BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8157_g2_i1 len=1130 path=[2538:0-1129]

Length=1130
                                                                      Score     E

ref|XP_004241268.1|  PREDICTED: vicilin-like antimicrobial peptid...    221   9e-64   
ref|XP_002264047.1|  PREDICTED: vicilin-like antimicrobial peptid...    221   2e-63   Vitis vinifera
emb|CAN60323.1|  hypothetical protein VITISV_002857                     219   9e-63   Vitis vinifera
ref|XP_009597285.1|  PREDICTED: vicilin-like antimicrobial peptid...    219   2e-62   
ref|XP_009761195.1|  PREDICTED: vicilin-like antimicrobial peptid...    216   2e-61   
ref|XP_006365754.1|  PREDICTED: vicilin-like antimicrobial peptid...    215   2e-61   
ref|XP_006340383.1|  PREDICTED: vicilin-like antimicrobial peptid...    216   2e-61   
gb|EYU36204.1|  hypothetical protein MIMGU_mgv1a005561mg                216   3e-61   
ref|XP_006365760.1|  PREDICTED: vicilin-like antimicrobial peptid...    213   1e-60   
ref|XP_004234717.1|  PREDICTED: vicilin-like antimicrobial peptid...    212   3e-60   
ref|XP_006365753.1|  PREDICTED: vicilin-like antimicrobial peptid...    211   1e-59   
ref|XP_011089873.1|  PREDICTED: vicilin-like antimicrobial peptid...    210   3e-59   
ref|XP_004242091.1|  PREDICTED: vicilin-like antimicrobial peptid...    209   6e-59   
ref|XP_004251255.1|  PREDICTED: beta-conglycinin, beta chain-like       208   3e-58   
ref|XP_006365740.1|  PREDICTED: vicilin-like antimicrobial peptid...    206   8e-58   
emb|CDP08920.1|  unnamed protein product                                206   2e-57   
emb|CBI16272.3|  unnamed protein product                                203   2e-57   
ref|XP_002526353.1|  nutrient reservoir, putative                       204   3e-57   Ricinus communis
ref|XP_006424635.1|  hypothetical protein CICLE_v10028266mg             205   3e-57   
ref|XP_004242092.1|  PREDICTED: vicilin-like antimicrobial peptid...    203   2e-56   
gb|KHG30193.1|  Vicilin-like antimicrobial peptides 2-2                 202   7e-56   
gb|AAC15238.1|  globulin-like protein                                   201   2e-55   Daucus carota [carrots]
ref|XP_009593305.1|  PREDICTED: beta-conglycinin, beta chain-like       202   2e-55   
ref|XP_009783254.1|  PREDICTED: vicilin-like antimicrobial peptid...    198   3e-54   
gb|AAT40548.1|  Putative vicilin, identical                             197   6e-54   Solanum demissum
ref|XP_008782665.1|  PREDICTED: vicilin-like antimicrobial peptid...    195   2e-53   
ref|XP_010034297.1|  PREDICTED: vicilin-like antimicrobial peptid...    194   2e-53   
ref|XP_010104126.1|  Vicilin-like antimicrobial peptides 2-2            195   3e-53   
ref|XP_004309885.1|  PREDICTED: vicilin-like antimicrobial peptid...    196   3e-53   
pir||T10443  probable major protein body membrane protein MP27 / ...    194   3e-53
ref|XP_009416713.1|  PREDICTED: vicilin-like antimicrobial peptid...    194   4e-53   
ref|XP_007015475.1|  RmlC-like cupins superfamily protein, putative     194   5e-53   
ref|XP_011025519.1|  PREDICTED: vicilin-like antimicrobial peptid...    192   2e-52   
ref|XP_010521773.1|  PREDICTED: vicilin-like antimicrobial peptid...    192   2e-52   
ref|XP_010253553.1|  PREDICTED: vicilin-like antimicrobial peptid...    192   2e-52   
ref|XP_002313331.2|  hypothetical protein POPTR_0009s05950g             192   3e-52   Populus trichocarpa [western balsam poplar]
gb|ABK80758.1|  7S globulin precursor                                   192   4e-52   Ficus pumila var. awkeotsang [jelly fig]
emb|CDY15753.1|  BnaC04g15710D                                          191   4e-52   
ref|XP_010689593.1|  PREDICTED: vicilin-like antimicrobial peptid...    192   1e-51   
ref|XP_009103693.1|  PREDICTED: vicilin-like antimicrobial peptid...    189   2e-51   
emb|CDY04569.1|  BnaA07g13950D                                          187   7e-51   
ref|XP_008463915.1|  PREDICTED: LOW QUALITY PROTEIN: globulin-1 S...    189   1e-50   
ref|XP_009338303.1|  PREDICTED: vicilin-like antimicrobial peptid...    187   2e-50   
ref|XP_007208640.1|  hypothetical protein PRUPE_ppa020107mg             187   3e-50   
ref|XP_004163383.1|  PREDICTED: vicilin-like antimicrobial peptid...    186   5e-50   
ref|XP_009358363.1|  PREDICTED: vicilin-like antimicrobial peptid...    187   5e-50   
gb|EPS66719.1|  hypothetical protein M569_08055                         185   6e-50   
ref|XP_004149563.1|  PREDICTED: vicilin-like antimicrobial peptid...    186   6e-50   
ref|XP_008224564.1|  PREDICTED: vicilin-like antimicrobial peptid...    184   3e-49   
ref|NP_180416.1|  cupin domain-containing protein                       184   5e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295626.1|  hypothetical protein CARUB_v10024739mg             183   5e-49   
ref|XP_010046432.1|  PREDICTED: vicilin-like antimicrobial peptid...    182   6e-49   
gb|KCW85695.1|  hypothetical protein EUGRSUZ_B02472                     182   7e-49   
ref|XP_010510617.1|  PREDICTED: provicilin-like                         182   1e-48   
ref|XP_010414517.1|  PREDICTED: provicilin-like                         182   1e-48   
gb|KCW85694.1|  hypothetical protein EUGRSUZ_B02472                     182   1e-48   
ref|XP_009342359.1|  PREDICTED: vicilin-like antimicrobial peptid...    182   2e-48   
gb|ACD36978.1|  Gly m Bd 28K allergen                                   179   7e-48   Glycine max [soybeans]
ref|XP_008385385.1|  PREDICTED: vicilin-like antimicrobial peptid...    181   8e-48   
ref|XP_003542001.1|  PREDICTED: vicilin-like antimicrobial peptid...    179   1e-47   
ref|NP_001267501.1|  allergen Gly m Bd 28K precursor                    179   1e-47   
gb|KHN22047.1|  Vicilin-like antimicrobial peptides 2-2                 179   2e-47   
ref|XP_002880986.1|  cupin family protein                               179   2e-47   
ref|XP_004505960.1|  PREDICTED: vicilin-like antimicrobial peptid...    178   3e-47   
ref|XP_002465310.1|  hypothetical protein SORBIDRAFT_01g036140          177   2e-46   Sorghum bicolor [broomcorn]
ref|XP_004487139.1|  PREDICTED: vicilin-like antimicrobial peptid...    175   4e-46   
ref|XP_003597178.1|  Vicilin-like antimicrobial peptides 2-2            174   5e-46   
gb|AES67417.2|  allergen gly M Bd 28 kDa protein                        174   6e-46   
ref|XP_003597181.1|  Vicilin-like antimicrobial peptides 2-3            174   6e-46   
ref|XP_003597166.1|  Vicilin-like antimicrobial peptides 2-3            174   8e-46   
gb|KFK32293.1|  hypothetical protein AALP_AA6G223800                    174   1e-45   
ref|XP_010922746.1|  PREDICTED: vicilin-like antimicrobial peptid...    174   1e-45   
ref|XP_006409876.1|  hypothetical protein EUTSA_v10017921mg             174   2e-45   
ref|XP_006843294.1|  hypothetical protein AMTR_s00080p00163630          172   3e-45   
ref|XP_003597162.1|  Vicilin-like antimicrobial peptides 2-3            172   4e-45   
ref|XP_007150226.1|  hypothetical protein PHAVU_005G137200g             172   6e-45   
tpg|DAA45235.1|  TPA: hypothetical protein ZEAMMB73_974672              172   6e-45   
ref|NP_001147040.1|  LOC100280650 precursor                             172   7e-45   Zea mays [maize]
ref|XP_003597174.1|  Vicilin-like antimicrobial peptides 2-3            166   7e-45   
ref|XP_004984460.1|  PREDICTED: globulin-1 S allele-like                172   1e-44   
ref|XP_003557965.1|  PREDICTED: vicilin                                 170   3e-44   
ref|XP_007132181.1|  hypothetical protein PHAVU_011G072800g             170   4e-44   
ref|XP_008366368.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin-like...    169   1e-43   
gb|EMT30208.1|  Vicilin-like antimicrobial peptides 2-2                 166   1e-42   
ref|XP_003606476.1|  Allergen Gly m Bd                                  165   2e-42   
gb|EYU18873.1|  hypothetical protein MIMGU_mgv1a024892mg                164   3e-42   
dbj|BAJ87938.1|  predicted protein                                      164   5e-42   
ref|XP_003597167.1|  Vicilin-like antimicrobial peptides 2-3            162   8e-42   
ref|XP_004309898.1|  PREDICTED: vicilin-like antimicrobial peptid...    163   9e-42   
ref|XP_010244960.1|  PREDICTED: vicilin-like antimicrobial peptid...    159   1e-40   
ref|XP_009415596.1|  PREDICTED: vicilin-like antimicrobial peptid...    158   4e-40   
ref|XP_006650050.1|  PREDICTED: vicilin-like antimicrobial peptid...    156   7e-39   
ref|XP_004309901.1|  PREDICTED: vicilin-like antimicrobial peptid...    152   5e-38   
ref|XP_009396660.1|  PREDICTED: vicilin-like antimicrobial peptid...    151   2e-37   
gb|ABF95817.1|  Cupin family protein, expressed                         149   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965782.1|  hypothetical protein SELMODRAFT_22892              140   2e-34   
ref|XP_002984436.1|  hypothetical protein SELMODRAFT_12725              140   2e-34   
gb|EMS66387.1|  Vicilin-like antimicrobial peptides 2-2                 135   3e-32   
gb|ACD36975.1|  Gly m Bd 28K allergen                                   134   9e-32   Glycine max [soybeans]
gb|ACD36974.1|  Gly m Bd 28K allergen                                   132   3e-31   Glycine max [soybeans]
ref|XP_002988968.1|  hypothetical protein SELMODRAFT_129041             132   4e-31   
gb|ACD36976.1|  Gly m Bd 28K allergen                                   130   1e-30   Glycine max [soybeans]
ref|XP_002961493.1|  hypothetical protein SELMODRAFT_22406              128   1e-29   
ref|XP_002971314.1|  hypothetical protein SELMODRAFT_12200              128   1e-29   
ref|XP_002975077.1|  hypothetical protein SELMODRAFT_102742             117   4e-26   
ref|XP_010921152.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin-like...    115   2e-25   
emb|CAA91187.1|  vicilin                                                116   2e-25   Matteuccia struthiopteris
gb|ABR16441.1|  unknown                                               97.4    5e-19   Picea sitchensis
gb|ABK24863.1|  unknown                                               97.1    6e-19   Picea sitchensis
ref|XP_002977505.1|  hypothetical protein SELMODRAFT_107197           96.3    1e-18   
ref|XP_002972193.1|  hypothetical protein SELMODRAFT_172591           94.7    4e-18   
ref|XP_009367697.1|  PREDICTED: sucrose-binding protein-like          94.0    1e-17   
ref|XP_008386543.1|  PREDICTED: sucrose-binding protein-like          91.7    7e-17   
emb|CAA90652.1|  vicilin; 7S globulin                                 90.5    1e-16   Zamia furfuracea
ref|XP_011008280.1|  PREDICTED: uncharacterized protein LOC105113691  85.5    2e-16   
gb|AAB01554.1|  vicilin-like storage protein                          87.4    1e-15   Picea glauca
ref|XP_008355465.1|  PREDICTED: sucrose-binding protein-like          85.5    7e-15   
ref|XP_009370838.1|  PREDICTED: sucrose-binding protein-like          85.5    7e-15   
emb|CAA44873.1|  vicilin-like storage protein                         84.7    1e-14   Picea glauca
ref|XP_008350065.1|  PREDICTED: sucrose-binding protein-like          84.7    2e-14   
ref|XP_004292578.1|  PREDICTED: vicilin-like antimicrobial peptid...  81.6    1e-13   
ref|XP_006466758.1|  PREDICTED: vicilin-like antimicrobial peptid...  81.3    2e-13   
ref|XP_006425720.1|  hypothetical protein CICLE_v10027019mg           81.3    2e-13   
ref|XP_008235388.1|  PREDICTED: sucrose-binding protein-like          80.5    4e-13   
ref|XP_007200965.1|  hypothetical protein PRUPE_ppa004438mg           77.8    3e-12   
pdb|4LEJ|A  Chain A, Crystal Structure Of The Korean Pine (pinus ...  75.9    9e-12   
gb|AHC94918.1|  vicilin                                               75.9    1e-11   
gb|AAL86739.1|AF441864_1  48-kDa glycoprotein precursor               74.3    3e-11   Corylus avellana [European hazelnut]
gb|ABO36677.1|  vicilin                                               74.7    4e-11   Pistacia vera [pistachio]
gb|AFK48280.1|  unknown                                               68.6    5e-11   
ref|NP_001291343.1|  vicilin-like antimicrobial peptides 2-2 prec...  72.8    1e-10   
ref|XP_008339320.1|  PREDICTED: globulin-1 S allele-like              72.8    1e-10   
ref|XP_010911186.1|  PREDICTED: vicilin-like antimicrobial peptid...  72.4    2e-10   
emb|CAA91188.1|  vicilin                                              70.9    2e-10   Zamia furfuracea
ref|XP_011090693.1|  PREDICTED: vicilin-like antimicrobial peptid...  72.0    3e-10   
ref|XP_009356668.1|  PREDICTED: globulin-1 S allele-like              72.0    3e-10   
ref|XP_010054529.1|  PREDICTED: sucrose-binding protein-like          71.6    3e-10   
sp|Q9SPL4.1|AMP22_MACIN  RecName: Full=Vicilin-like antimicrobial...  71.6    3e-10   Macadamia integrifolia [macadamia nut]
ref|XP_009374239.1|  PREDICTED: LOW QUALITY PROTEIN: vicilin-like...  71.2    5e-10   
ref|XP_008241881.1|  PREDICTED: globulin-1 S allele                   70.5    7e-10   
dbj|BAB78478.1|  preproMP73                                           70.1    1e-09   Cucurbita maxima [Boston marrow]
ref|XP_009786980.1|  PREDICTED: vicilin-like antimicrobial peptid...  69.7    1e-09   
ref|XP_010905079.1|  PREDICTED: vicilin-like antimicrobial peptid...  69.7    1e-09   
ref|XP_007144650.1|  hypothetical protein PHAVU_007G173600g           69.3    2e-09   
ref|XP_009607668.1|  PREDICTED: vicilin-like antimicrobial peptid...  69.3    2e-09   
gb|EYU41459.1|  hypothetical protein MIMGU_mgv1a003361mg              69.3    2e-09   
ref|XP_006369592.1|  hypothetical protein POPTR_0001s26660g           64.7    2e-09   
sp|Q9SPL3.1|AMP23_MACIN  RecName: Full=Vicilin-like antimicrobial...  68.9    2e-09   Macadamia integrifolia [macadamia nut]
ref|XP_008451293.1|  PREDICTED: sucrose-binding protein-like          68.9    2e-09   
ref|XP_009417381.1|  PREDICTED: globulin-1 S allele-like              68.6    3e-09   
gb|ACU17936.1|  unknown                                               67.4    3e-09   Glycine max [soybeans]
ref|XP_006839012.1|  hypothetical protein AMTR_s00002p00272040        68.6    3e-09   
ref|XP_004247670.1|  PREDICTED: vicilin-like antimicrobial peptid...  67.8    4e-09   
gb|ABU45197.1|  unknown                                               68.6    4e-09   Petunia integrifolia subsp. inflata
gb|AAM73729.1|AF395893_1  vicilin-like protein                        68.2    4e-09   Anacardium occidentale [maranon]
gb|AAM73730.2|AF395894_1  vicilin-like protein                        68.2    4e-09   Anacardium occidentale [maranon]
ref|XP_004162195.1|  PREDICTED: vicilin-like antimicrobial peptid...  67.8    5e-09   
gb|EYU40904.1|  hypothetical protein MIMGU_mgv1a003248mg              68.2    5e-09   
ref|XP_010680893.1|  PREDICTED: calponin homology domain-containi...  68.2    5e-09   
gb|KHN18868.1|  Sucrose-binding protein                               67.8    5e-09   
ref|XP_008798757.1|  PREDICTED: uncharacterized protein LOC103713...  68.2    5e-09   
gb|AAF05723.1|AF191299_1  sucrose binding protein homolog S-64        67.8    5e-09   Glycine max [soybeans]
gb|EYU23233.1|  hypothetical protein MIMGU_mgv1a024110mg              67.8    6e-09   
ref|XP_003536630.1|  PREDICTED: sucrose-binding protein-like          67.8    6e-09   
ref|NP_001237244.1|  sucrose-binding protein 2 precursor              67.4    6e-09   
ref|XP_011100121.1|  PREDICTED: globulin-1 S allele                   67.8    6e-09   
ref|XP_009771135.1|  PREDICTED: vicilin-like antimicrobial peptid...  67.4    7e-09   
ref|XP_004146991.1|  PREDICTED: vicilin-like antimicrobial peptid...  67.0    8e-09   
gb|KGN48815.1|  PreproMP73                                            67.4    8e-09   
gb|KGN44776.1|  hypothetical protein Csa_7G380130                     67.0    8e-09   
ref|XP_008440688.1|  PREDICTED: globulin-1 S allele                   67.0    1e-08   
ref|XP_006444033.1|  hypothetical protein CICLE_v10024281mg           66.6    1e-08   
gb|KDO68672.1|  hypothetical protein CISIN_1g040805mg                 66.6    1e-08   
ref|XP_009605859.1|  PREDICTED: vicilin-like antimicrobial peptid...  66.2    1e-08   
sp|Q9SPL5.1|AMP21_MACIN  RecName: Full=Vicilin-like antimicrobial...  66.6    2e-08   Macadamia integrifolia [macadamia nut]
gb|AAS07324.1|  putative globulin (with alternative splicing)         66.2    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938152.1|  PREDICTED: vicilin-like antimicrobial peptid...  65.9    2e-08   
gb|KDP31795.1|  hypothetical protein JCGZ_12256                       65.9    2e-08   
ref|XP_009394628.1|  PREDICTED: vicilin-like antimicrobial peptid...  65.1    3e-08   
ref|XP_006650381.1|  PREDICTED: globulin-1 S allele-like              65.5    3e-08   
gb|AGU37285.1|  7S globulin precursor isoform 2                       65.5    4e-08   
gb|AAK28402.1|AF250228_1  7S globulin                                 65.1    4e-08   Elaeis guineensis
ref|XP_010679084.1|  PREDICTED: vicilin-like antimicrobial peptid...  65.1    4e-08   
ref|NP_001276308.1|  sucrose-binding protein precursor                64.7    5e-08   
ref|XP_003632318.2|  PREDICTED: vicilin-like antimicrobial peptid...  64.7    7e-08   
ref|XP_009407076.1|  PREDICTED: vicilin-like antimicrobial peptid...  64.3    7e-08   
emb|CBI28721.3|  unnamed protein product                              63.9    8e-08   
ref|XP_009771136.1|  PREDICTED: vicilin-like antimicrobial peptid...  64.3    9e-08   
gb|KHG24948.1|  Vicilin-like antimicrobial peptides 2-1               63.9    1e-07   
gb|AAD10375.1|  globulin-like protein                                 63.5    1e-07   Oryza sativa [red rice]
ref|XP_010695493.1|  PREDICTED: vicilin-like antimicrobial peptid...  63.5    1e-07   
gb|KHN33448.1|  Legumin A                                             62.8    1e-07   
ref|XP_004495184.1|  PREDICTED: sucrose-binding protein-like          63.2    2e-07   
ref|XP_010026166.1|  PREDICTED: provicilin-like                       63.2    2e-07   
ref|XP_006383667.1|  hypothetical protein POPTR_0005s23390g           63.2    2e-07   
emb|CAC27161.1|  putative sucrose binding protein                     62.8    2e-07   Vicia faba var. minor [tick bean]
ref|XP_006380750.1|  hypothetical protein POPTR_0007s12490g           63.2    2e-07   
ref|XP_009386161.1|  PREDICTED: allergen Ara h 1, clone P41B-like     62.8    2e-07   
ref|XP_011032788.1|  PREDICTED: vicilin-like antimicrobial peptid...  62.8    2e-07   
emb|CBI17554.3|  unnamed protein product                              62.4    3e-07   
ref|XP_010099837.1|  Vicilin-like antimicrobial peptides 2-2          62.0    4e-07   
ref|XP_010649177.1|  PREDICTED: provicilin-like                       62.0    5e-07   
ref|XP_004247186.1|  PREDICTED: vicilin-like antimicrobial peptid...  61.6    5e-07   
ref|XP_010256229.1|  PREDICTED: vicilin-like antimicrobial peptid...  61.6    6e-07   
gb|ABS89092.1|  globulin-1                                            59.7    6e-07   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89064.1|  globulin-1                                            59.7    6e-07   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007046997.1|  RmlC-like cupins superfamily protein, putative   61.2    6e-07   
ref|XP_009595711.1|  PREDICTED: vicilin-like antimicrobial peptid...  61.2    8e-07   
gb|ABU45177.1|  unknown                                               61.2    8e-07   Solanum melongena [aubergine]
ref|XP_009595712.1|  PREDICTED: vicilin-like antimicrobial peptid...  61.2    8e-07   
gb|ABS89031.1|  globulin-1                                            59.3    1e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_006349767.1|  PREDICTED: vicilin-like antimicrobial peptid...  60.5    1e-06   
ref|XP_006363154.1|  PREDICTED: vicilin-like antimicrobial peptid...  60.5    1e-06   
gb|ABS89073.1|  globulin-1                                            58.9    1e-06   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89077.1|  globulin-1                                            58.9    1e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011025729.1|  PREDICTED: globulin-1 S allele                   60.5    1e-06   
emb|CAA72090.1|  P54 protein                                          60.1    1e-06   Pisum sativum [garden pea]
ref|NP_001050038.1|  Os03g0336100                                     59.7    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003537573.1|  PREDICTED: stress response protein nst1-like     60.1    2e-06   
gb|ABS89030.1|  globulin-1                                            58.2    2e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003516577.1|  PREDICTED: globulin-1 S allele-like              59.7    2e-06   
gb|KHN36140.1|  Vicilin-like antimicrobial peptides 2-2               59.7    2e-06   
ref|XP_009803271.1|  PREDICTED: eukaryotic translation initiation...  59.7    2e-06   
gb|ABU45211.1|  unknown                                               59.7    2e-06   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009590474.1|  PREDICTED: eukaryotic translation initiation...  59.7    2e-06   
ref|XP_010254445.1|  PREDICTED: vicilin-like antimicrobial peptid...  56.6    3e-06   
gb|ABS89043.1|  globulin-1                                            57.8    3e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010531167.1|  PREDICTED: vicilin-like antimicrobial peptid...  58.9    4e-06   
gb|ABS89047.1|  globulin-1                                            57.4    4e-06   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89078.1|  globulin-1                                            57.4    5e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004981475.1|  PREDICTED: globulin-1 S allele-like              58.2    6e-06   
ref|XP_004300614.1|  PREDICTED: vicilin-like antimicrobial peptid...  58.5    6e-06   
gb|ABS89028.1|  globulin-1                                            56.6    7e-06   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003611961.1|  Vicilin-like antimicrobial peptides 2-3          58.2    7e-06   
gb|AES94919.2|  cupin family protein                                  58.2    7e-06   
ref|XP_004512222.1|  PREDICTED: globulin-1 S allele-like              57.8    9e-06   
gb|ABS89057.1|  globulin-1                                            56.2    1e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMS62417.1|  Globulin-1 S allele                                   57.4    1e-05   
ref|XP_010548347.1|  PREDICTED: vicilin                               57.4    1e-05   
ref|XP_006419988.1|  hypothetical protein CICLE_v10006494mg           57.4    1e-05   
dbj|BAK04746.1|  predicted protein                                    57.0    2e-05   
ref|XP_010026941.1|  PREDICTED: vicilin C72                           57.0    2e-05   
ref|XP_004247580.1|  PREDICTED: vicilin GC72-A                        56.6    2e-05   
gb|ABS89063.1|  globulin-1                                            55.1    2e-05   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_009396731.1|  PREDICTED: vicilin-like antimicrobial peptid...  56.2    3e-05   
ref|NP_001173574.1|  Os03g0663800                                     55.8    3e-05   
ref|XP_006360765.1|  PREDICTED: vicilin-like antimicrobial peptid...  55.8    3e-05   
ref|XP_010108323.1|  Vicilin-like antimicrobial peptides 2-1          56.2    4e-05   
gb|ABF98040.1|  Cupin family protein, expressed                       55.5    4e-05   Oryza sativa Japonica Group [Japonica rice]
gb|ACN34339.1|  unknown                                               55.8    4e-05   Zea mays [maize]
ref|XP_007156915.1|  hypothetical protein PHAVU_002G027900g           55.8    5e-05   
emb|CAA41809.1|  vicilin-like embryo storage protein                  55.5    5e-05   Zea mays [maize]
ref|XP_008665579.1|  PREDICTED: globulin-1 S allele-like              55.1    5e-05   
gb|ACG48473.1|  globulin-1 S allele precursor                         55.1    5e-05   Zea mays [maize]
gb|AAF13484.1|AF113053_1  vicilin                                     53.5    7e-05   Guazuma ulmifolia
gb|EAZ28885.1|  hypothetical protein OsJ_12925                        54.7    7e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551719.1|  PREDICTED: vicilin                               54.7    7e-05   
ref|XP_006650713.1|  PREDICTED: globulin-1 S allele-like              54.7    8e-05   
gb|ABS89066.1|  globulin-1                                            53.5    9e-05   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89026.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
gb|EMS48588.1|  Vicilin-like antimicrobial peptides 2-2               54.7    1e-04   
ref|NP_001105887.1|  globulin-1 S allele precursor                    54.3    1e-04   Zea mays [maize]
emb|CAA90641.1|  legumin; 11S-globulin                                54.3    1e-04   Ginkgo biloba [ginkgo]
gb|ABS89097.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89096.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89074.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABS89048.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
emb|CAA53177.1|  ginnacin                                             54.3    1e-04   Ginkgo biloba [ginkgo]
gb|ABS89079.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_002464118.1|  hypothetical protein SORBIDRAFT_01g012640        54.3    1e-04   Sorghum bicolor [broomcorn]
gb|ABS89083.1|  globulin-1                                            53.1    1e-04   Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003556051.1|  PREDICTED: beta-conglycinin, alpha chain         54.3    1e-04   
sp|P13916.2|GLCA_SOYBN  RecName: Full=Beta-conglycinin, alpha cha...  54.3    1e-04   Glycine max [soybeans]
ref|XP_004233717.1|  PREDICTED: globulin-1 S allele-like              54.3    1e-04   
gb|ACC97138.1|  globulin-1                                            52.8    1e-04   Zea mays [maize]
gb|AAM33459.2|  globulin-like protein                                 53.9    1e-04   Oryza sativa Japonica Group [Japonica rice]
gb|ACC97140.1|  globulin-1                                            52.8    1e-04   Zea mays [maize]
gb|ABR67869.1|  globulin-1                                            52.8    1e-04   Zea mays [maize]
gb|KHN15747.1|  Beta-conglycinin, alpha chain                         53.9    1e-04   
gb|ABS89088.1|  globulin-1                                            52.8    1e-04   
gb|ABS89044.1|  globulin-1                                            52.8    1e-04   
ref|NP_001051533.1|  Os03g0793700                                     53.9    1e-04   
gb|ACC97139.1|  globulin-1                                            52.8    1e-04   
dbj|BAE44299.1|  beta-conglycinin alpha subunit                       53.9    1e-04   
dbj|BAK39718.1|  beta-conglycinin alpha subunit                       53.9    1e-04   
gb|ABS89046.1|  globulin-1                                            52.8    1e-04   
gb|ABS89056.1|  globulin-1                                            52.8    1e-04   
gb|ABS89027.1|  globulin-1                                            52.8    1e-04   
dbj|BAE02727.1|  beta-conglycinin alpha subunit                       53.9    1e-04   
gb|ABS89065.1|  globulin-1                                            52.8    1e-04   
gb|ABS89058.1|  globulin-1                                            52.8    1e-04   
ref|XP_008439368.1|  PREDICTED: vicilin                               53.9    2e-04   
gb|ABS89068.1|  globulin-1                                            52.8    2e-04   
gb|ABS89050.1|  globulin-1                                            52.8    2e-04   
gb|ABS89036.1|  globulin-1                                            52.8    2e-04   
gb|ABS89101.1|  globulin-1                                            52.8    2e-04   
gb|EEC76319.1|  hypothetical protein OsI_13867                        53.5    2e-04   
gb|ABS89081.1|  globulin-1                                            52.8    2e-04   
gb|ABS89080.1|  globulin-1                                            52.8    2e-04   
ref|XP_006856052.1|  hypothetical protein AMTR_s00059p00089270        53.5    2e-04   
gb|ABS89062.1|  globulin-1                                            52.8    2e-04   
gb|AAF13483.1|AF113052_1  vicilin                                     52.4    2e-04   
gb|ABS89076.1|  globulin-1                                            52.4    2e-04   
gb|ABS89082.1|  globulin-1                                            52.4    2e-04   
gb|ABS89055.1|  globulin-1                                            52.4    2e-04   
dbj|BAA23360.2|  alpha subunit of beta conglycinin                    53.5    2e-04   
gb|ABS89035.1|  globulin-1                                            52.4    2e-04   
gb|ABS89053.1|  globulin-1                                            52.4    2e-04   
ref|XP_002517098.1|  Vicilin GC72-A precursor, putative               53.5    2e-04   
gb|ABS89039.1|  globulin-1                                            52.4    2e-04   
gb|ABS89038.1|  globulin-1                                            52.0    2e-04   
gb|ABS89106.1|  globulin-1                                            52.0    2e-04   
gb|ABS89098.1|  globulin-1                                            52.0    3e-04   
ref|XP_002466310.1|  hypothetical protein SORBIDRAFT_01g005440        52.8    3e-04   
gb|ABR67870.1|  globulin-1                                            52.0    3e-04   
gb|ABS89095.1|  globulin-1                                            52.0    3e-04   
gb|ABS89102.1|  globulin-1                                            52.0    3e-04   
gb|ABS89054.1|  globulin-1                                            52.0    3e-04   
ref|XP_010938562.1|  PREDICTED: globulin-1 S allele                   52.8    3e-04   
gb|ABS89040.1|  globulin-1                                            51.6    3e-04   
emb|CBK38921.1|  vicilin 47k                                          52.4    4e-04   
gb|ABS89103.1|  globulin-1                                            51.6    4e-04   
gb|AAC31469.1|  globulin-1                                            51.6    4e-04   
gb|ABS89099.1|  globulin-1                                            51.6    4e-04   
ref|NP_001236856.1|  beta-conglycinin alpha-subunit precursor         52.8    4e-04   
gb|AAK20335.1|AF329793_1  globulin 1                                  51.2    4e-04   
ref|XP_004134437.1|  PREDICTED: vicilin-like antimicrobial peptid...  52.8    4e-04   
gb|AAK20334.1|AF329792_1  globulin 1                                  51.2    4e-04   
gb|KFK40533.1|  hypothetical protein AALP_AA2G008100                  52.4    4e-04   
emb|CBK38919.1|  vicilin 47k                                          52.4    4e-04   
emb|CBK38920.1|  vicilin 47k                                          52.4    4e-04   
gb|KGN56960.1|  hypothetical protein Csa_3G146460                     52.4    5e-04   
ref|XP_006406142.1|  hypothetical protein EUTSA_v10021982mg           52.0    6e-04   
ref|XP_003590610.1|  Vicilin-like antimicrobial peptides 2-2          52.0    6e-04   
emb|CBK38922.1|  vicilin 47k                                          52.0    6e-04   
dbj|BAA34056.1|  PV100                                                52.4    6e-04   
ref|XP_010254919.1|  PREDICTED: golgin subfamily A member 6-like ...  52.0    7e-04   
emb|CAA47814.1|  vicilin 47kD protein                                 51.6    7e-04   
emb|CAF25232.1|  Vicilin                                              51.2    8e-04   
gb|AAK20338.1|AF329796_1  globulin 1                                  50.1    0.001   
sp|P11827.1|GLCAP_SOYBN  RecName: Full=Beta-conglycinin, alpha' c...  51.6    0.001   



>ref|XP_004241268.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Solanum lycopersicum]
Length=455

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 122/232 (53%), Positives = 158/232 (68%), Gaps = 24/232 (10%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS LV
Sbjct  39   EKWFLLRQLHNVVKTDAGSMRMVKGGYRAGSFLHSPMHIGFISMEPNSLFIPQYLDSDLV  98

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GHVY+D+LAER +K GD+YTI AGSAFY+EN  E QRL IICSI+I  TS
Sbjct  99   LFVHHGEARVGHVYRDELAERSLKQGDIYTIPAGSAFYLENRNENQRLRIICSIDI--TS  156

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG HP SVLAGFD  TLSTALNVS  E+   +  + SGPIV L+
Sbjct  157  ESMGW--HAFQSFFIGGGTHPASVLAGFDHTTLSTALNVSTEELKTFLTRQTSGPIVHLS  214

Query  169  NSNYTAPI-----------LAHLKRIVHYSD--VEQQQQHYWAPWLFMRKLL  53
             S++T              LAHLKRIV++ +    +Q++  W+    MRK+L
Sbjct  215  GSHHTNTWSEFLAQEPHHKLAHLKRIVNFEEEASSKQEESTWS----MRKIL  262



>ref|XP_002264047.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Vitis vinifera]
 ref|XP_010651130.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Vitis vinifera]
Length=480

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/232 (48%), Positives = 162/232 (70%), Gaps = 21/232 (9%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTS--GRLMHIGFITMEPQSLLIPQYLDSHLV  530
            + ++F+++++K++V+T++G ++VVR +   S   + MHIGFITMEP+SL +PQYLDS L+
Sbjct  42   EHELFLMHDSKQMVKTDAGEMRVVRSAAGRSIVEKPMHIGFITMEPKSLFVPQYLDSSLI  101

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LFI +GEA++G +Y D+L E+++K GD+YTI AGSAFY+ NT EGQRLHIICSI++ ++ 
Sbjct  102  LFIRRGEAKVGSIYNDELVEKQLKIGDLYTIPAGSAFYLVNTGEGQRLHIICSIDMSESL  161

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             M      TFQSFF+GGG HPTS+L GF P TLSTA N+SM E+ +++  +  GPI+ + 
Sbjct  162  KMD-----TFQSFFLGGGTHPTSILTGFAPETLSTAFNISMSELEEIMTRQEGGPIIYIK  216

Query  169  NSNY-----------TAPILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            +S             T   + HLKRI+ + DVE +Q+H    W   RKLL +
Sbjct  217  DSQQPSTWAKFLEMKTQDKVKHLKRIMGF-DVETEQKH--GTWWSWRKLLNS  265



>emb|CAN60323.1| hypothetical protein VITISV_002857 [Vitis vinifera]
Length=452

 Score =   219 bits (557),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/232 (47%), Positives = 161/232 (69%), Gaps = 21/232 (9%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTS--GRLMHIGFITMEPQSLLIPQYLDSHLV  530
            + ++F+++++K++V+T++G ++VVR +   S   + MHIGFI MEP+SL +PQYLDS L+
Sbjct  42   EHELFLMHDSKQMVKTDAGEMRVVRSAAGRSIVEKPMHIGFIXMEPKSLFVPQYLDSGLI  101

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LFI +GEA++G +Y D+L E+++K GD+YTI AGSAFY+ NT EGQRLHIICSI++ ++ 
Sbjct  102  LFIRRGEAKVGSIYNDELVEKQLKIGDLYTIPAGSAFYLVNTGEGQRLHIICSIDMSESL  161

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             M      TFQSFF+GGG HPTS+L GF P TLSTA N+SM E+ +++  +  GPI+ + 
Sbjct  162  KMD-----TFQSFFLGGGTHPTSILTGFAPETLSTAFNISMSELEEIMTRQEGGPIIYIK  216

Query  169  NSNY-----------TAPILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            +S             T   + HLKRI+ + DVE +Q+H    W   RKLL +
Sbjct  217  DSQQPSTWAKFLEMKTQDKVKHLKRIMGF-DVETEQKH--GTWWSWRKLLNS  265



>ref|XP_009597285.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
tomentosiformis]
Length=487

 Score =   219 bits (558),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 150/209 (72%), Gaps = 18/209 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L    +VV+TE+GV+K+V+G           MHIGFI+MEP SL IPQYLDS+L+
Sbjct  42   EKWFLLRHLHDVVKTEAGVMKLVKGGYRRGTSFHSPMHIGFISMEPNSLFIPQYLDSNLL  101

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GH+Y+D+LAER +K GD+YTI AGSAFY+EN  E QRLHIICSI++  TS
Sbjct  102  LFVHHGEARVGHIYRDELAERSLKPGDVYTIPAGSAFYLENRVENQRLHIICSIDV--TS  159

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG++PTS++AGFD  TLSTALNVS  E+S  +  + SGPIV L+
Sbjct  160  ESMG--WHAFQSFFIGGGIYPTSIIAGFDHSTLSTALNVSAAELSTFLTRQSSGPIVHLS  217

Query  169  NSNYT-----------APILAHLKRIVHY  116
             S++T              LAHLKRI ++
Sbjct  218  GSHHTHIWSKFLAQEPHKRLAHLKRIANF  246



>ref|XP_009761195.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=486

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 160/233 (69%), Gaps = 20/233 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L    +VV+T++G++++V+G  S        M IGFI+MEP SL IPQYLDS+L+
Sbjct  41   EKWFLLRHLHDVVKTDAGLMRLVKGGYSRGTSFHSPMRIGFISMEPNSLFIPQYLDSNLL  100

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GH+Y D LAER +K GD+YTI AGSAFY+EN  E QRLHIICSI++  TS
Sbjct  101  LFVHHGEARVGHIYGDVLAERGLKPGDVYTIPAGSAFYLENRVENQRLHIICSIDV--TS  158

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFF+GGG++PTS+LAGFD  TLSTALNVS  E+S  +  + SGPIV L+
Sbjct  159  ESMG--WHAFQSFFVGGGIYPTSILAGFDHTTLSTALNVSTAELSTFLTRQSSGPIVHLS  216

Query  169  NSNYT-----------APILAHLKRIVHYSD--VEQQQQHYWAPWLFMRKLLT  50
             S++T              LAHLKRI ++ +  + ++++  W+   F+  LL 
Sbjct  217  GSHHTHIWSKFLAQEPHKRLAHLKRIANFKEETIPKEEESTWSLRKFLFTLLN  269



>ref|XP_006365754.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=459

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 158/233 (68%), Gaps = 20/233 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS LV
Sbjct  39   EKWFLLRQLHNVVKTDAGSMRMVKGGYRPDSFLHSPMHIGFISMEPNSLFIPQYLDSDLV  98

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            +F++ GEAR+GH+Y+D+LAER +K GD+YTI AGSAFY+EN  E QRL IICSI I  TS
Sbjct  99   IFVHHGEARVGHIYRDELAERSLKQGDVYTIPAGSAFYLENRNENQRLRIICSIGI--TS  156

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG+HP S+LAGFD  TLSTALNVS  E+   +  + SGPIV L+
Sbjct  157  ESMG--WHAFQSFFIGGGIHPASILAGFDHTTLSTALNVSTAELKTFLTRQTSGPIVHLS  214

Query  169  NS-------NYTA----PILAHLKRIVHYSD--VEQQQQHYWAPWLFMRKLLT  50
             S       N+ A      LAHLKRIV+ ++    ++++  W+   F+  LL+
Sbjct  215  GSHDTNIWTNFIAQECHKKLAHLKRIVNSAEEASPKEEESTWSLRKFLCTLLS  267



>ref|XP_006340383.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=509

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/241 (49%), Positives = 157/241 (65%), Gaps = 32/241 (13%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVR------GSTSTSGRLMHIGFITMEPQSLLIPQYLDSHL  533
            +F+L+++KE+VRT++GV++VV       G  S    LMHIGFITMEP +L IPQYL++HL
Sbjct  35   LFLLHDSKEIVRTDAGVMRVVSKGGFSGGEVSIFQSLMHIGFITMEPNTLFIPQYLNAHL  94

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
             LF+ +GE RIGH+YKD   ER++K GD+Y+I AGSAFY+ N AEGQRLHIICSI+  +T
Sbjct  95   TLFVRRGETRIGHIYKDDFTERRLKEGDVYSIRAGSAFYLVNPAEGQRLHIICSISNSNT  154

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
              +     Y FQSFFIGGG++PTS+L+GFD  TLSTA NVS  E+S+++  ++SG IV L
Sbjct  155  LGL-----YGFQSFFIGGGIYPTSILSGFDTLTLSTAFNVSSEEVSEILTRQLSGAIVPL  209

Query  172  TNSNYTAPIL-------------AHLKRIVH--------YSDVEQQQQHYWAPWLFMRKL  56
              +    P +              HLKR+VH          D E++QQ  W+   FM  L
Sbjct  210  NTTQSPTPSIWANFLNLEQHQRHDHLKRVVHLEEEASFEEEDEEREQQPTWSLRKFMNNL  269

Query  55   L  53
             
Sbjct  270  F  270



>gb|EYU36204.1| hypothetical protein MIMGU_mgv1a005561mg [Erythranthe guttata]
Length=479

 Score =   216 bits (549),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 158/226 (70%), Gaps = 23/226 (10%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            ++ F+L ++K VV+T++G ++VVRG     GR     MHIGFITMEP+SL IPQYLDS L
Sbjct  46   QESFLLQDSKHVVKTDAGDMRVVRG---FGGRFAKSPMHIGFITMEPKSLFIPQYLDSSL  102

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +LF+ +GEAR+G++YKD+L ER +K GD+Y I AGSAFY+ NTAEGQRLH+ICSI   DT
Sbjct  103  ILFVRRGEARVGYIYKDELVERDLKMGDIYRIGAGSAFYLINTAEGQRLHVICSI---DT  159

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+  G    +FQSF+I GG +P+SVL+GFD  TLSTA NVS  E+S+++ T+ SGPIV L
Sbjct  160  SESLGWS--SFQSFYIAGGTYPSSVLSGFDQLTLSTAFNVSETELSEMLTTQQSGPIVFL  217

Query  172  TNSNYTAPI-----------LAHLKRIVHYSDVEQQQQHYWAPWLF  68
            T+S+  +             +AH++RIV     + +Q+   + W F
Sbjct  218  TSSHAPSSWSKFLDMDRNQKVAHMRRIVRIRREDLEQEEDKSTWSF  263



>ref|XP_006365760.1| PREDICTED: vicilin-like antimicrobial peptides 2-3-like [Solanum 
tuberosum]
Length=460

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 145/208 (70%), Gaps = 18/208 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS LV
Sbjct  39   EKWFLLRQLHNVVKTDAGSMRMVKGGYRAGSFLHSPMHIGFISMEPNSLFIPQYLDSDLV  98

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GH+Y D+LAER +K GD+YTI AGSAFY+EN  E QRL IICSI I  TS
Sbjct  99   LFVHHGEARVGHIYWDELAERSLKQGDVYTIPAGSAFYLENRNENQRLRIICSIGI--TS  156

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG HPTS+LAGFD  TLSTALNVS  E+   +  + SGPIV ++
Sbjct  157  ESMG--WHAFQSFFIGGGTHPTSILAGFDHTTLSTALNVSTAEVRTFLTRQSSGPIVHIS  214

Query  169  NSNYTA-----------PILAHLKRIVH  119
            +S++T              LAHLKRIV+
Sbjct  215  DSHHTNIWTEFVSQEPHQKLAHLKRIVN  242



>ref|XP_004234717.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=455

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/232 (50%), Positives = 156/232 (67%), Gaps = 20/232 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            ++ F+L     VV+T++G ++ V+G       L   MHIGFI+MEP SL IPQYLDS+LV
Sbjct  38   EQWFLLRHLHNVVKTDAGSMRFVKGGYRRGSFLHSPMHIGFISMEPNSLFIPQYLDSNLV  97

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            +F++ GEAR+GH+YKD+L ER +K GD+YTI AGSAFY+EN  E +RL IICSI+I  TS
Sbjct  98   IFVHHGEARVGHIYKDQLEERSLKPGDVYTIPAGSAFYLENRVESKRLQIICSIDI--TS  155

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG +P+SVLAGFD  TLSTALNVS  E+  L+  + SGPIV L+
Sbjct  156  ESMG--WHAFQSFFIGGGSNPSSVLAGFDHTTLSTALNVSTAEVHALLTRQSSGPIVHLS  213

Query  169  NSNYTAPI------------LAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLT  50
             S++ A +            LA+LKRIV++ D E   +   + W F + L T
Sbjct  214  GSHHDANVWSNFLDLEPHERLANLKRIVNF-DEEVSPKEEKSRWSFRKFLFT  264



>ref|XP_006365753.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=457

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 157/232 (68%), Gaps = 21/232 (9%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS L+
Sbjct  37   EKWFLLRQLHNVVKTDAGSMRIVKGGYRAGSFLHSPMHIGFISMEPNSLFIPQYLDSDLL  96

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++QGEAR+G++Y+D+LAER +K GD+YTI AGSAFY+EN+ E QRL IICSI I  +S
Sbjct  97   LFVHQGEARVGNIYRDELAERSLKEGDVYTIPAGSAFYLENSNENQRLRIICSIGI--SS  154

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G +   FQSFFIGGG H TS+LAGFD  TLSTALNVS+ E+   +  + SGPIV L+
Sbjct  155  ESMGWN--PFQSFFIGGGAH-TSILAGFDHTTLSTALNVSIAELKTFLTRQTSGPIVHLS  211

Query  169  NSNY---------TAP--ILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            NS             P   LAHLKRIV++ + E   +   + W  +RK L N
Sbjct  212  NSQQLNIWSKFLAQEPHQKLAHLKRIVNFGE-ESNPKEEVSTWS-LRKFLFN  261



>ref|XP_011089873.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=484

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 155/228 (68%), Gaps = 24/228 (11%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L ++K VVRT++G ++VV G     GR     MHIGFITMEP++L IPQYLDS L+LF
Sbjct  47   FLLQDSKHVVRTDAGDMRVVSG---FGGRFVKSPMHIGFITMEPKTLFIPQYLDSSLILF  103

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GEAR+GH+YKD+L ER+++ GD+Y IEAGSAFY+ NT EGQRLHI+CSI   DTS  
Sbjct  104  VRRGEARVGHIYKDELVERRLRMGDIYRIEAGSAFYLMNTGEGQRLHIVCSI---DTSQS  160

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G    TFQSF+I GG +P+SVLAGFD  TL+TA NV+  E+ +++  +++GPIV L+++
Sbjct  161  LGFQ--TFQSFYIAGGTYPSSVLAGFDHLTLATAFNVTEAELGEMLTRQMNGPIVYLSDT  218

Query  163  NYTA-----------PILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLL  53
            +  +             LAH++RIV   + + +       W F RK L
Sbjct  219  HSPSVWSKFLDMEQNQKLAHMRRIVRIREEDLEADEEQPTWSF-RKFL  265



>ref|XP_004242091.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=460

 Score =   209 bits (532),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 117/234 (50%), Positives = 159/234 (68%), Gaps = 25/234 (11%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS L+
Sbjct  40   EKWFLLRQLHNVVKTDAGSMRMVKGGYRAGSFLHSPMHIGFISMEPNSLFIPQYLDSDLL  99

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++QGEARIG+++KD+LAER +K GD+YTI AGSAFY+EN+ E QRL IICSI I  +S
Sbjct  100  LFVHQGEARIGNIHKDELAERSLKQGDVYTIPAGSAFYLENSNENQRLRIICSIGI--SS  157

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G +   FQS+FIGGG+H TS+LAGFD  TLSTALNVS  E+   +  + SGPIV L+
Sbjct  158  ESMGWN--AFQSYFIGGGVH-TSILAGFDHTTLSTALNVSTAELKTFLTRQTSGPIVHLS  214

Query  169  NSNYTA-----------PILAHLKRIVHYSDVE--QQQQHYWAPWLFMRKLLTN  47
            NS+                LAHLKRIV++ +    ++++  W+    +RK L N
Sbjct  215  NSHQLNIWFKFLAQEPHQKLAHLKRIVNFREESNHKEEESTWS----LRKFLFN  264



>ref|XP_004251255.1| PREDICTED: beta-conglycinin, beta chain-like [Solanum lycopersicum]
Length=511

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 155/245 (63%), Gaps = 36/245 (15%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRL------MHIGFITMEPQSLLIPQYLDSHL  533
            +F+L+++KE+VRT++GV++VV       G +      MHIGFITMEP +L IPQY+++ L
Sbjct  37   LFLLHDSKEIVRTDAGVMRVVSKGGFGGGGVSIFQSPMHIGFITMEPNTLFIPQYMNAQL  96

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
             LF+ +GE RIGH+YKD   ER++K GD+Y+I AGSAFY+ N AEGQRLHIICSI     
Sbjct  97   TLFVRRGETRIGHIYKDDFTERRLKEGDIYSIRAGSAFYLVNPAEGQRLHIICSI-----  151

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+      Y FQSFFIGGG++PTS+L+GFD  TLSTA NVS  E+S+++  ++SG IV L
Sbjct  152  SNSNNLGLYGFQSFFIGGGIYPTSILSGFDTLTLSTAFNVSSEEVSEILTRQLSGAIVPL  211

Query  172  TNSNYTAPIL-------------AHLKRIVHYSDVE--------QQQQHYWAPWLFMRKL  56
              +    P +              HLKR+VH  +          ++QQ  W+    +RK 
Sbjct  212  NTTQSPTPSIWANFLNLEQHQRHDHLKRVVHLEEEASSEEEDEGREQQPTWS----LRKF  267

Query  55   LTNHY  41
            + N +
Sbjct  268  MINLF  272



>ref|XP_006365740.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=474

 Score =   206 bits (525),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 114/234 (49%), Positives = 154/234 (66%), Gaps = 24/234 (10%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS+L+
Sbjct  37   EKWFLLRQLHNVVQTDAGSMRMVKGGYRRDSFLHSPMHIGFISMEPNSLFIPQYLDSNLI  96

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GH+Y  +L ER +K GD+YTI AGSAFY+EN  E QRL I CSI+I  TS
Sbjct  97   LFVHHGEARVGHIYSGELVERHLKHGDVYTIPAGSAFYLENRLENQRLRITCSIDI--TS  154

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG HP SVLAGFD  TL+TALNVS  E+   +  + SGPIV + 
Sbjct  155  ESMG--WHAFQSFFIGGGTHPASVLAGFDHNTLATALNVSPEELHTFMTRQTSGPIVHIP  212

Query  169  NSNYT-----------APILAHLKRIVHYSD--VEQQQQHYWAPWLFMRKLLTN  47
             S++            A  LAHLKRIV++ +    ++++  W+    +RK L N
Sbjct  213  GSHHKNMWSEFLAQEPAQKLAHLKRIVNFGEEASPKEEKSTWS----LRKFLFN  262



>emb|CDP08920.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 153/229 (67%), Gaps = 23/229 (10%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGR-LMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L E+ +VVRT++G ++V+R       R  M +G ITMEP SL IPQYLDS+L+LF+ +
Sbjct  58   FLLRESLDVVRTDAGHMRVIRNGGHRLWRSPMQMGLITMEPNSLFIPQYLDSNLILFVRR  117

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRG-  338
            GEARIGHVYKD  AER +K+GD+YTI +GSAFY+ N AEGQ+L+IICSI   +TS+  G 
Sbjct  118  GEARIGHVYKDDFAERHLKTGDLYTIASGSAFYLVNAAEGQKLYIICSI---ETSENYGW  174

Query  337  -ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
                + F+SFF+GGG +PTS+L+GFDP T+STA NVS+ E+      +  GPIV L++S 
Sbjct  175  HWHQHGFRSFFVGGGTNPTSILSGFDPLTMSTAFNVSVDELRDFTTRQHLGPIVYLSDSR  234

Query  160  YTAPI-------------LAHLKRIVHYSDVEQQQQHYWAPWLFMRKLL  53
              AP              LAHLKR+VH ++ E  Q      W F RKLL
Sbjct  235  --APSMWSKFLDLKEHQRLAHLKRVVH-AEEEANQDEEQPTWSF-RKLL  279



>emb|CBI16272.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 136/196 (69%), Gaps = 19/196 (10%)
 Frame = -2

Query  601  MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSA  422
            MHIGFITMEP+SL +PQYLDS L+LFI +GEA++G +Y D+L E+++K GD+YTI AGSA
Sbjct  1    MHIGFITMEPKSLFVPQYLDSSLILFIRRGEAKVGSIYNDELVEKQLKIGDLYTIPAGSA  60

Query  421  FYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTA  242
            FY+ NT EGQRLHIICSI++ ++  M      TFQSFF+GGG HPTS+L GF P TLSTA
Sbjct  61   FYLVNTGEGQRLHIICSIDMSESLKMD-----TFQSFFLGGGTHPTSILTGFAPETLSTA  115

Query  241  LNVSMVEISKLVGTKVSGPIVSLTNSNY-----------TAPILAHLKRIVHYSDVEQQQ  95
             N+SM E+ +++  +  GPI+ + +S             T   + HLKRI+ + DVE +Q
Sbjct  116  FNISMSELEEIMTRQEGGPIIYIKDSQQPSTWAKFLEMKTQDKVKHLKRIMGF-DVETEQ  174

Query  94   QHYWAPWLFMRKLLTN  47
            +H    W   RKLL +
Sbjct  175  KH--GTWWSWRKLLNS  188



>ref|XP_002526353.1| nutrient reservoir, putative [Ricinus communis]
 gb|EEF36024.1| nutrient reservoir, putative [Ricinus communis]
Length=463

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 156/225 (69%), Gaps = 30/225 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L ++K VV+T++G ++VV+   +  GR+    MHIGFITMEP+SL IPQYLDS+L++F
Sbjct  48   FLLQDSKHVVKTDAGDMRVVK---NFGGRILERPMHIGFITMEPKSLFIPQYLDSNLIIF  104

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I++GEA+IG +YK +LAER++K GD+Y I AGSAFY+ NT EGQRLH++CSI   D S+ 
Sbjct  105  ISRGEAKIGLIYKSELAERRLKMGDIYRIPAGSAFYLVNTGEGQRLHVVCSI---DPSE-  160

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G      QSFFIGGG +PTS+LAGF+P TL+TA N++M E+ +L   +  GPI+ L +S
Sbjct  161  -GLGLGAVQSFFIGGGTYPTSILAGFEPETLATAFNITMEEVRELTSRQSDGPIIYLEDS  219

Query  163  NYTAP-------------ILAHLKRIVHYSD--VEQQQQHYWAPW  74
               AP              L H+KR++ + +  +E++++  WA W
Sbjct  220  R--APRIWTKYFQMKEKERLKHMKRMMDFQNEPMEEEERTSWA-W  261



>ref|XP_006424635.1| hypothetical protein CICLE_v10028266mg [Citrus clementina]
 ref|XP_006488647.1| PREDICTED: sucrose-binding protein-like [Citrus sinensis]
 gb|ESR37875.1| hypothetical protein CICLE_v10028266mg [Citrus clementina]
Length=496

 Score =   205 bits (522),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/231 (47%), Positives = 154/231 (67%), Gaps = 25/231 (11%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRLM----HIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L +++ VV+TE+G ++VVR   S  GR++    H+GFITMEP+SL +PQY+DS L++F
Sbjct  58   FVLQDSRRVVQTEAGEMRVVR---SPGGRILDRQLHMGFITMEPKSLFVPQYIDSSLIIF  114

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I +GEA++G++YKD LAER +K+GD+Y I AGSAFY+ NT EGQRLHIICSI+  ++  +
Sbjct  115  IRRGEAKVGNIYKDDLAERTLKTGDIYRISAGSAFYIVNTGEGQRLHIICSIDPAESLGL  174

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
            R      FQSFFI GG  PTS+L+GF   TLS A NVS  E+ +++ ++  GPIV L++S
Sbjct  175  R-----EFQSFFIAGGTDPTSILSGFGLETLSNAFNVSSEEVEEILSSQNQGPIVHLSDS  229

Query  163  NYTAPI------------LAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            +    +            L H+KR+V     EQ +      W + RKLLT+
Sbjct  230  HEPRSMWSKFLQLKEQERLRHMKRMVEPHPREQDEDGEEIKWSW-RKLLTS  279



>ref|XP_004242092.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=481

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 159/243 (65%), Gaps = 25/243 (10%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL---MHIGFITMEPQSLLIPQYLDSHLV  530
            +K F+L +   VV+T++G +++V+G       L   MHIGFI+MEP SL IPQYLDS+L+
Sbjct  37   EKWFVLRQLHNVVQTDAGSMRMVKGGYRRDSFLHSPMHIGFISMEPTSLFIPQYLDSNLI  96

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF++ GEAR+GH++  +L ER +K GD+YTI AGSAFY+EN  E QRL IICSI+I  TS
Sbjct  97   LFVHHGEARVGHIHSGELVERHLKHGDVYTIPAGSAFYLENRLENQRLRIICSIDI--TS  154

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQSFFIGGG H  SVLAGFD  TL+TALNVS  E+   +  + SGPIV ++
Sbjct  155  ESMG--WHAFQSFFIGGGTHTVSVLAGFDHNTLATALNVSPEELQTFLTRQTSGPIVHIS  212

Query  169  NSNYTA-----------PILAHLKRIVHYSD--VEQQQQHYWAPWLFM-----RKLLTNH  44
             S++               LAHLKRIV++ +    ++++  W+   F+     RK + NH
Sbjct  213  GSHHKNMWSEFLAQEPHQKLAHLKRIVNFGEEASPKEEKSTWSLRKFLLNLVNRKNVINH  272

Query  43   YYY  35
            +++
Sbjct  273  HHH  275



>gb|KHG30193.1| Vicilin-like antimicrobial peptides 2-2 [Gossypium arboreum]
Length=490

 Score =   202 bits (513),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 151/224 (67%), Gaps = 28/224 (13%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            K  F++ +++ V+ T++G +++VR   S  GR+    +H+GFITMEPQSL IPQYLDS L
Sbjct  55   KSWFLMPKSRPVMTTDAGEMRMVR---SPGGRIVDKPLHMGFITMEPQSLFIPQYLDSSL  111

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +LF+  GEAR+G +YKD++ ER++K GD+Y I AGS FY+ N  EGQRLHIICSI+  ++
Sbjct  112  ILFVRTGEARVGCIYKDEMVERRLKIGDVYHIPAGSTFYILNPGEGQRLHIICSIDPSES  171

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
             ++      TFQSFFIGGG HPTSVLAGF P TLSTA NVSM ++ +++  +  GPIV +
Sbjct  172  LNLD-----TFQSFFIGGGTHPTSVLAGFGPETLSTAFNVSMSKLEEIMRGQQEGPIVHV  226

Query  172  TNSNYTAPI-------------LAHLKRIVH-YSDVEQQQQHYW  83
            T S+  AP              L  +KR+V   +D E+++  +W
Sbjct  227  TKSH--APSIWTKLSQLQEQDRLKQVKRMVQGEADEEEKEWSWW  268



>gb|AAC15238.1| globulin-like protein [Daucus carota]
 gb|AAC18404.1| globulin-like protein [Daucus carota]
Length=481

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 146/205 (71%), Gaps = 10/205 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            +K+FIL+++ EVV++E+G +KVV+G T     + MHIGFI MEP+SL  PQYLDS+L+LF
Sbjct  32   RKLFILHDSVEVVKSEAGGMKVVKGITGKFVDKPMHIGFIYMEPKSLFDPQYLDSNLILF  91

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I +GEA++G +  DKL E+ +K+GD+YTI+AGS FY+ENT EGQRL IICSI   DTS+ 
Sbjct  92   IRRGEAKVGSIRNDKLVEQDLKTGDIYTIDAGSVFYIENTGEGQRLQIICSI---DTSE-  147

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
                 + FQSFFIGGG +P+S+LAGFD  TLSTA NVS+ E+ + +  + SG IV ++  
Sbjct  148  -SLTWHAFQSFFIGGGRNPSSILAGFDKETLSTAFNVSVSELEEFLSPEPSGAIVYISPE  206

Query  163  NYTAPILAHLKRIVHYSDVEQQQQH  89
            + +  +  H   + H+    Q++ H
Sbjct  207  SKSPNLWTHFINLEHH----QKKAH  227



>ref|XP_009593305.1| PREDICTED: beta-conglycinin, beta chain-like [Nicotiana tomentosiformis]
Length=593

 Score =   202 bits (515),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 122/240 (51%), Positives = 157/240 (65%), Gaps = 32/240 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L+++KE+VRT++GV++VVRG       +    MHIGFITME  SL IPQYLDSHL LF
Sbjct  129  FLLHDSKEIVRTDAGVMRVVRGGFGGGISMFQSPMHIGFITMELNSLFIPQYLDSHLTLF  188

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GE RIGH+YKD   ER++K GD+Y+I AGSAFY+ N AEGQRLHIICSI+   +   
Sbjct  189  VRRGETRIGHIYKDDFTERRLKEGDVYSIRAGSAFYLVNPAEGQRLHIICSISTSSSLGW  248

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G     FQSFFIGGGM+PTSVLAGFD  TLSTA NVS  E+S+++  + SG IV L  +
Sbjct  249  LG-----FQSFFIGGGMYPTSVLAGFDTLTLSTAFNVSTAEVSEILTRQYSGAIVYLNTT  303

Query  163  NYTAPI-------------LAHLKRIVH------YSDVEQQQQHYWAPWLFMRKLLTNHY  41
            +   P              L HLKRIVH        + E+++Q  W+    +RK LTN +
Sbjct  304  HSPTPSIWATFLNLEQHQKLEHLKRIVHLEEEASQEEEEEKEQPIWS----LRKFLTNLF  359



>ref|XP_009783254.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=511

 Score =   198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 121/238 (51%), Positives = 156/238 (66%), Gaps = 32/238 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L+++KE+VRT++G+++VVRG       +    MHIG ITMEP SL IPQYLDSHL LF
Sbjct  46   FLLHDSKEIVRTDAGIMRVVRGGFGGGVSMFQSPMHIGLITMEPNSLFIPQYLDSHLTLF  105

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GE RIGH+YKD   ER++K GD+Y+I AGSAFY+ N AEGQRLHIICSI+   +   
Sbjct  106  VRRGETRIGHIYKDDFVERRLKEGDVYSIRAGSAFYLVNPAEGQRLHIICSISTSSSLGW  165

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G     FQSFFIGGGM+PTSVLAGFD  TLSTA NVS  E+S+++  + SG IV L  +
Sbjct  166  HG-----FQSFFIGGGMYPTSVLAGFDSLTLSTAFNVSTDEVSEILTRQYSGAIVYLNTT  220

Query  163  NYTAPI-------------LAHLKRIVH------YSDVEQQQQHYWAPWLFMRKLLTN  47
            +   P              L HLKRIVH        + E+++Q  W+    +RK LTN
Sbjct  221  HSPTPSIWATFLNLEQHQKLDHLKRIVHLEEEASQEEDEEKEQPIWS----LRKFLTN  274



>gb|AAT40548.1| Putative vicilin, identical [Solanum demissum]
Length=535

 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 116/271 (43%), Positives = 161/271 (59%), Gaps = 62/271 (23%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVV-RGSTSTSG-----RLMHIGFITMEPQSLLIPQYLDSHL  533
            +F+L+++KE+VRT++GV++VV +G  S  G       MHIGFITMEP +L IPQY+++HL
Sbjct  35   LFLLHDSKEIVRTDAGVMRVVSKGGFSGGGVSIFQSPMHIGFITMEPNTLFIPQYINAHL  94

Query  532  VLFINQG--------------------------EARIGHVYKDKLAERKVKSGDMYTIEA  431
             L + +G                          E RIGH+YKD   ER++K GD+Y+I A
Sbjct  95   TLLVRRGVELVDYLNFQLEVHPEPLVFHFLIPGETRIGHIYKDDFTERRLKEGDVYSIRA  154

Query  430  GSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTL  251
            GSAFY+ N AEGQRLHIICSI+  +T  +     Y FQSFFIGGG++PTS+L+GFD  TL
Sbjct  155  GSAFYLVNPAEGQRLHIICSISNSNTLGL-----YGFQSFFIGGGIYPTSILSGFDSLTL  209

Query  250  STALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPIL-------------AHLKRIVHY--  116
            STA NVS  E+S+++  ++SG IV L  +    P +              HLKR+VH   
Sbjct  210  STAFNVSSEEVSEILTRQLSGAIVPLNTTQSPTPSIWANFLNLEQHQRHDHLKRVVHLEE  269

Query  115  ------SDVEQQQQHYWAPWLFMRKLLTNHY  41
                   D E++QQ  W+    +RKL+ N +
Sbjct  270  EASFEEEDEEREQQPTWS----LRKLMNNLF  296



>ref|XP_008782665.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Phoenix dactylifera]
Length=483

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 149/238 (63%), Gaps = 26/238 (11%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL--MHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            F+L E++EVV+ E G ++VVRG     GR   MHIGFITMEP++L IPQYLDS L+LF++
Sbjct  49   FVLEESEEVVKAEGGEVRVVRG-FGIGGRPAPMHIGFITMEPKTLFIPQYLDSSLILFVH  107

Query  517  QGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRG  338
            +GEARIG +Y+D + ER++K GD+  I AGS FY+ NT +GQRL IICSI   DTS+  G
Sbjct  108  KGEARIGWIYEDNMVERRLKMGDIIHIAAGSTFYMVNTGKGQRLQIICSI---DTSESLG  164

Query  337  ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV-----SL  173
               Y  QSFFIGGG +P+SVLAGFD  TL+ A NV+  E+  ++G ++ GPI+     + 
Sbjct  165  LGPY--QSFFIGGGTYPSSVLAGFDIETLTAAFNVTTEEMDTILGARIRGPIIFYSDRAA  222

Query  172  TNSNYTAPIL----AHLKRIVHYSD---------VEQQQQHYWAPWLFMRKLLTNHYY  38
              S   A  +     H K  + ++D         V+Q++   W    F+  LL   +Y
Sbjct  223  DQSRLLASCMQWKQVHKKGSLDFNDVADDEGGGEVQQEENKRWTLRNFLANLLGGQFY  280



>ref|XP_010034297.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Eucalyptus 
grandis]
Length=477

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/212 (47%), Positives = 143/212 (67%), Gaps = 25/212 (12%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            +  F+L++++ V++TE+G +KVVR   S  GR+    MHIGFITMEPQ+L +PQYLDS+L
Sbjct  34   EDFFLLHDSEHVIQTEAGEMKVVR---SFGGRIVDRPMHIGFITMEPQTLFLPQYLDSNL  90

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +LF+ +GEA IG +  D+L ER++K GD+Y + AGSAFY+ N  EGQRLHII SI+  ++
Sbjct  91   ILFVRRGEATIGAILNDELVERRLKIGDIYRVPAGSAFYLVNIGEGQRLHIITSIDTSES  150

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
              +R     TFQSFFIGGG +PTSVL GF+P TL+TA NVS+ E++ ++  +  GPI+ +
Sbjct  151  LGLR-----TFQSFFIGGGSYPTSVLTGFEPKTLATAFNVSIDEVTDILTRQQEGPIMYI  205

Query  172  TNSNYTAPI-------------LAHLKRIVHY  116
             +     P              L HLK++V +
Sbjct  206  NDDTRQPPSLWSKFLQLKEQDRLQHLKKMVEF  237



>ref|XP_010104126.1| Vicilin-like antimicrobial peptides 2-2 [Morus notabilis]
 gb|EXB98567.1| Vicilin-like antimicrobial peptides 2-2 [Morus notabilis]
Length=497

 Score =   195 bits (495),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/238 (45%), Positives = 157/238 (66%), Gaps = 38/238 (16%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L ++K VV+T++G ++VV+   S  GR     M IGFI MEP++L +PQYLDS L++F
Sbjct  63   FLLKDSKHVVKTDAGEMRVVK---SFGGRFVQGPMRIGFIMMEPKTLFVPQYLDSSLIIF  119

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I +GEA++G +YKD+LAER++K GD+Y I AGSAFY+ NT EGQRLHIICSI   DTS+ 
Sbjct  120  IRRGEAKLGFIYKDQLAERRLKIGDVYRIPAGSAFYLVNTGEGQRLHIICSI---DTSE-  175

Query  343  RGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              + T+ +FQSFF+GGG++PTSVL+GFD   L  A NV+  E+ + + ++  GPIV +++
Sbjct  176  --SLTFGSFQSFFVGGGINPTSVLSGFDSEILENAFNVTHAELKEFLTSQQEGPIVYISD  233

Query  166  SN-----------YTAPILAHLKRIVHYSDV---------EQQQQHYWAPWLFMRKLL  53
            S              +  L HLK++V + D          E++++  W+ W   RKLL
Sbjct  234  SRSPKLWSKFLELKESEKLEHLKKMVGFDDEEEEEEYSGGEKKEEEIWS-W---RKLL  287



>ref|XP_004309885.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Fragaria 
vesca subsp. vesca]
Length=561

 Score =   196 bits (498),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 152/235 (65%), Gaps = 32/235 (14%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L  +K+VV+T++G ++VV+   S  GR+    MHIGFITMEP+SL +PQY+DS L+ F
Sbjct  56   FLLGNSKQVVKTKAGEMRVVK---SVGGRIVDKPMHIGFITMEPKSLFVPQYMDSSLIFF  112

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            +  GEA++G +YKD+L ER++++GD+Y I AGS FY+ NT EGQRLHIICS   VDTS+ 
Sbjct  113  VRSGEAKVGLIYKDELGERRLRAGDVYRIPAGSPFYLVNTGEGQRLHIICS---VDTSES  169

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G    T QSF+IGGG +P SVLAGFD   L +A NV+  E+S  +  +  GPIV +T+S
Sbjct  170  LGMG--TLQSFYIGGGYNPASVLAGFDQEILESAFNVTSTELSDFLSRQQDGPIVYVTDS  227

Query  163  NYTAPI------------LAHLKRIVHYSD----VEQQQQHYWAPWLFMRKLLTN  47
             +   +            L  +KR+V Y++     E +Q   W+ W   RKLL +
Sbjct  228  PHPPSLWSKFLELKEPDRLQKMKRMVGYTEEPEHREDEQIQAWS-W---RKLLNS  278



>pir||T10443 probable major protein body membrane protein MP27 / major protein 
body protein MP32 precursor - cucurbit
 dbj|BAA06186.1| preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri]
Length=499

 Score =   194 bits (494),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 131/181 (72%), Gaps = 8/181 (4%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            K+ F+L ++K V+ TE+G ++V+R   S    R MHIGFITMEP+SL +PQYLDS L+LF
Sbjct  53   KEQFLLEDSKRVIETEAGEMRVIRSPASRILDRPMHIGFITMEPKSLFVPQYLDSSLILF  112

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GE ++G +YKD+LAER++K GD+Y I AGS FY+ N  EGQRL IICSI      D 
Sbjct  113  VRRGEVKVGLIYKDELAERRMKGGDVYRIPAGSVFYMVNVGEGQRLQIICSI------DK  166

Query  343  RGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              + +Y TFQSFFIGGG +P SVLAGFD  TL+TA NVS  E+ +++  +  GPIV +++
Sbjct  167  SESLSYGTFQSFFIGGGTYPVSVLAGFDQDTLATAFNVSYTELRRILSRQRQGPIVYVSD  226

Query  166  S  164
            +
Sbjct  227  T  227



>ref|XP_009416713.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   194 bits (492),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 146/222 (66%), Gaps = 17/222 (8%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL-------MHIGFITMEPQSLLIPQYLDSHL  533
            F L ++++VV+TE G ++VVRG  S+S          MHIGFI MEP++L IPQYLDS L
Sbjct  47   FKLEKSEQVVKTEGGEVRVVRGFGSSSKWGGGGPVSPMHIGFIFMEPKTLFIPQYLDSSL  106

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +LF+++G+ R+G +YKD LAER++K GD+  I AGS FY+ N  EGQRL IICSI+  D+
Sbjct  107  ILFVHRGDVRVGWIYKDGLAERQLKMGDIIHIPAGSTFYMVNAGEGQRLQIICSIDTSDS  166

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
             D        +QSFFIGGGM+PTSV+AGFD  TLSTA NV+  E+  ++G++  GPIV L
Sbjct  167  MDFS-----PYQSFFIGGGMYPTSVVAGFDMGTLSTAFNVTEEEVQAILGSQTGGPIVLL  221

Query  172  TNSNYTAPILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            T            K ++ + D E+++  +W  W   RKLLT 
Sbjct  222  TGEAAERIDRRRRKGLLEFHD-EEEEDGWWT-W---RKLLTG  258



>ref|XP_007015475.1| RmlC-like cupins superfamily protein, putative [Theobroma cacao]
 gb|EOY33094.1| RmlC-like cupins superfamily protein, putative [Theobroma cacao]
Length=491

 Score =   194 bits (493),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 144/210 (69%), Gaps = 27/210 (13%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            ++ F+  ++K V++T++G ++VV+   S  GR+    +HIGFITMEP++L IPQYLDS L
Sbjct  50   EEWFLFPDSKPVMKTDAGEMRVVK---SLGGRIIEKPLHIGFITMEPKTLFIPQYLDSSL  106

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +LF+ +GEAR+G +Y D++ ER++K GD+Y I AGS FY+ N  EGQRLHIICSI+  ++
Sbjct  107  ILFVRRGEARVGCIYNDQMVERRMKIGDVYHIPAGSTFYILNPGEGQRLHIICSIDPSES  166

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S +      TFQSFFIGGG +PTS+LAGF P TLSTA NVS+ +++ ++  +  GPIV L
Sbjct  167  SQLG-----TFQSFFIGGGTYPTSILAGFGPETLSTAFNVSVSKLTGILSQQQEGPIVYL  221

Query  172  TNSNYTAPI-------------LAHLKRIV  122
            T S   AP              L HLK+++
Sbjct  222  TESR--APSIWTKFSQLQEQDRLKHLKKLI  249



>ref|XP_011025519.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Populus euphratica]
Length=486

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 149/235 (63%), Gaps = 25/235 (11%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +++  +L ++K VV+T++G ++V++        R MHIGFITMEP+SL +PQY+DS L+L
Sbjct  44   EEEWLLLQDSKRVVKTDAGDVRVLKNYGGRIIDRPMHIGFITMEPRSLFVPQYIDSSLIL  103

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            FI  GEA++G +YKD+LAER++K GD+Y I AGSAFY+ N  EGQRLHIICSI   D S+
Sbjct  104  FIRTGEAKVGLIYKDELAERRLKIGDIYRIPAGSAFYLMNAEEGQRLHIICSI---DPSE  160

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              G     FQSFFIGGG +P S+LAGF+  TLS A NV+  E+ +++  +  GPIV + +
Sbjct  161  SLGLG--FFQSFFIGGGTYPPSILAGFELETLSNAFNVTTDEVREIMTRQQEGPIVFIGD  218

Query  166  SNYTAPI-------------LAHLKRIVHYSDVEQ--QQQHYWAPWLFMRKLLTN  47
            S    P              L HLKR V +       ++Q  W+ W   RKLL +
Sbjct  219  SRAPRPSLWTKFLQLKEQDRLQHLKRTVKFQQQPSPGEEQRTWS-W---RKLLNS  269



>ref|XP_010521773.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Tarenaya 
hassleriana]
Length=501

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/236 (45%), Positives = 148/236 (63%), Gaps = 35/236 (15%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+RTE+G ++VV    S  GR+    MHIGF+TMEPQSL +PQYLDS L++F
Sbjct  66   FLMRESRQVIRTEAGDMRVV---LSPRGRIIEKPMHIGFLTMEPQSLFVPQYLDSSLLIF  122

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GEAR+G + +D+  E+++K+GD+Y I AGS FY+ NT  GQRLH+ICSI+  D+  +
Sbjct  123  VRRGEARLGVMCEDEFGEKRLKAGDIYWIPAGSVFYLVNTGIGQRLHVICSIDPADSLGL  182

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
                  TFQSF+IGGG HP S+L+GFD  TL+TA NVS  E+ +++  +V GPIV +   
Sbjct  183  E-----TFQSFYIGGGAHPPSILSGFDIDTLATAFNVSGAELRQMLTGQVGGPIVHIAGG  237

Query  163  NYTAPIL-------------AHLKRIVHYSD------VEQQQQHYWAPWLFMRKLL  53
               AP L              HLKRI   S        E ++   W  W   RKLL
Sbjct  238  E-RAPALWTKFLELRDEEKHMHLKRISGMSRESSSGYRETEEHSGWMSW---RKLL  289



>ref|XP_010253553.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nelumbo nucifera]
Length=484

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 147/228 (64%), Gaps = 18/228 (8%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            +F+L  +K+VV+TE+G ++VVRG         MHIGFITMEP++L +PQY+DS L+ F+ 
Sbjct  44   IFLLQHSKQVVKTEAGEMRVVRGFRIKGVENPMHIGFITMEPKTLFVPQYIDSGLIFFVR  103

Query  517  QGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRG  338
            +G A+IG VYKD+L ER++K GD+Y I AGSAFY+ N  + Q L IICSI+  + S  RG
Sbjct  104  RGNAKIGSVYKDELVERELKHGDIYRIPAGSAFYMVNVHDRQNLEIICSIDSTE-SIGRG  162

Query  337  ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNY  158
                 FQSFFIGGG +P SVL+GFDP TL+TA NVS  E+ +L+  +  GPI+ + ++  
Sbjct  163  P----FQSFFIGGGSYPASVLSGFDPRTLATAFNVSSSELKELMTRQQGGPIIYVQDTQD  218

Query  157  TA-----------PILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
            T+             L   KR+    D +Q++Q     W + RKLLT+
Sbjct  219  TSRWASIMKLKQQERLEQQKRMGEDDDADQEEQVEEETWTW-RKLLTS  265



>ref|XP_002313331.2| hypothetical protein POPTR_0009s05950g [Populus trichocarpa]
 gb|EEE87286.2| hypothetical protein POPTR_0009s05950g [Populus trichocarpa]
Length=486

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/235 (46%), Positives = 149/235 (63%), Gaps = 25/235 (11%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +++  +L ++K VV+T++G + V+R        R MHIGFITMEP++L +PQY+DS L+L
Sbjct  44   EEEWLLLQDSKRVVKTDAGEMMVLRNYGGRIIDRPMHIGFITMEPRTLFVPQYIDSSLIL  103

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            FI  GEA++G +YKD+LAER++K GD+Y I AGSAFY+ N  EGQRLHIICSI   D S+
Sbjct  104  FIRTGEAKVGLIYKDELAERRLKIGDIYRIPAGSAFYLMNAEEGQRLHIICSI---DPSE  160

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              G     FQSF+IGGG +P S+LAGF+  TLS A NV+  E+ +++  +  GPIV + +
Sbjct  161  SLGLG--FFQSFYIGGGTYPPSILAGFELETLSAAFNVTADEVREIMTRQQEGPIVFIGD  218

Query  166  SNYTAPI-------------LAHLKRIVHYSDVEQQ--QQHYWAPWLFMRKLLTN  47
            S    P              L HLKR+V +     Q  +Q  W+ W   RKLL +
Sbjct  219  SRAPRPSLWTKFLQLKEQDRLQHLKRMVKFQQQPSQGEEQRTWS-W---RKLLNS  269



>gb|ABK80758.1| 7S globulin precursor [Ficus pumila var. awkeotsang]
Length=497

 Score =   192 bits (487),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 151/235 (64%), Gaps = 35/235 (15%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F+L ++K VVRT++G +KVV+      GR     M IGFITMEP++L +PQYLDS  +LF
Sbjct  65   FLLKDSKHVVRTDAGEMKVVK---RIGGRFIQGPMRIGFITMEPKTLFVPQYLDSDFILF  121

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD-  347
            I +GEA++G +YKD+LAER++K GD+Y I AGS FY+ NT EGQRLH+ICSI   DTS+ 
Sbjct  122  IRRGEAKVGFIYKDQLAERRLKIGDVYRIPAGSVFYLVNTGEGQRLHVICSI---DTSES  178

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
            +R     +FQSFF+GGG +P S+++GFD   L  A NV+  E+ + + ++  GPIV +++
Sbjct  179  LRFG---SFQSFFVGGGTNPVSIISGFDSEILENAFNVTHAELREFLSSQQEGPIVYISD  235

Query  166  SN-----------YTAPILAHLKRIVHYSD------VEQQQQHYWAPWLFMRKLL  53
            S              +  L HLK+IV   +      +E+Q Q  W+ W   RK+L
Sbjct  236  SRSPRLWSKFLELKESEKLDHLKKIVDSEEESDDEKLEEQGQEVWS-W---RKML  286



>emb|CDY15753.1| BnaC04g15710D [Brassica napus]
Length=472

 Score =   191 bits (485),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/232 (45%), Positives = 151/232 (65%), Gaps = 31/232 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS L++F
Sbjct  50   FMMKESRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSSLLIF  106

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD+  E+++K GD+Y I AGSAFY+ NT  GQRLH+ICSI   D S  
Sbjct  107  IRQGEATLGVICKDEFGEKRLKGGDIYWIPAGSAFYLLNTGRGQRLHVICSI---DPSQS  163

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G +  TFQ F+IGGG  P+SVLAGFDP TL++ALNVS  E+ +L+ ++V GPIV +T  
Sbjct  164  LGFE--TFQPFYIGGG--PSSVLAGFDPDTLTSALNVSRPEVQQLMTSQVRGPIVHITEH  219

Query  163  NYTAPIL-------------AHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
               AP +              HLK+++       Q+Q Y  PW   + ++++
Sbjct  220  ---APTMWTEFLGLRGEEKHKHLKKLLEMKQGTSQEQEY-NPWWSWKNIVSS  267



>ref|XP_010689593.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Beta vulgaris 
subsp. vulgaris]
Length=588

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 140/197 (71%), Gaps = 13/197 (7%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            + +MF+L E+K+V+ TE+G ++VV+G     GRL    +HIGF+T+EP+SL +PQYLDS 
Sbjct  117  KGEMFLLKESKKVISTEAGEMRVVKG---YGGRLVERPLHIGFLTLEPRSLFVPQYLDSS  173

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L+LF+ +GEA++G +Y D+L ER+++ GD+Y I AGS FY+ NT E QRLHIICSI   D
Sbjct  174  LILFVRRGEAKVGLIYNDELGERELRMGDVYRIPAGSTFYIVNTGETQRLHIICSI---D  230

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
             S+  G    TFQSFF+GGG +P +V AGFDP TLSTA NVS+ E+  L+  + +GPIV 
Sbjct  231  PSE--GLGFGTFQSFFVGGGANPVTVFAGFDPQTLSTAFNVSIGELRDLMTGQDAGPIV-  287

Query  175  LTNSNYTAPILAHLKRI  125
              +  +T  + A+  ++
Sbjct  288  YADPTHTPSLWANFLKV  304



>ref|XP_009103693.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Brassica 
rapa]
Length=466

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 152/232 (66%), Gaps = 31/232 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS+L++F
Sbjct  44   FMMKESRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSNLLIF  100

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD+  E+++K GD+Y I AGSAFY+ NT  GQRLH+ICSI   D S  
Sbjct  101  IRQGEATLGVICKDEFGEKRLKGGDIYWIPAGSAFYLLNTGRGQRLHVICSI---DPSQS  157

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G +  TFQ F+IGGG  P+SVLAGFDP T+++ALNVS  E+ +L+ ++V GPIV +T  
Sbjct  158  LGFE--TFQPFYIGGG--PSSVLAGFDPDTITSALNVSRPEVQQLMTSQVRGPIVHITEH  213

Query  163  NYTAPIL-------------AHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
               AP +              HLK+++       Q+Q +  PW   + ++++
Sbjct  214  ---APTMWTDFLGLRGEEKHKHLKKLLEMKQGTSQEQEF-NPWWSWKNIVSS  261



>emb|CDY04569.1| BnaA07g13950D [Brassica napus]
Length=466

 Score =   187 bits (476),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 148/225 (66%), Gaps = 32/225 (14%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS+L++F
Sbjct  44   FMMKESRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSNLLIF  100

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD+  E+++K GD+Y I AGSAFY+ NT  GQRLH+ICSI   D S  
Sbjct  101  IRQGEATLGVICKDEFGEKRLKGGDIYWIPAGSAFYLLNTGRGQRLHVICSI---DPSQS  157

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G +  TFQ F+IGGG  P+SVLAGFDP T+++ALNVS  E+ +L+ ++V GPIV +T  
Sbjct  158  LGFE--TFQPFYIGGG--PSSVLAGFDPDTITSALNVSRPEVQQLMTSRVRGPIVHITEH  213

Query  163  NYTAPIL-------------AHLKRIVHYSD--VEQQQQHYWAPW  74
               AP +              HLK+++       ++Q+ + W  W
Sbjct  214  ---APTMWTDFLGLRGEEKHKHLKKLLEMKQGTSQEQEDNPWWSW  255



>ref|XP_008463915.1| PREDICTED: LOW QUALITY PROTEIN: globulin-1 S allele [Cucumis 
melo]
Length=544

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 151/226 (67%), Gaps = 16/226 (7%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +K+ F++ ++K+V+ TE+G ++V+RG  S    R MHIGFITMEP+SL +PQYLDS L+L
Sbjct  84   RKERFLMVDSKKVIETEAGEMRVMRGPASRILDRPMHIGFITMEPKSLFVPQYLDSTLIL  143

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +G+ ++G +YKD+LAER++K GD++ I AGS FY+ N  EGQRL IICSI      D
Sbjct  144  FVRRGDVKVGLIYKDELAERRMKGGDVFRIPAGSVFYMVNVGEGQRLEIICSI------D  197

Query  346  MRGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
               + +Y TFQSFF+ GG +P SVLAGFD  TL+TA NVS  E+ +++  +  GPIV ++
Sbjct  198  KSESLSYGTFQSFFVAGGKYPGSVLAGFDQDTLATAFNVSYTELRRILSRQRQGPIVYVS  257

Query  169  NSNYTAPILAHLK-----RIVHYSDVEQ--QQQHYWAPWLFMRKLL  53
            ++         L+     R+   +D+++  ++     PW + RKL+
Sbjct  258  DTESPRVWSKFLQVNDEARLSKVADIDEDGEKSEKNKPWSW-RKLV  302



>ref|XP_009338303.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Pyrus x bretschneideri]
Length=506

 Score =   187 bits (475),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 149/235 (63%), Gaps = 30/235 (13%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            ++  F+L EAK VV+T +G ++VV    S  GR     MHIGFITMEP+SL IPQYLDS+
Sbjct  64   REDRFLLPEAKHVVKTAAGEMRVV---MSALGRAVYKPMHIGFITMEPKSLFIPQYLDSN  120

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L+LF+ +GE ++G +YKD+L ER++K+GD+Y I AGS FY+ NT EGQR+HIICSI+I +
Sbjct  121  LILFVRRGEVKVGLIYKDELGERRLKAGDVYIIPAGSPFYLVNTGEGQRVHIICSIDISE  180

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            +  M        QSFFIGGG +P SV+AGFD   L+ A NV+  E+S++  ++  GPIV 
Sbjct  181  SLGM------GLQSFFIGGGSNPQSVIAGFDHEVLANAFNVTSSELSEMFTSQQQGPIVF  234

Query  175  LTNSNYTA--------PILAHLKRIVHYSDVEQQQQHY-----WAPWLFMRKLLT  50
            +  S+  +             L+ +    D++Q+  H+     W+ W   RKLL 
Sbjct  235  VPESHSPSVWSKFLRLKQQGRLQEMKSMFDIQQEDHHHGKSETWS-W---RKLLN  285



>ref|XP_007208640.1| hypothetical protein PRUPE_ppa020107mg [Prunus persica]
 gb|EMJ09839.1| hypothetical protein PRUPE_ppa020107mg [Prunus persica]
Length=534

 Score =   187 bits (475),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 153/234 (65%), Gaps = 24/234 (10%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTS-GRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            ++  ++L ++++VV+TE+G + VV         + MHIGFITMEP+SL IPQYLDS+LVL
Sbjct  61   KEDWYLLPQSRQVVKTEAGEMSVVMRVGGRVVDKPMHIGFITMEPKSLFIPQYLDSNLVL  120

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +GEA++G +Y+D+L ER++KSGD+Y I AGS FY+ NT EGQRLHIICS+   DTS+
Sbjct  121  FVRRGEAKVGLIYRDELGERRLKSGDVYRIPAGSPFYLVNTGEGQRLHIICSL---DTSE  177

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              G    + QSFFIGGG +P SVLAGFD   L+ A NVS  E+ +++ ++  GPIV L++
Sbjct  178  SLGLG--SVQSFFIGGGSNPQSVLAGFDHDILTNAFNVSSSELMEVLTSQQKGPIVYLSD  235

Query  166  S---NYTAPI--------LAHLKRIVHYS---DVEQQQQHYWAPWLFMRKLLTN  47
            S   N  A          L  +K++V +    D  Q Q   W+ W   RKLL +
Sbjct  236  SHSPNLWAKFLQLKEQDRLQEMKKMVDFQQEPDHHQDQTQTWS-W---RKLLNS  285



>ref|XP_004163383.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Cucumis 
sativus]
Length=511

 Score =   186 bits (473),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 132/181 (73%), Gaps = 8/181 (4%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            K+ F++ ++K+V+ TE+G ++V+RG  S    + MHIGFITMEP+SL +PQYLDS L+LF
Sbjct  43   KERFLMVDSKKVIETEAGEMRVMRGPISRILDKAMHIGFITMEPKSLFVPQYLDSTLILF  102

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +G+ ++G +YKD+LAER++K GD++ I AGS FY+ N  EGQRL IICSI      D 
Sbjct  103  VRRGDVKVGLIYKDELAERRMKGGDVFRIPAGSVFYMVNVGEGQRLEIICSI------DK  156

Query  343  RGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              + +Y TFQSFF+ GG +P SVLAGFD  TL+TA NVS  E+ +++  +  GPIV +++
Sbjct  157  SESLSYGTFQSFFVAGGKYPGSVLAGFDQDTLATAFNVSYTELRRILSRQRQGPIVYISD  216

Query  166  S  164
            +
Sbjct  217  T  217



>ref|XP_009358363.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Pyrus x bretschneideri]
Length=571

 Score =   187 bits (476),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 105/236 (44%), Positives = 150/236 (64%), Gaps = 32/236 (14%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            ++  F+L EAK VV+T +G ++VV    S  GR     MHIGFITMEP+SL IPQYLDS+
Sbjct  74   REDRFLLPEAKHVVKTAAGEMRVV---MSALGRAVYKPMHIGFITMEPKSLFIPQYLDSN  130

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L+LF+ +GE ++G +YKD+L ER++K+GD+Y I AGS FY+ NT EGQR+HIICSI+I +
Sbjct  131  LILFVRRGEVKVGLIYKDELGERRLKAGDVYIIPAGSPFYLVNTGEGQRVHIICSIDISE  190

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            +  M        QSFFIGGG +P SV+AGFD   L+ A NV+  E+S++  ++  GPIV 
Sbjct  191  SLGM------GLQSFFIGGGSNPQSVIAGFDHEVLANAFNVTSSELSEMFTSQQQGPIVF  244

Query  175  LTNSNYTAPILAHLKRIVHYS---------DVEQQQQHY-----WAPWLFMRKLLT  50
            +  S ++  + +   R+             D++Q+  H+     W+ W   RKLL 
Sbjct  245  VPES-HSPSVWSKFLRLKQQDRLQEMKSMFDIQQEDHHHGKSETWS-W---RKLLN  295



>gb|EPS66719.1| hypothetical protein M569_08055 [Genlisea aurea]
Length=472

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 143/232 (62%), Gaps = 18/232 (8%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSG--RLMHIGFITMEPQSLLIPQYLDSHLV  530
            + + F+L +A+ VVRTE+G +KVV G     G    +H+GFITMEP S  +PQYLDS L+
Sbjct  55   EGEEFLLRDAQRVVRTEAGEMKVVTGFGGGGGVRNPIHVGFITMEPSSFFVPQYLDSSLI  114

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LFI +GE  +GH+YKD+L ER +K+GD+Y I AGS FY+ N AEGQRLH++C I    TS
Sbjct  115  LFIRRGEVTVGHIYKDELVERNLKTGDVYRIAAGSTFYLINAAEGQRLHVVCGIT---TS  171

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G   + FQ F+IGGG +P SVL+GFDP TLSTA NVS  E+   +  +  GPIV  +
Sbjct  172  ESFG--WHPFQPFYIGGGRNPVSVLSGFDPLTLSTAFNVSEAELVDFLTMQEKGPIVYYS  229

Query  169  NS-NYTAPILAHLK----------RIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
             S + + P  A +K          R     D+ ++     + W  ++ LL +
Sbjct  230  ESESESRPWSAFVKMDKHRKLAELRTAAEDDIAEEILEDQSTWWSLKNLLNS  281



>ref|XP_004149563.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Cucumis 
sativus]
 gb|KGN47306.1| hypothetical protein Csa_6G290870 [Cucumis sativus]
Length=508

 Score =   186 bits (472),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 132/181 (73%), Gaps = 8/181 (4%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            K+ F++ ++K+V+ TE+G ++V+RG  S    + MHIGFITMEP+SL +PQYLDS L+LF
Sbjct  42   KERFLMVDSKKVIETEAGEMRVMRGPISRILDKAMHIGFITMEPKSLFVPQYLDSTLILF  101

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +G+ ++G +YKD+LAER++K GD++ I AGS FY+ N  EGQRL IICSI      D 
Sbjct  102  VRRGDVKVGLIYKDELAERRMKGGDVFRIPAGSVFYMVNVGEGQRLEIICSI------DK  155

Query  343  RGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              + +Y TFQSFF+ GG +P SVLAGFD  TL+TA NVS  E+ +++  +  GPIV +++
Sbjct  156  SESLSYGTFQSFFVAGGKYPGSVLAGFDQDTLATAFNVSYTELRRILSRQRQGPIVYISD  215

Query  166  S  164
            +
Sbjct  216  T  216



>ref|XP_008224564.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Prunus mume]
Length=531

 Score =   184 bits (468),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/234 (45%), Positives = 151/234 (65%), Gaps = 24/234 (10%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTS-GRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            ++  ++L  +++VV+TE+G + VV         + MHIGFITMEP+SL IPQYLDS+L L
Sbjct  70   KEDWYLLPHSRQVVKTEAGEMSVVMRVGGRVVDKPMHIGFITMEPKSLFIPQYLDSNLFL  129

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +GEA++G +Y+D+L ER++KSGD+Y I AGS FY+ NT EGQRLHIICS+   DTS+
Sbjct  130  FVRRGEAKVGLIYRDELGERRLKSGDVYRIPAGSPFYLVNTGEGQRLHIICSL---DTSE  186

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
              G    + QSFFIGGG++P SVLAGFD   L+ A NVS  E+ +++ ++  GPIV L++
Sbjct  187  SLGLG--SVQSFFIGGGINPQSVLAGFDHDILTNAFNVSSSELMEVLTSQQKGPIVYLSD  244

Query  166  SN-----------YTAPILAHLKRIVHYS---DVEQQQQHYWAPWLFMRKLLTN  47
            S+                L  +K++V +    D  Q Q   W+ W   RKLL +
Sbjct  245  SHSPNLWSKFLQLKEQDRLQEMKKMVDFQQEPDHHQDQTQTWS-W---RKLLNS  294



>ref|NP_180416.1| cupin domain-containing protein [Arabidopsis thaliana]
 gb|AAD21484.1| putative seed storage protein (vicilin-like) [Arabidopsis thaliana]
 gb|AAP40444.1| putative seed storage protein (vicilin) [Arabidopsis thaliana]
 gb|AEC08130.1| cupin domain-containing protein [Arabidopsis thaliana]
Length=511

 Score =   184 bits (466),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 144/229 (63%), Gaps = 29/229 (13%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            ++  F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS 
Sbjct  82   RRGWFMMRESRQVIKSEGGEMRVV---LSPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSS  138

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L++FI QGEA +G + KD+  ERK+K+GD+Y I AGS FY+ NT  GQRLH+ICSI   D
Sbjct  139  LLIFIRQGEATLGVICKDEFGERKLKAGDIYWIPAGSVFYLHNTGLGQRLHVICSI---D  195

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
             +   G +  TFQ F+IGGG  P+SVLAGFDP+TL++A NVS+ E+ +++ ++  GPIV 
Sbjct  196  PTQSLGFE--TFQPFYIGGG--PSSVLAGFDPHTLTSAFNVSLPELQQMMMSQFRGPIVY  251

Query  175  LTNSNYTAPILA---------------HLKRIVHYSDVEQQQQHYWAPW  74
            +T      P                   LK+++       Q Q Y + W
Sbjct  252  VTEGPQPQPQSTVWTQFLGLRGEEKHKQLKKLLETKQGSPQDQQYSSGW  300



>ref|XP_006295626.1| hypothetical protein CARUB_v10024739mg [Capsella rubella]
 gb|EOA28524.1| hypothetical protein CARUB_v10024739mg [Capsella rubella]
Length=501

 Score =   183 bits (465),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/225 (43%), Positives = 142/225 (63%), Gaps = 29/225 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS L++F
Sbjct  87   FMMRESRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSSLLIF  143

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD+  ER++K+GD+Y I AGS FY++N   GQRLH+ICSI   D +  
Sbjct  144  IRQGEATLGVICKDEFGERRLKAGDIYWIPAGSVFYLQNIGRGQRLHVICSI---DPTQS  200

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G +  TFQ F+IGGG  P+SVLAGFDP TL++ALNVS  E+ +++ ++  GPIV +T  
Sbjct  201  LGFE--TFQPFYIGGG--PSSVLAGFDPDTLTSALNVSRPELQQMMRSQFRGPIVHVTEG  256

Query  163  NYTAPILA---------------HLKRIVHYSDVEQQQQHYWAPW  74
                P                  +LK+++       Q Q Y + W
Sbjct  257  PRQGPQPTIWTQFLGLKGEEKQRYLKKLLEMKQGSPQDQQYSSGW  301



>ref|XP_010046432.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Eucalyptus 
grandis]
Length=445

 Score =   182 bits (462),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG--STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +K F+L + K VV T++G ++V+R   S  ++ R   IGFI MEP +L IPQY DS LVL
Sbjct  9    EKAFLLRDWKRVVHTDAGEMRVLRSFRSQRSAERSTRIGFINMEPSTLFIPQYTDSGLVL  68

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +GEAR+G +Y+++  ER ++ GD+Y I AGSAFY+ NT E ++L +ICSI I DTS+
Sbjct  69   FVRKGEARLGTIYRNEPVERSLRKGDVYRIPAGSAFYLVNTGESRKLRVICSIEI-DTSE  127

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
                 T  FQSFF+GGG +P S+L GFDP TL+TA NVS  E+ +++  ++ GPIV +++
Sbjct  128  -EDLPTRNFQSFFLGGGPNPASILTGFDPETLATAFNVSSGEVQEILSREIEGPIVHMSD  186

Query  166  S  164
            S
Sbjct  187  S  187



>gb|KCW85695.1| hypothetical protein EUGRSUZ_B02472 [Eucalyptus grandis]
Length=468

 Score =   182 bits (462),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG--STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +K F+L + K VV T++G ++V+R   S  ++ R   IGFI MEP +L IPQY DS LVL
Sbjct  57   EKAFLLRDWKRVVHTDAGEMRVLRSFRSQRSAERSTRIGFINMEPSTLFIPQYTDSGLVL  116

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +GEAR+G +Y+++  ER ++ GD+Y I AGSAFY+ NT E ++L +ICSI I DTS+
Sbjct  117  FVRKGEARLGTIYRNEPVERSLRKGDVYRIPAGSAFYLVNTGESRKLRVICSIEI-DTSE  175

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
                 T  FQSFF+GGG +P S+L GFDP TL+TA NVS  E+ +++  ++ GPIV +++
Sbjct  176  -EDLPTRNFQSFFLGGGPNPASILTGFDPETLATAFNVSSGEVQEILSREIEGPIVHMSD  234

Query  166  S  164
            S
Sbjct  235  S  235



>ref|XP_010510617.1| PREDICTED: provicilin-like [Camelina sativa]
Length=499

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/225 (44%), Positives = 145/225 (64%), Gaps = 29/225 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS L++F
Sbjct  84   FMMRESRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSSLLIF  140

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD+  ER++K+GD+Y I AGS FY+ NT  GQRLH+ICSI   D +  
Sbjct  141  IRQGEATLGVICKDEFGERRLKAGDIYWIPAGSVFYLHNTGRGQRLHVICSI---DPTQS  197

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL---  173
             G +  TFQ F+IGGG  P+SVLAGFDP TL++ALNVS  E+ +++ ++  GPIV +   
Sbjct  198  LGFE--TFQPFYIGGG--PSSVLAGFDPDTLTSALNVSRPELQRMMRSQFRGPIVHVMEG  253

Query  172  -----TNSNYTAPI-------LAHLKRIVHYSDVEQQQQHYWAPW  74
                   + +T  +        +HLK+++       Q Q Y + W
Sbjct  254  PEGPQPTTTWTQFLGLREEEKRSHLKKLLEMKQGSPQDQQYSSGW  298



>ref|XP_010414517.1| PREDICTED: provicilin-like [Camelina sativa]
Length=503

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/229 (43%), Positives = 147/229 (64%), Gaps = 29/229 (13%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            ++  F++ E+++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS 
Sbjct  73   RRGWFMMRESRKVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSS  129

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L++FI QGEA +G + KD+  ER++K+GD+Y I AGS FY+ NT  GQRLH+ICSI   D
Sbjct  130  LLIFIRQGEATLGVICKDEFGERRLKAGDIYWIPAGSVFYLHNTGRGQRLHVICSI---D  186

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
             +   G +  TFQ F+IGGG  P+SVLAGFDP TL++ALNVS  E+ +++ ++  GPIV 
Sbjct  187  PTQSLGFE--TFQPFYIGGG--PSSVLAGFDPDTLTSALNVSRPELQEMMRSQFRGPIVH  242

Query  175  L--------TNSNYTAPI-------LAHLKRIVHYSDVEQQQQHYWAPW  74
            +          + +T  +        +HLK+++       Q Q Y + W
Sbjct  243  VMEGPEGPQPTTTWTQFLGLREEEKRSHLKKLLEMKQGSPQDQQYSSGW  291



>gb|KCW85694.1| hypothetical protein EUGRSUZ_B02472 [Eucalyptus grandis]
Length=493

 Score =   182 bits (462),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG--STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            +K F+L + K VV T++G ++V+R   S  ++ R   IGFI MEP +L IPQY DS LVL
Sbjct  57   EKAFLLRDWKRVVHTDAGEMRVLRSFRSQRSAERSTRIGFINMEPSTLFIPQYTDSGLVL  116

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+ +GEAR+G +Y+++  ER ++ GD+Y I AGSAFY+ NT E ++L +ICSI I DTS+
Sbjct  117  FVRKGEARLGTIYRNEPVERSLRKGDVYRIPAGSAFYLVNTGESRKLRVICSIEI-DTSE  175

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
                 T  FQSFF+GGG +P S+L GFDP TL+TA NVS  E+ +++  ++ GPIV +++
Sbjct  176  -EDLPTRNFQSFFLGGGPNPASILTGFDPETLATAFNVSSGEVQEILSREIEGPIVHMSD  234

Query  166  S  164
            S
Sbjct  235  S  235



>ref|XP_009342359.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Pyrus x bretschneideri]
Length=538

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 128/177 (72%), Gaps = 7/177 (4%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTS-TSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L +AK+VV+T +G ++VV  + S    + MHIGFITMEP+SL IPQYLDS+L+LF+ +
Sbjct  91   FLLPQAKQVVKTAAGEMRVVMSARSRVVDKPMHIGFITMEPKSLFIPQYLDSNLILFLCR  150

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            GE ++G +YKD+L ER++K+GD+Y I AGS FY+ NT EGQR+HIICSI   DTS+  G 
Sbjct  151  GEVKVGLIYKDELGERRLKTGDVYRIPAGSPFYLVNTGEGQRVHIICSI---DTSESLG-  206

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
                 QSFFIGGG +P S++AGFD   L+ A NV+  E+ ++  ++  GPIV +  S
Sbjct  207  --MGLQSFFIGGGSNPQSIIAGFDREILANAFNVTSSELREMFTSQQQGPIVFVPES  261



>gb|ACD36978.1| Gly m Bd 28K allergen [Glycine max]
Length=455

 Score =   179 bits (455),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 140/205 (68%), Gaps = 14/205 (7%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            K +F+++ +  V +T++G ++V++   S  GR+    MHIGFI+MEP+SL +PQYLDS+L
Sbjct  25   KSLFLMSNSTRVFKTDAGEMRVLK---SHGGRIFYRHMHIGFISMEPKSLFVPQYLDSNL  81

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI   D 
Sbjct  82   IIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI---DP  138

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S   G +  TFQSF+IGGG +  SVL+GF+P  L TA N S   + ++   ++ GPI+ +
Sbjct  139  STSLGLE--TFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFV  196

Query  172  TNSNYTAPILAHLKRIVHYSDVEQQ  98
             +S+  AP L      +   D EQQ
Sbjct  197  DDSH--APSLWTKFLQLKKDDKEQQ  219



>ref|XP_008385385.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Malus domestica]
Length=545

 Score =   181 bits (459),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 143/228 (63%), Gaps = 23/228 (10%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTS-TSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L +AK+VV+T +G ++VV  + S    + MHIGFITMEP+SL IP YLDS+L LF+ +
Sbjct  75   FLLPQAKQVVKTAAGEMRVVMSARSRVVDKPMHIGFITMEPKSLFIPHYLDSNLXLFVRR  134

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            GE ++G +YKD+L ER++K+GD+Y I AGS FY+ NT EGQR+HIICSI   DTS+  G 
Sbjct  135  GEVKVGLIYKDELGERRLKTGDVYRIPAGSPFYLVNTGEGQRVHIICSI---DTSESLG-  190

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
                 QSFFIGGG +P S++AGFD   L+ A NV+  E+ ++  ++  GPIV +  S Y+
Sbjct  191  --MGLQSFFIGGGSNPQSIIAGFDHEILANAFNVTSSELREMFTSQQQGPIVFVPES-YS  247

Query  154  API------------LAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
              +            L  +KR+      + Q +     W   RKLL +
Sbjct  248  PSVWSKFLQLKQQDRLQEMKRMFDIQQXDHQDKSETWSW---RKLLNS  292



>ref|XP_003542001.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Glycine 
max]
 gb|KHN21538.1| Vicilin-like antimicrobial peptides 2-2 [Glycine soja]
Length=483

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 130/186 (70%), Gaps = 12/186 (6%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVRGSTSTSGRLM----HIGFITMEPQSLLIPQYLDSHLV  530
            K+F++ ++K V +T++G ++V+    S  GR++    +IGFI MEP+SL IPQY+DS L+
Sbjct  41   KLFMMLKSKRVAQTDAGEMRVLE---SYGGRILERRLNIGFINMEPRSLFIPQYIDSTLI  97

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            +F+  GEA++G +YKDKLAER +K GD+Y I AGSAFY+ N  E Q+LHIICSI   D S
Sbjct  98   IFLRSGEAKLGFIYKDKLAERHLKMGDVYQIPAGSAFYLVNIEEAQKLHIICSI---DPS  154

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            +  G D   FQSF++GGG HP SVL+GF+P  L TA N S  E+ K+   +  GPIV + 
Sbjct  155  ESLGID--IFQSFYLGGGAHPASVLSGFEPQILETAFNASGEELRKMFTRQHEGPIVHVG  212

Query  169  NSNYTA  152
            +S+ T+
Sbjct  213  DSHATS  218



>ref|NP_001267501.1| allergen Gly m Bd 28K precursor [Glycine max]
 dbj|BAB21619.2| allergen Gly m Bd 28K [Glycine max]
Length=476

 Score =   179 bits (454),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 140/205 (68%), Gaps = 14/205 (7%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            K +F+++ +  V +T++G ++V++   S  GR+    MHIGFI+MEP+SL +PQYLDS+L
Sbjct  37   KSLFLMSNSTRVFKTDAGEMRVLK---SHGGRIFYRHMHIGFISMEPKSLFVPQYLDSNL  93

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI   D 
Sbjct  94   IIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI---DP  150

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S   G +  TFQSF+IGGG +  SVL+GF+P  L TA N S   + ++   ++ GPI+ +
Sbjct  151  STSLGLE--TFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFV  208

Query  172  TNSNYTAPILAHLKRIVHYSDVEQQ  98
             +S+  AP L      +   D EQQ
Sbjct  209  DDSH--APSLWTKFLQLKKDDKEQQ  231



>gb|KHN22047.1| Vicilin-like antimicrobial peptides 2-2 [Glycine soja]
Length=498

 Score =   179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 140/205 (68%), Gaps = 14/205 (7%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            K +F+++ +  V +T++G ++V++   S  GR+    MHIGFI+MEP+SL +PQYLDS+L
Sbjct  37   KSLFLMSNSTRVFKTDAGEMRVLK---SHGGRIFYRHMHIGFISMEPKSLFVPQYLDSNL  93

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI   D 
Sbjct  94   IIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI---DP  150

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S   G +  TFQSF+IGGG +  SVL+GF+P  L TA N S   + ++   ++ GPI+ +
Sbjct  151  STSLGLE--TFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDGPIMFV  208

Query  172  TNSNYTAPILAHLKRIVHYSDVEQQ  98
             +S+  AP L      +   D EQQ
Sbjct  209  DDSH--APSLWTKFLQLKKDDKEQQ  231



>ref|XP_002880986.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57245.1| cupin family protein [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/227 (42%), Positives = 141/227 (62%), Gaps = 27/227 (12%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
            ++  F++ E+K+V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS 
Sbjct  72   RRGWFMMRESKQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSS  128

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L++FI QGEA +G + KD+  ERK+K+GD+Y I AGS FY+ NT  GQRLH+ICSI   D
Sbjct  129  LLIFIRQGEATLGVICKDEFGERKLKAGDIYWIPAGSVFYLLNTGRGQRLHVICSI---D  185

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
             +   G +  TFQ F+IGGG  P+SVLAGF+P TL++A NVS  E+ +++ ++  GPIV 
Sbjct  186  PTQSLGFE--TFQPFYIGGG--PSSVLAGFEPDTLTSAFNVSRPELQQMMMSQFRGPIVH  241

Query  175  LTNSNYTAPIL-------------AHLKRIVHYSDVEQQQQHYWAPW  74
            +       P +               LK+++       Q Q   + W
Sbjct  242  VMEGPQPQPTIWTQFLGLRGEEKHKQLKKLLEMKQGSPQDQQSTSGW  288



>ref|XP_004505960.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Cicer 
arietinum]
Length=474

 Score =   178 bits (452),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/231 (43%), Positives = 145/231 (63%), Gaps = 28/231 (12%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            K+F++ ++K VV+T++G +++ +   T    R MHIG I MEP+SL IPQYLDS+ ++F+
Sbjct  35   KLFLMQDSKSVVKTDAGEMRLFQNKDTEFLDRNMHIGLINMEPRSLFIPQYLDSNFIIFV  94

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
             +G+A++G +Y D+L ER++K+GD+Y I AGS FY+ N  EGQRLH+ICSI   D S   
Sbjct  95   RRGDAKLGFIYGDELEERRLKTGDIYVIPAGSVFYLVNIGEGQRLHLICSI---DPSTSL  151

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
            G    TFQ F+IGGG +  SVLAGF+P  L TA N S  ++ ++   KV GPIV + +S+
Sbjct  152  GD---TFQPFYIGGGDNSQSVLAGFEPVILETAFNESREKLERIFSKKVDGPIVYIDDSH  208

Query  160  YTAPIL-------------AHLKRIV--HYSDVEQQQQHYWAPWLFMRKLL  53
              AP L              HL ++V     + E+++Q  W+ W   RKL 
Sbjct  209  --APSLWTKFLQLKKEEKVQHLNKMVQGQEENNEEKKQTSWS-W---RKLF  253



>ref|XP_002465310.1| hypothetical protein SORBIDRAFT_01g036140 [Sorghum bicolor]
 gb|EER92308.1| hypothetical protein SORBIDRAFT_01g036140 [Sorghum bicolor]
Length=533

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 124/184 (67%), Gaps = 10/184 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGST-------STSGRLMHIGFITMEPQSLLIPQYLD  542
            + +F+L+  ++VV +E G ++VVRG         +    LMHIGFITMEP++L +PQYLD
Sbjct  56   RGLFVLDRLEKVVESEGGQVRVVRGQPWPPAAAFACRDGLMHIGFITMEPKTLFVPQYLD  115

Query  541  SHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINI  362
            S + LF+ +GE ++G+++KD+L ERK+K GD+  I+AGS FY+ NT +GQRL IICSI  
Sbjct  116  SSITLFVQRGEVKVGYIHKDELVERKLKMGDVLHIDAGSTFYLVNTGKGQRLQIICSI--  173

Query  361  VDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPI  182
             D SD  G     +Q+F++GG  HP SV+AGF P TL+ A N +  E++ ++  K  GPI
Sbjct  174  -DASDSLGFFGPPYQAFYLGGAGHPASVIAGFGPKTLTHAFNATYDELASILLAKTGGPI  232

Query  181  VSLT  170
            V  T
Sbjct  233  VHYT  236



>ref|XP_004487139.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Cicer 
arietinum]
Length=488

 Score =   175 bits (444),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 127/187 (68%), Gaps = 7/187 (4%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            +K+F+L  +K VV+T++G ++V+       S R +HIGFI MEP SL +PQYLDS L++F
Sbjct  41   EKLFLLQNSKRVVKTDAGEMRVLESYGGRVSERRLHIGFINMEPSSLFVPQYLDSTLIVF  100

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            +  GEA++G +Y+D+LAER++K GD+Y I AGSAFY+ N  + Q+LHIICSI   D S+ 
Sbjct  101  VRSGEAKVGFIYEDELAERELKRGDVYQIPAGSAFYLLNIGKAQKLHIICSI---DPSES  157

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G     FQSF+IGGG  P SVL+GF+P  L TA N S  E+ K    +  GPIV + +S
Sbjct  158  LGIG--IFQSFYIGGGA-PVSVLSGFEPQILETAFNASEAELIKFFTRQHEGPIVHIGDS  214

Query  163  NYTAPIL  143
            + +A  L
Sbjct  215  HVSASSL  221



>ref|XP_003597178.1| Vicilin-like antimicrobial peptides 2-2 [Medicago truncatula]
 gb|ABD33080.1| Cupin region [Medicago truncatula]
 gb|AES67429.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=457

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 13/187 (7%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRLM----HIGFITMEPQSLLIPQYLDSHL  533
            KK+F+L  +K VV+T++G ++V+    S  GR++    H+GFITMEP SL +PQYLDS L
Sbjct  39   KKLFLLQNSKRVVKTDAGEMRVLE---SRGGRILERRLHVGFITMEPSSLFVPQYLDSTL  95

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++F+  GEA++G +Y+++L E ++K GD+Y I AGSAFY+ N  EGQ+LHIICSI   D 
Sbjct  96   IIFVLTGEAKVGFMYENELEESELKKGDVYQIPAGSAFYLSNIGEGQKLHIICSI---DP  152

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+  G     FQSF+IGGG  P SV +GF+P  L +A NVS  E+SK    K  GPIV +
Sbjct  153  SESLGIG--IFQSFYIGGGA-PVSVFSGFEPQILESAFNVSGSELSKFFTRKHEGPIVHV  209

Query  172  TNSNYTA  152
             +S+ +A
Sbjct  210  GHSHASA  216



>gb|AES67417.2| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=461

 Score =   174 bits (442),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 127/183 (69%), Gaps = 7/183 (4%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            K+F+L  +K VV+T++G ++V+       S R +H+GFITMEP SL +PQYLDS L++F+
Sbjct  40   KLFLLQNSKLVVKTDAGEMRVLESHGGRISERRLHVGFITMEPSSLFVPQYLDSTLIVFV  99

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            + GEA++G V +D+LAER +K GD+Y I AGSAFY+ NT E Q+LHIICSI+  ++  + 
Sbjct  100  HTGEAKVGFVNEDELAERDLKKGDVYQIPAGSAFYLLNTGEAQKLHIICSIDPSESLRIG  159

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
                  FQSF+IGGG  P SVL+GF+P  L +A NVS  E+ K    K  GPIV + +S+
Sbjct  160  -----IFQSFYIGGGA-PVSVLSGFEPRILESAFNVSGSELKKFFTRKHEGPIVHVGHSH  213

Query  160  YTA  152
             +A
Sbjct  214  ASA  216



>ref|XP_003597181.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
 gb|ABD33075.1| Cupin region [Medicago truncatula]
 gb|AES67432.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=456

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 128/187 (68%), Gaps = 13/187 (7%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRLM----HIGFITMEPQSLLIPQYLDSHL  533
            KK+F+L  +K VV+T++G ++V+    S  GR++    H+GFITMEP SL +PQYLDS L
Sbjct  40   KKLFLLQNSKRVVKTDAGEMRVLE---SRGGRILERRLHVGFITMEPSSLFVPQYLDSTL  96

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++F+  GEA++G +Y+++L E ++K GD+Y I AGSAFY+ N  EGQ+LHIICSI   D 
Sbjct  97   IIFVLTGEAKVGFMYENELEESELKKGDVYQIPAGSAFYLSNIGEGQKLHIICSI---DP  153

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+  G     FQSF+IGGG  P SV +GF+P  L +A NVS  E+SK    K  GPIV +
Sbjct  154  SESLGIG--IFQSFYIGGGA-PVSVFSGFEPRILESAFNVSGSELSKFFTRKHEGPIVHV  210

Query  172  TNSNYTA  152
              S+ +A
Sbjct  211  GRSHASA  217



>ref|XP_003597166.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
Length=464

 Score =   174 bits (441),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 127/183 (69%), Gaps = 7/183 (4%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            K+F+L  +K VV+T++G ++V+       S R +H+GFITMEP SL +PQYLDS L++F+
Sbjct  40   KLFLLQNSKLVVKTDAGEMRVLESHGGRISERRLHVGFITMEPSSLFVPQYLDSTLIVFV  99

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            + GEA++G V +D+LAER +K GD+Y I AGSAFY+ NT E Q+LHIICSI+  ++  + 
Sbjct  100  HTGEAKVGFVNEDELAERDLKKGDVYQIPAGSAFYLLNTGEAQKLHIICSIDPSESLRIG  159

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
                  FQSF+IGGG  P SVL+GF+P  L +A NVS  E+ K    K  GPIV + +S+
Sbjct  160  -----IFQSFYIGGGA-PVSVLSGFEPRILESAFNVSGSELKKFFTRKHEGPIVHVGHSH  213

Query  160  YTA  152
             +A
Sbjct  214  ASA  216



>gb|KFK32293.1| hypothetical protein AALP_AA6G223800 [Arabis alpina]
Length=470

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/219 (44%), Positives = 137/219 (63%), Gaps = 30/219 (14%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            F++ + ++V+++E G ++VV    S  GR+    MHIGF+TMEP++L +PQYLDS L++F
Sbjct  46   FMMKDWRQVIKSEGGEMRVV---ISPRGRIIEKPMHIGFLTMEPKTLFVPQYLDSGLLIF  102

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KDK  ER++K GD+Y I AGS FY+ NT  GQRLH+ICSI   D S  
Sbjct  103  IRQGEATLGVICKDKFGERRLKGGDIYWIPAGSVFYLLNTGIGQRLHVICSI---DPSQS  159

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
             G +  TFQ F+IGGG  P+SVLAGFD  TL++A NVS  E+ +++ ++  GPIV +T  
Sbjct  160  LGFE--TFQPFYIGGG--PSSVLAGFDTDTLTSAFNVSQPELQQMMMSQFRGPIVHITER  215

Query  163  NYTAPIL-------------AHLKRIVHYSDVEQQQQHY  86
               AP +              H K+++       Q + Y
Sbjct  216  ---APTMWTSFLGLREEEKHKHFKKLLEMKQGSSQNKQY  251



>ref|XP_010922746.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Elaeis guineensis]
Length=486

 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 140/205 (68%), Gaps = 18/205 (9%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVV-----RGSTSTSGRLMHIGFITMEPQSLLIPQYLDS  539
             + +FIL  +KEV++T++G +++V     RG+ S     MHIGFITMEP +L IPQY+D+
Sbjct  50   DRGLFILRRSKEVLKTDAGKVRLVMGYRYRGNHSP----MHIGFITMEPNTLYIPQYIDA  105

Query  538  HLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIV  359
             L+LF+ +GEA++G++YK+KL E++++SG +  I AGS+FY+ N+ + +RLHIICSI+  
Sbjct  106  SLILFVRRGEAKVGYIYKNKLVEKRLRSGYIDAIPAGSSFYIVNSGKSERLHIICSIDNW  165

Query  358  DTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            ++ D  GA     QSF+IGGG+HP SVL+GFD  TLS A NVS  ++  ++  +  GPI+
Sbjct  166  ESMDY-GAYP---QSFYIGGGVHPRSVLSGFDASTLSAAFNVSSDQLEMVLNRQRGGPII  221

Query  178  SLTNS-----NYTAPILAHLKRIVH  119
             L+       +Y + I+   +R+V 
Sbjct  222  RLSGEAADQPDYLSSIMQLKERMVQ  246



>ref|XP_006409876.1| hypothetical protein EUTSA_v10017921mg [Eutrema salsugineum]
 gb|ESQ51329.1| hypothetical protein EUTSA_v10017921mg [Eutrema salsugineum]
Length=503

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 137/230 (60%), Gaps = 31/230 (13%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHLVLF  524
            FI+ E++ V ++E G ++VV    S  GR+    MHIGF+TMEPQ+L +PQYLDS L++F
Sbjct  87   FIMKESRRVFKSEGGEMRVV---ISPKGRIIEKPMHIGFLTMEPQTLFVPQYLDSSLLIF  143

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            I QGEA +G + KD   E+ +K GD+Y I AGS FY+ NT  GQ+LH+I SI+   +  +
Sbjct  144  IRQGEATLGVICKDDFGEKTLKGGDIYWIPAGSVFYLLNTGRGQQLHVIASIDPTQSLGL  203

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
                  TFQ F+IGGG    SVLAGFDP TL++ALNVS  E+ KL+ ++  GPIV +   
Sbjct  204  E-----TFQPFYIGGGQ--MSVLAGFDPDTLTSALNVSRPELQKLMMSQFRGPIVHIREH  256

Query  163  NYTAPIL-------------AHLKRIVHYSDVEQQQQHYWAPWLFMRKLL  53
               AP +              HLK+++       Q Q Y  PW   R ++
Sbjct  257  ---APTMWTEFLGLRGEEKHKHLKKLLEMKQGTSQDQDY-IPWWSWRNIV  302



>ref|XP_006843294.1| hypothetical protein AMTR_s00080p00163630 [Amborella trichopoda]
 gb|ERN04969.1| hypothetical protein AMTR_s00080p00163630 [Amborella trichopoda]
Length=456

 Score =   172 bits (436),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/192 (46%), Positives = 130/192 (68%), Gaps = 7/192 (4%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            +FIL ++K+V++TE+G ++V+ G+       M+IGFI MEP+SL +PQYLD+ L+LF+ +
Sbjct  47   LFILRDSKQVIKTEAGEVRVMMGAERGVSSPMNIGFINMEPESLFVPQYLDAALILFVRR  106

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            G A+IG + +D L E++++ GD+Y+I AGS FY+ N  EGQRL IICSI   DTS+  G 
Sbjct  107  GSAKIGWINRDDLVEKELRIGDVYSIPAGSPFYLVNIGEGQRLQIICSI---DTSERIGH  163

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
                FQSF +GGG    SVL+GF+  TLSTA NVS  E+S ++G   +GPI+ +T ++  
Sbjct  164  Q--PFQSFILGGGR--GSVLSGFNLKTLSTAFNVSTEELSSMLGRPSAGPIIYMTGAHEP  219

Query  154  APILAHLKRIVH  119
                + +K   H
Sbjct  220  PKAFSLIKPTPH  231



>ref|XP_003597162.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
 gb|AES67413.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=460

 Score =   172 bits (436),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 127/185 (69%), Gaps = 7/185 (4%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
             KK+F+L  +K VV+T++G ++V++      S R +H+GFITMEP SL +PQYLDS L++
Sbjct  38   NKKLFLLQNSKLVVKTDAGEMRVLKSHGGRISERRLHVGFITMEPSSLFVPQYLDSTLII  97

Query  526  FINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            F+  GEA++G V +D+LAER +K GD+Y I AGSAFY+ NT E Q+LHIICSI+  ++  
Sbjct  98   FVLTGEAKVGFVNEDELAERDLKKGDVYQIPAGSAFYLLNTGEAQKLHIICSIDPSESLR  157

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
            +       FQSF+IGGG  P SVL+GF+P  L +A NVS  ++ K    K  GPIV +  
Sbjct  158  IG-----IFQSFYIGGGA-PLSVLSGFEPRILESAFNVSGSKLMKFFTRKNEGPIVHVGR  211

Query  166  SNYTA  152
            S+ ++
Sbjct  212  SHASS  216



>ref|XP_007150226.1| hypothetical protein PHAVU_005G137200g [Phaseolus vulgaris]
 gb|ESW22220.1| hypothetical protein PHAVU_005G137200g [Phaseolus vulgaris]
Length=478

 Score =   172 bits (435),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 134/207 (65%), Gaps = 11/207 (5%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            +F++ ++K V++T +G ++V        S R +HIGFITMEP+SL IPQY+DS L++F+ 
Sbjct  43   LFLMKKSKLVIKTSAGKMRVFESYGGKASERHLHIGFITMEPKSLFIPQYIDSTLIIFVR  102

Query  517  QGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRG  338
             GEA++G V K KLA R++K GD+Y I AGSAFY+ N   GQ+LHIICSI   + S+  G
Sbjct  103  SGEAKLGFVNKGKLARRRLKMGDVYQIPAGSAFYIVNIEGGQKLHIICSI---EPSESLG  159

Query  337  ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNY  158
             D   FQSF+IGGG+HP  VLAGF+   L  + NVS  E+ K    K  G IV + +S+ 
Sbjct  160  DD--VFQSFYIGGGLHPAPVLAGFEHEILEASFNVSGEELRKFFTKKHGGAIVHVRDSHA  217

Query  157  TAPI-----LAHLKRIVHYSDVEQQQQ  92
            T+       L   +++ H +++ QQ+Q
Sbjct  218  TSIWTEFLQLEEEEKLQHLNEMVQQRQ  244



>tpg|DAA45235.1| TPA: hypothetical protein ZEAMMB73_974672 [Zea mays]
Length=501

 Score =   172 bits (436),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 125/183 (68%), Gaps = 10/183 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG------STSTSGRLMHIGFITMEPQSLLIPQYLDS  539
            + +F+L+  ++VV +E G ++VVRG      S +    LMHIGFITMEP++L +PQYLDS
Sbjct  55   RGLFLLHRVEKVVESEGGQVRVVRGQPWPPASFACREGLMHIGFITMEPKTLFVPQYLDS  114

Query  538  HLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIV  359
             + LF+ +GEA++G+++KD+L ERK+K GD+  I+AGS FY+ N  +GQRL IICS   V
Sbjct  115  SITLFVQRGEAKVGYIHKDELVERKLKMGDVLHIDAGSTFYMVNPGKGQRLQIICS---V  171

Query  358  DTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            D SD  G     +Q+FF+GG   P SV+AGF P TL+ A N +  E+++++  +  GPIV
Sbjct  172  DASDSLGFGP-PYQAFFLGGAGDPASVIAGFGPKTLTRAFNATYDELARILLPRTGGPIV  230

Query  178  SLT  170
              T
Sbjct  231  YYT  233



>ref|NP_001147040.1| LOC100280650 precursor [Zea mays]
 gb|ACG25229.1| cupin family protein [Zea mays]
Length=522

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 125/183 (68%), Gaps = 10/183 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG------STSTSGRLMHIGFITMEPQSLLIPQYLDS  539
            + +F+L+  ++VV +E G ++VVRG      S +    LMHIGFITMEP++L +PQYLDS
Sbjct  55   RGLFLLHRVEKVVESEGGQVRVVRGQPWPPASFACREGLMHIGFITMEPKTLFVPQYLDS  114

Query  538  HLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIV  359
             + LF+ +GEA++G+++KD+L ERK+K GD+  I+AGS FY+ N  +GQRL IICS   V
Sbjct  115  SITLFVQRGEAKVGYIHKDELVERKLKMGDVLHIDAGSTFYMVNPGKGQRLQIICS---V  171

Query  358  DTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            D SD  G     +Q+FF+GG   P SV+AGF P TL+ A N +  E+++++  +  GPIV
Sbjct  172  DASDSLGFGP-PYQAFFLGGAGDPASVIAGFGPKTLTRAFNATYDELARILLPRTGGPIV  230

Query  178  SLT  170
              T
Sbjct  231  YYT  233



>ref|XP_003597174.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
 gb|AES67425.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=241

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 126/186 (68%), Gaps = 9/186 (5%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVV--RGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLV  530
             +K+F+L  +K VV+T++G ++++  RG      RL H+GFITMEP SL +PQYLDS L+
Sbjct  38   DRKLFLLQNSKRVVKTDAGEMRMLESRGGRILERRL-HVGFITMEPSSLFVPQYLDSTLI  96

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            +F+  GEA++G +Y+D+L E ++K GD+Y I AGSAFY+ N  EGQ+LHIICSI+   + 
Sbjct  97   IFVLTGEAKVGIMYEDELEESELKKGDVYQIPAGSAFYLSNIGEGQKLHIICSID--PSE  154

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             +R      FQSF+IGGG  P SVL+GF+   L +A NVS  E+ K    K  GPIV + 
Sbjct  155  SLR---IGIFQSFYIGGGA-PLSVLSGFEHRILESAFNVSGSELMKFFTRKNEGPIVHVG  210

Query  169  NSNYTA  152
             S+ +A
Sbjct  211  PSHASA  216



>ref|XP_004984460.1| PREDICTED: globulin-1 S allele-like, partial [Setaria italica]
Length=504

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 126/183 (69%), Gaps = 10/183 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRG------STSTSGRLMHIGFITMEPQSLLIPQYLDS  539
            + +F+L+  ++VV +E G ++VVRG      S +    LMH+GFITMEP++L +PQYL S
Sbjct  60   RGLFVLDRLEKVVESEGGQVRVVRGQPWPPASFACREGLMHLGFITMEPRTLFVPQYLGS  119

Query  538  HLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIV  359
            +++LF+ +GE ++G++YKD+L ERK+K GD+  I+AGS FY+ NT +GQRL IICSI   
Sbjct  120  NVILFVRRGEVKVGYIYKDELVERKLKMGDVLHIDAGSTFYMVNTGKGQRLQIICSI---  176

Query  358  DTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            D SD  G     + SFF+GG  H  SVLAGF+P TL+ A N +  E+++++  +  GPIV
Sbjct  177  DASDSLGFGP-PYLSFFLGGAGHQASVLAGFEPKTLAMAFNATYDELARVILAQTRGPIV  235

Query  178  SLT  170
              T
Sbjct  236  YYT  238



>ref|XP_003557965.1| PREDICTED: vicilin [Brachypodium distachyon]
Length=503

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 123/186 (66%), Gaps = 14/186 (8%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGS----------TSTSGRLMHIGFITMEPQSLLIPQ  551
            K +F+L+  ++VV +E G + VVRG            +    LMHIGFITMEP++L +PQ
Sbjct  51   KGLFLLDNVEKVVDSEGGQVHVVRGPFVPEQPWQQYGACREGLMHIGFITMEPKTLFVPQ  110

Query  550  YLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICS  371
            Y+DS+L+LF+ +GE +IG ++ D+L ++++K GD+  IEAG+ FY+ NT +GQRL IICS
Sbjct  111  YIDSNLILFVQRGEVKIGWIHNDELVQKQLKMGDVLHIEAGATFYMVNTGKGQRLQIICS  170

Query  370  INIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVS  191
            I+  D+    G     +QSFF+ GG +PTSVLAGFDP  L TA N +  E+++L   +  
Sbjct  171  IDASDSPIGLGP----YQSFFLTGGGNPTSVLAGFDPKMLVTAFNTTYDEVARLFRPETR  226

Query  190  GPIVSL  173
            GP VS 
Sbjct  227  GPFVSF  232



>ref|XP_007132181.1| hypothetical protein PHAVU_011G072800g [Phaseolus vulgaris]
 gb|ESW04175.1| hypothetical protein PHAVU_011G072800g [Phaseolus vulgaris]
Length=493

 Score =   170 bits (430),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 135/208 (65%), Gaps = 13/208 (6%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESG---VIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHL  533
            +  +F+++  K VV+T++G   V+K   G      R MHIGFITMEP+SL +P YLD++L
Sbjct  83   EDSLFLMHSPKRVVKTDAGEMHVLKTQSGCMRFLDRHMHIGFITMEPKSLFVPHYLDTNL  142

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            ++FI++GEA +G +Y D+L E+++K+GD+Y I +GSAFY  N  EGQRLHIICSI   D 
Sbjct  143  IIFIHKGEANLGFMYDDELVEKRLKTGDLYVIPSGSAFYFVNIEEGQRLHIICSI---DP  199

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S   G D  TF SF+IGGG +  S+L+GF P  L  A N + +E+  +   ++ GPI+ +
Sbjct  200  STSLGLD--TFHSFYIGGGANSHSLLSGFGPAILEAAFNETRMEVESIFYKELDGPIMYM  257

Query  172  TNSNYTAPILAHLKRIVHYSDVEQQQQH  89
             +S+  +  +  L+      + E+++QH
Sbjct  258  DDSHVPSLGIKFLQL-----EKEEKEQH  280



>ref|XP_008366368.1| PREDICTED: LOW QUALITY PROTEIN: vicilin-like antimicrobial peptides 
2-2 [Malus domestica]
Length=554

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 140/228 (61%), Gaps = 24/228 (11%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTS-TSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L +AK+VV+T +G ++VV  + S    + MHIGFITMEP+SL IP YLDS+L+LF+ +
Sbjct  75   FLLPQAKQVVKTAAGEMRVVMSARSRVVDKPMHIGFITMEPKSLFIPHYLDSNLILFVRR  134

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            GE ++G +YKD+L   +++ GD+Y I AGS FY+ NT EGQR+HIICSI   DTS+  G 
Sbjct  135  GEVKVGLIYKDELGREEIRQGDVYRIPAGSPFYLVNTGEGQRVHIICSI---DTSESLG-  190

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
                 QS FIGGG +P S++AGFD   L+ A NV+  E+ ++  ++  GPIV +  S Y+
Sbjct  191  --MGLQS-FIGGGSNPQSIIAGFDHEILANAFNVTSSELREMFTSQQQGPIVFVPES-YS  246

Query  154  API------------LAHLKRIVHYSDVEQQQQHYWAPWLFMRKLLTN  47
              +            L  +KR+      + Q +     W   RKLL +
Sbjct  247  PSVWSKFLQLKQQDRLQEMKRMFDIQQXDHQDKSETWSW---RKLLNS  291



>gb|EMT30208.1| Vicilin-like antimicrobial peptides 2-2 [Aegilops tauschii]
Length=499

 Score =   166 bits (420),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 126/197 (64%), Gaps = 24/197 (12%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTS-------------------GRLMHIGFITMEP  572
            +F+L++ ++VV +E G + VVRG  ++                      LMHIGFITMEP
Sbjct  52   LFLLDKVEKVVESEGGSVHVVRGLPASGVPEAPWQHGGWSAGCGACREGLMHIGFITMEP  111

Query  571  QSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQ  392
            ++L +PQY+DS+L+LF+ +G+ ++G ++K  L E+++K GD+  I+AGS FY+ NT +GQ
Sbjct  112  KTLFVPQYIDSNLILFVQRGDVKVGWIHKGGLVEKQLKMGDVLQIDAGSTFYMVNTGKGQ  171

Query  391  RLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISK  212
            RLHIICSI   D SD  G   Y  QSF++GGG   TSVLAGF+P  L TALN +  E+ +
Sbjct  172  RLHIICSI---DASDSAGFAPY--QSFYLGGGGKRTSVLAGFEPKILVTALNTTFDELER  226

Query  211  LVGTKVSGPIVSLTNSN  161
            ++  K  GP VS T  +
Sbjct  227  ILPVKPLGPFVSYTTES  243



>ref|XP_003606476.1| Allergen Gly m Bd [Medicago truncatula]
 gb|AES88673.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=473

 Score =   165 bits (418),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/230 (40%), Positives = 137/230 (60%), Gaps = 24/230 (10%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            +F++  +K VV+T +G +++ + +      R MHIG + MEP+S  IPQYLDS+L++F+ 
Sbjct  35   LFLMQNSKSVVKTHAGELRLFKNNDDRFLDRHMHIGLLNMEPRSCSIPQYLDSNLIIFVR  94

Query  517  QGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRG  338
            +G A++G +Y D+L ER++K+GD+Y I AG+ FY+ N  EGQRLH+ICS    D S   G
Sbjct  95   RGVAKLGFIYGDELEERRIKTGDLYVIPAGTVFYLVNIGEGQRLHVICSF---DPSTSLG  151

Query  337  ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNY  158
                TFQ F+IGGG +  SVLAGF P  L TA N S  +I ++   K  GPIV + + ++
Sbjct  152  D---TFQPFYIGGGDNQQSVLAGFGPTILETAFNESRTKIERIFTKKQDGPIVFIDDDSH  208

Query  157  TAPI------LAHLKRIVHYSDVEQQQ-------QHYWAPWLFMRKLLTN  47
            +  +      L    ++ H   + Q+Q       Q  W+ W   RKL+ N
Sbjct  209  SPSLWTKFLELKKNDKVQHLKTLVQRQEEEEEEKQTSWS-W---RKLMKN  254



>gb|EYU18873.1| hypothetical protein MIMGU_mgv1a024892mg [Erythranthe guttata]
Length=464

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/230 (41%), Positives = 142/230 (62%), Gaps = 23/230 (10%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTST-SGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L ++K VV+T++G ++VV G  S      MH+GFITME ++L IPQY+       +  
Sbjct  52   FVLQDSKHVVKTDAGDMRVVGGFGSKFMTSPMHVGFITMELRTLFIPQYVPRFQPHSLR-  110

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
             EAR+GH+YKD+L ER +K GD+Y IEAGSAFY+ N AEG++LH+ICSI+  ++      
Sbjct  111  -EARVGHIYKDELVERSLKVGDIYRIEAGSAFYMINRAEGEKLHVICSIDASESLQY---  166

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
              +T QSFF+ GG +P SVL+GFD  TLS A NVS  E+  ++  + +G I+ L++++  
Sbjct  167  -WHTVQSFFVAGGTYPASVLSGFDHSTLSAAFNVSEAELGIMLTKQHNGRIIYLSSNDSR  225

Query  154  API-------------LAHLKRIVHYS---DVEQQQQHYWAPWLFMRKLL  53
            +P              L H++RIVH +   D+E  ++        +RKLL
Sbjct  226  SPCLWSKFSEMEHHQKLTHMRRIVHVTGAEDIEHMEEEQPIVAWSIRKLL  275



>dbj|BAJ87938.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   164 bits (416),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 126/199 (63%), Gaps = 26/199 (13%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTS---------------------GRLMHIGFITM  578
            +F+L++ +++V +E G + VVRG   +                        LMHIGFITM
Sbjct  60   LFLLDKVEKLVESEGGSVHVVRGVPGSGVPELPWQHGHGGWSAGCGACREGLMHIGFITM  119

Query  577  EPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAE  398
            EP++L +PQY+DS++VLF+ +G+ ++G ++K  L E+++K GD+  I+AG+ FY+ NT +
Sbjct  120  EPKTLFVPQYIDSNIVLFVQRGDVKVGWIHKGGLVEKQLKMGDVLQIDAGTTFYMVNTGK  179

Query  397  GQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEI  218
            GQRLHIICSI   D SD  GA    +QSF++GGG   TSVLAGF+P  L TALN +  E+
Sbjct  180  GQRLHIICSI---DASD--GAGFVPYQSFYLGGGGRQTSVLAGFEPKILVTALNTTYDEL  234

Query  217  SKLVGTKVSGPIVSLTNSN  161
             +++  K  GP VS T  +
Sbjct  235  ERILPVKPRGPFVSYTTES  253



>ref|XP_003597167.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
 gb|AES67418.1| allergen gly M Bd 28 kDa protein [Medicago truncatula]
Length=418

 Score =   162 bits (410),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 125/188 (66%), Gaps = 15/188 (8%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSH  536
             KK+F+L  +K VV+T++G ++V+    S  GR+    +H+GFITMEP  L +PQYLDS 
Sbjct  38   DKKLFLLQNSKRVVKTDAGEMRVLE---SHGGRIFERRLHVGFITMEPSPLFVPQYLDST  94

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            L++F+    A++G +YKD+LAER +K GD+Y I AGSAFY+ NT E Q+LHIICSI+  +
Sbjct  95   LIIFVLT--AKVGFIYKDELAERDLKKGDVYQIPAGSAFYLLNTGEAQKLHIICSIDPSE  152

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            +  +       FQSF+IGGG  P SV +GF+P  L +A NVS  ++ K    K  GPIV 
Sbjct  153  SLRIG-----IFQSFYIGGGA-PLSVPSGFEPRILESAFNVSGSKLMKFFTRKHEGPIVH  206

Query  175  LTNSNYTA  152
            +  S+ +A
Sbjct  207  VGRSHPSA  214



>ref|XP_004309898.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Fragaria 
vesca subsp. vesca]
Length=470

 Score =   163 bits (412),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 134/217 (62%), Gaps = 28/217 (13%)
 Frame = -2

Query  658  TESGVIKVVRGSTSTSGRLMH----IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHV  491
            T++G ++VVR   S   R++H    +GF++MEP SL IPQYLDS LVLF++ G A +G V
Sbjct  64   TKAGEMRVVR---SVGRRMVHRHINVGFLSMEPNSLFIPQYLDSSLVLFVHTGRANVGLV  120

Query  490  YKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSF  311
            +  +L ER++K+GD+Y I AGS FY++N  EG RL +I SI   DTS+  G    T ++F
Sbjct  121  HHHELGERQLKAGDLYRIPAGSTFYLQNVEEGHRLELILSI---DTSE--GLRMGTLENF  175

Query  310  FIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA-------  152
            FIGGG +P SVLAGFD   L++A NVS  E+  ++  +  GPIVSL NS  +        
Sbjct  176  FIGGGNYPKSVLAGFDSGVLTSAFNVSTSELRHVLSRQHQGPIVSLNNSQSSNLWKKFLS  235

Query  151  ----PILAHLKRIVHYSDVEQQQQHYWAPWLFMRKLL  53
                  L  LK++V +   ++Q Q    PW + RKLL
Sbjct  236  MEEHDRLQELKKMVDFPQEQEQTQ----PWSW-RKLL  267



>ref|XP_010244960.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=431

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 123/181 (68%), Gaps = 7/181 (4%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            +F+L  +K+V +T++G ++VVRG  T      MHIGFITMEP +  IPQY+DS+L++F++
Sbjct  40   IFLLQHSKQVFQTDAGQMRVVRGLRTKGVESPMHIGFITMEPNTFFIPQYIDSNLIIFVH  99

Query  517  QGEARIGHV-YKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            +GE +IG + +  +L E ++K GD+Y I AGSAFY+ N  + QRL IIC I   DTS+  
Sbjct  100  EGEGKIGRISHGRQLEEGQLKVGDVYRIPAGSAFYLMNNGKDQRLQIICGI---DTSE--  154

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
               +  FQSFFIGGG +P SVL GFD  TL+ A NVS  E+  ++  +  GPI+ + +++
Sbjct  155  SIQSGLFQSFFIGGGSYPRSVLRGFDQTTLAAAFNVSSSELEDILIGQEGGPIIFVKDAD  214

Query  160  Y  158
            +
Sbjct  215  H  215



>ref|XP_009415596.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=458

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 122/179 (68%), Gaps = 6/179 (3%)
 Frame = -2

Query  676  AKEVVRTESGVIKVV-RGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++ V RT++G I+VV R  + +    MHIGFI MEP SL++PQY+D++LV+F+++GE ++
Sbjct  59   SRTVARTDAGEIRVVSRYRSKSEPCPMHIGFIQMEPNSLVVPQYVDANLVVFVHRGEVKV  118

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
            G +++D+L ER+++ GD+  I AGS FY+ NT    R  IICSI   DT+   G   +  
Sbjct  119  GWIHEDELVERQLRRGDVSVIPAGSTFYIVNTHSSDRSQIICSI---DTTQSMGHSLH--  173

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPIL  143
            QSFFIGGGM+PTSVLAGFD  TL+ A NV+  E+ +++ ++  G IV ++  +   P L
Sbjct  174  QSFFIGGGMNPTSVLAGFDTNTLTAAFNVTAEELERMMQSQRGGAIVYMSGESSERPDL  232



>ref|XP_006650050.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Oryza 
brachyantha]
Length=568

 Score =   156 bits (394),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 91/197 (46%), Positives = 128/197 (65%), Gaps = 28/197 (14%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGS----------------TSTSG---RLMHIGFITM  578
            + +F+L++ ++VV +E G ++VVRG                 ++ SG    LMHIGFITM
Sbjct  74   RGLFVLDKGEKVVESEGGHVRVVRGRPWPPATVMPDPWQHGWSAPSGCREGLMHIGFITM  133

Query  577  EPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAE  398
            EP++L +PQY+DS+LVLF++ GE ++G ++KDKL E+K+K GD+  I+AGS FY+ N+ +
Sbjct  134  EPKTLFVPQYVDSNLVLFVHLGEVKVGWIHKDKLVEKKLKMGDVLHIDAGSTFYMVNSGK  193

Query  397  GQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGM-HPTSVLAGFDPYTLSTALNVSMVE  221
            GQRL IICSI   D SD  G   Y  Q+FF+GGG     SVLAGFD  TL TA N +  E
Sbjct  194  GQRLKIICSI---DASDSIGFSPY--QAFFLGGGAGRAQSVLAGFDTKTLVTAFNTTYEE  248

Query  220  ISK--LVGT-KVSGPIV  179
            +++  L  T +  GPIV
Sbjct  249  LAQTLLADTGRDRGPIV  265



>ref|XP_004309901.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   152 bits (385),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 115/176 (65%), Gaps = 6/176 (3%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            F+L  ++ +V+TE+G ++VVR        R +++GF+T+EP SL IPQYLDS L+LF+ +
Sbjct  59   FLLQRSRVLVKTEAGEMRVVRSVGHEIVDRHINVGFLTLEPNSLFIPQYLDSSLILFVQR  118

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            G+  +G V+  +L ER++K+GD++ I AGS FY+ N  E QRL II S++  D+  M   
Sbjct  119  GQGNLGLVHHHELGERQLKAGDVHRIPAGSTFYLHNAREHQRLQIILSVDTSDSLRM---  175

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
               T ++FFIGGG +P SVL+GFD   L+ A NVS  E+ +++     G IV L N
Sbjct  176  --GTLENFFIGGGTNPKSVLSGFDSEILTNAFNVSSSELRQVLTRHQEGAIVHLKN  229



>ref|XP_009396660.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   151 bits (381),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 115/179 (64%), Gaps = 9/179 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGST-STSGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            +  FIL   +  VRTE+G ++VV G         MHIGF+ +EP SL +PQY+D++L+ F
Sbjct  50   RGRFILGRTRRAVRTEAGQVRVVSGDRWKGHPSTMHIGFLRLEPNSLFLPQYVDANLIQF  109

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            + +GE   G ++KD+L +RK+K GD+  I AGS FY+ NT   +R H++C I   DTS  
Sbjct  110  VREGEVEAGWIHKDELVQRKLKRGDINVIPAGSPFYIANT-NSERSHMVCGI---DTSQ-  164

Query  343  RGADTY-TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
              + TY + QSFFIGGG +PTSVLAGFD  TL+ A N++  ++  ++  +  GPIV  +
Sbjct  165  --SLTYNSQQSFFIGGGTNPTSVLAGFDVNTLANAFNITSDQLRPMMRRQSGGPIVHFS  221



>gb|ABF95817.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
 gb|EAY89913.1| hypothetical protein OsI_11462 [Oryza sativa Indica Group]
 gb|EAZ26837.1| hypothetical protein OsJ_10753 [Oryza sativa Japonica Group]
Length=565

 Score =   149 bits (375),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 131/213 (62%), Gaps = 36/213 (17%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGS---------------TSTSG----RLMHIGFIT  581
            ++ +F+L+  ++VV +E G ++VVRG                ++ SG     LMHIGFIT
Sbjct  72   ERGLFVLDRGEKVVESEGGHVRVVRGRPWPPAAVPDPWQRGWSAASGCCREGLMHIGFIT  131

Query  580  MEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTA  401
            MEP++L +PQY+DS+L+LF+  GE ++G ++KD+L E+ +K GD+  I+AGS FY+ N+ 
Sbjct  132  MEPKTLFVPQYVDSNLILFVQLGEVKVGWMHKDELVEKNLKMGDVLHIDAGSTFYMVNSG  191

Query  400  EGQRLHIICSINIVDTSDMRGADTYTFQSFFI-----GGGMHPTSVLAGFDPYTLSTALN  236
            +GQRL IICSI   D SD  G   Y  Q+FF+     GG  HP SV+AGFDP TL  A N
Sbjct  192  KGQRLKIICSI---DASDNIGFGPY--QAFFLGGGGGGGSRHPQSVIAGFDPKTLVIAFN  246

Query  235  VSMVEISK--LVGTKVSGPIVSLTNSNYTAPIL  143
             +  ++ +  LV T   GPI+  T    T P++
Sbjct  247  TTFEDLDQTLLVDTG-RGPIMYYT----TEPVM  274



>ref|XP_002965782.1| hypothetical protein SELMODRAFT_22892, partial [Selaginella moellendorffii]
 gb|EFJ33202.1| hypothetical protein SELMODRAFT_22892, partial [Selaginella moellendorffii]
Length=355

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 8/174 (5%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGS---TSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            FIL E  E V++++G I+ + GS    S   R + +GFITMEP++LL+P Y+D+ LV ++
Sbjct  1    FILGEPVEYVKSDAGEIRALMGSHEDLSLKERDVALGFITMEPRALLLPHYMDASLVFYV  60

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
             +G+A IG +  +   ++ +K GD+YT+ AG+ FYV N  E ++L +   I I DTS  R
Sbjct  61   QKGDAMIGSIRGESTVKKDLKRGDVYTVPAGAVFYVLNANEDEKLEL---IGIFDTS--R  115

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            G+ +   QSFF+GGG+HP   LAGF    L+ A  VS  EI  + G++  GPI+
Sbjct  116  GSRSGKLQSFFVGGGLHPKLALAGFRSGLLAAAFKVSEEEIKNVFGSQDGGPII  169



>ref|XP_002984436.1| hypothetical protein SELMODRAFT_12725, partial [Selaginella moellendorffii]
 gb|EFJ14486.1| hypothetical protein SELMODRAFT_12725, partial [Selaginella moellendorffii]
Length=352

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 110/174 (63%), Gaps = 8/174 (5%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGS---TSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            FIL E  E V++++G I+ + GS    S   R + +GFITMEP++LL+P Y+D+ LV ++
Sbjct  1    FILGEPVEYVKSDAGEIRALMGSHEDLSLKERDVALGFITMEPRALLLPHYMDASLVFYV  60

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
             +G+A IG +  +   ++ +K GD+YT+ AG+ FYV N  E ++L +   I I DTS  R
Sbjct  61   QKGDAMIGSIRGESTVKKDLKRGDVYTVPAGAVFYVLNANEDEKLEL---IGIFDTS--R  115

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            G+ +   QSFF+GGG+HP   LAGF    L+ A  VS  EI  + G++  GPI+
Sbjct  116  GSRSGKLQSFFVGGGLHPKLALAGFRSGLLAAAFKVSEEEIKNVFGSQDGGPII  169



>gb|EMS66387.1| Vicilin-like antimicrobial peptides 2-2 [Triticum urartu]
Length=396

 Score =   135 bits (340),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 98/143 (69%), Gaps = 8/143 (6%)
 Frame = -2

Query  580  MEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTA  401
            MEP++L +PQY+DS+L+LF+ +G+ ++G ++K  L E+++K GD+  I+AGS FY+ NT 
Sbjct  1    MEPKTLFVPQYIDSNLILFVQRGDVKVGWIHKGGLVEKQLKMGDVLQIDAGSIFYMVNTG  60

Query  400  EGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVE  221
            +GQRLHIICSI   D SD  G   Y  QSF++GGG   TSVLAGF+P  L TALN +  E
Sbjct  61   KGQRLHIICSI---DASDSAGFAPY--QSFYLGGGGKQTSVLAGFEPKILVTALNTTYDE  115

Query  220  ISKLVGTK---VSGPIVSLTNSN  161
            + +++  +     GP VS T  +
Sbjct  116  LGRILPVRTGGTGGPFVSYTTES  138



>gb|ACD36975.1| Gly m Bd 28K allergen [Glycine max]
 gb|ACD36977.1| Gly m Bd 28K allergen [Glycine max]
Length=373

 Score =   134 bits (336),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 101/150 (67%), Gaps = 7/150 (5%)
 Frame = -2

Query  547  LDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSI  368
            LDS+L++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI
Sbjct  1    LDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI  60

Query  367  NIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
               D S   G +  TFQSF+IGGG +  SVL+GF+P  L TA N S   + ++   ++ G
Sbjct  61   ---DPSTSLGLE--TFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDG  115

Query  187  PIVSLTNSNYTAPILAHLKRIVHYSDVEQQ  98
            PI+ + +S+  AP L      +   D EQQ
Sbjct  116  PIMFVDDSH--APSLWTKFLQLKKDDKEQQ  143



>gb|ACD36974.1| Gly m Bd 28K allergen [Glycine max]
Length=373

 Score =   132 bits (332),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 101/150 (67%), Gaps = 7/150 (5%)
 Frame = -2

Query  547  LDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSI  368
            LDS+L++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI
Sbjct  1    LDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI  60

Query  367  NIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
               D S   G +  TFQSF+IGGG +  SVL+GF+P  L TA N S   + ++   ++ G
Sbjct  61   ---DPSTSLGLE--TFQSFYIGGGANSHSVLSGFEPAILETAFNESRTVVEEIFSKELDG  115

Query  187  PIVSLTNSNYTAPILAHLKRIVHYSDVEQQ  98
            PI+ + +S+  +     L+  +   D EQQ
Sbjct  116  PIMFVDDSHVPSLWTKFLQ--LKKDDKEQQ  143



>ref|XP_002988968.1| hypothetical protein SELMODRAFT_129041 [Selaginella moellendorffii]
 gb|EFJ09997.1| hypothetical protein SELMODRAFT_129041 [Selaginella moellendorffii]
Length=416

 Score =   132 bits (332),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 114/182 (63%), Gaps = 10/182 (5%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRLM--HIGF--ITMEPQSLLIPQYLDSHLVLF  524
            F+L E  +VV TE+G I+V+ G     G L   HIG   IT+EP+ LL+PQYLD+  VL+
Sbjct  46   FVLKEPVQVVSTEAGDIQVLPGPKEL-GALAENHIGLSIITIEPKGLLLPQYLDASCVLY  104

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDM  344
            +++G   +G   +D L  + +++GD+Y +  G  FYV NT EGQRL +     + DTS+ 
Sbjct  105  VHKGRMTLGWAEQDYLNRQDLETGDIYALPGGFVFYVLNTDEGQRLRL---YGMCDTSE-  160

Query  343  RGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNS  164
               D   FQSFF+GGG+ P ++L+GF    ++ AL V+  ++S+++G++  GPIV  + +
Sbjct  161  -SLDAGHFQSFFVGGGVDPRTILSGFRKEAVAAALKVAPEDVSEILGSQTEGPIVYTSRA  219

Query  163  NY  158
             Y
Sbjct  220  GY  221



>gb|ACD36976.1| Gly m Bd 28K allergen [Glycine max]
Length=373

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 99/150 (66%), Gaps = 7/150 (5%)
 Frame = -2

Query  547  LDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSI  368
            LDS+L++FI +GEA++G +Y D+LAER++K+GD+Y I +GSAFY+ N  EGQRLH+ICSI
Sbjct  1    LDSNLIIFIRRGEAKLGFIYDDELAERRLKTGDLYMIPSGSAFYLVNIGEGQRLHVICSI  60

Query  367  NIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
               D S   G +  TFQSF IGGG +  SVL+GF+P  L TA N S   + +    ++ G
Sbjct  61   ---DPSTSLGLE--TFQSFNIGGGANSHSVLSGFEPAILETAFNESRTVVEETFSKELDG  115

Query  187  PIVSLTNSNYTAPILAHLKRIVHYSDVEQQ  98
            PI+ + +S+  AP L      +   D EQQ
Sbjct  116  PIMFVDDSH--APSLWTKFLQLKKDDKEQQ  143



>ref|XP_002961493.1| hypothetical protein SELMODRAFT_22406, partial [Selaginella moellendorffii]
 gb|EFJ36753.1| hypothetical protein SELMODRAFT_22406, partial [Selaginella moellendorffii]
Length=425

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 115/185 (62%), Gaps = 10/185 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            +  F+L +  E+V TE+G I V+ G    +G L    + + FITMEP++LL+PQY+D+  
Sbjct  37   RNPFVLEKPVEIVSTEAGKIHVLPGRKDKAGVLGSNNIGLNFITMEPKALLLPQYIDAPC  96

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            VL++ +G+ R+G V +D L ++ +++GD+Y I  G  FY+ NT E QRL +     + DT
Sbjct  97   VLYVLKGKMRLGWV-EDGLNQQDLEAGDIYVIPGGLVFYILNTDEAQRLRVF---GMFDT  152

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+    +T  FQS F+GGG +P ++L+GFD   L+ +  VS  E+ +++  +  GPIV  
Sbjct  153  SE--SLETGVFQSAFVGGGTNPLTILSGFDSDVLAASFKVSSEEVIEVLSNQDQGPIVYT  210

Query  172  TNSNY  158
            + + +
Sbjct  211  SQARF  215



>ref|XP_002971314.1| hypothetical protein SELMODRAFT_12200, partial [Selaginella moellendorffii]
 gb|EFJ27912.1| hypothetical protein SELMODRAFT_12200, partial [Selaginella moellendorffii]
Length=423

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 115/185 (62%), Gaps = 10/185 (5%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRL----MHIGFITMEPQSLLIPQYLDSHL  533
            +  F+L +  E+V TE+G I V+ G    +G L    + + FITMEP++LL+PQY+D+  
Sbjct  37   RNPFVLEKPVEIVSTEAGKIHVLPGRKDKAGVLGSNNIGVNFITMEPKALLLPQYIDAPC  96

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            VL++ +G+ R+G V +D L ++ +++GD+Y I  G  FY+ NT E QRL +     + DT
Sbjct  97   VLYVLKGKMRLGWV-EDGLNQQDLEAGDIYVIPGGLVFYILNTDEAQRLRVF---GMFDT  152

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            S+    +T  FQS F+GGG +P ++L+GFD   L+ +  VS  E+ +++  +  GPIV  
Sbjct  153  SES--LETGVFQSAFVGGGTNPLTILSGFDSDVLAASFKVSSEEVIEVLSNQDQGPIVYT  210

Query  172  TNSNY  158
            + + +
Sbjct  211  SQARF  215



>ref|XP_002975077.1| hypothetical protein SELMODRAFT_102742 [Selaginella moellendorffii]
 gb|EFJ23862.1| hypothetical protein SELMODRAFT_102742 [Selaginella moellendorffii]
Length=414

 Score =   117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 111/183 (61%), Gaps = 14/183 (8%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRLM--HIGF--ITMEPQSLLIPQYLDSHLVLF  524
            F+L E  +VV TE+G I+V+ G     G L   HIG   IT+EP+ LL+PQYLD+  VL+
Sbjct  46   FVLKEPVQVVSTEAGDIQVLPGPKEL-GALAENHIGLSIITIEPKGLLLPQYLDASCVLY  104

Query  523  INQGEARIGHVYKDKLAER-KVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            +++G+     +       R  +++GD+Y +  G  FYV NT EGQRL +     + DTS+
Sbjct  105  VHKGKLSFSLL---SFGFRFDLETGDIYALPGGFVFYVLNTDEGQRLRLY---GMCDTSE  158

Query  346  MRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTN  167
                D   FQSFF+GGG+ P ++L+GF    ++ AL V+  ++S+++G++  GPIV  + 
Sbjct  159  --SLDAGHFQSFFVGGGVDPRTILSGFHKEAVAAALKVAPEDVSEILGSQTEGPIVYTSR  216

Query  166  SNY  158
            + Y
Sbjct  217  AGY  219



>ref|XP_010921152.1| PREDICTED: LOW QUALITY PROTEIN: vicilin-like antimicrobial peptides 
2-3 [Elaeis guineensis]
Length=351

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 92/161 (57%), Gaps = 25/161 (16%)
 Frame = -2

Query  478  LAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGG  299
            + ER++K GD+  I AGS FY+ NT +GQRL IICSI   DTS+  G   Y  QSFFIGG
Sbjct  1    MVERRLKMGDIIHIAAGSXFYMVNTGKGQRLQIICSI---DTSESLGLGPY--QSFFIGG  55

Query  298  GMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKRIVH  119
            GM P+SVLAGFD  TL+ A NV+  E+  ++G  V GPI+  T+   + P     +R+V 
Sbjct  56   GMDPSSVLAGFDIGTLTAAFNVTTEEMDTILGAHVRGPIIFYTDRAASQP-----RRLVS  110

Query  118  YSDVEQQQQHYWAP--------------WLFMRKLLTNHYY  38
            Y  ++Q Q  Y +               W  +RK L N +Y
Sbjct  111  YMQLKQMQVRYASDDEGEEEMQQEENQRWT-LRKFLANLFY  150



>emb|CAA91187.1| vicilin [Matteuccia struthiopteris]
Length=504

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 111/184 (60%), Gaps = 8/184 (4%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRGSTSTSG---RLMHIGFITMEPQSLLIPQYLDSHL  533
            +++ F+L +  +V++TE+G ++++  +   S    + + +GF+++EP++LLIPQY+D+  
Sbjct  117  RQESFVLEKPIKVIKTEAGELRMLPQAGINSELVRQRLGLGFLSLEPKALLIPQYIDADC  176

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            +  +++G  ++  V +  + E  V+ GD++ IE+G+ FY+ N  EGQRL I    +I DT
Sbjct  177  LFLVHEGRGQLSWVEEGDVQEVDVEEGDVFEIESGTVFYMLNQDEGQRLSI---FSIYDT  233

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSL  173
            + +   +   F SFF+ GG  P ++L+GFD   L+T       E+  ++ ++  GPI+  
Sbjct  234  ATV--FNDQMFHSFFVAGGQKPKTILSGFDEDVLATVFKAHADEVGDMLSSQTQGPIIYF  291

Query  172  TNSN  161
            +  N
Sbjct  292  SGRN  295



>gb|ABR16441.1| unknown [Picea sitchensis]
Length=432

 Score = 97.4 bits (241),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 102/181 (56%), Gaps = 11/181 (6%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVV---RGSTSTSGRL--MHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            E  +++  E+G I+V    R +  ++ +L    +    M+P SL++P+Y+ +   ++  +
Sbjct  51   ENWKIIDAEAGHIRVAPSFRENARSAPQLHSFEVNSFEMDPNSLMLPRYITASWYMYAYE  110

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            G+ RIG V+  K  E+ +++G +Y +  G+ FYV NT + Q LH+   IN++   +    
Sbjct  111  GKGRIGWVHNQKSIEQDIEAGQVYYVPKGAPFYVINTDKNQSLHL---INLMHNENPGSP  167

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT--NSN  161
            D +  +S+++GGG  P +V +GF   TL+    + + E+ K++  +V G IVSL    +N
Sbjct  168  DRH-HESYYVGGGQDPPTVFSGFRRETLAAGFGIGIREVEKVLSKQVRGSIVSLNKEQTN  226

Query  160  Y  158
            Y
Sbjct  227  Y  227



>gb|ABK24863.1| unknown [Picea sitchensis]
Length=432

 Score = 97.1 bits (240),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 99/175 (57%), Gaps = 9/175 (5%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVV---RGSTSTSGRL--MHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            E  +++  E+G I+V    R +  ++ +L    +    M+P SL++P+Y+ +   ++  +
Sbjct  51   ENWKIIDAEAGHIRVAPSFRENARSAPQLHNFEVNSFEMDPNSLMLPRYITASWYMYAYE  110

Query  514  GEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
            G+ RIG V+  K  E+ +++G +Y +  G+ FYV NT + Q LH+   IN++   +    
Sbjct  111  GKGRIGWVHNQKSIEQDIEAGQVYYVPKGAPFYVINTDKNQSLHL---INLMHNENPGSP  167

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            D +  +S+++GGG  P +V +GF   TL+    + + E+ K++  +V G IVSL 
Sbjct  168  DRH-HESYYVGGGQDPPTVFSGFRRETLAAGFGIGIREVEKVLSKQVRGSIVSLN  221



>ref|XP_002977505.1| hypothetical protein SELMODRAFT_107197 [Selaginella moellendorffii]
 gb|EFJ21509.1| hypothetical protein SELMODRAFT_107197 [Selaginella moellendorffii]
Length=421

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 112/210 (53%), Gaps = 14/210 (7%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQG  512
             IL E  ++V+T+ G I+V+  S       + +GFIT+ P++LL+P YLD+  V  + QG
Sbjct  44   LILEEPTQLVKTQWGEIRVLLSSPLLRKHNVGLGFITLRPRALLLPHYLDASFVFLVQQG  103

Query  511  EARIGHV-YKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
             ARIG V  + +L  + + +GD+Y + AGS FY+ +T E + L I     + DTS+    
Sbjct  104  SARIGWVDQQGELLRQDLSTGDVYAVAAGSLFYLLSTHEDEELEI---YGLYDTSE--AI  158

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
            D  + + FFI G    +++ +GF    +S A  VS   +++ +  + S  I+  T+ +  
Sbjct  159  DIESIKPFFIAG---KSNLFSGFGTRLVSAAFKVSEEGVAEFLSQQPSKAIIP-TSVDAF  214

Query  154  APILAHLKRIVHYSDVE----QQQQHYWAP  77
            A + +HL     + +V      ++ H  AP
Sbjct  215  AQLTSHLPEAWSWKNVASFLLNKKMHGRAP  244



>ref|XP_002972193.1| hypothetical protein SELMODRAFT_172591 [Selaginella moellendorffii]
 gb|EFJ27110.1| hypothetical protein SELMODRAFT_172591 [Selaginella moellendorffii]
Length=421

 Score = 94.7 bits (234),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 112/210 (53%), Gaps = 14/210 (7%)
 Frame = -2

Query  691  FILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQG  512
             IL E  ++V+T+ G I+V+  S       + +GFIT+ P++LL+P YLD+  V  + QG
Sbjct  44   LILEEPTQLVKTQWGEIRVLLRSPLLRKHNVGLGFITLRPRALLLPHYLDASFVFLVQQG  103

Query  511  EARIGHV-YKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
             ARIG V  + +L  + + +GD+Y + AGS FY+ +T E + L I     + DTS+    
Sbjct  104  SARIGWVDQQGELLRQDLSTGDVYAVAAGSLFYLLSTHEDEELKI---YGLYDTSE--AI  158

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
            D  + + FFI G    +++ +GF    +S A  VS   +++ +  + S  I+  T+ +  
Sbjct  159  DIESIKPFFIAG---ESNLFSGFGTRLVSAAFKVSEEGVAEFLRQQSSEAIIP-TSVDAF  214

Query  154  APILAHLKRIVHYSDVE----QQQQHYWAP  77
            A + +HL     + +V      ++ H  AP
Sbjct  215  AQLTSHLPEAWSWKNVASFLLNKKMHGRAP  244



>ref|XP_009367697.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=481

 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 83/170 (49%), Gaps = 12/170 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V+TE G ++V++     S  L       +GF+  EP + + P +LD+  VLF+ QG   I
Sbjct  103  VQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDADCVLFVFQGRPTI  162

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V ++K     ++ GD++ I AG+ FY+ N  E +RLHI+  +  V T          +
Sbjct  163  TVVKEEKKESHNLERGDLFRIPAGTPFYILNRDENERLHIVKLLKTVSTPG-------EY  215

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            ++F+  GG  P S    F P  L  A      ++ +L G +  G I+  +
Sbjct  216  EAFYSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDRLFGQQRRGSIIRAS  265



>ref|XP_008386543.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=485

 Score = 91.7 bits (226),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 81/167 (49%), Gaps = 12/167 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V+TE G ++V++     S  L       +GF+  EP + + P +LD+  VLF+ QG   I
Sbjct  106  VQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDADCVLFVCQGRPTI  165

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V ++K     ++ GD++ I AG+ FY+ N  + +RLHI+  +  V T          +
Sbjct  166  TLVREEKKESHNLERGDLFRIPAGTPFYILNRDDNERLHIVQLLKAVSTPG-------EY  218

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            ++F   GG  P S    F P  L  A      ++ +L G +  G I+
Sbjct  219  EAFHSAGGQDPESFFKAFSPEVLQAAFKTDRNKLDRLFGQQTRGSII  265



>emb|CAA90652.1| vicilin; 7S globulin [Zamia furfuracea]
Length=414

 Score = 90.5 bits (223),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 80/133 (60%), Gaps = 9/133 (7%)
 Frame = -2

Query  586  ITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVEN  407
            I++EP+S+L+P Y+++ L L++  G  R+  V++++L ER+++ GD+Y I AG  FY+ N
Sbjct  75   ISLEPRSVLLPHYIEADLALYVTGGRGRVAFVHEERLVERQLRDGDVYAIAAGIPFYILN  134

Query  406  TAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSM  227
            T + +RL I C +        + + T  ++SF++ GG +P +VL+ F    L  A N S 
Sbjct  135  TDDSRRLFIHCLLR------TQCSTTGLYESFYVVGGRNPQNVLSQFSEDVLQAAFNSSK  188

Query  226  VEISKLVGTKVSG  188
              +  ++   VSG
Sbjct  189  AVLDPML---VSG  198



>ref|XP_011008280.1| PREDICTED: uncharacterized protein LOC105113691 [Populus euphratica]
Length=138

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            ++  F L ++K V++T++GV+ V+R        R +HIGFITMEP+++ IPQY+   L+L
Sbjct  44   EEDWFSLQDSKRVIKTDAGVMTVLRNYGGRIVDRTLHIGFITMEPRAVFIPQYIHFSLIL  103

Query  526  FINQGEARIGHVYKDKLAERKV  461
            FI  GEAR+G +Y+DKLA+R++
Sbjct  104  FIRTGEARVGLIYRDKLADRRL  125



>gb|AAB01554.1| vicilin-like storage protein [Picea glauca]
Length=450

 Score = 87.4 bits (215),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/143 (29%), Positives = 84/143 (59%), Gaps = 6/143 (4%)
 Frame = -2

Query  607  RLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAG  428
            R   + FI M+P+++++P Y+D+  +L++ +G   I +V++++L +RK++ GD++ + +G
Sbjct  90   RKFRVTFIEMKPKTVMLPHYIDATWILYVTRGRGYITYVHQNELVKRKLEEGDVFGVPSG  149

Query  427  SAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLS  248
              FY+ N+ +   L I   +  V T  +RG     +Q F++ GG +P +V + F    L 
Sbjct  150  HTFYLVNSDDHNTLRIASLLRPVST--VRGE----YQPFYVAGGRNPQTVYSAFSDDVLE  203

Query  247  TALNVSMVEISKLVGTKVSGPIV  179
             A N ++ ++ ++ G   SG I+
Sbjct  204  AAFNTNVQQLERIFGGHKSGVII  226



>ref|XP_008355465.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=490

 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 77/167 (46%), Gaps = 12/167 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++TE G ++V++     S  L       +GF+  EP + + P +LD+  +LF+ QG   I
Sbjct  95   IQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDADSILFVFQGRPTI  154

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V  +K     ++ GD++ I AG+ FYV N  E ++LHI+     V T          +
Sbjct  155  XTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFKTVSTPG-------EY  207

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
             +F   GG  P S    F P  L  A      ++ +L G    G I+
Sbjct  208  AAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQXRRGSII  254



>ref|XP_009370838.1| PREDICTED: sucrose-binding protein-like [Pyrus x bretschneideri]
Length=476

 Score = 85.5 bits (210),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 78/167 (47%), Gaps = 12/167 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++TE G ++V++     S  L       +GF+  EP + + P +LD+  +LF+ QG   I
Sbjct  97   IQTEEGSVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVSPTHLDADSILFVFQGGPTI  156

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V  +K     ++ GD++ I AG+ FYV N  E ++LHI+     V T          +
Sbjct  157  TMVRGEKKESHNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFKTVSTPG-------EY  209

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
             SF   GG  P S    F P  L  A      ++ +L G +  G I+
Sbjct  210  ASFHSSGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQQRRGSII  256



>emb|CAA44873.1| vicilin-like storage protein [Picea glauca]
Length=448

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/143 (28%), Positives = 81/143 (57%), Gaps = 6/143 (4%)
 Frame = -2

Query  607  RLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAG  428
            R   +  I M+P ++++P Y+D+  +L++ +G   I +V++++L +RK++ GD++ + +G
Sbjct  88   RKFRVTCIEMKPNTVMLPHYIDATWILYVTRGRGYIAYVHQNELVKRKLEEGDVFGVPSG  147

Query  427  SAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLS  248
              FY+ N  +   L I   +  V T  +RG     +Q F++ GG +P +V + F    L 
Sbjct  148  HTFYLVNNDDHNTLRIASLVRPVST--VRGE----YQPFYVAGGRNPQTVYSAFSDDVLE  201

Query  247  TALNVSMVEISKLVGTKVSGPIV  179
             A N ++ ++ ++ G   SG I+
Sbjct  202  AAFNTNVQQLERIFGGHKSGVII  224



>ref|XP_008350065.1| PREDICTED: sucrose-binding protein-like [Malus domestica]
Length=524

 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/167 (29%), Positives = 77/167 (46%), Gaps = 12/167 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++TE G ++V++     S  L       +GF+  EP + + P +LD+  +LF+ QG   I
Sbjct  108  IQTEEGRVQVLQKFNERSDLLRGIENFRVGFLVTEPHAFVAPTHLDADSILFVFQGRPTI  167

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V  +K     ++ GD++ I AG+ FYV N  E ++LHI+     V T          +
Sbjct  168  XTVRGEKKESXNLERGDLFRIPAGTPFYVLNRDENEKLHIVELFKTVSTPG-------EY  220

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
             +F   GG  P S    F P  L  A      ++ +L G    G I+
Sbjct  221  AAFHSAGGQDPESFFRAFSPEVLQAAFKTDRNKLDRLFGQXRRGSII  267



>ref|XP_004292578.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Fragaria 
vesca subsp. vesca]
Length=512

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 80/171 (47%), Gaps = 12/171 (7%)
 Frame = -2

Query  667  VVRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            +V T+ G +++++  T  S  L       IG +  +P S + P + D+  V F+  G   
Sbjct  115  IVETDQGRVQILQKFTEKSDLLRGIANFRIGALITKPHSFVAPHHFDADCVFFVFHGRPT  174

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYT  323
            I  V  DK     ++ GD+  + AG+  Y+ N  E ++L ++  ++ V+  D        
Sbjct  175  ISMVRGDKRESHNLERGDILRVPAGTPVYIINRDENEKLFVVKLLHPVNLPDQ-------  227

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            F++F+ GGG +P S    F P  L  A      E+ +L G +  G I+  +
Sbjct  228  FEAFYEGGGENPQSFFKAFSPEVLEAAFKTERDELRRLFGQQRQGSIMKAS  278



>ref|XP_006466758.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Citrus 
sinensis]
Length=585

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 87/174 (50%), Gaps = 6/174 (3%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            + M   +E + ++ TE G I   + ST  + R  ++ FIT+EP SL +P  L + +V ++
Sbjct  35   RPMVKRDERRSLIETEYGRISAAKISTDGTRRPYYLQFITLEPNSLFLPALLHADMVFYV  94

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            + G  R+    +D +    ++ GD+Y ++ GS FY+E+  E +R  +       +T +  
Sbjct  95   HTGRGRLSWADEDAIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEN--  152

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
              D+Y F+   IG     + ++ GFD   L +A  VS   I +L       PIV
Sbjct  153  --DSY-FEP-VIGAYTSISDLILGFDRKVLQSAFKVSEDVIEELFNATRPRPIV  202



>ref|XP_006425720.1| hypothetical protein CICLE_v10027019mg, partial [Citrus clementina]
 gb|ESR38960.1| hypothetical protein CICLE_v10027019mg, partial [Citrus clementina]
Length=529

 Score = 81.3 bits (199),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 87/174 (50%), Gaps = 6/174 (3%)
 Frame = -2

Query  700  KKMFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFI  521
            + M   +E + ++ TE G I   + ST  + R  ++ FIT+EP SL +P  L + +V ++
Sbjct  12   RPMVKRDERRSLIETEYGRISAAKISTDGTRRPYYLQFITLEPNSLFLPALLHADMVFYV  71

Query  520  NQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            + G  R+    +D +    ++ GD+Y ++ GS FY+E+  E +R  +       +T +  
Sbjct  72   HTGRGRLSWADEDAIRTLDIRRGDVYRLQPGSVFYIESNLEQEREKLRIYAIFSNTEN--  129

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
              D+Y F+   IG     + ++ GFD   L +A  VS   I +L       PIV
Sbjct  130  --DSY-FEP-VIGAYTSISDLILGFDRKVLQSAFKVSEDVIEELFNATRPRPIV  179



>ref|XP_008235388.1| PREDICTED: sucrose-binding protein-like [Prunus mume]
Length=508

 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/170 (28%), Positives = 82/170 (48%), Gaps = 12/170 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V+TE G  ++++  T  S  L       IGF+  +P + + P + D+  VLF+ QG   +
Sbjct  118  VQTEEGRFQLLQKFTERSDLLRAIENYRIGFLVTKPHAFVAPSHFDADTVLFVFQGRPAV  177

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V  +K     ++ GD++ I AG+  Y+ N  E ++L I   +N +    + G     +
Sbjct  178  TIVRGEKRETHNLERGDLFRIPAGTPVYMVNRDENEKLFI---VNFMKPVSVPG----EY  230

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            ++F+  GG +P S    F P  L  AL   M ++ +L G +  G I   +
Sbjct  231  EAFYAAGGENPESFFKAFSPQVLQAALKTEMNKLERLFGQQRQGSITRAS  280



>ref|XP_007200965.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
 gb|EMJ02164.1| hypothetical protein PRUPE_ppa004438mg [Prunus persica]
Length=510

 Score = 77.8 bits (190),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 87/184 (47%), Gaps = 13/184 (7%)
 Frame = -2

Query  703  QKKMFILNEAKEV-VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLD  542
            Q   F  +E  E  V+TE G  ++++  T  S  L       IGF+  +P + + P + D
Sbjct  104  QNPYFFEDEHFETRVQTEEGRFQLLQKFTERSDLLRAIENYRIGFLVTKPHAFVAPCHFD  163

Query  541  SHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINI  362
            +  VLF+ QG   +  V  +K     ++ GD++ I AG+  Y+ N  E ++L I   +N 
Sbjct  164  ADTVLFVFQGRPAVTIVRGEKRETHNLEHGDLFRIPAGTPVYMVNRDENEKLFI---VNF  220

Query  361  VDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPI  182
            +    + G     +++F+  GG +P S    F P  L  AL   + ++ +L G +  G I
Sbjct  221  MKPVSVPG----EYEAFYAAGGENPESFFKAFSPQVLQAALKTEINKLERLFGQQRQGSI  276

Query  181  VSLT  170
               +
Sbjct  277  TRAS  280



>pdb|4LEJ|A Chain A, Crystal Structure Of The Korean Pine (pinus Koraiensis) 
Vicilin
Length=407

 Score = 75.9 bits (185),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 72/135 (53%), Gaps = 6/135 (4%)
 Frame = -2

Query  586  ITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVEN  407
            I M+P ++++P Y+D+  +L++  G   I +V +++L +RK++ GD++ + +G  FY+ N
Sbjct  53   IEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVN  112

Query  406  TAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSM  227
              +   L I   +    T  MRG     ++ F++ GG +P +V + F    L  A N  +
Sbjct  113  NDDHNSLRIASLLRTEST--MRGE----YEPFYVAGGRNPETVYSAFSDDVLEAAFNTDV  166

Query  226  VEISKLVGTKVSGPI  182
             ++  + G    G I
Sbjct  167  QKLEHIFGAHRRGVI  181



>gb|AHC94918.1| vicilin [Pinus koraiensis]
Length=463

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 72/135 (53%), Gaps = 6/135 (4%)
 Frame = -2

Query  586  ITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVEN  407
            I M+P ++++P Y+D+  +L++  G   I +V +++L +RK++ GD++ + +G  FY+ N
Sbjct  109  IEMKPNTVMLPHYIDAKWILYVTGGRGYIAYVQQNELVKRKLEEGDVFGVPSGHTFYLVN  168

Query  406  TAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSM  227
              +   L I   +    T  MRG     ++ F++ GG +P +V + F    L  A N  +
Sbjct  169  NDDHNSLRIASLLRTEST--MRG----EYEPFYVAGGRNPETVYSAFSDDVLEAAFNTDV  222

Query  226  VEISKLVGTKVSGPI  182
             ++  + G    G I
Sbjct  223  QKLEHIFGAHRRGVI  237



>gb|AAL86739.1|AF441864_1 48-kDa glycoprotein precursor [Corylus avellana]
Length=448

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 81/177 (46%), Gaps = 14/177 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM------HIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            V+TE G ++V+   T  S RL+       +  +   P + + P + D+ LVLF+ +G A 
Sbjct  73   VKTEEGRVQVLENFTKRS-RLLSGIENFRLAILEANPHTFISPAHFDAELVLFVAKGRAT  131

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYT  323
            I  V ++K     V+ GD+  I AG+  Y+ N  E ++L I+  +  V            
Sbjct  132  ITMVREEKRESFNVEHGDIIRIPAGTPVYMINRDENEKLFIVKILQPVSAPGH-------  184

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            F++F+  GG  P S    F    L  AL V   ++ K+ G +  G IV  +     A
Sbjct  185  FEAFYGAGGEDPESFYRAFSWEVLEAALKVRREQLEKVFGEQSKGSIVKASREKIRA  241



>gb|ABO36677.1| vicilin [Pistacia vera]
Length=519

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 80/176 (45%), Gaps = 12/176 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V+TE G + V+   T  S  L       + F+   PQ+ ++P ++D+  + F++ G   I
Sbjct  140  VKTEQGKVVVLPKFTKRSKLLRGLEKYRLAFLVANPQAFVVPNHMDADSIFFVSWGRGTI  199

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              + ++K     VK GD+  I AG+ FY+ NT E ++L+I+  +  V+           +
Sbjct  200  TKIRENKRESMNVKQGDIIRIRAGTPFYIVNTDENEKLYIVKLLQPVNLPGH-------Y  252

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            + F   GG +P S    F    L  AL     ++ KL   +  G IV  +     A
Sbjct  253  EVFHGPGGENPESFYRAFSREVLEAALKTPRDKLEKLFEKQDEGAIVKASKEQIRA  308



>gb|AFK48280.1| unknown [Lotus japonicus]
Length=73

 Score = 68.6 bits (166),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSD  347
            +Y D+L+ER++K+GD+Y I AGSAFY+ N  EGQRLHIICSI+   + D
Sbjct  1    MYGDELSERRLKTGDLYVIPAGSAFYLVNLGEGQRLHIICSIDTSTSMD  49



>ref|NP_001291343.1| vicilin-like antimicrobial peptides 2-2 precursor [Sesamum indicum]
 gb|AAK15089.1|AF240006_1 7S globulin [Sesamum indicum]
Length=585

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 77/175 (44%), Gaps = 12/175 (7%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIG  497
            RT+ G ++V++  T  S  L       +  +  EPQ+ ++P + D+  V+F+ +G   I 
Sbjct  208  RTQHGRMRVLQKFTDRSELLRGIENYRVAILEAEPQTFIVPNHWDAESVVFVAKGRGTIS  267

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             V +D+     +K GD+  I AG+  Y+ N    +RL +   +  V T          F+
Sbjct  268  LVRQDRRESLNIKQGDILKINAGTTAYLINRDNNERLVLAKLLQPVSTPG-------EFE  320

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
             FF  GG +P S    F    L  A N     + ++ G +  G IV  +     A
Sbjct  321  LFFGAGGENPESFFKSFSDEILEAAFNTRRDRLQRIFGQQRQGVIVKASEEQVRA  375



>ref|XP_008339320.1| PREDICTED: globulin-1 S allele-like [Malus domestica]
Length=723

 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 70/138 (51%), Gaps = 7/138 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            HI FIT+EP SL +P  L + ++ ++N G  R+     DK+    +K GD+Y +  GS F
Sbjct  78   HIQFITLEPNSLFLPVLLHADMIFYVNTGSGRLSWTDDDKIRRVDIKRGDLYRLTPGSVF  137

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            +V++  E +R  +   IN + TS+    D Y      +G       ++ GFDP  L +A 
Sbjct  138  FVQSNLETERQKL--RINAIFTSN-SDDDLYDPA---VGAYSSIRDLVRGFDPKLLRSAF  191

Query  238  NVSMVEISKLV-GTKVSG  188
             VS   I  +V GT  S 
Sbjct  192  KVSEEVIESIVNGTDQSA  209



>ref|XP_010911186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2, partial [Elaeis 
guineensis]
Length=555

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 77/170 (45%), Gaps = 12/170 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            VRTE G I+V R     S  L+      +  I   P + ++P + D+  +LF+ +G   +
Sbjct  161  VRTEHGQIRVFRNFFEKSKLLLGVANYRVAIIETNPNTFVLPSHFDAEALLFVARGNGIL  220

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              + +D     +++ GD+  + AG+   + N    ++L I+C +  V T  M       F
Sbjct  221  TLMCQDNKEAHELRRGDIMRVRAGAIASLMNKDRNEKLVIVCLLQPVATPGM-------F  273

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            ++F   GG +P S    F    L  A N    ++ +L   +  GPI+  +
Sbjct  274  EAFVGAGGQNPESFYRSFSKQVLRAAFNTREDKLKRLFEKQQKGPIIQAS  323



>emb|CAA91188.1| vicilin [Zamia furfuracea]
Length=287

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 63/112 (56%), Gaps = 6/112 (5%)
 Frame = -2

Query  541  SHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINI  362
            + L L++  G  R+  V++++L ER+++ GD+Y I AG  FY+ NT + +RL I C +  
Sbjct  1    ADLALYVTGGRGRVAFVHEERLVERQLRDGDVYAIAAGIPFYILNTDDSRRLFIHCLLRT  60

Query  361  VDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLV  206
              ++      T  ++SF++ GG +P +VL+ F    L  A N S   +  ++
Sbjct  61   QCST------TGLYESFYVVGGRNPQNVLSQFSEDVLQAAFNSSKAVLDPML  106



>ref|XP_011090693.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Sesamum indicum]
Length=626

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 96/214 (45%), Gaps = 20/214 (9%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIG  497
            RTE G +KV+   +  S  L       +  +   P + ++P + D+  VL +  G+  I 
Sbjct  235  RTEEGNVKVLERFSKKSELLQGVDNYRLAVLEANPNTFVLPHHFDAESVLVVAGGKGTIS  294

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
            +V++++     VK GD+  + AGS  Y+ N  + ++L+++  +  V+T          F+
Sbjct  295  YVWQNRRKSYNVKLGDVMRVPAGSIVYLVNRDDNEKLYVLKLLQPVNTPG-------RFK  347

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAH  137
             +F  GG +P S    F    L  A NV    + +L G +  G I+  +     A     
Sbjct  348  EYFGVGGENPESFYRTFSNEILEAAFNVPSDRLKRLFGQQKKGVIIRASKEQIRA-----  402

Query  136  LKRIVHYSDVEQQQQHYWAPWLFM--RKLLTNHY  41
            L +    S   ++++  W P+  +  R L +N Y
Sbjct  403  LSQESEESSRGRREES-WGPFNLLEGRPLFSNRY  435



>ref|XP_009356668.1| PREDICTED: globulin-1 S allele-like [Pyrus x bretschneideri]
Length=664

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 68/131 (52%), Gaps = 6/131 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            HI FIT+EP SL +P  L +++V ++N G  R+     DK+    +K GD+Y +  GS F
Sbjct  80   HIQFITLEPNSLFLPVLLHAYMVFYVNTGSGRLSWTDDDKIRRVDIKRGDLYRLTPGSVF  139

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            +V++  E +R  +   IN + TS+    D Y      +G       ++ GFDP  L +A 
Sbjct  140  FVQSNLETERQKL--RINAIFTSN-SDDDLYDPA---VGPYSSIRDLVRGFDPKLLQSAF  193

Query  238  NVSMVEISKLV  206
             VS   I  +V
Sbjct  194  KVSEEVIESIV  204



>ref|XP_010054529.1| PREDICTED: sucrose-binding protein-like [Eucalyptus grandis]
 gb|KCW76785.1| hypothetical protein EUGRSUZ_D01140 [Eucalyptus grandis]
Length=566

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/179 (27%), Positives = 79/179 (44%), Gaps = 12/179 (7%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            K +V TE G + V+   T  S  L       +  +  EP +  +P + D+  VLFI +G 
Sbjct  170  KAIVETEHGRVSVLPKFTKRSKLLRGIENFRLALLEAEPNTFEVPSHWDTDAVLFIVEGR  229

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADT  329
              I  V ++K     ++ GD+  +EAG+  Y+ N  + Q+L I   +  V+         
Sbjct  230  GTITLVRQNKRQSINIEEGDIVRVEAGTPVYMINRDQNQKLIIAQLLRPVNLPSQ-----  284

Query  328  YTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
              F++F+  GG +P S    F    L  AL     ++ +L G +  G IV  +     A
Sbjct  285  --FEAFYGTGGQNPESFYTAFSWEVLEAALKTDRNKLERLFGQQQQGAIVKASREQIEA  341



>sp|Q9SPL4.1|AMP22_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-2; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54245.1|AF161884_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 12/169 (7%)
 Frame = -2

Query  661  RTESGVIKVVR---GSTSTSGRLMHIGFITME--PQSLLIPQYLDSHLVLFINQGEARIG  497
            RTE G I V+    G +     L +   + +E  P + ++P +LD+  +L +  G   + 
Sbjct  264  RTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVTGGRGALK  323

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             +++D      ++ GD+  I AG+ FY+ N    +RLHI   +  + T          ++
Sbjct  324  MIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQ-------YK  376

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             FF  GG +P   L+ F    L  ALN     +  ++G +  G I+S +
Sbjct  377  EFFPAGGQNPEPYLSTFSKEILEAALNTQAERLRGVLGQQREGVIISAS  425



>ref|XP_009374239.1| PREDICTED: LOW QUALITY PROTEIN: vicilin-like antimicrobial peptides 
2-2, partial [Pyrus x bretschneideri]
Length=603

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 77/169 (46%), Gaps = 7/169 (4%)
 Frame = -2

Query  685  LNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEA  506
            +N+ + +V TE G +  V        R  HI FIT+EP SL +P  L + +V ++N G  
Sbjct  42   INQRRSLVSTEYGEVWSV-DVNDGHRRPYHIQFITLEPDSLFLPVLLHADMVFYVNTGSG  100

Query  505  RIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTY  326
            R+     D++    +K GD+Y ++ G+ F+V++  E     +  +      SD    D Y
Sbjct  101  RLSWTDDDEIRRVDIKRGDLYRLDPGTVFFVQSNLETGSPKLRINAIFASNSD---DDLY  157

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
                  +G       ++ GFDP  L +A  VS   I  +V       IV
Sbjct  158  DPA---VGAYSSIRDIVRGFDPKLLRSAFKVSEEVIESIVNGTDQSAIV  203



>ref|XP_008241881.1| PREDICTED: globulin-1 S allele, partial [Prunus mume]
Length=596

 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 83/167 (50%), Gaps = 10/167 (6%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            ++ + +V TE G I  +  S    G   HI FIT+EP SL +P  L + +VL+++ G  R
Sbjct  54   DQRRALVVTEYGEISSIDISDGHRGPY-HIQFITLEPNSLFLPVLLHADMVLYVHTGSGR  112

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTY  326
            +    +D +    +K GD++ +  GS F+V++  + +R  + I +I   +T D    D Y
Sbjct  113  LSWGDEDDIKRVAIKRGDLFRLRPGSVFFVQSDLQAERQKLRIYAIFATNTDD----DLY  168

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLV-GTKVSG  188
                  IG       ++  FDP  L +A  VS   I  ++ GT  SG
Sbjct  169  DPA---IGAYSSVRDLVRAFDPKVLRSAFKVSDEVIESIINGTDQSG  212



>dbj|BAB78478.1| preproMP73 [Cucurbita maxima]
Length=685

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 77/164 (47%), Gaps = 11/164 (7%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            NE K +++TE G I  V    ++     H+ FITMEP SL +P  L + +VL+++ G  R
Sbjct  46   NERKSLLKTEYGEISAVDLHDASQFGPYHLQFITMEPNSLFLPVLLHADMVLYMHTGSGR  105

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQR--LHIICSINIVDTSDMRGADT  329
            +     D L E  ++ GD++ ++ G+ FY+ ++ E +R  L +    +  D      A  
Sbjct  106  LNWFDDDDLREVDLRRGDIFRLQPGAIFYIHSSLETEREKLRMYALFSSTDEDPFEPA--  163

Query  328  YTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTK  197
                   IG     T  + GFD   L  A  V    I +++  K
Sbjct  164  -------IGAYSRVTDHVRGFDKEILCKAFMVPEEVIEEIMDAK  200



>ref|XP_009786980.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=497

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 80/177 (45%), Gaps = 13/177 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++T+ G I+V+   T  S  L       +  +   PQ+ ++P + D+  VLF+ QG   +
Sbjct  107  IKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQTFIVPNHWDADAVLFVAQGRGTL  166

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V + K     +++GD+  + AG+  Y+ N    ++L I   +N V T          F
Sbjct  167  NLVRRGKRNSFNIRAGDVIRVHAGTTAYLINRDNNEKLVIAKLLNPVSTPGQ-------F  219

Query  319  QSFF-IGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            + FF  GG  +P S    F    L +ALNV    + +L G +  G I+  +     A
Sbjct  220  EHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQRLFGQQREGVIIRASEEQIRA  276



>ref|XP_010905079.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Elaeis guineensis]
Length=731

 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 74/152 (49%), Gaps = 15/152 (10%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            + +V T+SG+I  V       G L H+ FITMEP SL +P  L + ++ ++  G   + +
Sbjct  38   RTLVTTDSGMITAVDVHDGYKG-LYHLQFITMEPSSLFLPVLLHTDMLFYVQTGRGTVSY  96

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVEN----TAEGQRLHIICSINIVDTSDMRGADTY  326
              +D   +  VK GD+Y +E G+ FYV +      E  R+H      I DT++M      
Sbjct  97   TTEDGTTQVDVKRGDIYRLEEGTVFYVRSHPDPMREKLRIHA-----IFDTNNMENPSES  151

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVS  230
                 F+G   + + ++ GFD   L  +  VS
Sbjct  152  -----FVGAYSNISDLVRGFDEKVLEMSFAVS  178



>ref|XP_007144650.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
 gb|ESW16644.1| hypothetical protein PHAVU_007G173600g [Phaseolus vulgaris]
Length=502

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 79/168 (47%), Gaps = 12/168 (7%)
 Frame = -2

Query  658  TESGVIKVVRGSTSTSGRLMHIGFITM-----EPQSLLIPQYLDSHLVLFINQGEARIGH  494
            TE G I++++  T  S  L  I  I +     +P + + P++ DS +VLF  +G A +G 
Sbjct  129  TEDGRIRLLKKFTEKSELLKGIENIRLTIVEAKPHTFVAPRHFDSDVVLFNIKGRAVLGW  188

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
            V + +  +  ++SGDM  I AG+  Y+ N  E ++L +      V T          FQ 
Sbjct  189  VKESETEKFILESGDMLAIPAGTPLYIVNRDENEKLFLAMLHVPVSTPG-------KFQE  241

Query  313  FFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
            FF  GG  P S L+ F    L  AL     ++ KL   +  G I  ++
Sbjct  242  FFGPGGRDPESFLSAFGWNVLQAALQSPKGQLEKLFNQQNGGSIFEIS  289



>ref|XP_009607668.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
tomentosiformis]
Length=499

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 79/177 (45%), Gaps = 13/177 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++T+ G I+V+   T  S  L       +  +   PQ+ ++P + D+  VLF+ QG   +
Sbjct  109  IKTQHGRIRVLPKFTERSKLLKGIENYRVAILEANPQTFIVPNHWDADAVLFVAQGRGTL  168

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V + K     ++ GD+  + AG+  Y+ N    ++L I   +N V T          F
Sbjct  169  NLVRRGKRNSFNIRPGDVIRVHAGTTAYLINRENNEKLVIAKLLNPVSTPGQ-------F  221

Query  319  QSFF-IGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            + FF  GG  +P S    F    L +ALNV    + +L G +  G I+  +     A
Sbjct  222  EHFFGPGGRENPESFYNAFSSEILESALNVRRDRLQRLFGQQREGVIIRASEEQIRA  278



>gb|EYU41459.1| hypothetical protein MIMGU_mgv1a003361mg [Erythranthe guttata]
Length=590

 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 78/175 (45%), Gaps = 12/175 (7%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHLVLFINQGEARIG  497
            RTE G IK++   +  S  L  I       +   P + ++P + D+  V  +  G   I 
Sbjct  193  RTEQGHIKILERFSKNSDLLQGIENYRLAILEANPNTFVLPHHCDAESVFLVVGGRGTIS  252

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
            +V++ +     +KSG +  + AGS  Y+ N  + +RL+I+  +  V+T          F+
Sbjct  253  YVWEKQRKSYNLKSGGVLWVPAGSIVYLTNNDDNERLYILKLLQPVNTPG-------KFK  305

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
             +F  GG +P S  + F    L  A N    ++ +L G +  G I+  +     A
Sbjct  306  EYFGVGGENPESFYSSFSNEILEAAFNTQSEKLQRLFGQQSKGVIIKASKEQIRA  360



>ref|XP_006369592.1| hypothetical protein POPTR_0001s26660g [Populus trichocarpa]
 gb|ERP66161.1| hypothetical protein POPTR_0001s26660g [Populus trichocarpa]
Length=113

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 45/62 (73%), Gaps = 1/62 (2%)
 Frame = -2

Query  703  QKKMFILNEAKEVVRTESGVIKVVRG-STSTSGRLMHIGFITMEPQSLLIPQYLDSHLVL  527
            ++  F+L ++K V++T++GV+ V+R        R MHIGFITMEP+++ IPQY+ S L+L
Sbjct  44   EEDWFLLQDSKRVIKTDAGVMTVLRNYGGRIVDRAMHIGFITMEPRAVFIPQYIHSSLIL  103

Query  526  FI  521
            FI
Sbjct  104  FI  105



>sp|Q9SPL3.1|AMP23_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-3; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor, 
partial [Macadamia integrifolia]
 gb|AAD54246.1| vicilin precursor [Macadamia integrifolia]
Length=625

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 77/169 (46%), Gaps = 12/169 (7%)
 Frame = -2

Query  661  RTESGVIKVVR---GSTSTSGRLMHIGFITME--PQSLLIPQYLDSHLVLFINQGEARIG  497
            RTE G I V+    G +     L +   + +E  P + ++P +LD+  +L +  G   + 
Sbjct  223  RTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALK  282

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             +++D      ++ GD+  I AG+ FY+ N    +RLHI   +  + T          ++
Sbjct  283  MIHRDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQ-------YK  335

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             FF  GG +P   L+ F    L  ALN     +  ++G +  G I+  +
Sbjct  336  EFFPAGGQNPEPYLSTFSKEILEAALNTQTERLRGVLGQQREGVIIRAS  384



>ref|XP_008451293.1| PREDICTED: sucrose-binding protein-like [Cucumis melo]
Length=515

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/215 (25%), Positives = 96/215 (45%), Gaps = 23/215 (11%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V T  G IKV++  T  S  L       +  +   P + ++P + D+ +++F+ QG   I
Sbjct  129  VETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFDAEIIMFVAQGRGTI  188

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V K+K     +K GD++ I +G+ FY  N  E Q+L I   + ++ ++ + G     F
Sbjct  189  T-VIKEKRGSFDLKCGDVFRIPSGAPFYFINKDEHQKLKI---VKLLQSTSVPGH----F  240

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPILA  140
            Q+F   GG +P S    F    L  A  +   ++ +    +  G I+  +     + +  
Sbjct  241  QTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQRPGTIIKASREQIRS-LSQ  299

Query  139  H---LKRIVHYSDVEQQ------QQHYWAPWLFMR  62
            H   + +I  +S+ E +      +QH W    F R
Sbjct  300  HEEIIPKIWPFSEGETERPFNLLKQHPWQSNKFGR  334



>ref|XP_009417381.1| PREDICTED: globulin-1 S allele-like [Musa acuminata subsp. malaccensis]
Length=437

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 12/175 (7%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHLVLFINQGEARIG  497
            R+E G  KV+   +  S  L+ I       +  EP++ ++P + D+  V ++ +G   I 
Sbjct  43   RSEHGRFKVLERFSRRSELLIGIENYRLAIMEAEPETFIMPSHWDAEEVFYVMEGRGTIT  102

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             ++++     ++K GD+  I AG   Y  N A+ +RLHI   ++ + T          F+
Sbjct  103  LLHEENRESHEIKRGDIMRIPAGVIVYAINKAKNERLHIAMLLHPISTPGH-------FE  155

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
             FF   G +P S    F    L  A N     + +L   +  G I+ +T     A
Sbjct  156  EFFGAAGSNPESFYNSFSNGVLEAAFNTPRDRLERLFERQKKGEIIKITEEQIRA  210



>gb|ACU17936.1| unknown [Glycine max]
Length=288

 Score = 67.4 bits (163),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 83/176 (47%), Gaps = 12/176 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V TE G I+V++  T  S  L       +  +     + + P++ DS +VLF  +G A +
Sbjct  111  VETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDSEVVLFNIRGRAVL  170

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
            G V + +  +  ++ GDM  I AG+  Y+ N  E ++L ++  ++I  ++  +      F
Sbjct  171  GLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKL-LLAMLHIPVSTPGK------F  223

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            + FF  GG  P SVL+ F    L  AL     ++ +L   +  G I  ++     A
Sbjct  224  EEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFKISRERVRA  279



>ref|XP_006839012.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
 gb|ERN01581.1| hypothetical protein AMTR_s00002p00272040 [Amborella trichopoda]
Length=523

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 67/140 (48%), Gaps = 7/140 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             I  + ++P + ++P + D+ ++ ++  G+AR+  + +++     +K GD  TI AG   
Sbjct  133  RICIMELKPNAFVLPHHKDADIIYYVANGDARLVTIGEERQDSHNLKKGDTATIPAGKTT  192

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    + L I+  +  + T          ++ FF   G +P S L  F    L  + 
Sbjct  193  YIINKDSQRELKIVALLQTISTPGQ-------YEIFFGATGQNPPSYLRAFSDEILEASF  245

Query  238  NVSMVEISKLVGTKVSGPIV  179
            NV    +S+L+  K  GPIV
Sbjct  246  NVDRSRLSRLLEQKGQGPIV  265



>ref|XP_004247670.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=424

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 67/157 (43%), Gaps = 8/157 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             IG +  EP+S L+P + D+ L+L I +G   I    +D+     ++ GD+ ++ AGS  
Sbjct  76   RIGVLEFEPRSFLLPHHFDAQLLLLIVRGRGSISIAEEDEKNSFNLEYGDVLSVSAGSTI  135

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y  NT   ++  +      ++           FQ FF  G  +P +    F    L TA 
Sbjct  136  YFTNTDNKEKFSVYVLAKAINVPGQ-------FQEFFSAGSENPETFYRAFSSDILETAF  188

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKR  128
            N     + +L G +  G I+  +     A I  H  R
Sbjct  189  NTPRSRLERLFGLQKQGIIIKASEEKIRA-ISQHASR  224



>gb|ABU45197.1| unknown [Petunia integrifolia subsp. inflata]
Length=750

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 84/168 (50%), Gaps = 10/168 (6%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E K VV TE+G +  VR +   +G   H+ FIT+EP SL +P  L + +V +++ G  R+
Sbjct  50   ERKSVVTTENGEVSSVRIADGVTGSY-HLQFITLEPNSLFLPVLLHADMVFYVHTGSGRL  108

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTYT  323
              + +D+L    ++ GD++ +  G+ F++E+  E  R  + + SI      D+R      
Sbjct  109  TWMGEDELKSEDLRIGDVFRLPFGTIFFLESNLEPARQKLRVYSIFANSGDDLR------  162

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLV-GTKVSGPI  182
             +    G       ++ GFD   L  A NV    I +++ GT+V   I
Sbjct  163  -EPLSTGPYSSIRDIILGFDRKVLQAAFNVPESVIDEVLNGTEVPAII  209



>gb|AAM73729.1|AF395893_1 vicilin-like protein [Anacardium occidentale]
Length=536

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 82/177 (46%), Gaps = 14/177 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            V+TE G + ++   T  S +L+H      +  +   PQ+ ++P ++D+  + F++ G   
Sbjct  162  VKTEQGKVVLLPKFTQKS-KLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGT  220

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYT  323
            I  + ++K     V+ GD+ +I +G+ FY+ N  E ++L+++  +  V+           
Sbjct  221  ITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGH-------  273

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            F+ F   GG +P S    F    L  AL  S   + KL   +  G I+  +     A
Sbjct  274  FEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASKEQVRA  330



>gb|AAM73730.2|AF395894_1 vicilin-like protein [Anacardium occidentale]
Length=538

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 82/177 (46%), Gaps = 14/177 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            V+TE G + ++   T  S +L+H      +  +   PQ+ ++P ++D+  + F++ G   
Sbjct  164  VKTEQGKVVLLPKFTQKS-KLLHALEKYRLAVLVANPQAFVVPSHMDADSIFFVSWGRGT  222

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYT  323
            I  + ++K     V+ GD+ +I +G+ FY+ N  E ++L+++  +  V+           
Sbjct  223  ITKILENKRESINVRQGDIVSISSGTPFYIANNDENEKLYLVQFLRPVNLPGH-------  275

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            F+ F   GG +P S    F    L  AL  S   + KL   +  G I+  +     A
Sbjct  276  FEVFHGPGGENPESFYRAFSWEILEAALKTSKDTLEKLFEKQDQGTIMKASKEQIRA  332



>ref|XP_004162195.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 80/173 (46%), Gaps = 13/173 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            V T  G IKV++  T  S  L       +  +   P + ++P + D+ ++LF+ QG   I
Sbjct  99   VETGEGKIKVLQKFTQRSQLLRGIENFRVSIVEANPSTFVVPTHFDAEIILFVAQGRGTI  158

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V K+K    ++K GD++ I +G+ FY  N  E ++L I   + ++ ++ + G     F
Sbjct  159  T-VIKEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKI---VKLLQSTSVPG----HF  210

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
            Q+F   GG +P S    F    L  A  +   ++ +    +  G I+  +   
Sbjct  211  QTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263



>gb|EYU40904.1| hypothetical protein MIMGU_mgv1a003248mg [Erythranthe guttata]
Length=597

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/176 (23%), Positives = 78/176 (44%), Gaps = 12/176 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + T+ G ++++   T  S  L       +  +  EPQ+ ++P + D+  ++F+  G   +
Sbjct  215  METQHGRLRILPKFTDRSKLLKGIENYRVAILEAEPQTFIVPNHWDADTLIFVANGRGAV  274

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              + +++     +K GD++ I AG+  Y+ N    Q+L +   +  V+T          F
Sbjct  275  SLMRQERRESFNIKQGDIFRINAGTTAYLINRDSNQKLVLAKLLQPVNTPGQ-------F  327

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            ++FF  GG +P S    F    L  A N     + +L G +  G I+  +     A
Sbjct  328  EAFFGAGGENPESFYTAFSNDILEAAFNTRRDRLQRLFGQQKQGVIIKASEEQVRA  383



>ref|XP_010680893.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
[Beta vulgaris subsp. vulgaris]
Length=744

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 81/177 (46%), Gaps = 12/177 (7%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVR--GSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLF  524
            K+    E   VV TE G I  V     T T     H+ FIT+EP S+ +P  L++ +V +
Sbjct  51   KLVKKEERIPVVATEYGEISAVDIDDGTGTGRHNYHLQFITLEPNSIFLPVLLNADMVFY  110

Query  523  INQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENT--AEGQRLHIICSINIVDTS  350
            +  G  +I     D+L +  ++ GD+Y + +G+ FY+ ++  AE  RL II      +  
Sbjct  111  VQTGSGKISWANSDELYKVSLQRGDVYRLRSGTLFYIHSSLEAERPRLRIIAIFANPEEE  170

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
             ++G          IG   +   ++ GFD   L  A  VS   I +L     +  IV
Sbjct  171  QLQGPS--------IGPYSNINDLVRGFDKRVLQAAFQVSEEVIEELTSATDTPAIV  219



>gb|KHN18868.1| Sucrose-binding protein [Glycine soja]
Length=423

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 88/188 (47%), Gaps = 15/188 (8%)
 Frame = -2

Query  691  FILNEAKEV---VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSH  536
            ++  E K+    V TE G I+V++  T  S  L  I       +     + + P++ DS 
Sbjct  33   YVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDSE  92

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            +VLF  +G A +G V + +  +  ++ GDM  I AG+  Y+ N  E ++L ++  ++I  
Sbjct  93   VVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKL-LLAMLHIPV  151

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            ++  +      F+ FF  GG  P SVL+ F    L  AL     ++ +L   +  G I  
Sbjct  152  STPGK------FEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFK  205

Query  175  LTNSNYTA  152
            ++     A
Sbjct  206  ISRERVRA  213



>ref|XP_008798757.1| PREDICTED: uncharacterized protein LOC103713559 isoform X1 [Phoenix 
dactylifera]
Length=675

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 78/168 (46%), Gaps = 9/168 (5%)
 Frame = -2

Query  697  KMFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFIN  518
            ++  +   + +V T+SG+I          G L H+ FITMEP SL +P  L + ++ ++ 
Sbjct  30   RLVPMESRRTLVTTDSGLITAADVHDGYRG-LYHLQFITMEPSSLFLPVLLHTDMLFYVQ  88

Query  517  QGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSIN-IVDTSDMR  341
             G   + +  +D      V+ GD+Y +E G+ FYV +     R  +   IN I DT++M 
Sbjct  89   TGSGTVSYTTEDGTTRVDVERGDIYRLEEGTVFYVRSHPSPMREKL--RINAIFDTNNME  146

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTK  197
                      F+G   + + ++ GFD   L     VS   I  + G K
Sbjct  147  NPSES-----FVGAYSNISDLVRGFDDKVLEMGFGVSKEIIRSIEGVK  189



>gb|AAF05723.1|AF191299_1 sucrose binding protein homolog S-64 [Glycine max]
Length=489

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 88/188 (47%), Gaps = 15/188 (8%)
 Frame = -2

Query  691  FILNEAKEV---VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSH  536
            ++  E K+    V TE G I+V++  T  S  L       +  +     + + P++ DS 
Sbjct  99   YVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGNENFRLAILEARAHTFVSPRHFDSE  158

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            +VLF  +G A +G V + +  +  ++ GDM  I AG+  Y+ N  E ++L ++  ++I  
Sbjct  159  VVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKL-LLAMLHIPV  217

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            ++  +      F+ FF  GG  P SVL+ F    L  AL     ++ +L   +  G I  
Sbjct  218  STPGK------FEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFK  271

Query  175  LTNSNYTA  152
            ++     A
Sbjct  272  ISRERVRA  279



>gb|EYU23233.1| hypothetical protein MIMGU_mgv1a024110mg [Erythranthe guttata]
Length=592

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 67/149 (45%), Gaps = 7/149 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  +  EPQ+ ++P + D+  ++F+  G   +  + +++     +K GD++ I AG+  
Sbjct  247  RVAILEAEPQTFIVPNHWDADTLIFVANGRGAVSLMRQERRESFNIKQGDIFRINAGTTA  306

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    Q+L +   +  V+T          F++FF  GG +P S    F    L  A 
Sbjct  307  YLINRDSNQKLVLAKLLQPVNTPGQ-------FEAFFGAGGENPESFYTAFSNEILEAAF  359

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            N     + +L G +  G I+  +     A
Sbjct  360  NTRRDRLQRLFGQQKQGVIIKASEEQVRA  388



>ref|XP_003536630.1| PREDICTED: sucrose-binding protein-like [Glycine max]
 gb|KHN03813.1| Sucrose-binding protein [Glycine soja]
Length=504

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 84/193 (44%), Gaps = 23/193 (12%)
 Frame = -2

Query  691  FILNEAKEV---VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSH  536
            +I  E K+    V TE G I+V++  T  S  L  I       +     + + P++ DS 
Sbjct  110  YIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDSE  169

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRL-----HIICS  371
            +V F  +G A +G V + +  +  ++ GDM  I AG+  Y+ N  E  +L     HI  S
Sbjct  170  VVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKLFLAMLHIPVS  229

Query  370  INIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVS  191
            ++              F+ FF  GG  P SVL+ F    L  AL     ++ KL   +  
Sbjct  230  VSTPGK----------FEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLEKLFDQQNE  279

Query  190  GPIVSLTNSNYTA  152
            G I +++     A
Sbjct  280  GSIFAISREQVRA  292



>ref|NP_001237244.1| sucrose-binding protein 2 precursor [Glycine max]
 gb|AAO48716.1| sucrose-binding protein 2 [Glycine max]
Length=489

 Score = 67.4 bits (163),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 88/188 (47%), Gaps = 15/188 (8%)
 Frame = -2

Query  691  FILNEAKEV---VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSH  536
            ++  E K+    V TE G I+V++  T  S  L  I       +     + + P++ DS 
Sbjct  99   YVFEEDKDFSTRVETEGGSIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDSE  158

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVD  356
            +VLF  +G A +G V + +  +  ++ GDM  I AG+  Y+ N  E ++L ++  ++I  
Sbjct  159  VVLFNIKGRAVLGLVRESETEKITLEPGDMIHIPAGTPLYIVNRDENEKL-LLAMLHIPV  217

Query  355  TSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
            ++  +      F+ FF  GG  P SVL+ F    L  AL     ++ +L   +  G I  
Sbjct  218  STPGK------FEEFFGPGGRDPESVLSAFSWNVLQAALQTPKGKLERLFNQQNEGSIFK  271

Query  175  LTNSNYTA  152
            ++     A
Sbjct  272  ISRERVRA  279



>ref|XP_011100121.1| PREDICTED: globulin-1 S allele [Sesamum indicum]
Length=749

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 78/165 (47%), Gaps = 17/165 (10%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSG-RLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            E + +V TE G I  VR     SG  L+H  FIT+EP SL +P  L + +V +++ G  R
Sbjct  21   ERRALVSTEYGQISAVRVRDDVSGSHLLH--FITLEPNSLFLPVVLHADMVFYVHTGSGR  78

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYV----ENTAEGQRLHIICSINIVDTSDMRGA  335
            +    +D L    ++ GD+Y +  GS F++    E   E Q+L I     I   SD    
Sbjct  79   VSWTEEDDLKNADLRRGDVYRLPQGSVFFIQSNLETETERQKLRIHA---IFANSD----  131

Query  334  DTYTFQSFFIGGGMHPTSV---LAGFDPYTLSTALNVSMVEISKL  209
            +  T QSF+       +S+   + GFD   L  A  V    I +L
Sbjct  132  NGLTVQSFWEQANGPYSSIRDMVLGFDRKVLQAAFKVPEEVIDEL  176



>ref|XP_009771135.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nicotiana 
sylvestris]
Length=431

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 85/192 (44%), Gaps = 21/192 (11%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  +  EP S ++P + D+ ++ F+ +G   I    +D+     ++ GD+  + AGS  
Sbjct  71   RVAVLEFEPLSFMLPHHCDAEVIFFVVRGRGTISIAEQDEQNSFNLEHGDVIRVNAGSTI  130

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    +R  +     +  T ++ G     FQ +F GGG +P S    F    L TA 
Sbjct  131  YMINRDNNERFFVYV---LAKTVNIPG----QFQEYFSGGGENPESFYRAFSSEILETAF  183

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKRIVHYSDVEQQQQHYWAPW--LFM  65
            N S+  I  L+G +  G  V  +           ++ I  ++ +  +QQ    P+  L  
Sbjct  184  NTSIDTIEGLLGQQRKGIFVKASEE--------QIRAISEHASLSTKQQ-TRGPFNLLNE  234

Query  64   RKLLTN---HYY  38
            R LL N   HY+
Sbjct  235  RPLLGNKFGHYF  246



>ref|XP_004146991.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Cucumis 
sativus]
Length=453

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 80/173 (46%), Gaps = 13/173 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + T  G IKV++  T  S  L       +  +   P + ++P + D+ ++LF+ QG   I
Sbjct  99   IETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFDAEIILFVAQGRGTI  158

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V K+K    ++K GD++ I +G+ FY  N  E ++L I   + ++ ++ + G     F
Sbjct  159  T-VIKEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKI---VKLLQSTSVPG----HF  210

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
            Q+F   GG +P S    F    L  A  +   ++ +    +  G I+  +   
Sbjct  211  QTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263



>gb|KGN48815.1| PreproMP73 [Cucumis sativus]
Length=661

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 54/98 (55%), Gaps = 0/98 (0%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            NE   +++TE G I  V     T     H+ FIT+EP SL +P  L S +V +++ G  R
Sbjct  49   NERIPILKTEYGEISAVDFDDGTRFGRYHLQFITLEPNSLFLPVLLHSDMVFYVHTGSGR  108

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQR  389
            +     + L E  ++ GD+Y +  GS FY++++ E +R
Sbjct  109  LNWFDDNDLKEVDLRRGDLYRLHPGSIFYLQSSLETER  146



>gb|KGN44776.1| hypothetical protein Csa_7G380130 [Cucumis sativus]
Length=485

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 80/173 (46%), Gaps = 13/173 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + T  G IKV++  T  S  L       +  +   P + ++P + D+ ++LF+ QG   I
Sbjct  99   IETGEGKIKVLQKFTQRSHLLRGIENFRVSIVEANPSTFVVPTHFDAEIILFVAQGRGTI  158

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V K+K    ++K GD++ I +G+ FY  N  E ++L I   + ++ ++ + G     F
Sbjct  159  T-VIKEKRGSFELKCGDVFRIPSGAPFYFINKDEHRKLKI---VKLLQSTSVPG----HF  210

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
            Q+F   GG +P S    F    L  A  +   ++ +    +  G I+  +   
Sbjct  211  QTFQPAGGENPESFYTAFSWDLLEAAFKIPRDKLERFFKQQKPGTIIKASREQ  263



>ref|XP_008440688.1| PREDICTED: globulin-1 S allele [Cucumis melo]
Length=656

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            NE  ++++TE G I  V     +     H+ FIT+EP SL +P  L S +V +I+ G  R
Sbjct  49   NERIQLLKTEYGDISAVDFDDGSRFGPYHLQFITLEPNSLFLPVLLHSDMVFYIHTGSGR  108

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQR  389
            +    ++ L E  ++ GD+Y +  GS FY++++ E +R
Sbjct  109  LNWFDENDLKEVDLRRGDLYRLHPGSIFYLQSSLEIER  146



>ref|XP_006444033.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
 gb|ESR57273.1| hypothetical protein CICLE_v10024281mg [Citrus clementina]
Length=540

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 71/149 (48%), Gaps = 7/149 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +G +   PQ+ + P +LD+  V F++ G+  I  + ++      VK GD+  + +G+ F
Sbjct  180  RLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRESYNVKRGDIIRVPSGNTF  239

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            YV NT + ++L+I+  I  ++           +++F+  GG +P S L  F    L +A 
Sbjct  240  YVTNTDDDEKLYIVKFIKSINLPGQ-------YEAFYGAGGENPESFLRAFSWEILESAF  292

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
                  + +++  +  G +V  +     A
Sbjct  293  KTKRDSLERVLFQQDQGAMVKASKQQIRA  321



>gb|KDO68672.1| hypothetical protein CISIN_1g040805mg [Citrus sinensis]
Length=540

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 71/149 (48%), Gaps = 7/149 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +G +   PQ+ + P +LD+  V F++ G+  I  + ++      VK GD+  + +G+ F
Sbjct  180  RLGILIANPQTFVTPTHLDADAVFFVSWGQGTITVIRENNRESYNVKRGDIIRVPSGNTF  239

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            YV NT + ++L+I+  I  ++           +++F+  GG +P S L  F    L +A 
Sbjct  240  YVTNTDDDEKLYIVKFIKSINLPGQ-------YEAFYGAGGENPESFLRAFSWEILESAF  292

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
                  + +++  +  G +V  +     A
Sbjct  293  KTKRDSLERVLFQQDQGAMVKASKQQIRA  321



>ref|XP_009605859.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Nicotiana 
tomentosiformis]
Length=440

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/187 (26%), Positives = 79/187 (42%), Gaps = 18/187 (10%)
 Frame = -2

Query  595  IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFY  416
            +  +  EP S + P + D+ ++LF+ +G   I    +++     +++GD+  + AGS  Y
Sbjct  83   VAVLEFEPLSFMFPHHCDAEIILFVVRGRGTISIAEQEEKNSFNLENGDVIRVNAGSTIY  142

Query  415  VENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALN  236
            + N    +R  +     +  T ++ G     FQ +F GGG +P S    F    L TA N
Sbjct  143  MINRNNNERFFVYV---LAKTVNIPG----QFQEYFSGGGENPESFYRAFSSEILETAFN  195

Query  235  VSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKRIVHYSDVEQQQQHYWAPW--LFMR  62
            +    I  L G +  G  V  +     A I  H  R          +Q    P+  L  R
Sbjct  196  IPRDTIEGLFGQQRKGIFVKASEEQIRA-ISEHASRST--------KQQTRGPFNLLNER  246

Query  61   KLLTNHY  41
             LL N +
Sbjct  247  PLLGNRF  253



>sp|Q9SPL5.1|AMP21_MACIN RecName: Full=Vicilin-like antimicrobial peptides 2-1; AltName: 
Full=MiAMP2; Contains: RecName: Full=Antimicrobial peptide 
2a; AltName: Full=MiAMP2a; Contains: RecName: Full=Antimicrobial 
peptide 2b; AltName: Full=MiAMP2b; Contains: RecName: 
Full=Antimicrobial peptide 2c-1; AltName: Full=MiAMP2c-1; Contains: 
RecName: Full=Antimicrobial peptide 2c-2; AltName: 
Full=MiAMP2c-2; Contains: RecName: Full=Antimicrobial peptide 
2c-3; AltName: Full=MiAMP2c-3; Contains: RecName: Full=Antimicrobial 
peptide 2d; AltName: Full=MiAMP2d; Flags: Precursor 
[Macadamia integrifolia]
 gb|AAD54244.1|AF161883_1 vicilin precursor [Macadamia integrifolia]
Length=666

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (45%), Gaps = 12/169 (7%)
 Frame = -2

Query  661  RTESGVIKVVR---GSTSTSGRLMHIGFITME--PQSLLIPQYLDSHLVLFINQGEARIG  497
            RTE G I V+    G +     L +   + +E  P + ++P +LD+  +L +  G   + 
Sbjct  264  RTEEGHISVLENFYGRSKLLRALKNYRLVLLEANPNAFVLPTHLDADAILLVIGGRGALK  323

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             ++ D      ++ GD+  I AG+ FY+ N    +RLHI   +  + T          ++
Sbjct  324  MIHHDNRESYNLECGDVIRIPAGTTFYLINRDNNERLHIAKFLQTISTPGQ-------YK  376

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
             FF  GG +P   L+ F    L  ALN    ++  + G +  G I+  +
Sbjct  377  EFFPAGGQNPEPYLSTFSKEILEAALNTQTEKLRGVFGQQREGVIIRAS  425



>gb|AAS07324.1| putative globulin (with alternative splicing) [Oryza sativa Japonica 
Group]
 gb|ABF98039.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
Length=562

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/173 (25%), Positives = 84/173 (49%), Gaps = 12/173 (7%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            ++VVR++ G ++++      S  L       +  +   P+S ++P + D+H + ++ QGE
Sbjct  114  RQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAHCICYVAQGE  173

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADT  329
              +  +   +     ++ GD++   AG+  Y+ NT +G+R  I+    I+ T  + G   
Sbjct  174  GVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANT-DGRRKLIV--TKILHTISVPG---  227

Query  328  YTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
               Q FF  GG +P S L+ F       A  +S  ++ KL+G +  G I+  +
Sbjct  228  -QIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLLGKQDKGVIIRAS  279



>ref|XP_010938152.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Elaeis guineensis]
Length=574

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 78/168 (46%), Gaps = 13/168 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            VRTE G ++V+R     S  L+      +  +   P + ++P + D+  +LF+ +G   I
Sbjct  157  VRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDAEALLFVARGHGHI  216

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEG-QRLHIICSINIVDTSDMRGADTYT  323
                +D  A  +++ GD+  + AG+     N+  G ++L I+  ++ V T  M       
Sbjct  217  TLQCQDNKATHELRRGDIMRVRAGTIVSFANSGVGNEKLVIVILLHPVATPGM-------  269

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            F++F   GG +P S    F    LS A N    ++ +L   +  G I+
Sbjct  270  FEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLFQKQNKGAII  317



>gb|KDP31795.1| hypothetical protein JCGZ_12256 [Jatropha curcas]
Length=618

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 75/151 (50%), Gaps = 11/151 (7%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + K ++ TE G I  V  ST T G   H+ FIT+EP SL +P  L S +V ++N G  R+
Sbjct  37   DRKSLIVTEYGQISAVDISTGTIGDY-HLEFITLEPNSLFLPVILHSDMVFYVNTGSGRL  95

Query  499  GHVYKDKLAER-KVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTY  326
                  K  +R  +K GD+Y +  GS F++++  E +R  + I +I          AD  
Sbjct  96   SWAEGGKELKRMDIKKGDVYRLHPGSVFFMQSNLETERKKLRIYAI-------FSNADEG  148

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNV  233
            T++   IG       ++ GFD   L +A  V
Sbjct  149  TYEP-HIGAYSSINDLVLGFDTKLLQSAFKV  178



>ref|XP_009394628.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=451

 Score = 65.1 bits (157),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 77/172 (45%), Gaps = 15/172 (9%)
 Frame = -2

Query  658  TESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDK  479
            TESG I  V       G   H+ FI+MEP SL +P  L + ++ +++ G   + ++ +D+
Sbjct  43   TESGGITAVDVHVGCRGSY-HLQFISMEPGSLFLPVLLHTDMLFYVHTGRGTVTYIGEDE  101

Query  478  LAERKVKSGDMYTIEAGSAFYVEN----TAEGQRLHIICSINIVDTSDMRGADTYTFQSF  311
              E  V  GD+Y ++ G+AFYV +    T E  R+H I   +  D  D  G     + + 
Sbjct  102  TDEIDVVRGDVYRLQQGTAFYVRSHPDPTREKLRVHAI--FDKTDIEDPLGFSVSAYSNL  159

Query  310  FIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYT  155
                    + ++ GFD   L +   VS   I  L        IV  T  N T
Sbjct  160  --------SDMVRGFDEKVLQSGFGVSEETIRGLKWVPTPPSIVPTTRGNET  203



>ref|XP_006650381.1| PREDICTED: globulin-1 S allele-like [Oryza brachyantha]
Length=549

 Score = 65.5 bits (158),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/143 (27%), Positives = 69/143 (48%), Gaps = 7/143 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  +   P+S ++P + D+H V ++ QGE  +  +   +     ++ GD++   AG+  
Sbjct  147  RVAVLEANPRSFVVPSHTDAHCVCYVAQGEGVVAMIENGERRSYAIRQGDIFVAPAGTIN  206

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ NT +G+R  I+    I+ T  + G      Q FF  GG +P S L+ F       A 
Sbjct  207  YLANT-DGRRKLIV--TKILHTISVPG----KIQFFFGAGGRNPESFLSSFSKRVQRAAF  259

Query  238  NVSMVEISKLVGTKVSGPIVSLT  170
             +S   + KL+G +  G I+  +
Sbjct  260  KISDERLEKLLGKQDKGVIIRAS  282



>gb|AGU37285.1| 7S globulin precursor isoform 2, partial [Ficus pumila var. awkeotsang]
Length=676

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 75/166 (45%), Gaps = 18/166 (11%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIG  497
            RT+ G +KV+   +S S  L       I  +   P + ++P + D+  VL + +G   I 
Sbjct  268  RTDEGHLKVLEKLSSRSELLKGLENYRIVVLEANPNTFVVPHHCDADSVLVVTRGRGTIS  327

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI---ICSINIVDTSDMRGADTY  326
             V ++      ++  D+ T+ AGS  Y+ N  + +RL I   + S+NI            
Sbjct  328  IVRQNNKESYNIECADVITVRAGSTVYLVNDDDNERLQITKLVTSVNI----------PG  377

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
             F+ +F  GG +P S    F    L   L+ +  +I +L+G +  G
Sbjct  378  QFEEYFAAGGDNPQSYFKAFSTNILKRTLSATEDQIERLIGQQSQG  423



>gb|AAK28402.1|AF250228_1 7S globulin [Elaeis guineensis]
Length=572

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 43/168 (26%), Positives = 77/168 (46%), Gaps = 13/168 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            VRTE G ++V+R     S  L+      +  +   P + ++P + D+  +LF+ +G   I
Sbjct  157  VRTEHGHVRVLRNFLEKSKLLLGVANYRVAILETNPNTFVLPSHWDAEALLFVARGHGHI  216

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEG-QRLHIICSINIVDTSDMRGADTYT  323
                +D  A  +++ GD+  + AG+     N   G ++L I+  ++ V T  M       
Sbjct  217  TLQCQDNKATHELRRGDIMRVRAGTIVSFANRGVGNEKLVIVILLHPVATPGM-------  269

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            F++F   GG +P S    F    LS A N    ++ +L   +  G I+
Sbjct  270  FEAFVGAGGQNPESFYRSFSKRVLSAAFNTREDKLERLFQKQNKGAII  317



>ref|XP_010679084.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Beta vulgaris 
subsp. vulgaris]
Length=551

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 66/148 (45%), Gaps = 9/148 (6%)
 Frame = -2

Query  574  PQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEG  395
            PQ+ ++P + D+  V F+ QGE  +  VY D+     +K G +  I AG   Y+ N    
Sbjct  192  PQTFVVPNHWDADSVFFVAQGEGTVSLVYTDRRDSFNIKRGHVMVIPAGVTAYLINRGNN  251

Query  394  QRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEIS  215
             +L ++  IN V       ++   F+SFF  GG +P S    F    L  A   S  ++ 
Sbjct  252  DKLVLVKLINPV-------SNPGKFESFFGPGGENPESFFNAFSTDILGAAFKTSGDKVK  304

Query  214  KLVGTKVSGPIVSLTNSNYTAPILAHLK  131
            ++   +  G I+  +     A  L H K
Sbjct  305  RIFSQQHEGAIIRASEEQIRA--LTHEK  330



>ref|NP_001276308.1| sucrose-binding protein precursor [Glycine max]
 sp|Q04672.1|SBP_SOYBN RecName: Full=Sucrose-binding protein; Short=SBP; Flags: Precursor 
[Glycine max]
 gb|AAB03894.1| glucose binding protein [Glycine max]
Length=524

 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/193 (26%), Positives = 82/193 (42%), Gaps = 23/193 (12%)
 Frame = -2

Query  691  FILNEAKEV---VRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSH  536
            +I  E K+    V TE G I+V++  T  S  L       +  +     + + P++ DS 
Sbjct  110  YIFEEDKDFETRVETEGGRIRVLKKFTEKSKLLQGIENFRLAILEARAHTFVSPRHFDSE  169

Query  535  LVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRL-----HIICS  371
            +V F  +G A +G V + +  +  ++ GDM  I AG+  Y+ N  E  +L     HI  S
Sbjct  170  VVFFNIKGRAVLGLVSESETEKITLEPGDMIHIPAGTPLYIVNRDENDKLFLAMLHIPVS  229

Query  370  INIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVS  191
            ++              F+ FF  GG  P SVL+ F    L  AL     ++  +   +  
Sbjct  230  VSTPGK----------FEEFFAPGGRDPESVLSAFSWNVLQAALQTPKGKLENVFDQQNE  279

Query  190  GPIVSLTNSNYTA  152
            G I  ++     A
Sbjct  280  GSIFRISREQVRA  292



>ref|XP_003632318.2| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Vitis vinifera]
Length=843

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/176 (26%), Positives = 79/176 (45%), Gaps = 12/176 (7%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMHIG---FITME--PQSLLIPQYLDSHLVLFINQGEARI  500
            + T  G IK+++     S  L  +    F+ +E  PQ+ ++P +LD+  V+++  G   +
Sbjct  174  LETNEGRIKILQRFHQRSRLLRGLKNYRFVYLEANPQTFVLPAHLDAEAVVYVASGRGTL  233

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V + K     +K GD+  I AG+  Y+ N  + ++L I   +  V   D        F
Sbjct  234  SLVSQGKRESFNIKQGDIVRIRAGTTIYMINRDKNKKLRIAKLLQPVALPD-------EF  286

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
            Q F+   G +P S    F    LS+AL V    + +++  +  G IV  +     A
Sbjct  287  QPFYGPAGENPQSFYRAFSEELLSSALKVEQDRVQRVIKQQNKGVIVKASEQQIQA  342



>ref|XP_009407076.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 78/178 (44%), Gaps = 12/178 (7%)
 Frame = -2

Query  670  EVVRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEA  506
            E VRTE G + V+      S  L+      I  + + P++ L+P +LD+  + ++ +G  
Sbjct  206  EQVRTEHGHVMVLENFLEKSEFLLGIANYRIAIVGLNPRAFLVPHHLDADAIYYVARGCG  265

Query  505  RIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTY  326
             +  V ++K    +++ GD+    AG+  Y+ N    +   +I  ++ V T         
Sbjct  266  VLTLVCEEKKETHELRRGDILEAPAGAIIYMINKDSNEEFLLIKLLHPVSTPG-------  318

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
             F+ F+  GG +P S    F    L  A N     +S++ G +  G IV  +     A
Sbjct  319  RFEVFYGAGGQNPKSFFPSFSDEILEAAFNTRRDRLSRIFGQQRKGGIVEASEEQVRA  376



>emb|CBI28721.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 66/146 (45%), Gaps = 7/146 (5%)
 Frame = -2

Query  589  FITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVE  410
            ++   PQ+ ++P +LD+  V+++  G   +  V + K     +K GD+  I AG+  Y+ 
Sbjct  59   YLEANPQTFVLPAHLDAEAVVYVASGRGTLSLVSQGKRESFNIKQGDIVRIRAGTTIYMI  118

Query  409  NTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVS  230
            N  + ++L I   +  V   D        FQ F+   G +P S    F    LS+AL V 
Sbjct  119  NRDKNKKLRIAKLLQPVALPD-------EFQPFYGPAGENPQSFYRAFSEELLSSALKVE  171

Query  229  MVEISKLVGTKVSGPIVSLTNSNYTA  152
               + +++  +  G IV  +     A
Sbjct  172  QDRVQRVIKQQNKGVIVKASEQQIQA  197



>ref|XP_009771136.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nicotiana 
sylvestris]
Length=796

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 77/188 (41%), Gaps = 14/188 (7%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  I  EP S ++P + D+  +  + +G   I    +D+     ++ GD+  + AGS  
Sbjct  415  RVAVIEFEPLSFMLPHHCDAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTI  474

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    +R  +      V+T          FQ FF  GG +P S    F    L TA 
Sbjct  475  YMLNRDNNERFFVYVLAQAVNTPGQ-------FQEFFSAGGQNPESFYRAFSSDILETAF  527

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKRIVHYSDVEQQQQHYWAPW--LFM  65
            N     + +L G +  G ++  +     A I  H  R    S  +Q +     P+  L  
Sbjct  528  NTPRDRLERLFGQQKQGIVIKASEEQIRA-ISEHASR----STKQQTKGQTTGPFNPLKE  582

Query  64   RKLLTNHY  41
            R L++N +
Sbjct  583  RPLISNKF  590



>gb|KHG24948.1| Vicilin-like antimicrobial peptides 2-1 [Gossypium arboreum]
Length=542

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/149 (21%), Positives = 67/149 (45%), Gaps = 7/149 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  +   P+S ++P + D++ +  + QG   +  +++DK     +++GD+  + AG+  
Sbjct  184  RLALLVASPKSFVVPNHFDANAIFVVTQGRGTLTLIHEDKRESFNIETGDIIYVRAGTPL  243

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N  + ++L I+  +  ++  D        ++ F+  GG  P S    F    L  AL
Sbjct  244  YLINRDDDEKLFIVKLLQPINQPDH-------YEVFYGAGGAKPESFYETFSTEILEAAL  296

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
              S  ++ K    +  GP +  +     A
Sbjct  297  KTSRDKLEKFFDKQGKGPFLEASKEQIEA  325



>gb|AAD10375.1| globulin-like protein, partial [Oryza sativa]
Length=461

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 83/170 (49%), Gaps = 12/170 (7%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            ++VVR++ G ++++      S  L       +  +   P+S ++P + D+H + ++ QG+
Sbjct  2    RQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAHCICYVAQGQ  61

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADT  329
              +  +   +     ++ GD++   AG+  Y+ NT +G+R  I+    I+ T  + G   
Sbjct  62   GVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANT-DGRRKLIVT--KILHTISVPG---  115

Query  328  YTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
               Q FF  GG +P S L+ F       A  +S  ++ KL+G +  G I+
Sbjct  116  -QIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLLGKQDKGVII  164



>ref|XP_010695493.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Beta vulgaris 
subsp. vulgaris]
Length=607

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 85/188 (45%), Gaps = 14/188 (7%)
 Frame = -2

Query  658  TESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            T+ G ++V++  +  S  L+      +G     P++ ++P + D+  V+F+ +G A +  
Sbjct  230  TQEGQMRVLQRFSEKSDLLLGMDKFRVGIYEANPKTFMLPHHWDADSVVFVMKGNAVVTL  289

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
            + ++      ++ GD+  I AG+  Y+ N+   ++L I   +  V+T          +Q 
Sbjct  290  LKQENRKTLNLERGDVLMIPAGTTTYLINSHNDEKLEIAELLRPVNTPG-------RYQQ  342

Query  313  FFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHL  134
            FF  GG    S    F    L  ALN+   ++ KL+  +  G I+  ++    A  LAH 
Sbjct  343  FFGVGGEQSKSFFTSFSTEILQAALNIPREQLQKLLAQQKEGAIIKASHEQVRA--LAHK  400

Query  133  KRIVHYSD  110
                 + D
Sbjct  401  TSRRQFGD  408



>gb|KHN33448.1| Legumin A [Glycine soja]
Length=334

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 58/110 (53%), Gaps = 11/110 (10%)
 Frame = -2

Query  409  NTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVS  230
            N  E Q+LHIICSI   D S+  G D   FQSF+I GG HP S+L+GF+   L TA NV 
Sbjct  10   NVEEAQKLHIICSI---DPSESLGVDV--FQSFYIEGGAHPASLLSGFESEILETAFNVR  64

Query  229  M-VEISKLVGTKVSGPIVSLTNSNYTAPILAHLK-----RIVHYSDVEQQ  98
            +   ++K +     GP      S+ T+     L+     ++ H  ++ QQ
Sbjct  65   IRRRVAKNLHWATRGPNCVRGGSHATSIWTKFLQLKEEDKLYHLREIVQQ  114



>ref|XP_004495184.1| PREDICTED: sucrose-binding protein-like [Cicer arietinum]
Length=470

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 74/157 (47%), Gaps = 9/157 (6%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMHI---GFITMEPQ--SLLIPQYLDSHLVLFINQGEARI  500
            + TE G + V+      S  L +I   G   +E +  + + P + DS +++F  +G+A I
Sbjct  98   IDTEDGRVLVLNKFNDKSKLLRNIENYGLAVLEVKGHAFVSPHHFDSEVIIFNVKGKAII  157

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
            G V +DK     ++SGD+  + AG+  Y+ N  E ++L I      +    +  +     
Sbjct  158  GLVMEDKTERFNLESGDIMRVPAGTPMYLVNRDENEKLFIAA----LHMPPLSASAPVNL  213

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKL  209
            ++FF  GG +P SVL  F    L  AL     ++ + 
Sbjct  214  EAFFEPGGRNPESVLTAFSSKVLQAALKTPKEKLERF  250



>ref|XP_010026166.1| PREDICTED: provicilin-like [Eucalyptus grandis]
Length=641

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 78/167 (47%), Gaps = 8/167 (5%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E   +  TE G I   R +    G + H+ F+T+EP +L +P  L S +VL+++ G  R+
Sbjct  59   ERTPIAATEYGEITAARVADGGGG-VYHLRFVTLEPNALFLPVLLRSDMVLYVHTGRGRL  117

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
                ++ +    ++ GD+Y +  G+ FYV+++ E +R  +  +    +T +    D Y  
Sbjct  118  NWADENDVKRIDLRRGDIYRLRPGTIFYVQSSLEPEREKLRINAIFTNTEE----DIYEP  173

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
                IG       +L GFD   L  A  V    + +++      PIV
Sbjct  174  S---IGAYSSIGDLLRGFDSKVLQGAFKVPEEVVEEVISATRPPPIV  217



>ref|XP_006383667.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 ref|XP_002306784.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|ERP61464.1| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
 gb|EEE93780.2| hypothetical protein POPTR_0005s23390g [Populus trichocarpa]
Length=544

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/156 (27%), Positives = 74/156 (47%), Gaps = 12/156 (8%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            K  V TE G ++V++  T  S  L     + +  I   PQ+ + P +LD+  VLF+ +G 
Sbjct  152  KSEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQTFIAPTHLDAGFVLFVAKGR  211

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADT  329
              I  ++++      ++ GD++ + AG+ FY+ N  E ++L +     I+   ++ G   
Sbjct  212  GAITLIHEEDKQTFNLERGDVFGVPAGTTFYMVNKDENEKLRV---AKILWPVNLPG---  265

Query  328  YTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVE  221
              F++F   GG    S    F    L  AL V  +E
Sbjct  266  -NFKAFHGAGGEDAESFFRAFSWELLEAALKVRRLE  300



>emb|CAC27161.1| putative sucrose binding protein [Vicia faba var. minor]
Length=482

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 81/173 (47%), Gaps = 9/173 (5%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + T+ G I ++      S  L +I       + ++  + L P + DS  +LF  +G+  I
Sbjct  102  IDTKDGRILILNKFHEKSKLLKNIENYGLAVLEIKANAFLSPHHYDSEAILFNIKGKGII  161

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
            G V +D+     ++ GD+  + AG+  Y+ N  E ++L +I + ++  +S   G+     
Sbjct  162  GLVAEDQTERFNLEEGDLIRVPAGTPTYLVNRDENEKL-LIAAFHLPPSS---GSAPVNL  217

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
            + FF  GG  P SVL+ F    L  AL  S  E+  ++  +  G I  +   +
Sbjct  218  EPFFESGGRRPESVLSTFSSKVLQAALKSSERELETVLDEQQKGRIFKIAKED  270



>ref|XP_006380750.1| hypothetical protein POPTR_0007s12490g [Populus trichocarpa]
 gb|ERP58547.1| hypothetical protein POPTR_0007s12490g [Populus trichocarpa]
Length=694

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 71/147 (48%), Gaps = 8/147 (5%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            + +V TE G I     S+ T G   HI FIT+EP SLL+P  L + +V +++ G  ++  
Sbjct  45   RSLVVTEYGEISAAEISSGTKGPY-HIQFITLEPNSLLLPVLLHADMVFYVHTGNGKLSW  103

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
                ++    ++ GD+Y ++AGS F+V +  + +R  +       +T +    D Y    
Sbjct  104  TDGREMKRMNLRRGDVYRLQAGSVFFVRSNLDSERQKMRIHAIFSNTDE----DIYEPS-  158

Query  313  FFIGGGMHPTSVLAGFDPYTLSTALNV  233
              IG     + ++ GFD   L  A  V
Sbjct  159  --IGAYSSVSDLVLGFDRKVLQEAFKV  183



>ref|XP_009386161.1| PREDICTED: allergen Ara h 1, clone P41B-like [Musa acuminata 
subsp. malaccensis]
Length=461

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 68/135 (50%), Gaps = 13/135 (10%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            + V  T SG I  V       G   H+ FITM P SL +P  L + +V ++  G  R+ +
Sbjct  45   RTVASTASGEITAVDVRDGYGG-AYHLQFITMAPSSLFLPVLLHTDMVFYVQSGSGRVTY  103

Query  493  VYKDKLAERK---VKSGDMYTIEAGSAFYVEN----TAEGQRLHIICSINIVDTSDMR--  341
            V +D+  E +   V  GD+Y +E GS FYV++    T +  R+H I   N VDT + +  
Sbjct  104  VEEDENHETEHIDVVRGDIYRLEKGSMFYVQSHPDPTRDNLRIHAI--FNAVDTDNTKVE  161

Query  340  -GADTYTFQSFFIGG  299
              A  Y+  S  +GG
Sbjct  162  LPAAAYSNISDLVGG  176



>ref|XP_011032788.1| PREDICTED: vicilin-like antimicrobial peptides 2-1 [Populus euphratica]
Length=546

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/170 (25%), Positives = 75/170 (44%), Gaps = 18/170 (11%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRL-----MHIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            K  V TE G ++V++  T  S  L     + +  I   PQ+ + P +LD+  VLF+ +G 
Sbjct  152  KTEVETEHGRVRVLQKFTKKSKLLRGLENIRVAIIEANPQAFIAPTHLDAGFVLFVAKGR  211

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLH---IICSINIVDTSDMRG  338
              I  ++++      ++ GD++ + AG+ FY+ N  E ++L    I+  +N+ D      
Sbjct  212  GAITLIHEEDKQTYSLERGDVFRVPAGTTFYMVNKDENEKLRVAKILWPVNLPD------  265

Query  337  ADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
                 F +F   GG    S    F    L  AL      + ++   +  G
Sbjct  266  ----NFNAFHGAGGEDAESFFKAFSWELLEAALKTDRGRLERIFKQQQGG  311



>emb|CBI17554.3| unnamed protein product [Vitis vinifera]
Length=478

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 75/157 (48%), Gaps = 7/157 (4%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            +F  ++ + +V TE G I   + S  T     H+ F T+EP SL +P  L + +V +++ 
Sbjct  37   LFPKDKRETIVSTEYGEISAAQVSDGTRRGSYHLQFFTLEPNSLFLPVLLHTDMVFYVHT  96

Query  514  GEARI--GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            G  ++   +  K+K     ++ GD+Y ++ G+ FY+++  E +R  +      V+  D  
Sbjct  97   GSGKLNWANEEKEKTTLTALRRGDVYRLKPGTVFYLQSNLESEREKLRIYAIFVNLED--  154

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVS  230
              D     S  IG     + ++ GFD   L  A  VS
Sbjct  155  -GDLNEVSS--IGAYSSISDLVRGFDKKVLQAAFEVS  188



>ref|XP_010099837.1| Vicilin-like antimicrobial peptides 2-2 [Morus notabilis]
 gb|EXB80597.1| Vicilin-like antimicrobial peptides 2-2 [Morus notabilis]
Length=631

 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 12/151 (8%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + K +V  E G I  V  S    G   HI F T+EP SL +P  L + +VLF++ G  R+
Sbjct  52   QRKSLVDNEYGQISAVNISDGIRGPY-HIQFFTLEPNSLFLPVLLHADMVLFVHTGSGRL  110

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQR--LHIICSINIVDTSDMRGADTY  326
             +  +++     ++S D++ ++ GS F+V++  + +R  L I    +  D      A   
Sbjct  111  SYADEEETRSVHLRSADIFRLQTGSVFFVQSDLQPERESLRIYAMFSNTDDELFEPA---  167

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNV  233
                  IG      +++ GFD  TL  A  V
Sbjct  168  ------IGAYSGFRNLVRGFDKVTLKQAFKV  192



>ref|XP_010649177.1| PREDICTED: provicilin-like [Vitis vinifera]
Length=613

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/157 (27%), Positives = 75/157 (48%), Gaps = 7/157 (4%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQ  515
            +F  ++ + +V TE G I   + S  T     H+ F T+EP SL +P  L + +V +++ 
Sbjct  37   LFPKDKRETIVSTEYGEISAAQVSDGTRRGSYHLQFFTLEPNSLFLPVLLHTDMVFYVHT  96

Query  514  GEARI--GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMR  341
            G  ++   +  K+K     ++ GD+Y ++ G+ FY+++  E +R  +      V+  D  
Sbjct  97   GSGKLNWANEEKEKTTLTALRRGDVYRLKPGTVFYLQSNLESEREKLRIYAIFVNLED--  154

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVS  230
              D     S  IG     + ++ GFD   L  A  VS
Sbjct  155  -GDLNEVSS--IGAYSSISDLVRGFDKKVLQAAFEVS  188



>ref|XP_004247186.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Solanum lycopersicum]
Length=469

 Score = 61.6 bits (148),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/182 (26%), Positives = 79/182 (43%), Gaps = 15/182 (8%)
 Frame = -2

Query  691  FILNEAKEV--VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHL  533
            ++ NE   +  + TE G I+V+      S  L  I       +   P++ ++P + D+  
Sbjct  80   YVFNEEHFIMGIETEHGRIRVLPKFNERSKLLKGIENYRFAILEANPKTFVVPNHWDADA  139

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            VLF+ QG   +  V K K     ++ GD+  + AG+  Y+ N  + ++L I   +  V T
Sbjct  140  VLFVAQGRGTLSLVRKGKRNSFNIRRGDVIKVCAGTTAYLINRDDNEKLLIAKLLRPVST  199

Query  352  SDMRGADTYTFQSFF-IGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVS  176
                      F+ FF  GG  +P S  + F    L  ALN     + +L G    G I+ 
Sbjct  200  PGH-------FEHFFGPGGRQNPESFYSAFSSEILEAALNTRKDRLQRLFGQPREGVIIR  252

Query  175  LT  170
             +
Sbjct  253  AS  254



>ref|XP_010256229.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Nelumbo nucifera]
Length=542

 Score = 61.6 bits (148),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 78/185 (42%), Gaps = 18/185 (10%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLM--------HIGFITMEPQSLLIPQYLDS  539
            +F     K   +TE G IKV+      S RL          +  I   P + + P + D+
Sbjct  135  LFDEKSFKTRFQTEEGNIKVL---ERFSERLEFLRGIESYRLAIIKASPNTFVTPCHEDA  191

Query  538  HLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIV  359
             +V F+  G   I  V  D     K++ GD+  I AG+  Y  N    ++L I   +  +
Sbjct  192  DVVFFVTWGRGVITLVRNDNRESFKIQKGDVMMIPAGTVVYFINNDNHEKLFIAKLLLPI  251

Query  358  DTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
             T          F++FF  GG +P S    F    L  ALNV   ++ +L+G +  G I+
Sbjct  252  STPGH-------FEAFFGPGGENPESFYRAFSTEVLEAALNVRKDKLKRLLGRQDKGVII  304

Query  178  SLTNS  164
              ++ 
Sbjct  305  KASDE  309



>gb|ABS89092.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89093.1| globulin-1 [Zea mays subsp. parviglumis]
Length=248

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 71/148 (48%), Gaps = 12/148 (8%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSG-----RLMHIGFITMEPQSLLIPQYLDSHLV  530
            +F  +  + VVR+E G ++V+R     S      R   +  +   P+S ++P + D+H +
Sbjct  104  VFDRHSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAHCI  163

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
             ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T 
Sbjct  164  CYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---AKILHTI  220

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGF  266
             + G     FQ FF  GG +P S L+ F
Sbjct  221  SVPG----EFQFFFGPGGRNPESFLSSF  244



>gb|ABS89064.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89067.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89086.1| globulin-1 [Zea mays subsp. parviglumis]
Length=248

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 71/148 (48%), Gaps = 12/148 (8%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSG-----RLMHIGFITMEPQSLLIPQYLDSHLV  530
            +F  +  + VVR+E G ++V+R     S      R   +  +   P+S ++P + D+H +
Sbjct  104  VFDRHSFRRVVRSEQGSLRVLRPFDEVSRLLRGIRDYRVAVLEANPRSFVVPSHTDAHCI  163

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
             ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T 
Sbjct  164  CYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---AKILHTI  220

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGF  266
             + G     FQ FF  GG +P S L+ F
Sbjct  221  SVPG----EFQFFFGPGGRNPESFLSSF  244



>ref|XP_007046997.1| RmlC-like cupins superfamily protein, putative [Theobroma cacao]
 gb|EOX91154.1| RmlC-like cupins superfamily protein, putative [Theobroma cacao]
Length=580

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/154 (29%), Positives = 75/154 (49%), Gaps = 16/154 (10%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            +E   ++ TE G I  V+ +  T G   H+ FIT+EP SL +P  L + +V +++ G   
Sbjct  43   HERTPLIETEYGEISAVKFTDGTRGPY-HLQFITLEPSSLFLPVLLHADMVFYVHTGSGT  101

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQ----RLHIICSINIVDTSDMRGA  335
            +     +++    ++ GD+Y +  GS FYV+++ + +    R+H I S N  D       
Sbjct  102  LSWTDDNEIRNVNLRKGDIYRLHPGSVFYVQSSLKPEREKFRIHAIFS-NAED-------  153

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNV  233
            D Y     ++G     T ++ GFD   L  A  V
Sbjct  154  DIY---EPWVGAYSSITDLVLGFDSKVLQAAFKV  184



>ref|XP_009595711.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X1 
[Nicotiana tomentosiformis]
Length=798

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 64/156 (41%), Gaps = 8/156 (5%)
 Frame = -2

Query  595  IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFY  416
            +  +  EP S ++P + D+  +  + +G   I    +D+     ++ GD+  + AGS  Y
Sbjct  419  VAVVEFEPLSFMLPHHCDAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVY  478

Query  415  VENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALN  236
            + N    +R  +      V+T          FQ +F  GG +P S    F    L TA N
Sbjct  479  MLNRDNNERFFVYVLAQAVNTPGQ-------FQEYFSAGGQNPESFYRAFSSDILETAFN  531

Query  235  VSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKR  128
                 + +L G +  G ++  +     A I  H  R
Sbjct  532  TPRDRLERLFGQQKQGIVIKASEEQIRA-ISEHASR  566



>gb|ABU45177.1| unknown [Solanum melongena]
Length=814

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (51%), Gaps = 10/151 (7%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            +E K ++ TE+G +  +R +  T+G   H+ FIT+EP SL +P  L S +V +++ G  +
Sbjct  26   SERKSIISTENGQVSSLRVTDGTTGSY-HLQFITLEPNSLFLPVVLHSDMVFYVHTGSGK  84

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTY  326
            +  + + +     ++ GD++ +  GS F++E++ E  R  + + SI      D+R     
Sbjct  85   LSWMDEHEQKSADLRIGDVFRLPFGSIFFLESSLEPTRQKLRLYSIFANSEDDLREPLNE  144

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNV  233
             + S          +++ GFD   L  A +V
Sbjct  145  PYSSI--------RNMVLGFDKKVLQAAFHV  167



>ref|XP_009595712.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 isoform X2 
[Nicotiana tomentosiformis]
Length=797

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/156 (24%), Positives = 64/156 (41%), Gaps = 8/156 (5%)
 Frame = -2

Query  595  IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFY  416
            +  +  EP S ++P + D+  +  + +G   I    +D+     ++ GD+  + AGS  Y
Sbjct  418  VAVVEFEPLSFMLPHHCDAEAIFVVVRGRGTISIAEQDEKNSFNLEHGDVIRVNAGSTVY  477

Query  415  VENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALN  236
            + N    +R  +      V+T          FQ +F  GG +P S    F    L TA N
Sbjct  478  MLNRDNNERFFVYVLAQAVNTPGQ-------FQEYFSAGGQNPESFYRAFSSDILETAFN  530

Query  235  VSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKR  128
                 + +L G +  G ++  +     A I  H  R
Sbjct  531  TPRDRLERLFGQQKQGIVIKASEEQIRA-ISEHASR  565



>gb|ABS89031.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89037.1| globulin-1 [Zea mays subsp. parviglumis]
Length=251

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 74/149 (50%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + V+R+E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  107  VFDRRSFRRVIRSEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  165

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT +G++  +I    I+ T
Sbjct  166  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANT-DGRKKLVI--AKILHT  222

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  223  ISVPG----EFQFFFGPGGRNPESFLSSF  247



>ref|XP_006349767.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=474

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 74/168 (44%), Gaps = 13/168 (8%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            ++TE G I+V+   +  S  L  I       +   P++ ++P + D+  VLF+ QG   +
Sbjct  90   IKTEHGRIRVLPKFSERSKLLKGIENYRFAILEANPKTFVVPNHWDADAVLFVAQGRGTL  149

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V K K     +  GD+  + AG+  Y+ N  + ++L I   +  V T          F
Sbjct  150  SLVRKGKRNSFNIGRGDVIKVCAGTTAYLINRDDNEKLLIAKLLRPVSTPGQ-------F  202

Query  319  QSFF-IGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            + FF  GG  +P S  + F    L  ALN     + +L G    G I+
Sbjct  203  EHFFGPGGRENPQSFYSAFSSDILEAALNTRKDRLQRLFGQPREGVII  250



>ref|XP_006363154.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Solanum 
tuberosum]
Length=684

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/215 (26%), Positives = 98/215 (46%), Gaps = 20/215 (9%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E K ++ TE+G +  V  +  T+G   H+ FIT+EP SL +P  L S +V +++ G  ++
Sbjct  45   ERKTIISTENGEVSSVTVADGTTGSY-HLQFITLEPNSLFLPVVLHSDMVFYVHTGSGKL  103

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTYT  323
              + +++     ++ GD++ +  GS FY+E+  +  R  + + SI      D+R +    
Sbjct  104  TWMNENEEKSVDLRIGDVFRLPFGSIFYLESNLDPIRQKLRVYSIFPNSGDDLRESLNGP  163

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISK-LVGTKVSG-----PIVSLTNSN  161
            + S           ++ GFD   L  A +V    I + L GT+V       P  +    N
Sbjct  164  YSSI--------RKMVLGFDKKVLQAAFHVPEDVIEEVLAGTEVPAIVHGVPKSTKKKKN  215

Query  160  YTAPILAHLKRIV----HYSDVEQQQQHYWAPWLF  68
                + A  K+ V     YS  + Q+    +  LF
Sbjct  216  NLWEMEAQFKKTVLGRGSYSFFDNQRNKKKSSKLF  250



>gb|ABS89073.1| globulin-1 [Zea mays subsp. parviglumis]
Length=248

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 73/149 (49%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F  +  + VVR+E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  104  VFDRHSFRRVVRSEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  162

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  163  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---AKILHT  219

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  220  ISVPG----EFQFFFGLGGRNPESFLSSF  244



>gb|ABS89077.1| globulin-1 [Zea mays subsp. parviglumis]
Length=251

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 73/149 (49%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VVR E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  107  VFDRRSFRRVVRNEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  165

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT +G++  +I    I+ T
Sbjct  166  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANT-DGRKKLVI--AKILHT  222

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  223  ISVPG----EFQFFFGPGGRNPESFLSSF  247



>ref|XP_011025729.1| PREDICTED: globulin-1 S allele [Populus euphratica]
Length=612

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 70/147 (48%), Gaps = 8/147 (5%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            + +V TE G I      + T G   HI FIT+EP SLL+P  L + +V +++ G  ++  
Sbjct  45   RSLVVTEYGEISAAEIRSGTKG-PYHIQFITLEPNSLLLPVLLHADMVFYVHTGNGKLSW  103

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
                ++    ++ GD+Y ++AGS F+V +  + +R  +       +T +    D Y    
Sbjct  104  TDGREMKRMNLRRGDVYRLQAGSVFFVRSNLDSERQKMRIHAIFSNTDE----DIYEPS-  158

Query  313  FFIGGGMHPTSVLAGFDPYTLSTALNV  233
              IG     + ++ GFD   L  A  V
Sbjct  159  --IGAYSSVSDLVLGFDRKVLQEAFKV  183



>emb|CAA72090.1| P54 protein [Pisum sativum]
Length=483

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 83/183 (45%), Gaps = 9/183 (5%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMHI-----GFITMEPQSLLIPQYLDSHLV  530
            +F  N+ +  + T+ G + ++      S  L +I       + ++  + L P + DS  +
Sbjct  92   VFEDNDFETKIDTKDGRVLILNKFNEKSKLLKNIENYGLAVLEIKANAFLSPHHYDSEAI  151

Query  529  LFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTS  350
            LF  +G   IG V +D+     ++ GD+  + AG+  Y+ N  E ++L+ I + ++  +S
Sbjct  152  LFNIKGRGIIGLVAEDRTERFNLEEGDIMRVPAGTPMYLVNRDENEKLY-IAAFHMPPSS  210

Query  349  DMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLT  170
               G+     + FF   G  P SVL  F    L  AL  S  E+  ++  +  G I  + 
Sbjct  211  ---GSAPVNLEPFFESAGRKPESVLNTFSSKVLQAALKSSKGELETVLDEQKKGRIFKIE  267

Query  169  NSN  161
              +
Sbjct  268  KED  270



>ref|NP_001050038.1| Os03g0336100 [Oryza sativa Japonica Group]
 dbj|BAF11952.1| Os03g0336100 [Oryza sativa Japonica Group]
Length=337

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = -2

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
            ++KD+L E+ +K GD+  I+AGS FY+ N+ +GQRL IICSI   D SD  G   Y  Q+
Sbjct  1    MHKDELVEKNLKMGDVLHIDAGSTFYMVNSGKGQRLKIICSI---DASDNIGFGPY--QA  55

Query  313  FFI  305
            FF+
Sbjct  56   FFL  58



>ref|XP_003537573.1| PREDICTED: stress response protein nst1-like [Glycine max]
Length=696

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 66/140 (47%), Gaps = 7/140 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            H+ FIT+EP SL +P  L + +V +++ G  ++     D  +  +++ GD+ ++  GS F
Sbjct  74   HLQFITLEPNSLFLPVLLQADMVFYVHTGSGKLTWANDDGTSTIRLREGDVCSLNEGSVF  133

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+++  E +R  +       +T D    +TY      IG       ++ GFD   +  AL
Sbjct  134  YIQSNLEAERRKLRIYAMFTNTDD----NTYDPS---IGAYSRINELVKGFDKKIMQAAL  186

Query  238  NVSMVEISKLVGTKVSGPIV  179
             V    I  ++    +  IV
Sbjct  187  KVPEDLIEAIINKTETPAIV  206



>gb|ABS89030.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89032.1| globulin-1 [Zea mays subsp. parviglumis]
 gb|ABS89041.1| globulin-1 [Zea mays subsp. parviglumis]
Length=251

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 71/149 (48%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VVR E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  107  VFDRRSFRRVVRNEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  165

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  166  ICYVAKGEGVVTTIENGERRSYTIKQGHVFVAPAGAITYLANTDGRKKLVI---AKILHT  222

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  223  ISVPG----EFQFFFGPGGRNPESFLSSF  247



>ref|XP_003516577.1| PREDICTED: globulin-1 S allele-like [Glycine max]
Length=614

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 67/140 (48%), Gaps = 7/140 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            H+ FIT+EP SL +P  L + +V +++ G  ++     D  +  +++ GD+ +++ GS F
Sbjct  73   HLRFITLEPNSLFLPVLLHADMVFYVHTGSGKLTWANDDGTSTIRLREGDVCSLKEGSVF  132

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+++  E +R  +       +T D    +TY      IG       ++ GFD   +  AL
Sbjct  133  YIQSNLEAERRKLRIYAMFTNTDD----NTYDPS---IGAYSRINELVKGFDTKIMQAAL  185

Query  238  NVSMVEISKLVGTKVSGPIV  179
             V    I  ++    +  IV
Sbjct  186  KVPEDLIEAIINKTETPAIV  205



>gb|KHN36140.1| Vicilin-like antimicrobial peptides 2-2 [Glycine soja]
Length=630

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 67/140 (48%), Gaps = 7/140 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            H+ FIT+EP SL +P  L + +V +++ G  ++     D  +  +++ GD+ +++ GS F
Sbjct  73   HLRFITLEPNSLFLPVLLHADMVFYVHTGSGKLTWANDDGTSTIRLREGDVCSLKEGSVF  132

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+++  E +R  +       +T D    +TY      IG       ++ GFD   +  AL
Sbjct  133  YIQSNLEAERRKLRIYAMFTNTDD----NTYDPS---IGAYSRINELVKGFDTKIMQAAL  185

Query  238  NVSMVEISKLVGTKVSGPIV  179
             V    I  ++    +  IV
Sbjct  186  KVPEDLIEAIINKTETPAIV  205



>ref|XP_009803271.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A [Nicotiana sylvestris]
Length=731

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 83/168 (49%), Gaps = 11/168 (7%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E K VV TE+G +  VR +   +G   H+ FIT+EP SL +P  L + +V +++ G  R+
Sbjct  58   ERKSVVSTENGEVSSVRVADGITGSY-HLQFITLEPNSLFLPVVLHADMVFYVHTGSGRL  116

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTYT  323
              + + +     ++ GD++ +  G+ F++E+  E  R  + + SI      D+R   +  
Sbjct  117  TWMDETEQKSVDLRIGDVFRLPYGTIFFIESNLEPARQKLRVYSIFANSGDDLREPLSGP  176

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLV-GTKVSGPI  182
            + +           ++ GFD   L  A +V    I +++ GT+V   I
Sbjct  177  YSNI--------RDMILGFDRKVLQAAFHVPEDVIDEVLNGTEVPAII  216



>gb|ABU45211.1| unknown [Solanum bulbocastanum]
Length=734

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/164 (27%), Positives = 82/164 (50%), Gaps = 11/164 (7%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E K ++ TE+G +  V  +  T+G   H+ FIT+EP SL +P  L S +V +++ G  ++
Sbjct  53   ERKTIISTENGQVSSVTIADGTTGSY-HLQFITLEPNSLFLPVVLHSDMVFYVHTGSGKL  111

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTYT  323
              +++++     ++ GD++ +  GS F++E+  +  R  + + SI      D R +    
Sbjct  112  TWMHENEEKSVDLRIGDVFRLPFGSIFFLESNLDPIRQKLRVYSIFPNSGDDFRESLNGP  171

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISK-LVGTKV  194
            + S           ++ GFD   L  A +V    I + L GT+V
Sbjct  172  YSSI--------RKMVLGFDKKVLQAAFHVPEDVIEQVLAGTEV  207



>ref|XP_009590474.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
A {ECO:0000255|HAMAP-Rule:MF_03000} [Nicotiana tomentosiformis]
Length=730

 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 83/168 (49%), Gaps = 11/168 (7%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            E K VV TE+G +  VR +   +G   H+ FIT+EP SL +P  L + +V +++ G  R+
Sbjct  59   ERKLVVSTENGEVSSVRVADGITGSY-HLQFITLEPNSLFLPVVLHADMVFYVHTGSGRL  117

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI-ICSINIVDTSDMRGADTYT  323
              + + +     ++ GD++ +  G+ F++E+  E  R  + + SI      D+R   +  
Sbjct  118  TWMDETEQKSVDLRIGDVFRLPFGTIFFIESNLEPARQKLRVYSIFTNSGDDLREPLSGP  177

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLV-GTKVSGPI  182
            + S           ++ GFD   L  A +V    I +++ GT+V   I
Sbjct  178  YSSI--------RDMVLGFDRKVLQAAFHVPEDVIDEVLNGTEVPAII  217



>ref|XP_010254445.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Nelumbo nucifera]
Length=150

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/137 (25%), Positives = 58/137 (42%), Gaps = 7/137 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
            H+  +  EP + LIP + D+  V+ + +G+A I  V+ D      ++ GD+  I AG   
Sbjct  13   HLAILEAEPNTFLIPHHWDADAVVIVVKGKATINLVHNDNRESFNLECGDVARIPAGMMV  72

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N  + + L I+     + T             FF    +   S    F    L  AL
Sbjct  73   YLVNRDDNENLQIVTLFRTISTPGHA-------LKFFSANSVDGVSFYTAFSNEILEAAL  125

Query  238  NVSMVEISKLVGTKVSG  188
            N    ++ +++G K  G
Sbjct  126  NTPKDKLKRMLGEKRKG  142



>gb|ABS89043.1| globulin-1 [Zea mays subsp. parviglumis]
Length=251

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (48%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + V+R E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  107  VFDRRSFRRVLRNEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  165

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  166  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---AKILHT  222

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  223  ISVPG----EFQFFFGPGGRNPESFLSSF  247



>ref|XP_010531167.1| PREDICTED: vicilin-like antimicrobial peptides 2-3 [Tarenaya 
hassleriana]
Length=483

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 1/93 (1%)
 Frame = -2

Query  667  VVRTESGVIKVVRGSTSTSGR-LMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHV  491
            +V TE G I  V  +     R   HI FIT++P +LL+P  L S +V F++ G   +  V
Sbjct  47   IVETELGEISAVEINDGCGIRGKHHIHFITLDPNALLLPVLLHSDMVFFVHTGSGNLTWV  106

Query  490  YKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQ  392
             +DK    +++ GD+Y +  G+ FY+++  E +
Sbjct  107  DEDKETMTEIRRGDVYRLRPGTIFYIQSNLETE  139



>gb|ABS89047.1| globulin-1 [Zea mays subsp. parviglumis]
Length=247

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 72/149 (48%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VV++E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  103  VFDRRSFRRVVQSEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  161

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  162  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---AKILHT  218

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  219  ISVPG----EFQFFFGPGGRNPESFLSSF  243



>gb|ABS89078.1| globulin-1 [Zea mays subsp. parviglumis]
Length=251

 Score = 57.4 bits (137),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 70/149 (47%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VVR E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  107  VFDRRSFRHVVRNEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  165

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG   Y+ NT   ++L I     I+ T
Sbjct  166  ICYVAEGEGVVTTIENSERRSYTIKQGHVFVAPAGVITYLANTDGRKKLVI---AKILHT  222

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  223  ISVPG----EFQFFFGPGGRNPESFLSSF  247



>ref|XP_004981475.1| PREDICTED: globulin-1 S allele-like [Setaria italica]
Length=455

 Score = 58.2 bits (139),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 59/136 (43%), Gaps = 7/136 (5%)
 Frame = -2

Query  574  PQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEG  395
            P++ L P + D+  V+F+ +GE  +  + + K     VK GD+  I AG+  Y  NT   
Sbjct  89   PRAFLQPSHYDADEVMFVKEGEGVVALLARGKRESFCVKEGDVLVIPAGAVVYSANTHGS  148

Query  394  QRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEIS  215
            +   ++  +N V T          F+ FF  GG  P S  + F    L  A N    E  
Sbjct  149  KWFRVVMLLNPVSTKG-------RFEEFFPIGGESPESFFSVFSDDVLQAAFNTRREEWE  201

Query  214  KLVGTKVSGPIVSLTN  167
            ++   +  G I + + 
Sbjct  202  QVFEKQSKGEITTASE  217



>ref|XP_004300614.1| PREDICTED: vicilin-like antimicrobial peptides 2-2-like [Fragaria 
vesca subsp. vesca]
Length=656

 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 81/172 (47%), Gaps = 14/172 (8%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRL--MHIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            ++ + +V+TE G I  +     T GR    H+ FITMEP SL +P  L + +V +++ G 
Sbjct  52   DQRRALVQTEYGDISSI---DVTDGRRGPYHVQFITMEPNSLFLPVLLHADMVFYVHTGS  108

Query  508  ARI--GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGA  335
              +   H   D++ +  +K GD++ +  GS F++++  + +R  +  +    +T +    
Sbjct  109  GTLNWAHGEDDQINKVSIKKGDIHRLRPGSLFFIQSDLQTERHKLRINAIFANTEE----  164

Query  334  DTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            D Y      IG       ++ GFD   L +A  VS   I  +  +     IV
Sbjct  165  DVYDPT---IGAYSSVRDLVRGFDTKILRSAFQVSEEVIQSITNSTDHSAIV  213



>gb|ABS89028.1| globulin-1 [Zea mays subsp. parviglumis]
Length=247

 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (48%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VV++E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  103  VFDRRSFRRVVQSEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  161

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  162  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGTVTYLANTDGRKKLVI---TKILHT  218

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG  P S L+ F
Sbjct  219  ISVPGE----FQFFFGPGGRSPESFLSSF  243



>ref|XP_003611961.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
 ref|XP_003636284.1| Vicilin-like antimicrobial peptides 2-3 [Medicago truncatula]
Length=735

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 71/167 (43%), Gaps = 7/167 (4%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + K +  TE G I         + +  HI F T+EP S+ +P  L + ++ +++ G  ++
Sbjct  83   QRKTLFETEYGEISATDVKDGHNTQHYHIEFFTLEPNSVFLPVLLHAAMLFYVHTGSGKL  142

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
                +D  +   ++ GD+ ++  GS FY+ N  + QR  +       +T D       TF
Sbjct  143  SWANEDGTSTIDIREGDVGSLTEGSVFYIHNNLDDQRKKLRIYAMFTNTDD------STF  196

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
                IG       ++ GFD   +  A  V    I  +     + PIV
Sbjct  197  DP-SIGAYSRINELVKGFDKKIIQAAFKVPEDLIEAITNKTETPPIV  242



>gb|AES94919.2| cupin family protein [Medicago truncatula]
Length=702

 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/167 (24%), Positives = 71/167 (43%), Gaps = 7/167 (4%)
 Frame = -2

Query  679  EAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            + K +  TE G I         + +  HI F T+EP S+ +P  L + ++ +++ G  ++
Sbjct  50   QRKTLFETEYGEISATDVKDGHNTQHYHIEFFTLEPNSVFLPVLLHAAMLFYVHTGSGKL  109

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
                +D  +   ++ GD+ ++  GS FY+ N  + QR  +       +T D       TF
Sbjct  110  SWANEDGTSTIDIREGDVGSLTEGSVFYIHNNLDDQRKKLRIYAMFTNTDDS------TF  163

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
                IG       ++ GFD   +  A  V    I  +     + PIV
Sbjct  164  DP-SIGAYSRINELVKGFDKKIIQAAFKVPEDLIEAITNKTETPPIV  209



>ref|XP_004512222.1| PREDICTED: globulin-1 S allele-like [Cicer arietinum]
Length=699

 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 7/168 (4%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEAR  503
            +E + +  TE G I  +           H+ F T+EP S+ +P  L + +V +++ G  +
Sbjct  98   DERRTLFDTEYGEISAIDVKDGNKTLPYHLQFFTLEPNSVFLPVLLHAAMVFYVHTGSGK  157

Query  502  IGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYT  323
            +    +D+    ++  GD+ ++  GS FY+ +  E QR  +       +T D       T
Sbjct  158  LSWANEDETGTTEICEGDVGSLREGSVFYIHSNLEAQRKKLRIYAMFTNTDD------ST  211

Query  322  FQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIV  179
            F    IG       ++ GFD   +  A  V    +  +   K +  IV
Sbjct  212  FDP-SIGAYSRINELVKGFDKKIIQAAFKVPEDLVEAITNKKETPAIV  258



>gb|ABS89057.1| globulin-1 [Zea mays subsp. parviglumis]
Length=249

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (48%), Gaps = 14/149 (9%)
 Frame = -2

Query  694  MFILNEAKEVVRTESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHL  533
            +F     + VV +E G ++V+R     S RL+       +  +   P+S ++P + D+H 
Sbjct  105  VFDRRSFRRVVWSEQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHC  163

Query  532  VLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDT  353
            + ++ +GE  +  +   +     +K G ++   AG+  Y+ NT   ++L I     I+ T
Sbjct  164  ICYVAEGEGVVTTIENGERRSYTIKQGHVFVAPAGAVTYLANTDGRKKLVI---TKILHT  220

Query  352  SDMRGADTYTFQSFFIGGGMHPTSVLAGF  266
              + G     FQ FF  GG +P S L+ F
Sbjct  221  ISVPG----EFQFFFGPGGRNPESFLSSF  245



>gb|EMS62417.1| Globulin-1 S allele [Triticum urartu]
Length=493

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 62/138 (45%), Gaps = 9/138 (7%)
 Frame = -2

Query  595  IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFY  416
            + ++   P++ L P + D+  + F+ +GE  +  +   K     ++ GD+  I AGS  Y
Sbjct  93   VAYLDAAPRAFLQPSHHDADEIAFVREGEGVLVLLRNGKRESFCIREGDVIVIPAGSIVY  152

Query  415  VENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFI--GGGMHPTSVLAGFDPYTLSTA  242
              NT   + L ++  IN V T          FQ FF+   G   P S L+ F    +  A
Sbjct  153  SANTHRSKWLRVVMLINPVSTPG-------RFQEFFLIGSGDERPQSFLSVFSDEVIQAA  205

Query  241  LNVSMVEISKLVGTKVSG  188
            LN    ++ ++  +K  G
Sbjct  206  LNTRREDVDRVFESKSKG  223



>ref|XP_010548347.1| PREDICTED: vicilin [Tarenaya hassleriana]
Length=711

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 92/199 (46%), Gaps = 30/199 (15%)
 Frame = -2

Query  682  NEAKEVVRTESGVIKVVRGSTSTSGRLMH-IGFITMEPQSLLIPQYLDSHLVLFINQGEA  506
            ++   +V TE G I  V  S     R  H I FIT+EP SLL+P  L S +V F++ G  
Sbjct  51   DQRTRIVETEFGEISAVEISDGCGIRGTHSIHFITLEPNSLLLPLLLHSDMVFFVHTGSG  110

Query  505  RIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQ-----RLHIICSINIVDTSDMR  341
             +  V +DK    +++ GD+Y +  G+ FYV +  E +     R++ I S    DTS+  
Sbjct  111  VLTWVDEDKETRIEIRRGDVYRLRPGTVFYVRSNLEREIREKLRVYAIFS----DTSE--  164

Query  340  GADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSN  161
              D Y +    +G       +L GFD  TL +A  V           +V G I + T   
Sbjct  165  --DDYIYDP-CLGPYSSIRELLLGFDERTLRSAFAVP---------EEVIGTIRNATK--  210

Query  160  YTAPILAH--LKRIVHYSD  110
               P++ H   K I H SD
Sbjct  211  --PPLIVHGMPKNITHGSD  227



>ref|XP_006419988.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
 gb|ESR33228.1| hypothetical protein CICLE_v10006494mg, partial [Citrus clementina]
Length=610

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/222 (24%), Positives = 97/222 (44%), Gaps = 22/222 (10%)
 Frame = -2

Query  664  VRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGEARI  500
            VR++SG ++V++  +  S  L       +  +   P +L++P + D+  +L + +G+  I
Sbjct  236  VRSDSGHMRVLQRFSQKSHLLRGIDNYRLAILEANPSTLVVPHHSDAETILVLLKGKGVI  295

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V  ++     ++ GD+  + AG+ +Y+ N     RLH+   +  V+T          F
Sbjct  296  TLVSHERRESFNMEHGDVIRVPAGTTYYLSNQDNVDRLHVAKLLQPVNTPGQ-------F  348

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKL--VGTKVSGPIVSLTNSNYTAPI  146
            + ++  GG  P S    F    L  ALN    ++  L  V  +  G I   +     A  
Sbjct  349  REYYAAGGGFPESYYKVFSYDILERALNTPREQLHSLFEVQQRQQGTIKRASQEQLKA--  406

Query  145  LAHLKRIVHYSDVEQQQQHYWAPW-LFMRKLLTNHYYYPFFS  23
            L+H     H S   +  +   AP+ L  RK + N+ +  FF 
Sbjct  407  LSH-----HASSRRRHGRGSTAPFNLLSRKPIYNNNFGRFFE  443



>dbj|BAK04746.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=688

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 93/206 (45%), Gaps = 33/206 (16%)
 Frame = -2

Query  667  VVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVY  488
            VV +E+G +         +G +  + FITM+P +L +P  L +  V +++ G  ++ ++ 
Sbjct  50   VVESEAGTVTATD-VADAAGTVYRLQFITMDPGALFLPVQLHADAVFYVHSGRGKVTYIQ  108

Query  487  K--DKLAERKVKSGDMYTIEAGSAFYVEN----TAEGQRLHIICSINIVDTSDMRGADTY  326
            +   + +  +V+ GD+Y +E GS  Y+++    T E  R++ I + N ++  D     + 
Sbjct  109  EGGSETSSLEVQRGDVYNLEQGSILYIQSYPNATRERLRVYAIFTSNAINCDDPSHPKSE  168

Query  325  TFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTAPI  146
             + S         +++L GFD   L     VS            SG + ++T++     I
Sbjct  169  AYSSV--------SNLLRGFDVKILRQGFGVS------------SGVVEAITSAKSPQSI  208

Query  145  LAHLKRIVHYSDVEQQQQHYWAPWLF  68
                  I +  D E+++   W   +F
Sbjct  209  ------ITYKPDQEKEESSNWTEEIF  228



>ref|XP_010026941.1| PREDICTED: vicilin C72 [Eucalyptus grandis]
Length=730

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 77/175 (44%), Gaps = 12/175 (7%)
 Frame = -2

Query  661  RTESGVIKVVRGSTSTSGRLMHIGFITME-----PQSLLIPQYLDSHLVLFINQGEARIG  497
            R E G I+V+      S  L  +    +E     P + ++P ++D+  +L + +GE  I 
Sbjct  301  RAEEGQIRVLERFDKRSRLLRGLKNYRLEIFEANPNTFVLPHHVDADCILIVLKGEGTIS  360

Query  496  HVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQ  317
             V++DK     ++ GD+  + AG+  Y  ++    ++ I   I  V+          TF+
Sbjct  361  LVWQDKKQSYHLEGGDVMRVPAGTTVYFISSGRDGQVQIAKLIQPVNIPG-------TFK  413

Query  316  SFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSGPIVSLTNSNYTA  152
             F+  G  +P S    F    L ++L  S  +I +L G +  G ++  +     A
Sbjct  414  EFYPVGTENPESYYKVFSSEILESSLKTSRDQIERLFGQQRQGVMIRASEEQRQA  468



>ref|XP_004247580.1| PREDICTED: vicilin GC72-A [Solanum lycopersicum]
 emb|CAP69670.1| vicilin [Solanum lycopersicum]
Length=569

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/157 (23%), Positives = 64/157 (41%), Gaps = 8/157 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  + +EPQS ++P + D   +  + +G+  I    +D      ++ GD+  + AGS  
Sbjct  186  RVAILELEPQSFVLPHHCDGEAIYVVVKGQGVINIAEQDNKNSFNLQKGDVIRLFAGSNV  245

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    ++L +      V+            Q +F  GG +P S    F    L +A 
Sbjct  246  YLLNKDNNEKLFVYVLAKSVNAPG-------NLQEYFSAGGQNPESFYRAFSSDILESAF  298

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKR  128
            N    ++ +L G    G I+  +     A I  H  R
Sbjct  299  NNPRDKLERLFGQHKEGIIIKASEEQIRA-ISEHASR  334



>gb|ABS89063.1| globulin-1 [Zea mays subsp. parviglumis]
Length=245

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 68/136 (50%), Gaps = 14/136 (10%)
 Frame = -2

Query  655  ESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            E G ++V+R     S RL+H      +  +   P+S ++P + D+H + ++ +GE  +  
Sbjct  114  EQGSLRVLRPFDEVS-RLLHGIRDYRVAVLEANPRSFVVPSHTDAHCICYVAEGEGVVTT  172

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
            +   +     +K G ++   AG+  Y+ NT +G++  +I    I+ T  + G     FQ 
Sbjct  173  IENGERRSYTIKQGHVFVAPAGAVTYLANT-DGRKKLVI--TKILHTISVPG----EFQF  225

Query  313  FFIGGGMHPTSVLAGF  266
            FF  GG +P S L+ F
Sbjct  226  FFGPGGRNPESFLSSF  241



>ref|XP_009396731.1| PREDICTED: vicilin-like antimicrobial peptides 2-2 [Musa acuminata 
subsp. malaccensis]
Length=700

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 7/112 (6%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLMHIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            + +V TESG I  V       G   H+ FIT+EP SL +P  L + +V +++ G   + +
Sbjct  37   RTLVLTESGRITAVDVHDGYGGSY-HLQFITLEPVSLFLPVLLHTDMVFYVHTGRGTVTY  95

Query  493  VY--KDKLAERKVKSGDMYTIEAGSAFYVEN----TAEGQRLHIICSINIVD  356
            V   KD+  E  V  GD+Y +E G+ F+V +    T E  R+H I     +D
Sbjct  96   VNEDKDETDEMDVGHGDVYRLEQGTVFFVRSHPDPTREKLRIHAIFDTAGID  147



>ref|NP_001173574.1| Os03g0663800 [Oryza sativa Japonica Group]
 dbj|BAH92302.1| Os03g0663800 [Oryza sativa Japonica Group]
Length=406

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 63/127 (50%), Gaps = 7/127 (6%)
 Frame = -2

Query  559  IPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHI  380
            +P + D+H + ++ QGE  +  +   +     ++ GD++   AG+  Y+ NT +G+R  I
Sbjct  1    MPTHTDAHCICYVAQGEGVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANT-DGRRKLI  59

Query  379  ICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGT  200
            +    I+ T  + G      Q FF  GG +P S L+ F       A  +S  ++ KL+G 
Sbjct  60   VT--KILHTISVPG----QIQFFFAPGGRNPESFLSSFSKGVQRAAFKISEEKLEKLLGK  113

Query  199  KVSGPIV  179
            +  G I+
Sbjct  114  QDKGVII  120



>ref|XP_006360765.1| PREDICTED: vicilin-like antimicrobial peptides 2-1-like [Solanum 
tuberosum]
Length=567

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 64/157 (41%), Gaps = 8/157 (5%)
 Frame = -2

Query  598  HIGFITMEPQSLLIPQYLDSHLVLFINQGEARIGHVYKDKLAERKVKSGDMYTIEAGSAF  419
             +  + +EPQS ++P + D   +  + +G+  I    +D      ++ GD+  + AGS  
Sbjct  186  RVSVLELEPQSFVLPHHCDGEAIFVVVKGQGIISIAEQDNKNSFNLQKGDVIRVFAGSNV  245

Query  418  YVENTAEGQRLHIICSINIVDTSDMRGADTYTFQSFFIGGGMHPTSVLAGFDPYTLSTAL  239
            Y+ N    ++L +      V+            Q +F  GG +P +    F    L +A 
Sbjct  246  YMLNKDNNEKLFVYVLAKSVNAPG-------NLQQYFSAGGQNPETFYKAFSSDILESAF  298

Query  238  NVSMVEISKLVGTKVSGPIVSLTNSNYTAPILAHLKR  128
            N    ++ +L G    G I+  +     A I  H  R
Sbjct  299  NNPRDKLERLFGQHKEGIIIKASEEQIRA-ISEHASR  334



>ref|XP_010108323.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
 gb|EXC18944.1| Vicilin-like antimicrobial peptides 2-1 [Morus notabilis]
Length=914

 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/164 (26%), Positives = 77/164 (47%), Gaps = 15/164 (9%)
 Frame = -2

Query  661  RTESGVIKVV----RGSTSTSGRLMHIGFITME--PQSLLIPQYLDSHLVLFINQGEARI  500
            RTE G +KV+    R S    G L +   + +E  P + ++P + D+  VL + +G+  I
Sbjct  510  RTEEGHLKVLEMLSRRSELLKG-LKNYRIVVLEANPNTFVVPHHCDADSVLVVTRGKGTI  568

Query  499  GHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTF  320
              V ++      ++  D+ T+ AGS  Y+ N  + + L I   +  V+           F
Sbjct  569  SIVRQNNKESYNIERADVITVLAGSTVYLVND-QNEPLQITKLVTPVNIPGQ-------F  620

Query  319  QSFFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVGTKVSG  188
            + ++ GGG +P S    F    L + L+ +  +I +L+G +  G
Sbjct  621  EEYYPGGGENPQSYFKAFSTNILKSTLSATEEQIERLIGEQREG  664



>gb|ABF98040.1| Cupin family protein, expressed [Oryza sativa Japonica Group]
Length=408

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/141 (26%), Positives = 70/141 (50%), Gaps = 12/141 (9%)
 Frame = -2

Query  673  KEVVRTESGVIKVVRGSTSTSGRLM-----HIGFITMEPQSLLIPQYLDSHLVLFINQGE  509
            ++VVR++ G ++++      S  L       +  +   P+S ++P + D+H + ++ QGE
Sbjct  114  RQVVRSDQGSVRLLPPFHQASSLLRGIKNYRVAVLEANPRSFVMPTHTDAHCICYVAQGE  173

Query  508  ARIGHVYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADT  329
              +  +   +     ++ GD++   AG+  Y+ NT +G+R  I+    I+ T  + G   
Sbjct  174  GVVAIIENGEKWSYAIRQGDVFVAPAGTINYLANT-DGRRKLIV--TKILHTISVPG---  227

Query  328  YTFQSFFIGGGMHPTSVLAGF  266
               Q FF  GG +P S L+ F
Sbjct  228  -QIQFFFAPGGRNPESFLSSF  247



>gb|ACN34339.1| unknown [Zea mays]
 tpg|DAA50577.1| TPA: LOW QUALITY PROTEIN: globulin1 [Zea mays]
Length=572

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 73/157 (46%), Gaps = 14/157 (9%)
 Frame = -2

Query  655  ESGVIKVVRGSTSTSGRLMH------IGFITMEPQSLLIPQYLDSHLVLFINQGEARIGH  494
            E G ++V+R     S RL+       +  +   P+S ++P + D+H + ++ +GE  +  
Sbjct  115  EQGSLRVLRPFDEVS-RLLRGIRDYRVAVLEANPRSFVVPSHTDAHCICYVAEGEGVVTT  173

Query  493  VYKDKLAERKVKSGDMYTIEAGSAFYVENTAEGQRLHIICSINIVDTSDMRGADTYTFQS  314
            +   +     +K G ++   AG+  Y+ NT +G++  +I    I+ T  + G     FQ 
Sbjct  174  IENGERRSYTIKQGHVFVAPAGAVTYLANT-DGRKKLVIA--KILHTISVPG----EFQF  226

Query  313  FFIGGGMHPTSVLAGFDPYTLSTALNVSMVEISKLVG  203
            FF  GG +P S L+ F       A   S   + +L G
Sbjct  227  FFGPGGRNPESFLSSFSKSIQRAAYKTSSDRLERLFG  263



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2764578267225