAMS-ALAKH-PLSVVKNV  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  ++ DYF  +KLH +  G+ L+ T++Q TGDA G  G+VN+T LKGGKVGF      
Sbjct  84    LSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGSAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
                DST+ KSV + PY ISV++IS   ++     APA   + VN+T  + K GCK FA L
Sbjct  144   SPLDSTYTKSVKQVPYNISVMEISAPIIAPGLLSAPAPSVSQVNLTATLEKAGCKIFASL  203

Query  833   LDSTGADATFALNVETGLTVFCPTDKVI-QGFMPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             L S+G    +   ++ GLT+  P D+   +  +P    +     +SLL YH +P+Y   G
Sbjct  204   LASSGVLKNYQDAMDKGLTILAPNDEAFKKPEVPDTAGMRVAQLVSLLEYHALPSYSPPG  263

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G ++TLA+ G  K+ F V  SG++VTL+T V  ++I  T+ D+ PL +  VD 
Sbjct  264   ALKA-ATGPVSTLAS-GVRKFAFRVATSGDEVTLDTGVDKSRIASTVLDDAPLCILTVDN  321

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  322   VLLPEELF  329



>gb|AGN92424.2| putative fasciclin-like arabinogalactan protein 4, partial [Centaurium 
erythraea]
Length=328

 Score =   234 bits (597),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 192/315 (61%), Gaps = 6/315 (2%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             FS A+  NIT IL+K+ D+S FN+YL+ T L  EIN RQTITVLVLNN AM+ +  KH  
Sbjct  16    FSNAH--NITDILSKYSDYSEFNKYLSETKLDGEINSRQTITVLVLNNGAMDSLAGKH-P  72

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  IK  LS  VL DYF   KLH L+ GTTLT T++Q TG+A G  G+VN+T LKGGKVG
Sbjct  73    LSVIKKALSLLVLLDYFDGAKLHQLSDGTTLTTTLYQTTGNADGDLGHVNITDLKGGKVG  132

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQG  855
                     + DST+ KSV +  Y ISV++IS   ++     APA   +D NIT L+ K G
Sbjct  133   LGSAAPGSKLDSTYTKSVEQIKYNISVLEISAPIIAPGLLTAPAPSASDFNITGLLEKAG  192

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL  +G    F    + GLT+F P D+  +   +P    L+    +SLL YH V
Sbjct  193   CKTFAGLLLQSGVLKVFQSAADKGLTIFAPNDEAFKAAKLPDLSKLTNAELVSLLEYHAV  252

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y  +G  ++   G ++TLAT G+ KYD +   +G+ VT++T V ++++  T+ D  PL
Sbjct  253   GDYSPMGTLKTQ-KGTVSTLATSGAGKYDLSFATAGDAVTVDTGVDSSRVASTVLDATPL  311

Query  497   SVFKVDKVLLPRELF  453
              +F VD + LP ELF
Sbjct  312   CIFTVDSIFLPAELF  326



>ref|XP_002440657.1| hypothetical protein SORBIDRAFT_09g004700 [Sorghum bicolor]
 gb|EES19087.1| hypothetical protein SORBIDRAFT_09g004700 [Sorghum bicolor]
Length=418

 Score =   236 bits (603),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 202/315 (64%), Gaps = 11/315 (3%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             GF+I +IL KHD+FS F + L  THLA +INR +TITVL + N  M  +   HYSL T++
Sbjct  29    GFDILEILGKHDEFSQFCKLLNETHLAGDINRDRTITVLAVANGDMGHLTGGHYSLGTLR  88

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             +IL  HV+ADY+  KKL  L+   T  +TMFQ +G APG +GYVN+T  +GGKV F  +D
Sbjct  89    HILELHVVADYYDDKKLKQLSHAATAASTMFQRSGFAPGMAGYVNITQHRGGKVSFIVDD  148

Query  1016  NTGRFDS-TFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                     T+VK +    Y  SV+Q+S  LSS  AEAP + P  VN+T +++K+ CK+FA
Sbjct  149   AADSVKPVTYVKQIESHRYDYSVLQVSGVLSSPEAEAPVAPPAPVNLTDILSKKYCKSFA  208

Query  839   DLLDSTGADATF--ALN--VETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
              LL    ADA    A+N   +T LTVFCP D  +  FMPK+KNL+   K ++LLYH +P 
Sbjct  209   ALL---AADAKVFDAINGTKDTALTVFCPVDAAVAAFMPKFKNLTAKAKTAILLYHAIPD  265

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMYDEEPL  498
             Y ++   +SN  G + TLAT  +NK D+T   ++  + VTL+T VVT+ I  T+ D++PL
Sbjct  266   YYSMQFLKSN-KGKVTTLATTNTNKKDYTYEAESKDDTVTLDTTVVTSTIQATVRDDDPL  324

Query  497   SVFKVDKVLLPRELF  453
             +V+ V K L P+ELF
Sbjct  325   AVYAVSKFLQPKELF  339



>emb|CDX71771.1| BnaC08g31030D [Brassica napus]
Length=422

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 202/316 (64%), Gaps = 5/316 (2%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              ST  G NITQIL++  ++S+FN YL+ T LA EIN R TIT+LVLNN AM+ +  KH  
Sbjct  21    LSTVSGHNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKH-P  79

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  +KN LS  VL DY+   KLH +++GTTLT T++Q TG+APG  G+VN+T LKGGKVG
Sbjct  80    LSVVKNALSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNVTDLKGGKVG  139

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDV-NITTLMAKQ  858
             F       +  S++ KSV + PY ISV++I +  ++     APA     + NIT L+ K 
Sbjct  140   FGSAAPGSKLASSYTKSVKQIPYNISVLEIDAPIIAPGILTAPAPSADGLNNITGLLEKA  199

Query  857   GCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHG  681
             GCK FA+LL ++G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH 
Sbjct  200   GCKTFANLLVTSGVLKTYVSTVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHA  259

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             +  Y+  G  ++N + + +TLAT G+ KYD T   SG++V L T +  +++  T+ DE P
Sbjct  260   LAEYKPKGSLKTNKDAI-STLATNGAGKYDLTTTTSGDEVILHTGIGPSRLADTVVDETP  318

Query  500   LSVFKVDKVLLPRELF  453
             + +F VDKVLLP ELF
Sbjct  319   VVIFTVDKVLLPTELF  334



>emb|CDY66159.1| BnaCnng49680D [Brassica napus]
Length=417

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 200/312 (64%), Gaps = 7/312 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL++  ++S+FN YL+ T L  EIN R TITVLVLNN AM+ +  KH  L 
Sbjct  22    TVSGHNITQILSQSPEYSSFNSYLSQTKLNDEINSRTTITVLVLNNDAMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +K  LS  VL DY+   KLH +++GTTLT T++Q TG A G  G+VN+T LKGGKVGF 
Sbjct  81    VVKTALSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCK  849
                   + D+ + KSV + PY ISV++I+   ++     APA  P++ N+T L+ K GCK
Sbjct  141   SAAPGSKLDANYTKSVKQIPYNISVLEINAPIIAPGILTAPA--PSN-NMTELLEKAGCK  197

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              FA +L S+G   T+   VE GLTVF P+D+  +G +P    L++   +SLL YH +  Y
Sbjct  198   TFASMLASSGVLKTYESTVEKGLTVFAPSDEAFRG-VPDLTKLTQAEVVSLLEYHALAEY  256

Query  668   QNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             +  G  + N N V++TLAT G+ KYD T   SG++V L T V  +++  T+ DE PL VF
Sbjct  257   KPKGSLKINRN-VISTLATNGAGKYDLTTSTSGDEVILHTGVGPSRVADTLVDETPLVVF  315

Query  488   KVDKVLLPRELF  453
             KVDKVLLP ELF
Sbjct  316   KVDKVLLPIELF  327



>ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Solanum 
tuberosum]
Length=415

 Score =   236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 193/314 (61%), Gaps = 7/314 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             + +  NIT+IL +  ++S FN YL+ T LA EIN R+TITVL L N AM+ ++DKH  L 
Sbjct  15    SVHAHNITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAMSAVVDKH-PLS  73

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKN+LS HVL DYF   KLH ++ GTT + T++Q TG+A G  G VN+T LKGGKVGF 
Sbjct  74    VIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNVGSVNITDLKGGKVGFG  133

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPA-SGPTDVNITTLMAKQGC  852
                      ST+ KSV +  Y ISV+++S   ++     APA SG  D NIT  + K GC
Sbjct  134   SAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGILTAPAPSG--DFNITGALEKAGC  191

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVP  675
             K FA LL  +G   T+   +E GLT+F P D+  +G  +P    LS    +SLL YH +P
Sbjct  192   KTFASLLVKSGVLKTYQTAIEKGLTIFAPNDEAFKGAKVPDLSELSSADVVSLLQYHAIP  251

Query  674   AYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLS  495
             +Y  +G  ++  + + +TLAT G++KYD      G+ VTL+T V +++I  T+ D  P  
Sbjct  252   SYTPIGTLKTKKDPI-STLATNGASKYDLKASTEGDQVTLDTGVDSSRIASTVIDSTPFC  310

Query  494   VFKVDKVLLPRELF  453
             +F VD VLLP EL+
Sbjct  311   IFTVDSVLLPEELY  324



>ref|XP_003623747.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=414

 Score =   234 bits (597),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/316 (44%), Positives = 192/316 (61%), Gaps = 9/316 (3%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT+IL+ + D+S +N +L+ T LA EIN RQTITVLVLNNAA + I   H  L
Sbjct  17    TTISAHNITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSH-PL  75

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +K ILS  +L DYF   KLH L  GTTL+ T+FQ TG+A    G VN+T LKGGKVGF
Sbjct  76    SVVKKILSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGF  135

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQ  858
                    + DS++ KSV + PY ISV++I+  + +     A  P+S    VN+T L+ K 
Sbjct  136   GSAAPGSKLDSSYSKSVKQIPYNISVLEITAPIIAPGILTAPPPSS---SVNLTALIEKA  192

Query  857   GCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHG  681
             GCK FA L+ S G   TF    + GLT+F P D+  +   +P    LS    +SLL YH 
Sbjct  193   GCKTFASLISSNGLIKTFQSTADKGLTIFAPNDEAFKAKGVPDLTKLSNAELVSLLQYHA  252

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
                Y  +G  ++  + + ++LAT G+ K+D+TV  +G+ VTL T V +++I  ++ D  P
Sbjct  253   AAKYLPIGSLKTTKDPI-SSLATNGAGKFDYTVTTAGDSVTLHTGVDSSRIADSILDSTP  311

Query  500   LSVFKVDKVLLPRELF  453
             L+++ VD VLLP ELF
Sbjct  312   LAIYSVDSVLLPSELF  327



>emb|CDY52341.1| BnaA09g38900D [Brassica napus]
Length=424

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/316 (46%), Positives = 200/316 (63%), Gaps = 5/316 (2%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              ST  G NITQIL++  ++S+FN YL+ T LA EIN R TIT+LVLNN AM+ +  KH  
Sbjct  22    LSTVSGHNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKH-P  80

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  +KN LS  VL DY+   KLH +++GTTLT T++Q TG+APG  G+VN+T LKGGKVG
Sbjct  81    LSVVKNALSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVG  140

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDV-NITTLMAKQ  858
             F       +  ST+ K V + PY ISV++I +  ++     APA     + NIT L+ K 
Sbjct  141   FGSAAPGSKLASTYTKLVKQIPYNISVLEIDAPIIAPGILTAPAPSADGLNNITGLLEKA  200

Query  857   GCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHG  681
             GCK FA+LL ++G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH 
Sbjct  201   GCKTFANLLVTSGVLKTYVSTVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHA  260

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             +  Y+  G  ++N   + +TLAT G+ KYD T   SG++V L T +  +++  T+ DE P
Sbjct  261   LAEYKPKGSLKTNKEAI-STLATNGAGKYDLTTSTSGDEVILHTGIGPSRLADTVVDETP  319

Query  500   LSVFKVDKVLLPRELF  453
             + +F VDKVLLP ELF
Sbjct  320   VVIFTVDKVLLPTELF  335



>gb|ACN30673.1| unknown [Zea mays]
Length=421

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 199/320 (62%), Gaps = 11/320 (3%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ A GF+I QIL KHD+FS F + L  THLA +INR +TITVL + N  M  +   HYS
Sbjct  24    FTAAEGFDILQILGKHDEFSQFCKLLNETHLAGDINRDRTITVLAVANGDMGHLAAGHYS  83

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L TI++IL  HV+ADY+  KKL  L+   T  +T+FQ +G APG +GYVN+T  +GGKV 
Sbjct  84    LGTIRHILELHVVADYYDDKKLKQLSHAATAASTLFQRSGFAPGMAGYVNITQHRGGKVS  143

Query  1031  FAPEDNTGRFDS-TFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQG  855
             F  +D        T+VK +    Y  SV+Q+S  LSS  AEAP + P  VN+T +++K+ 
Sbjct  144   FIVDDAADSVKPVTYVKQIESHRYDYSVLQVSGVLSSPEAEAPVAPPAPVNLTDILSKKY  203

Query  854   CKAFADLLDSTGADA----TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLY  687
             CK+FA LL    AD     T     +T LTVFCP D  +  FMPK+KNL+   K ++LLY
Sbjct  204   CKSFAGLL---AADPKVFDTLNGTKDTALTVFCPVDAAVAAFMPKFKNLTAKAKTAILLY  260

Query  686   HGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMY  513
             H VP Y ++   +SN  G + TLAT    K D+T   ++  + VTL+T VVT+ I  T+ 
Sbjct  261   HAVPDYYSMQFLKSN-KGKVTTLATTSVAKKDYTYEAESKDDTVTLDTTVVTSTIQATVR  319

Query  512   DEEPLSVFKVDKVLLPRELF  453
             D++PL+V+   K L P+ELF
Sbjct  320   DDDPLAVYACSKFLQPKELF  339



>ref|XP_010919185.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=429

 Score =   234 bits (598),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 130/310 (42%), Positives = 190/310 (61%), Gaps = 6/310 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT IL    ++S +N YL+ T +  EIN R+T+T LVL NAAM+ +  K  SL  IK
Sbjct  21    GHNITAILDGFPEYSLYNSYLSQTKVCDEINSRETVTCLVLPNAAMSALAAKQ-SLAGIK  79

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N L    L DYF  +KLH L  G+ LT T++Q TGDA G SG+VN+T L+GG+V FA   
Sbjct  80    NALRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGDATGNSGFVNITNLRGGRVAFAAAT  139

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                +FDS++ KSV + PY +SV++IS  +      +AP++  +  N+T L+ K GCK FA
Sbjct  140   PGSKFDSSYTKSVRQVPYNLSVLEISAPIVFPGLLDAPSAAAS--NLTALLEKAGCKTFA  197

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQN  663
              L+ S+G    F   ++ GLT+F P D+  +   +P   +LS    ++LL YH +P Y  
Sbjct  198   SLVVSSGVLKIFQSAMDKGLTLFAPNDEAFKAPGVPDLSSLSSAELVTLLQYHALPTYTP  257

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
                 +    G + T+A+ G+ KYDF+V + G+DV+L+T V T+++  T+ D+ P+ V  V
Sbjct  258   KASLK-IAKGRIATMASSGAGKYDFSVVSRGDDVSLDTGVDTSRVASTVLDDTPVCVLTV  316

Query  482   DKVLLPRELF  453
             D +LLP ELF
Sbjct  317   DNLLLPSELF  326



>gb|KEH23329.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=418

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 190/310 (61%), Gaps = 9/310 (3%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT+IL+ + D+S +N +L+ T LA EIN RQTITVLVLNNAA + I   H  L  +K I
Sbjct  23    NITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSH-PLSVVKKI  81

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS  +L DYF   KLH L  GTTL+ T+FQ TG+A    G VN+T LKGGKVGF      
Sbjct  82    LSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGFGSAAPG  141

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLSSS---YAEAPASGPTDVNITTLMAKQGCKAFA  840
              + DS++ KSV + PY ISV++I+  + +     A  P+S    VN+T L+ K GCK FA
Sbjct  142   SKLDSSYSKSVKQIPYNISVLEITAPIIAPGILTAPPPSS---SVNLTALIEKAGCKTFA  198

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQN  663
              L+ S G   TF    + GLT+F P D+  +   +P    LS    +SLL YH    Y  
Sbjct  199   SLISSNGLIKTFQSTADKGLTIFAPNDEAFKAKGVPDLTKLSNAELVSLLQYHAAAKYLP  258

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
             +G  ++  + + ++LAT G+ K+D+TV  +G+ VTL T V +++I  ++ D  PL+++ V
Sbjct  259   IGSLKTTKDPI-SSLATNGAGKFDYTVTTAGDSVTLHTGVDSSRIADSILDSTPLAIYSV  317

Query  482   DKVLLPRELF  453
             D VLLP ELF
Sbjct  318   DSVLLPSELF  327



>ref|NP_001147121.1| rat frizzled homolog1 [Zea mays]
 gb|ACG25543.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
Length=421

 Score =   234 bits (596),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 199/320 (62%), Gaps = 11/320 (3%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ A GF+I QIL KHD+FS F + L  THLA +INR +TITVL + N  M  +   HYS
Sbjct  24    FTAAEGFDILQILGKHDEFSQFCKLLNETHLAGDINRDRTITVLAVANGDMGHLAAGHYS  83

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L TI++IL  HV+ADY+  KKL  L+   T  +T+FQ +G APG +GYVN+T  +GGKV 
Sbjct  84    LGTIRHILELHVVADYYDDKKLKQLSHAATAASTLFQRSGFAPGMAGYVNITQHRGGKVS  143

Query  1031  FAPEDNTGRFDS-TFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQG  855
             F  +D        T+VK +    Y  SV+Q+S  LSS  AEAP + P  VN+T +++K+ 
Sbjct  144   FIVDDAADSVKPVTYVKQIESHRYDYSVLQVSGVLSSPEAEAPVAPPAPVNLTDILSKKY  203

Query  854   CKAFADLLDSTGADA----TFALNVETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLY  687
             CK+FA LL    AD     T     +T LTVFCP D  +  FMPK+KNL+   K ++LLY
Sbjct  204   CKSFAGLL---AADPKVFDTLNGTKDTALTVFCPVDAAVAAFMPKFKNLTAKAKTAILLY  260

Query  686   HGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFT--VQNSGEDVTLETEVVTAKITGTMY  513
             H VP Y ++   +SN  G + TLAT    K D+T   ++  + VTL+T VVT+ I  T+ 
Sbjct  261   HAVPDYYSMQFLKSN-KGKVTTLATTSVAKKDYTYEAESKDDTVTLDTTVVTSTIQATVR  319

Query  512   DEEPLSVFKVDKVLLPRELF  453
             D++PL+V+   K L P+ELF
Sbjct  320   DDDPLAVYACSKFLQPKELF  339



>ref|XP_009116767.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=423

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 200/315 (63%), Gaps = 5/315 (2%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G NITQIL++  ++S+FN YL+ T LA EIN R TIT+LVLNN AM+ +  KH  L
Sbjct  22    STVSGHNITQILSESPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAMSSLAGKH-PL  80

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
               +KN LS  VL DY+   KLH +++GTTLT T++Q TG+APG  G+VN+T LKGGKVGF
Sbjct  81    SVVKNALSLLVLLDYYDPVKLHKISQGTTLTTTLYQTTGNAPGNLGFVNITDLKGGKVGF  140

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQI-SHHLSSSYAEAPASGPTDV-NITTLMAKQG  855
                    +  ST+ K V + PY ISV++I +  ++     APA     + NIT L+ K G
Sbjct  141   GSAAPGSKLASTYTKLVKQIPYNISVLEIDAPIIAPGILTAPAPSADGLNNITGLLEKAG  200

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA+LL ++G   T+   VE GLTVF P+D+  +   +P    L++   +SLL YH +
Sbjct  201   CKTFANLLVTSGVLKTYVSTVEKGLTVFAPSDEAFKAEGVPDLTKLTQAEVVSLLEYHAL  260

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
               Y+  G  ++N   + +TLAT G+ KYD T   SG++V L T +  +++  T+ DE P+
Sbjct  261   AEYKPKGSLKTNKEAI-STLATNGAGKYDLTTSTSGDEVILHTGIGPSRLADTVGDETPV  319

Query  497   SVFKVDKVLLPRELF  453
              +F VD+VLLP ELF
Sbjct  320   VIFTVDQVLLPTELF  334



>ref|XP_010692313.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Beta vulgaris 
subsp. vulgaris]
Length=408

 Score =   231 bits (590),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 190/315 (60%), Gaps = 9/315 (3%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
             F+ +Y  NIT+IL+   + S FN YLT T L  EIN RQTITVL L+N+AM+ +   H S
Sbjct  15    FTISYAHNITEILSSDPNLSQFNSYLTQTKLDDEINSRQTITVLALDNSAMSSLTSNH-S  73

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  IKN+LS HVL DY+  KKLH L  GT  T T++Q TG A    G VN+T L GG VG
Sbjct  74    LSVIKNLLSLHVLLDYYDPKKLHSLENGTVKTTTLYQTTGSATSDEGSVNITDLHGGSVG  133

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGC  852
             F       + DST+ KSV + PY ISV++IS  +      A  +  +D N+T ++ K GC
Sbjct  134   FGSGSPGSKLDSTYTKSVKQIPYNISVLEISAPI---ITPALLTSSSDANVTAILEKAGC  190

Query  851   KAFADLLDSTGADATFALNVETGLTVFCPTDKV--IQGFMPKYKNLSKDGKMSLLLYHGV  678
             K FA LL S+G    +   +E G+TVF PTD+   ++G +P    LS    +SLL +H +
Sbjct  191   KTFASLLSSSGVLKMYETQMEKGITVFAPTDEAFKVKG-VPDLNKLSSAELVSLLQFHAL  249

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
              +Y  +G  ++   G L TLA+ G  KYD +   +G+ VTL T V +++I GT+ D  P+
Sbjct  250   SSYSPIGTLKTT-KGKLTTLAS-GVGKYDLSPTTAGDSVTLHTGVDSSRIAGTLLDATPV  307

Query  497   SVFKVDKVLLPRELF  453
              ++ VD +LLP ELF
Sbjct  308   VIYSVDSLLLPVELF  322



>gb|KHN11149.1| Fasciclin-like arabinogalactan protein 1 [Glycine soja]
Length=344

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 155/210 (74%), Gaps = 4/210 (2%)
 Frame = -1

Query  1076  SGYVNMTALKGGKVGFAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASG  897
             +G+VN+T L  GKV FAPE+N G   STFVKSV E PY ISVIQIS  L S+ AEAPA  
Sbjct  127   AGFVNITDLHDGKVAFAPENNDGTLSSTFVKSVEEIPYNISVIQISKVLPSAAAEAPAPA  186

Query  896   PTDVNITTLMAKQGCKAFADLLDSTGADA--TFALNVETGLTVFCPTDKVIQGFMPKYKN  723
             PT  N+T +M+K GCK FAD L S   DA  TF  N++ GLTVFCP D   + F+PK+KN
Sbjct  187   PTQQNLTNIMSKHGCKVFADTL-SAQPDALNTFNDNLDGGLTVFCPLDDAFKAFLPKFKN  245

Query  722   LSKDGKMSLLLYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEV  543
             L+K GK +LL +H VP YQ+    +SN NG+ NTLAT G+NK+DFTVQN GEDVTL+T++
Sbjct  246   LTKSGKAALLEFHAVPVYQSKATLKSN-NGLQNTLATDGANKFDFTVQNDGEDVTLKTKL  304

Query  542   VTAKITGTMYDEEPLSVFKVDKVLLPRELF  453
              TAKIT T+ DE+PL++F ++KVL P+ELF
Sbjct  305   TTAKITDTLIDEQPLAIFAINKVLQPKELF  334



>ref|XP_008780048.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Phoenix 
dactylifera]
Length=419

 Score =   230 bits (586),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 129/310 (42%), Positives = 187/310 (60%), Gaps = 6/310 (2%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G NIT IL    ++S +N YL+ T +  EIN R+T+T LVL NAAM+ +  K  SL  IK
Sbjct  21    GHNITAILDGFPEYSLYNSYLSQTKVCDEINSRETVTCLVLPNAAMSALAAKQ-SLAGIK  79

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             N L    L DYF  +KLH L  G+ LT T++Q TG+A G SG+VN+T L+GG+V FA   
Sbjct  80    NALRLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGNALGNSGFVNITNLRGGRVAFAAAA  139

Query  1016  NTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                + DS++ KSV E PY +SV++IS  +      +AP++  +  N+T L+ K GCK FA
Sbjct  140   PGSKLDSSYTKSVREVPYNLSVLEISAPIVYPGLLDAPSAASS--NLTALLEKAGCKTFA  197

Query  839   DLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQN  663
              L+ S+G    F   +E GLT+F P D+  +   +P    LS    ++LL YH +P Y  
Sbjct  198   SLVVSSGVLKIFQSAMEKGLTLFAPNDEAFKAPGVPDLSTLSSAELVTLLQYHALPTYAP  257

Query  662   LGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKV  483
                 +    G + T+A+ G+ KYD +V + G+DV+L+T V T+++  T+ D+ P+ V  V
Sbjct  258   KDSLKI-AKGRITTMASSGAGKYDLSVVSRGDDVSLDTGVDTSRVASTILDDTPVCVLTV  316

Query  482   DKVLLPRELF  453
             D +LLP ELF
Sbjct  317   DNLLLPSELF  326



>emb|CDX86346.1| BnaA06g30630D [Brassica napus]
Length=413

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 198/316 (63%), Gaps = 13/316 (4%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL++  ++S+FN YL+ T L  EIN R TIT+LVLNN  M+ +  KH  L 
Sbjct  22    TVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +K  LS  VL DY+   KLH +++GTTLT T++Q TG A G  G+VN+T LKGGKVGF 
Sbjct  81    VVKTALSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCK  849
                   + D+ + KSV + PY ISV++I+   ++     APA  P++ N+T L+ K GCK
Sbjct  141   SAAPGSKLDANYTKSVKQIPYNISVLEINAPIIAPGILTAPA--PSN-NMTELLEKAGCK  197

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF----MPKYKNLSKDGKMSLLLYHG  681
              FA +L S+G   T+   VE GLTVF P+D   +GF     P    L++   +SLL YH 
Sbjct  198   IFASMLLSSGVVKTYESTVEKGLTVFAPSD---EGFKAESAPDLTKLTQAEVVSLLEYHA  254

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             +  Y+  G  + N N V++TLAT G+ KYD T   SG++V L T V  +++  T+ DE P
Sbjct  255   LAEYKPKGSLKINKN-VISTLATNGAGKYDLTTSTSGDEVILHTGVGPSRVADTVVDETP  313

Query  500   LSVFKVDKVLLPRELF  453
             L VFKVDKVLLP ELF
Sbjct  314   LVVFKVDKVLLPIELF  329



>ref|XP_004953764.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Setaria 
italica]
Length=397

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/312 (40%), Positives = 197/312 (63%), Gaps = 11/312 (4%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   D   F+R LT T LA +I+ R TITVL +++A+M  +  +     T++++
Sbjct  32    NITAILSGRRDLGEFSRELTATGLADDIDGRNTITVLAVDDASMAPLKARGLPRETLRHV  91

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDN-  1014
             LS HVL DY+   KLH L  G+   +T+FQA+GDAPG++G V +   +GG+V F+P+D+ 
Sbjct  92    LSLHVLVDYYDDAKLHRLPGGSADVSTLFQASGDAPGSAGMVEIAERRGGRVAFSPQDDG  151

Query  1013  TGRFDSTF-VKSVLEKPYKISVIQISHHLSSSYAEAPASGPTD--VNITTLMAKQGCKAF  843
               R  + F V+SV + PY ISV+Q+S  +SS  AEAP S P+   +N T +M+K GC  F
Sbjct  152   DARGAAVFYVRSVHQAPYNISVLQVSGVMSSPAAEAPGSSPSPSGLNFTDVMSKNGCGRF  211

Query  842   ADLLDST-GADATFALNVET--GLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPA  672
             A L+ +T GA ATF  +     G T FCP D+ ++ F P +K L  D +++++LYHG   
Sbjct  212   AGLIAATPGAAATFDKHAHDLGGFTFFCPADQAVEAFEPTFKKLPGDARLAVVLYHGALG  271

Query  671   YQNLGMFRSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVV-TAKITGTMYDEEP  501
             + +L   R++G+  + TLA+  GG+      V+++G+ VTL +    TA++T T+ D +P
Sbjct  272   HHSLQTLRADGS-RMATLASLDGGNTTAVLAVRHAGDKVTLVSATQNTARVTRTLADADP  330

Query  500   LSVFKVDKVLLP  465
             ++V+ +D +L+P
Sbjct  331   VAVYMIDALLVP  342



>gb|ABI95395.1| fasciclin-like protein FLA5 [Triticum aestivum]
Length=429

 Score =   226 bits (577),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 189/308 (61%), Gaps = 6/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL  + ++S +N YL+ T +  EIN R T+T LVL N AM+ ++  + SL  +KN 
Sbjct  26    NITDILDGYSEYSLYNNYLSQTKVCDEINGRSTVTCLVLTNGAMSSLV-ANLSLADVKNA  84

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L    L DY+  KKLH L+ G+ LT T++Q TGDA G  G+VN+T L+GGKVGFA  +  
Sbjct  85    LRLLTLLDYYDPKKLHSLHGGSELTTTLYQTTGDASGDMGHVNITNLRGGKVGFASAEPG  144

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              +F +T+ KSV E+PY +SV+++S  ++      +P++  T  N+T L+ K GCK FA L
Sbjct  145   SKFQATYTKSVKEEPYNLSVLEVSDPITFPGLFTSPSAAST--NLTALLEKAGCKRFARL  202

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G   T+   ++ GLT+F PTD   Q   +P    L+    ++LL YH +P Y    
Sbjct  203   IVSSGVVKTYQAAMDKGLTLFAPTDDAFQAKGLPDLGKLTSADLVALLEYHALPQYAPKA  262

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G+  TLA+ G  KYD +V   G+DV+++T +  +++  T+ D+ P++V  VD 
Sbjct  263   SLKTMKGGI-PTLASTGKGKYDLSVVAKGDDVSMDTGMDKSRVASTVLDDTPVTVHTVDS  321

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  322   VLLPPELF  329



>emb|CDX67846.1| BnaA07g18860D [Brassica napus]
Length=413

 Score =   226 bits (575),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 197/316 (62%), Gaps = 13/316 (4%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T  G NITQIL++  ++S+FN YL+ T L  EIN R TIT+LVLNN  M+ +  KH  L 
Sbjct  22    TVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKH-PLS  80

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              +K  LS  VL DY+   KLH +++GTTLT T++Q TG A G  G+VN+T LKGGKVGF 
Sbjct  81    VVKTALSLLVLLDYYDPLKLHKISQGTTLTTTLYQTTGRAAGNLGFVNVTDLKGGKVGFG  140

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHH-LSSSYAEAPASGPTDVNITTLMAKQGCK  849
                   +  + + KSV + PY ISV++I+   ++     APA  P++ N+T L+ K GCK
Sbjct  141   SAAPGSKLGANYTKSVKQIPYNISVLEINAPIIAPGILTAPA--PSN-NMTELLEKAGCK  197

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF----MPKYKNLSKDGKMSLLLYHG  681
              FA +L S+G   T+   VE GLTVF P+D   +GF     P    L++   +SLL YH 
Sbjct  198   IFASMLLSSGVVKTYESTVEKGLTVFAPSD---EGFKAESAPDLTKLTQAEVVSLLEYHA  254

Query  680   VPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEP  501
             +  Y+  G  + N N V++TLAT G+ KYD T   SG++V L T V  +++  T+ DE P
Sbjct  255   LAEYKPKGSLKINKN-VISTLATNGAGKYDLTTSTSGDEVILHTGVGPSRVADTVVDETP  313

Query  500   LSVFKVDKVLLPRELF  453
             L VFKVDKVLLP ELF
Sbjct  314   LVVFKVDKVLLPIELF  329



>ref|XP_006652672.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Oryza 
brachyantha]
Length=431

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 125/308 (41%), Positives = 186/308 (60%), Gaps = 6/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL  + ++S +N YL+ T +  EIN R T+T LVL N AM+ ++  + SL  IKN 
Sbjct  25    NITDILDGYPEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLV-SNLSLADIKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L    L DY+ TKKLH L+ G+ LT T++Q TGDA G  G+VN+T L+GGKVGFA     
Sbjct  84    LRLLTLLDYYDTKKLHSLSDGSELTTTLYQTTGDASGNMGHVNITNLRGGKVGFASAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              +F +T+ KSV ++PY +SV+++S  ++      +P++  T  N+T L+ K GCK FA L
Sbjct  144   SKFQATYTKSVKQEPYNLSVLEVSDPITFPGLFNSPSAAST--NLTALLEKAGCKQFARL  201

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G    +   ++ GLT+F P D       +P    L+    ++LL YH +P Y    
Sbjct  202   IVSSGVIKMYQAAMDKGLTLFAPNDDAFHAKDLPDLSKLTSAELVTLLQYHALPQYAPKA  261

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G L TLA+ G+ KYD +V   G+DV+++T V  +++  T+ D+ P  +  VD 
Sbjct  262   SLKTI-KGNLQTLASTGAGKYDLSVVAKGDDVSMDTGVDKSRVASTVLDDTPTVIHTVDS  320

Query  476   VLLPRELF  453
             VLLPRELF
Sbjct  321   VLLPRELF  328



>emb|CDY37043.1| BnaA04g26210D [Brassica napus]
Length=409

 Score =   224 bits (572),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/319 (40%), Positives = 187/319 (59%), Gaps = 18/319 (6%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G+NIT+ILA + D+S+FN YL+ T LA EIN   TIT+L LNN AM     K   L
Sbjct  21    STVGGYNITKILASYPDYSSFNSYLSQTKLAEEINTYPTITLLALNNDAMASFAGKR-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQAT-GDAPGTSGYVNMTALKGGKVG  1032
               +K  LS   L DY+  + LH +++GTTL+ T++  T G+AP   GYVN+T L GG+V 
Sbjct  80    SVVKKALSLLTLLDYYDPESLHQISEGTTLSVTLYNNTAGNAPEYLGYVNITDLYGGQVA  139

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGP-----TDVNITTLM  867
             F    +  + DS F KS+ + PY ISV++I         +AP   P     +  NIT L+
Sbjct  140   FGSAVSGSKLDSYFTKSIKQIPYDISVVEI---------DAPIIAPGILAASPANITVLL  190

Query  866   AKQGCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLL  690
                GCK FA +L  +G    +   ++ GLTVF P+D+  +   +P    L++D  +SL+ 
Sbjct  191   ENAGCKTFAKMLAKSGVIKKYESVIKNGLTVFAPSDEAFKAKGVPDLTKLTRDEVVSLVE  250

Query  689   YHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYD  510
             YH +  Y+  G  +SN N + +TLAT G+ K+D T   SG++V L T + ++++  T+ D
Sbjct  251   YHALAHYKPKGSLKSNKNKI-STLATTGAGKFDLTTSTSGDEVVLHTGIASSRLVHTVLD  309

Query  509   EEPLSVFKVDKVLLPRELF  453
               P+ +F VD VLLP ELF
Sbjct  310   ATPVVIFTVDNVLLPTELF  328



>ref|XP_008803297.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Phoenix 
dactylifera]
Length=421

 Score =   224 bits (572),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 131/315 (42%), Positives = 196/315 (62%), Gaps = 6/315 (2%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              + A G NIT IL    ++S +N YL+ T +  EIN R+T+T LVL NAAM+ +  K  S
Sbjct  16    LAPAEGHNITAILDGFPEYSVYNSYLSRTKVCDEINSRETVTSLVLPNAAMSALAAKQ-S  74

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  IKN L    L DYF  +KLH +  G+TLT T++Q TG+APG SG+VN+T L+GG+V 
Sbjct  75    LAGIKNALRLLTLLDYFDPQKLHDIPHGSTLTTTLYQTTGNAPGNSGFVNITNLRGGRVA  134

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQG  855
             F+   +  + DS++ K+V E PY +SV++IS  +      +AP++  +  N+T L+ K G
Sbjct  135   FSAAAHGSKLDSSYTKTVREVPYNLSVLEISAPIVFPGLLDAPSAASS--NLTALLEKAG  192

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G    F   ++ GLT+F P D+  +   +P   +LS    ++LL YH +
Sbjct  193   CKTFASLLASSGVLKIFQSAMDKGLTLFAPNDEAFKASGVPDLHSLSSAELVTLLQYHAL  252

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
             P+Y      +S   G + T+A+ G+ KYDF+V + G+DV+L+T V T+++  T+ D+ P+
Sbjct  253   PSYTPKSSLKS-AKGRIATMASTGAGKYDFSVVSRGDDVSLDTGVDTSRVASTVLDDTPV  311

Query  497   SVFKVDKVLLPRELF  453
              V  VD +LLP ELF
Sbjct  312   CVLTVDNLLLPSELF  326



>ref|XP_003580362.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brachypodium 
distachyon]
Length=428

 Score =   224 bits (570),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 186/313 (59%), Gaps = 6/313 (2%)
 Frame = -1

Query  1385  TAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLY  1206
             T    NIT IL    ++S +N YL+ T +  EIN R T+T LVL N AM+ ++  + SL 
Sbjct  20    TCCAHNITGILDGFSEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLV-SNLSLA  78

Query  1205  TIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFA  1026
              IKN L    L DY+  KKLH L+ G+ LT T++Q TGDA G  G+VN+T L+GGKVGFA
Sbjct  79    DIKNALRLLTLLDYYDPKKLHSLHGGSELTTTLYQTTGDASGDMGHVNITNLRGGKVGFA  138

Query  1025  PEDNTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCK  849
                   +  ST+ KSV E+PY +SV+++S  ++      +P++  +  N+T L+ K GCK
Sbjct  139   SAAPGSKLQSTYTKSVKEEPYNLSVLEVSDPITFPGLFSSPSAASS--NLTALLEKAGCK  196

Query  848   AFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPA  672
              FA L+ S+G   T+   ++ GLT+F P D   Q   +P    L+    ++LL YH +P 
Sbjct  197   QFARLIVSSGVIKTYQAAMDKGLTLFAPNDDAFQAKGLPDLSKLTSANLVTLLEYHALPQ  256

Query  671   YQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             Y      ++   G+  TLA+ GS KYD +V   G+DV++ T +  +++  T+ D+ P++V
Sbjct  257   YAPKASLKTMKGGI-PTLASTGSGKYDLSVVTKGDDVSMATGMDKSRVASTVLDDTPVAV  315

Query  491   FKVDKVLLPRELF  453
               VD VLLP ELF
Sbjct  316   HTVDSVLLPPELF  328



>dbj|BAJ88864.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=383

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 187/313 (60%), Gaps = 43/313 (14%)
 Frame = -1

Query  1376  GFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIK  1197
             G+NIT+IL ++ ++S FN+                                    L TI+
Sbjct  24    GYNITKILGEYPEYSQFNK------------------------------------LQTIR  47

Query  1196  NILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPED  1017
             ++L  HVL DY+G KKLH L  G T  ++MFQ +G APG SGYVN+T  +GGKV F  ED
Sbjct  48    HMLQIHVLVDYYGGKKLHQLAHGVTACSSMFQESGAAPGMSGYVNITQHRGGKVTFTAED  107

Query  1016  NTGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFA  840
                   S+ FVKSV E PY ++V+QIS  L+S  AEAP + P  VNIT L++K+ CK+FA
Sbjct  108   AEDSAPSSAFVKSVKEIPYDLAVLQISKVLASPEAEAPVAAPAPVNITELLSKKYCKSFA  167

Query  839   DLLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQ  666
              LL +  A+A   +N   + GLT+FCP D  +  FMPKYKNL+  G+ ++LLYH VP Y 
Sbjct  168   GLL-AADAEAYSTINATKDNGLTLFCPVDAAVASFMPKYKNLTAKGRTAILLYHAVPDYY  226

Query  665   NLGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSV  492
             +L +  SN +G ++TLAT    K  Y F V+  GE   L+T+V +A +T T+ D++PL+V
Sbjct  227   SLQLLTSN-SGKVSTLATSSVAKKDYSFDVEKDGETAELDTKVNSASVTYTIKDDDPLAV  285

Query  491   FKVDKVLLPRELF  453
             + + K L P+EL+
Sbjct  286   YAISKFLQPKELY  298



>ref|XP_009142340.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=409

 Score =   222 bits (565),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 187/320 (58%), Gaps = 19/320 (6%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             ST  G+NIT+ILA + D+S+FN YL+ T LA EIN   TIT+L LNN AM     K   L
Sbjct  21    STVGGYNITKILASYPDYSSFNSYLSQTKLAEEINTYPTITLLALNNDAMASFAGKR-PL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQAT-GDAPGTSGYVNMTALKGGKVG  1032
               +K  LS   L DY+  + LH +++GTTL+ T++  T G+AP   GYVN+T L GG+V 
Sbjct  80    SVVKKALSLLTLLDYYDPESLHQISEGTTLSVTLYNNTAGNAPEYLGYVNITDLYGGQVA  139

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGP-----TDVNITTLM  867
             F    +  + DS F KS+ + PY ISV++I         +AP   P     +  NIT L+
Sbjct  140   FGSAVSGSKLDSYFTKSIKQIPYDISVVEI---------DAPIIAPGILAASPANITVLL  190

Query  866   AKQGCKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLL  690
                GCK FA +L  +G    +   ++ GLTVF P+D+  +   +P    L++D  +SL+ 
Sbjct  191   ENAGCKTFAKMLAKSGVIKKYESVIKNGLTVFAPSDEAFKAKGVPDLTKLTRDEVVSLVE  250

Query  689   YHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGED-VTLETEVVTAKITGTMY  513
             YH +  Y+  G  +SN N + +TLAT G+ K+D T   SG+D V L T + ++++  T+ 
Sbjct  251   YHALAHYKPKGSLKSNKNKI-STLATTGAGKFDLTTSTSGDDEVVLHTGIASSRLVHTVL  309

Query  512   DEEPLSVFKVDKVLLPRELF  453
             D  P+ +F VD VLLP ELF
Sbjct  310   DATPVVIFTVDNVLLPTELF  329



>ref|NP_001053617.1| Os04g0574200 [Oryza sativa Japonica Group]
 emb|CAD41669.3| OSJNBa0019K04.16 [Oryza sativa Japonica Group]
 dbj|BAF15531.1| Os04g0574200 [Oryza sativa Japonica Group]
 gb|EAY95238.1| hypothetical protein OsI_17056 [Oryza sativa Indica Group]
 gb|EAZ31705.1| hypothetical protein OsJ_15854 [Oryza sativa Japonica Group]
Length=431

 Score =   221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/308 (40%), Positives = 186/308 (60%), Gaps = 6/308 (2%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL  + ++S +N YL+ T +  EIN R T+T LVL N AM+ ++  + SL  IKN 
Sbjct  25    NITDILDGYPEYSLYNSYLSQTKVCDEINSRSTVTCLVLTNGAMSSLV-SNLSLADIKNA  83

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             L    L DY+ TKKLH L+ G+ LT T++Q TGDA G  G+VN+T L+GGKVGFA     
Sbjct  84    LRLLTLLDYYDTKKLHSLSDGSELTTTLYQTTGDASGNMGHVNITNLRGGKVGFASAAPG  143

Query  1010  GRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQGCKAFADL  834
              +F +T+ KSV ++PY +SV+++S  ++     ++P++  T  N+T L+ K GCK FA L
Sbjct  144   SKFQATYTKSVKQEPYNLSVLEVSDPITFPGLFDSPSAAST--NLTALLEKAGCKQFARL  201

Query  833   LDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGVPAYQNLG  657
             + S+G    +   ++  LT+F P D   Q   +P    L+    ++LL YH +P Y    
Sbjct  202   IVSSGVMKMYQAAMDKALTLFAPNDDAFQAKGLPDLSKLTSAELVTLLQYHALPQYAPKA  261

Query  656   MFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVFKVDK  477
               ++   G + TLA+ G+ KYD +V   G+DV+++T +  +++  T+ D+ P  +  VD 
Sbjct  262   SLKTI-KGHIQTLASTGAGKYDLSVVTKGDDVSMDTGMDKSRVASTVLDDTPTVIHTVDS  320

Query  476   VLLPRELF  453
             VLLP ELF
Sbjct  321   VLLPPELF  328



>ref|XP_003572987.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Brachypodium 
distachyon]
Length=400

 Score =   219 bits (559),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 190/322 (59%), Gaps = 20/322 (6%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT ILA   D + F+R LT T LA EIN R TITVL +++A M+ +  +      ++ +
Sbjct  29    NITSILASRRDLAEFSRQLTATGLADEINVRNTITVLAVDDAHMSSLKARGLHREALRRV  88

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH L  G+ + +T+FQA+GDAPG+SG V ++  +GG+V F P+   
Sbjct  89    LSLHVLVDYYDDAKLHRLPGGSAVVSTLFQASGDAPGSSGMVKISDRRGGRVAFLPQQQD  148

Query  1010  GRFDST-------FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDV--NITTLMAKQ  858
                          +VKSV E PY ISV+Q+S  +SS  AEAP S P     N T +MA+ 
Sbjct  149   EEAADDAQAAAVFYVKSVHETPYNISVLQVSAVISSPAAEAP-SLPESARPNATDVMARN  207

Query  857   GCKAFADLLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYH  684
             GC  FA L  S GA + +   +  + GLT+FCP D  ++ FMP Y+ LS+D ++++LLYH
Sbjct  208   GCGRFASLAASAGAASRYEKTMANDGGLTIFCPGDDAMKAFMPAYRALSRDSQLAMLLYH  267

Query  683   GVPAYQNLGMFRSNGNGVLNTLATGGSN------KYDFTVQNSGEDVTLETEV-VTAKIT  525
             GV  + +L   ++ G G + TLA    N      KY  T + +G  VTL +     A +T
Sbjct  268   GVARHYSLPALKAIG-GAMRTLAMDTGNNGNDNDKYVLTAREAGSTVTLLSAAKEPATVT  326

Query  524   GTMYDEEPLSVFKVDKVLLPRE  459
             GT+ D +PL+V+ VD VL+P +
Sbjct  327   GTLMDADPLAVYIVDAVLVPMD  348



>ref|XP_010933921.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=421

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 195/315 (62%), Gaps = 6/315 (2%)
 Frame = -1

Query  1391  FSTAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYS  1212
              + A G NIT IL    ++S +N YL+ T +  EIN R+T+T LVL NAAM+ +  K  S
Sbjct  16    LAPAEGHNITAILDGFPEYSVYNSYLSRTKVCDEINSRETVTCLVLPNAAMSALAAKQ-S  74

Query  1211  LYTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVG  1032
             L  IKN L    L DYF  +KLH + +GTTLT T++Q TG+APG SG+VN+T L+GG+V 
Sbjct  75    LAGIKNALRLLTLLDYFDPQKLHDIPQGTTLTTTLYQTTGNAPGNSGFVNITNLRGGRVA  134

Query  1031  FAPEDNTGRFDSTFVKSVLEKPYKISVIQISHHLS-SSYAEAPASGPTDVNITTLMAKQG  855
             FA      + DS++ K+V E PY +SV++IS  +      +AP++  +  N+T L+ K G
Sbjct  135   FAAAAPGSKLDSSYTKTVREVPYNLSVLEISAPIVFPGLLDAPSAASS--NLTALLEKAG  192

Query  854   CKAFADLLDSTGADATFALNVETGLTVFCPTDKVIQGF-MPKYKNLSKDGKMSLLLYHGV  678
             CK FA LL S+G    F   ++ GLT+F P D+  +   +P  K+LS    ++LL YH +
Sbjct  193   CKTFASLLASSGVLKIFQSAMDKGLTLFAPNDEAFKAPGVPDLKSLSSAELVTLLQYHAL  252

Query  677   PAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNSGEDVTLETEVVTAKITGTMYDEEPL  498
             P Y      ++   G + T+A+ G+ KYDF+V + G+DV+L T V T+++  T+ D+ P+
Sbjct  253   PTYTPKSSLKTT-KGRIATMASTGAGKYDFSVVSRGDDVSLNTGVDTSRVASTVLDDTPV  311

Query  497   SVFKVDKVLLPRELF  453
              V  VD +LLP ELF
Sbjct  312   CVLTVDNLLLPSELF  326



>gb|EMS60835.1| hypothetical protein TRIUR3_26630 [Triticum urartu]
Length=346

 Score =   214 bits (545),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/252 (49%), Positives = 166/252 (66%), Gaps = 7/252 (3%)
 Frame = -1

Query  1193  ILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDN  1014
             +L  HVL DY+G KKLH L  G T  +TMFQ +G APG SGYVN+T  +GGKV F  ED 
Sbjct  1     MLQIHVLVDYYGGKKLHQLAHGVTACSTMFQESGAAPGMSGYVNITQHRGGKVTFTAEDA  60

Query  1013  TGRFDST-FVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCKAFAD  837
                  S+ FVKSV E PY ++V+QIS  L+S  AEAP + P  VNIT L++K+ CK+FA 
Sbjct  61    EDSAPSSAFVKSVKEIPYDLAVLQISKVLASPEAEAPVAAPAPVNITELLSKKYCKSFAG  120

Query  836   LLDSTGADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAYQN  663
             LL +  ADA   +N   + GLT+FCP D  +  FMPKYKNL+  G+ ++LLYH VP Y +
Sbjct  121   LL-AANADAYSTINATKDNGLTLFCPVDSAVASFMPKYKNLTAKGRTAILLYHAVPDYYS  179

Query  662   LGMFRSNGNGVLNTLATGGSNK--YDFTVQNSGEDVTLETEVVTAKITGTMYDEEPLSVF  489
             L +  SN +G ++TLAT    K  Y F V+  GE   L+T+V +A +T T+ D++PL+V+
Sbjct  180   LQLLTSN-SGKVSTLATSNVAKKDYSFDVEKDGETAELDTKVNSASVTYTIKDDDPLAVY  238

Query  488   KVDKVLLPRELF  453
              + K L P+EL+
Sbjct  239   AISKFLQPKELY  250



>gb|AAM78213.1| putative pollen surface protein [Gossypioides kirkii]
Length=213

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  932  LSSSYAEAPASGPTDVNITTLMAKQGCKAFADLLDSTGADATFALNVETGLTVFCPTDKV  753
            L+S+ AEAP + P+ +N+T +M+KQGCKAFADLL ++GAD  F  N++ GLTVFCPTD V
Sbjct  2    LNSADAEAPTAAPSQLNLTEIMSKQGCKAFADLLTASGADDKFNENMDAGLTVFCPTDSV  61

Query  752  IQGFMPKYKNLSKDGKMSLLLYHGVPAYQNLGMFRSNGNGVLNTLATGGSNKYDFTVQNS  573
            ++GFMPKYKNL+   K+SLLLYHGVP + ++ M ++N  GV+NTLAT G+N YDF+V   
Sbjct  62   VKGFMPKYKNLTASKKVSLLLYHGVPVFMSMQMLKTN-TGVMNTLATDGANSYDFSVSKE  120

Query  572  GEDVTLETEVVTAKITGTMYDEEPLSVFKVDKVLLPRELF  453
            GE V+L+T VVTAK++G + +EEPL VFK++KVL+P+ELF
Sbjct  121  GEVVSLDTTVVTAKVSGILKEEEPLIVFKINKVLMPKELF  160



>ref|XP_008679063.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Zea mays]
 gb|AFW63721.1| hypothetical protein ZEAMMB73_508962 [Zea mays]
Length=417

 Score =   214 bits (545),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 188/318 (59%), Gaps = 14/318 (4%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+ H D + F R L  T LA +I+ R TITVL +++A M  +  +     T++++
Sbjct  34    NITAILSGHRDLAEFGRELAATGLADDIDDRNTITVLAVDDAHMAPLKARGLPRETLRHV  93

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH L  G+   +T+FQA+GDAPG++G V +   +GG+V FAPED+ 
Sbjct  94    LSLHVLVDYYDDAKLHRLPGGSADVSTLFQASGDAPGSAGMVRVAERRGGRVAFAPEDDA  153

Query  1010  GRFDST--FVKSVLEKPYKISVIQISHHLSS----SYAEAPASGPTDVNITTLMAKQGCK  849
             G   +   +V  V E PY ISV+ +S  +SS    + A A    P+  N++ +M++ GC 
Sbjct  154   GSAAAAVFYVGPVHEAPYNISVLWVSGVISSPAAEAPAAAADRPPSRRNVSDVMSENGCG  213

Query  848   AFADLLDSTG-ADATFALNVE--TGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGV  678
              FA L+ +TG A ATF    +   GLT+FCP D+ ++ F P   +LS D +++++LYHG 
Sbjct  214   RFAGLVAATGDAAATFERQADGGGGLTLFCPADRAVEAFQPTLNSLSADARLAVVLYHGA  273

Query  677   PAYQNLGMFRSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEVV--TAKITGTMYD  510
             P + ++   R+ G+  L T A+  GG +     V+N    VTL        A++T T+ D
Sbjct  274   PGHHSMQALRA-GDQDLRTAASLDGGRSHLALAVRNVRGRVTLLASATRDVARVTRTLAD  332

Query  509   EEPLSVFKVDKVLLPREL  456
             EE ++V+ +D VL+P  L
Sbjct  333   EEAVAVYMIDAVLVPGNL  350



>gb|ACU21313.1| unknown [Glycine max]
Length=192

 Score =   205 bits (521),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/195 (54%), Positives = 132/195 (68%), Gaps = 26/195 (13%)
 Frame = -1

Query  1388  STAYGFNITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSL  1209
             +T    NIT++LA H  FSTFN YL++THLA EINRRQTITVL L+NAAM+ +LDKH SL
Sbjct  20    ATVPAHNITRMLAAHPGFSTFNHYLSVTHLAEEINRRQTITVLALDNAAMSSLLDKHLSL  79

Query  1208  YTIKNILSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGF  1029
              TIKN+LS H+L DYFG KKLH +N  TTL ++MFQATG A GT+GY             
Sbjct  80    PTIKNVLSLHILVDYFGAKKLHQINNSTTLVSSMFQATGSASGTAGY-------------  126

Query  1028  APEDNTGRFDSTFVKSVLEKPYKISVIQISHHLSSSYAEAPASGPTDVNITTLMAKQGCK  849
                          VKSV E PY ISV+QIS  +SS+ AEAP + P+ +++ ++M+KQGCK
Sbjct  127   -------------VKSVKEMPYYISVLQISAAISSADAEAPTAAPSAIDLISIMSKQGCK  173

Query  848   AFADLLDSTGADATF  804
             AFADLL  + A  +F
Sbjct  174   AFADLLRGSKALPSF  188



>ref|XP_002452625.1| hypothetical protein SORBIDRAFT_04g029330 [Sorghum bicolor]
 gb|EES05601.1| hypothetical protein SORBIDRAFT_04g029330 [Sorghum bicolor]
Length=413

 Score =   211 bits (538),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 194/314 (62%), Gaps = 10/314 (3%)
 Frame = -1

Query  1370  NITQILAKHDDFSTFNRYLTLTHLAAEINRRQTITVLVLNNAAMNDILDKHYSLYTIKNI  1191
             NIT IL+   D + F+R L  T LA +IN R TITVL +++A M  +  +     T++++
Sbjct  34    NITAILSGRRDLAEFSRELAATGLADDINGRNTITVLAVDDAHMAPLKARGLPRETLRHV  93

Query  1190  LSYHVLADYFGTKKLHHLNKGTTLTATMFQATGDAPGTSGYVNMTALKGGKVGFAPEDNT  1011
             LS HVL DY+   KLH L  G+   +T+FQA+GDAPG++G V +   +GG+V F P+D+ 
Sbjct  94    LSLHVLVDYYDDAKLHRLPGGSADVSTLFQASGDAPGSAGMVKVAERRGGRVAFVPQDDD  153

Query  1010  GRFDSTF-VKSVLEKPYKISVIQISHHLSS--SYAEAPASGPTDVNITTLMAKQGCKAFA  840
                 + F V+SV E PY ISV+Q+S  +SS  + A A  + P+  N++ +M+K GC  FA
Sbjct  154   AGSTAVFYVRSVHETPYNISVLQVSGVISSPAAEAPAATADPSRRNVSDVMSKNGCGRFA  213

Query  839   DLLDSTG-ADATFALNV--ETGLTVFCPTDKVIQGFMPKYKNLSKDGKMSLLLYHGVPAY  669
              L+ +TG A ATF      + G T FCP DK ++ F P +  LS D +++++LYHG   +
Sbjct  214   GLVATTGDAAATFEKKAHDDGGFTFFCPADKAVEAFQPTFNRLSADARLAVVLYHGALGH  273

Query  668   QNLGMFRSNGNGVLNTLAT--GGSNKYDFTVQNSGEDVTLETEV-VTAKITGTMYDEEPL  498
              ++   ++ G+  L TLA+  GG++ +DF V+N  + +TL +     A++T T+  EE +
Sbjct  274   YSMQALKA-GDQDLGTLASLDGGNSNFDFAVRNVRDKLTLVSATHNVARVTRTLAYEEDV  332

Query  497   SVFKVDKVLLPREL  456
             +V+ +D VL+P +L
Sbjct  333   AVYMIDAVLVPCDL  346



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4371205462068