BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81540_g1_i1 len=1080 path=[1:0-1079]

Length=1080
                                                                      Score     E

ref|XP_009625489.1|  PREDICTED: monocopper oxidase-like protein S...    506   1e-173   
ref|XP_009625488.1|  PREDICTED: monocopper oxidase-like protein S...    507   2e-173   
ref|XP_009759912.1|  PREDICTED: monocopper oxidase-like protein SKU5    507   6e-171   
ref|XP_006345997.1|  PREDICTED: monocopper oxidase-like protein S...    495   3e-169   
ref|XP_004240186.1|  PREDICTED: monocopper oxidase-like protein SKU5    490   4e-167   
ref|XP_006485345.1|  PREDICTED: monocopper oxidase-like protein S...    483   5e-164   
gb|KDO47580.1|  hypothetical protein CISIN_1g009960mg                   480   2e-163   
ref|XP_006436531.1|  hypothetical protein CICLE_v10033418mg             480   5e-163   
emb|CDO99811.1|  unnamed protein product                                472   9e-161   
ref|XP_008379888.1|  PREDICTED: monocopper oxidase-like protein SKU5    471   2e-159   
ref|XP_008233433.1|  PREDICTED: monocopper oxidase-like protein SKU5    467   1e-157   
ref|XP_004142507.1|  PREDICTED: monocopper oxidase-like protein S...    466   1e-157   
ref|XP_011076960.1|  PREDICTED: monocopper oxidase-like protein SKU5    466   2e-157   
gb|KGN52232.1|  hypothetical protein Csa_5G622490                       466   3e-157   
emb|CBI31393.3|  unnamed protein product                                464   3e-157   
ref|XP_004168806.1|  PREDICTED: monocopper oxidase-like protein S...    465   4e-157   
ref|XP_002271754.1|  PREDICTED: monocopper oxidase-like protein SKU5    466   5e-157   Vitis vinifera
ref|XP_008446813.1|  PREDICTED: monocopper oxidase-like protein SKU5    464   1e-156   
emb|CAN69084.1|  hypothetical protein VITISV_028171                     469   2e-156   Vitis vinifera
gb|KCW65287.1|  hypothetical protein EUGRSUZ_G027441                    455   5e-156   
ref|XP_007219525.1|  hypothetical protein PRUPE_ppa022550mg             461   8e-156   
ref|XP_010068843.1|  PREDICTED: monocopper oxidase-like protein SKU5    457   7e-154   
ref|XP_010940536.1|  PREDICTED: monocopper oxidase-like protein SKS1    454   1e-152   
gb|EYU39668.1|  hypothetical protein MIMGU_mgv1a002399mg                455   1e-151   
ref|XP_009597646.1|  PREDICTED: monocopper oxidase-like protein SKU5    445   3e-151   
ref|XP_004308756.1|  PREDICTED: monocopper oxidase-like protein S...    450   3e-151   
ref|XP_002311058.1|  hypothetical protein POPTR_0008s03200g             448   9e-151   Populus trichocarpa [western balsam poplar]
ref|XP_007010042.1|  Cupredoxin superfamily protein                     446   3e-149   
ref|XP_008780211.1|  PREDICTED: monocopper oxidase-like protein SKU5    442   5e-148   
ref|XP_011031806.1|  PREDICTED: monocopper oxidase-like protein SKU5    441   6e-148   
emb|CDP17254.1|  unnamed protein product                                434   3e-145   
ref|XP_006361718.1|  PREDICTED: monocopper oxidase-like protein S...    433   7e-145   
ref|XP_008233434.1|  PREDICTED: monocopper oxidase-like protein SKU5    434   2e-144   
ref|XP_002311059.2|  hypothetical protein POPTR_0008s03210g             433   2e-144   Populus trichocarpa [western balsam poplar]
ref|XP_002532786.1|  multicopper oxidase, putative                      432   4e-144   Ricinus communis
ref|XP_004308757.1|  PREDICTED: monocopper oxidase-like protein S...    432   8e-144   
gb|KCW51528.1|  hypothetical protein EUGRSUZ_J01040                     426   4e-143   
ref|XP_010034312.1|  PREDICTED: monocopper oxidase-like protein SKU5    429   7e-143   
ref|XP_007220122.1|  hypothetical protein PRUPE_ppa021300mg             428   1e-142   
ref|XP_004250496.1|  PREDICTED: monocopper oxidase-like protein SKU5    427   1e-142   
ref|XP_006436530.1|  hypothetical protein CICLE_v10033561mg             426   5e-142   
ref|XP_006838121.1|  hypothetical protein AMTR_s00106p00062610          419   5e-142   
ref|XP_011031807.1|  PREDICTED: monocopper oxidase-like protein SKU5    427   6e-142   
ref|XP_006485346.1|  PREDICTED: monocopper oxidase-like protein S...    425   4e-141   
ref|XP_009369004.1|  PREDICTED: monocopper oxidase-like protein SKU5    424   1e-140   
ref|XP_009351243.1|  PREDICTED: monocopper oxidase-like protein SKU5    423   2e-140   
ref|XP_009369002.1|  PREDICTED: monocopper oxidase-like protein SKU5    423   2e-140   
ref|XP_006606920.1|  PREDICTED: monocopper oxidase-like protein S...    418   7e-139   
ref|XP_008376280.1|  PREDICTED: monocopper oxidase-like protein SKU5    418   1e-138   
ref|XP_007144243.1|  hypothetical protein PHAVU_007G140000g             418   3e-138   
ref|XP_003555477.1|  PREDICTED: monocopper oxidase-like protein S...    418   2e-137   
ref|XP_004496129.1|  PREDICTED: monocopper oxidase-like protein S...    414   1e-136   
ref|XP_003535482.1|  PREDICTED: monocopper oxidase-like protein S...    415   1e-136   
gb|KHN37884.1|  Monocopper oxidase-like protein SKU5                    414   9e-136   
ref|XP_011084388.1|  PREDICTED: monocopper oxidase-like protein SKS2    409   2e-134   
gb|KEH43313.1|  multi-copper oxidase-like protein                       407   5e-134   
ref|XP_007144242.1|  hypothetical protein PHAVU_007G139900g             409   2e-133   
gb|KHN00955.1|  Monocopper oxidase-like protein SKU5                    403   3e-133   
ref|XP_003533163.1|  PREDICTED: monocopper oxidase-like protein S...    409   6e-132   
gb|EYU32431.1|  hypothetical protein MIMGU_mgv1a025826mg                397   2e-130   
emb|CDO99810.1|  unnamed protein product                                365   9e-118   
gb|KHN35422.1|  Monocopper oxidase-like protein SKU5                    347   1e-114   
gb|KDO47579.1|  hypothetical protein CISIN_1g042677mg                   354   1e-114   
ref|XP_009369006.1|  PREDICTED: monocopper oxidase-like protein SKU5    343   9e-113   
ref|XP_010090444.1|  Monocopper oxidase-like protein SKS1               352   3e-109   
emb|CDP02462.1|  unnamed protein product                                297   7e-92    
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             286   1e-87    
ref|XP_002969915.1|  hypothetical protein SELMODRAFT_410532             285   2e-87    
ref|XP_010326262.1|  PREDICTED: monocopper oxidase-like protein S...    284   3e-87    
ref|XP_002981392.1|  hypothetical protein SELMODRAFT_178788             285   3e-87    
ref|XP_006345715.1|  PREDICTED: monocopper oxidase-like protein S...    286   4e-87    
ref|XP_001771342.1|  predicted protein                                  285   4e-87    
ref|XP_004247026.1|  PREDICTED: monocopper oxidase-like protein S...    283   3e-86    
ref|XP_009792346.1|  PREDICTED: monocopper oxidase-like protein SKU5    283   6e-86    
ref|XP_009791835.1|  PREDICTED: monocopper oxidase-like protein SKS1    280   7e-86    
ref|XP_009401796.1|  PREDICTED: monocopper oxidase-like protein SKU5    281   3e-85    
ref|XP_002967301.1|  hypothetical protein SELMODRAFT_86988              279   4e-85    
ref|XP_009626424.1|  PREDICTED: monocopper oxidase-like protein SKU5    280   6e-85    
gb|ACN40384.1|  unknown                                                 280   1e-84    Picea sitchensis
ref|XP_009397600.1|  PREDICTED: L-ascorbate oxidase homolog             278   1e-84    
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             278   1e-84    
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   275   2e-84    
ref|XP_009392633.1|  PREDICTED: monocopper oxidase-like protein SKU5    279   3e-84    
ref|XP_002960418.1|  hypothetical protein SELMODRAFT_229918             276   6e-84    
ref|XP_010908415.1|  PREDICTED: monocopper oxidase-like protein S...    276   1e-83    
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             275   1e-83    
ref|XP_009382348.1|  PREDICTED: monocopper oxidase-like protein SKU5    276   2e-83    
ref|XP_010908414.1|  PREDICTED: monocopper oxidase-like protein S...    276   2e-83    
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             274   3e-83    
ref|XP_006661934.1|  PREDICTED: monocopper oxidase-like protein S...    276   3e-83    
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    274   6e-83    
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             274   6e-83    
ref|XP_011033926.1|  PREDICTED: monocopper oxidase-like protein SKU5    275   7e-83    
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             273   9e-83    
gb|EPS63456.1|  hypothetical protein M569_11328                         266   1e-82    
ref|XP_008787012.1|  PREDICTED: monocopper oxidase-like protein SKU5    274   1e-82    
ref|XP_010093686.1|  Monocopper oxidase-like protein SKU5               274   2e-82    
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             273   2e-82    
ref|XP_007201183.1|  hypothetical protein PRUPE_ppa003275mg             274   2e-82    
gb|EMS64364.1|  Monocopper oxidase-like protein SKU5                    268   2e-82    
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    272   2e-82    
ref|XP_004292333.1|  PREDICTED: monocopper oxidase-like protein S...    273   3e-82    
gb|AGE09595.1|  SKU5-like protein                                       271   3e-82    
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    271   3e-82    
ref|XP_011080540.1|  PREDICTED: monocopper oxidase-like protein SKU5    273   3e-82    
ref|XP_002528421.1|  multicopper oxidase, putative                      271   5e-82    Ricinus communis
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             271   5e-82    
ref|XP_002303520.1|  monocopper oxidase precursor family protein        272   5e-82    Populus trichocarpa [western balsam poplar]
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             271   6e-82    
ref|XP_004984344.1|  PREDICTED: monocopper oxidase-like protein S...    272   6e-82    
gb|EEC67281.1|  hypothetical protein OsI_34261                          273   7e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_006440373.1|  hypothetical protein CICLE_v10019410mg             272   8e-82    
gb|KDP25629.1|  hypothetical protein JCGZ_20785                         272   8e-82    
ref|XP_006643620.1|  PREDICTED: monocopper oxidase-like protein S...    272   9e-82    
ref|XP_006847483.1|  hypothetical protein AMTR_s00163p00059030          272   9e-82    
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             270   1e-81    
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             270   1e-81    
ref|XP_010919477.1|  PREDICTED: monocopper oxidase-like protein SKU5    272   1e-81    
emb|CBI18560.3|  unnamed protein product                                270   1e-81    
ref|XP_009358973.1|  PREDICTED: monocopper oxidase-like protein SKU5    271   1e-81    
ref|XP_006840959.1|  hypothetical protein AMTR_s00085p00024720          271   1e-81    
emb|CDP03969.1|  unnamed protein product                                271   1e-81    
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             270   2e-81    Vitis vinifera
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             270   2e-81    
emb|CAN72538.1|  hypothetical protein VITISV_028749                     271   2e-81    Vitis vinifera
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     271   2e-81    
ref|XP_008235896.1|  PREDICTED: monocopper oxidase-like protein SKU5    271   3e-81    
ref|XP_002527262.1|  multicopper oxidase, putative                      271   3e-81    Ricinus communis
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             270   3e-81    
ref|XP_007047154.1|  SKU5 similar 17 isoform 3                          265   3e-81    
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    269   3e-81    
gb|KHN42054.1|  L-ascorbate oxidase like                                269   3e-81    
ref|XP_008809034.1|  PREDICTED: monocopper oxidase-like protein SKU5    271   3e-81    
ref|XP_004515738.1|  PREDICTED: monocopper oxidase-like protein S...    270   3e-81    
ref|XP_010539786.1|  PREDICTED: monocopper oxidase-like protein SKU5    270   4e-81    
ref|XP_009339705.1|  PREDICTED: monocopper oxidase-like protein SKU5    270   4e-81    
ref|XP_007049589.1|  SKU5 similar 3                                     270   4e-81    
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    269   5e-81    
ref|XP_004147587.1|  PREDICTED: monocopper oxidase-like protein S...    270   5e-81    
ref|XP_002269725.2|  PREDICTED: monocopper oxidase-like protein SKU5    270   6e-81    Vitis vinifera
gb|KDO58565.1|  hypothetical protein CISIN_1g007633mg                   270   6e-81    
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             268   7e-81    
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             268   8e-81    Vitis vinifera
ref|XP_003568965.2|  PREDICTED: monocopper oxidase-like protein SKU5    277   8e-81    
ref|XP_002874771.1|  hypothetical protein ARALYDRAFT_911635             269   8e-81    
emb|CDX73238.1|  BnaC06g36860D                                          268   9e-81    
gb|KHN46930.1|  L-ascorbate oxidase like                                261   9e-81    
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             268   9e-81    
gb|EYU30502.1|  hypothetical protein MIMGU_mgv1a003271mg                269   1e-80    
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             268   1e-80    
ref|XP_008437127.1|  PREDICTED: monocopper oxidase-like protein SKU5    269   1e-80    
emb|CDX87633.1|  BnaA07g32400D                                          268   1e-80    
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             267   2e-80    
ref|XP_002465266.1|  hypothetical protein SORBIDRAFT_01g035180          268   2e-80    Sorghum bicolor [broomcorn]
ref|XP_010271560.1|  PREDICTED: monocopper oxidase-like protein SKU5    267   2e-80    
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             267   2e-80    
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             267   2e-80    
emb|CDP09915.1|  unnamed protein product                                268   2e-80    
ref|XP_006287348.1|  hypothetical protein CARUB_v10000546mg             268   2e-80    
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             267   2e-80    
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             267   2e-80    
ref|XP_008373811.1|  PREDICTED: monocopper oxidase-like protein SKU5    268   3e-80    
tpg|DAA45410.1|  TPA: hypothetical protein ZEAMMB73_672798              270   3e-80    
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         267   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_006447987.1|  hypothetical protein CICLE_v10014680mg             268   3e-80    
ref|XP_008381156.1|  PREDICTED: monocopper oxidase-like protein SKU5    268   3e-80    
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             266   3e-80    
ref|XP_007211279.1|  hypothetical protein PRUPE_ppa003224mg             268   3e-80    
gb|KDP45242.1|  hypothetical protein JCGZ_15107                         268   3e-80    
dbj|BAF01800.1|  pollen-specific protein                                260   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008238616.1|  PREDICTED: monocopper oxidase-like protein SKU5    267   5e-80    
gb|AAD41439.1|AC007727_28  Strong similarity to gb|X96932 ascorba...    261   5e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004245738.1|  PREDICTED: monocopper oxidase-like protein SKU5    267   5e-80    
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           266   5e-80    
gb|KFK26934.1|  monocopper oxidase-like protein sku5                    266   6e-80    
ref|XP_004972824.1|  PREDICTED: monocopper oxidase-like protein S...    267   7e-80    
ref|XP_006368173.1|  monocopper oxidase precursor family protein        267   7e-80    
ref|NP_192979.1|  multi-copper oxidase-like protein SKU5                267   7e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         266   7e-80    Populus trichocarpa [western balsam poplar]
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          265   7e-80    
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             266   7e-80    
gb|KEH30611.1|  multi-copper oxidase-like protein                       266   7e-80    
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             265   8e-80    
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             265   8e-80    
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             265   8e-80    
gb|KHN36198.1|  L-ascorbate oxidase like                                265   9e-80    
ref|XP_011018259.1|  PREDICTED: monocopper oxidase-like protein SKU5    266   9e-80    
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             265   9e-80    
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    265   1e-79    
emb|CDY01453.1|  BnaA07g12260D                                          265   1e-79    
ref|XP_011081204.1|  PREDICTED: monocopper oxidase-like protein SKU5    266   1e-79    
ref|XP_006355491.1|  PREDICTED: monocopper oxidase-like protein S...    266   1e-79    
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             265   1e-79    
ref|XP_006396765.1|  hypothetical protein EUTSA_v10028533mg             266   2e-79    
dbj|BAK00320.1|  predicted protein                                      266   2e-79    
ref|XP_009769792.1|  PREDICTED: L-ascorbate oxidase homolog             264   2e-79    
ref|XP_003608760.1|  Monocopper oxidase-like protein SKU5               266   2e-79    
ref|XP_010455683.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   2e-79    
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             264   2e-79    
gb|EMT17309.1|  Monocopper oxidase-like protein SKU5                    270   3e-79    
ref|XP_009134269.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   3e-79    
ref|XP_010422207.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   3e-79    
ref|XP_010241477.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   3e-79    
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             264   3e-79    
ref|XP_009407151.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   3e-79    
ref|XP_010906622.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   3e-79    
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         264   3e-79    
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             264   3e-79    
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             264   4e-79    
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             264   4e-79    
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             264   4e-79    
ref|XP_010433470.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   4e-79    
ref|XP_002962196.1|  hypothetical protein SELMODRAFT_403803             264   4e-79    
gb|KCW57990.1|  hypothetical protein EUGRSUZ_H00721                     261   4e-79    
gb|EEE53691.1|  hypothetical protein OsJ_00004                          265   4e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002532575.1|  multicopper oxidase, putative                      265   4e-79    Ricinus communis
gb|AGT57427.1|  ascorbate oxidase                                       263   4e-79    
ref|XP_002978641.1|  hypothetical protein SELMODRAFT_418427             265   4e-79    
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             263   4e-79    
gb|EYU46107.1|  hypothetical protein MIMGU_mgv1a003243mg                265   5e-79    
gb|EMT23980.1|  Monocopper oxidase-like protein SKU5                    265   5e-79    
ref|XP_009144495.1|  PREDICTED: monocopper oxidase-like protein SKU5    265   5e-79    
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             263   5e-79    
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             263   5e-79    
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             263   5e-79    
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         263   5e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             263   6e-79    
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             263   6e-79    
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             263   6e-79    
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   6e-79    
ref|XP_008671991.1|  PREDICTED: uncharacterized protein LOC100278...    272   7e-79    
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             263   7e-79    Populus trichocarpa [western balsam poplar]
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             263   7e-79    
emb|CDX81353.1|  BnaC09g07640D                                          263   7e-79    
ref|XP_002965109.1|  hypothetical protein SELMODRAFT_230488             263   8e-79    
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             263   8e-79    
ref|XP_002510630.1|  multicopper oxidase, putative                      263   8e-79    Ricinus communis
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             263   8e-79    
ref|NP_001041735.1|  Os01g0100400                                       264   9e-79    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             263   9e-79    
gb|KHG07318.1|  L-ascorbate oxidase                                     263   9e-79    
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   1e-78    
ref|XP_002321241.2|  hypothetical protein POPTR_0014s17590g             264   1e-78    Populus trichocarpa [western balsam poplar]
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             263   1e-78    
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             262   1e-78    
ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             263   1e-78    
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    263   1e-78    
ref|XP_004163159.1|  PREDICTED: monocopper oxidase-like protein S...    257   1e-78    
ref|XP_002984579.1|  hypothetical protein SELMODRAFT_445960             263   1e-78    
gb|AAG52028.1|AC022456_9  pectinesterase, putative, 5' partial; 9...    255   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             262   1e-78    
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             262   1e-78    
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             262   1e-78    
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             262   1e-78    
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          262   1e-78    
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             262   1e-78    
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               262   1e-78    
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             262   1e-78    
ref|XP_004298662.1|  PREDICTED: monocopper oxidase-like protein S...    263   1e-78    
ref|XP_010264215.1|  PREDICTED: monocopper oxidase-like protein SKU5    263   1e-78    
emb|CDM81381.1|  unnamed protein product                                263   2e-78    
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             262   2e-78    
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             262   2e-78    
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-78    
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             262   2e-78    
ref|XP_010259022.1|  PREDICTED: monocopper oxidase-like protein SKU5    263   2e-78    
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             262   2e-78    
emb|CDP07321.1|  unnamed protein product                                262   2e-78    
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   262   2e-78    
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             261   2e-78    
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             261   2e-78    
emb|CDY18626.1|  BnaA09g07690D                                          261   2e-78    
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             261   2e-78    
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-78    
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-78    
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-78    
gb|KHG25743.1|  L-ascorbate oxidase                                     261   3e-78    
gb|KDO85017.1|  hypothetical protein CISIN_1g009149mg                   259   3e-78    
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-78    
gb|KHN12597.1|  L-ascorbate oxidase like                                259   3e-78    
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             261   3e-78    
gb|KHN05478.1|  L-ascorbate oxidase like                                261   4e-78    
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             261   4e-78    
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             261   4e-78    
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    261   4e-78    
ref|XP_011009333.1|  PREDICTED: monocopper oxidase-like protein S...    262   4e-78    
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                261   5e-78    
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                261   5e-78    
gb|KFK31321.1|  hypothetical protein AALP_AA6G097300                    262   5e-78    
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             261   5e-78    
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          261   5e-78    
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             261   5e-78    
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             260   6e-78    
gb|KHG04142.1|  L-ascorbate oxidase                                     261   7e-78    
gb|EMS46249.1|  Monocopper oxidase-like protein SKU5                    263   7e-78    
emb|CDY04429.1|  BnaC02g28190D                                          261   7e-78    
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   260   8e-78    
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                260   8e-78    
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             260   9e-78    
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             260   9e-78    
ref|XP_002522337.1|  multicopper oxidase, putative                      260   9e-78    
gb|KEH36280.1|  multi-copper oxidase-like protein                       260   1e-77    
ref|XP_009395352.1|  PREDICTED: monocopper oxidase-like protein SKU5    261   1e-77    
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             260   1e-77    
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             259   1e-77    
gb|KHG11003.1|  L-ascorbate oxidase                                     260   1e-77    
gb|KHG18768.1|  Monocopper oxidase-like protein SKU5                    261   1e-77    
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         259   1e-77    
ref|XP_009630515.1|  PREDICTED: monocopper oxidase-like protein SKU5    261   2e-77    
gb|EMS55928.1|  Monocopper oxidase-like protein SKU5                    261   2e-77    
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-77    
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-77    
ref|XP_011076336.1|  PREDICTED: monocopper oxidase-like protein SKU5    261   2e-77    
gb|KHN20130.1|  L-ascorbate oxidase like                                252   2e-77    
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-77    
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-77    
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             259   2e-77    
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             258   2e-77    
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                259   2e-77    
ref|XP_010941126.1|  PREDICTED: monocopper oxidase-like protein S...    258   2e-77    
gb|EMT24690.1|  Monocopper oxidase-like protein SKU5                    261   2e-77    
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             259   3e-77    
ref|NP_173604.1|  SKU5 similar 7 protein                                259   3e-77    
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             259   3e-77    
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             259   3e-77    
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             258   3e-77    
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             258   4e-77    
gb|ABR18324.1|  unknown                                                 258   4e-77    
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             258   4e-77    
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             258   4e-77    
gb|AFK35121.1|  unknown                                                 258   4e-77    
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   258   4e-77    
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             258   4e-77    
ref|XP_002466968.1|  hypothetical protein SORBIDRAFT_01g017580          260   4e-77    
ref|XP_004148963.1|  PREDICTED: monocopper oxidase-like protein S...    259   5e-77    
gb|ACJ85585.1|  unknown                                                 258   5e-77    
emb|CDP04415.1|  unnamed protein product                                258   5e-77    
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             258   5e-77    
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             258   6e-77    
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          258   6e-77    
gb|AES78952.2|  multi-copper oxidase-like protein                       259   6e-77    
ref|NP_173603.1|  SKU5 similar 8 protein                                258   6e-77    
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             258   6e-77    
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             258   7e-77    
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             258   7e-77    
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             258   7e-77    
ref|XP_010069591.1|  PREDICTED: monocopper oxidase-like protein S...    259   7e-77    
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         258   7e-77    
gb|KHN03487.1|  L-ascorbate oxidase like                                258   8e-77    
ref|XP_003525802.1|  PREDICTED: monocopper oxidase-like protein S...    259   8e-77    
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         258   8e-77    
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             258   8e-77    
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             258   9e-77    
ref|XP_003622734.1|  Monocopper oxidase-like protein SKU5               259   9e-77    
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             258   9e-77    
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             258   9e-77    
ref|XP_010055530.1|  PREDICTED: monocopper oxidase-like protein SKU5    259   9e-77    
ref|XP_002518462.1|  multicopper oxidase, putative                      257   1e-76    
gb|EPS71245.1|  hypothetical protein M569_03512                         258   1e-76    
ref|XP_007155628.1|  hypothetical protein PHAVU_003G217800g             258   1e-76    
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             255   1e-76    
ref|NP_001105872.1|  LOC732784 precursor                                259   1e-76    
gb|KHG21949.1|  L-ascorbate oxidase                                     257   1e-76    
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     256   1e-76    
ref|XP_009771881.1|  PREDICTED: monocopper oxidase-like protein SKU5    258   1e-76    
ref|XP_008794814.1|  PREDICTED: monocopper oxidase-like protein SKU5    258   1e-76    
ref|XP_010678961.1|  PREDICTED: monocopper oxidase-like protein SKU5    258   1e-76    
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-76    
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-76    
ref|XP_010429313.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-76    
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             257   1e-76    
ref|XP_004492214.1|  PREDICTED: monocopper oxidase-like protein S...    258   2e-76    
ref|XP_006656543.1|  PREDICTED: monocopper oxidase-like protein S...    258   2e-76    
ref|XP_010547156.1|  PREDICTED: monocopper oxidase-like protein S...    257   2e-76    
ref|XP_002524823.1|  multicopper oxidase, putative                      256   2e-76    
ref|XP_002266352.1|  PREDICTED: monocopper oxidase-like protein SKU5    258   2e-76    
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             256   2e-76    
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             257   2e-76    
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             256   2e-76    
ref|XP_008447202.1|  PREDICTED: monocopper oxidase-like protein S...    257   2e-76    
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             256   2e-76    
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    256   2e-76    
ref|XP_010941125.1|  PREDICTED: monocopper oxidase-like protein S...    258   2e-76    
ref|XP_007047151.1|  SKU5 similar 16                                    256   2e-76    
ref|XP_003573491.1|  PREDICTED: monocopper oxidase-like protein SKU5    258   3e-76    
gb|KEH40258.1|  multi-copper oxidase-like protein                       256   3e-76    
gb|KHN33820.1|  L-ascorbate oxidase like                                256   3e-76    
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             256   3e-76    
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             256   3e-76    
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             256   3e-76    
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             256   3e-76    
ref|XP_003549901.1|  PREDICTED: monocopper oxidase-like protein S...    257   3e-76    
ref|XP_002445068.1|  hypothetical protein SORBIDRAFT_07g003590          257   3e-76    
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    254   3e-76    
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    256   4e-76    
gb|EPS74059.1|  hypothetical protein M569_00695                         256   4e-76    
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    256   4e-76    
ref|NP_177743.1|  SKU5-like 5 protein                                   256   4e-76    
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             256   4e-76    
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         256   4e-76    
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    253   4e-76    
gb|AAL09733.1|  At1g76160/T23E18_10                                     256   4e-76    
gb|ACN28977.1|  unknown                                                 252   4e-76    
ref|XP_004982658.1|  PREDICTED: monocopper oxidase-like protein S...    257   4e-76    
gb|ABK95805.1|  unknown                                                 256   4e-76    
emb|CDP02461.1|  unnamed protein product                                256   4e-76    
emb|CDY67479.1|  BnaCnng55180D                                          256   4e-76    
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             255   4e-76    
ref|XP_008447201.1|  PREDICTED: monocopper oxidase-like protein S...    257   5e-76    
dbj|BAH20248.1|  AT1G41830                                              252   5e-76    
emb|CDY35790.1|  BnaA08g04510D                                          256   5e-76    
ref|XP_007039921.1|  Cupredoxin superfamily protein isoform 1           257   5e-76    
gb|EYU31325.1|  hypothetical protein MIMGU_mgv1a003381mg                256   5e-76    
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         255   6e-76    
emb|CDP05323.1|  unnamed protein product                                256   6e-76    
gb|KEH20500.1|  multi-copper oxidase-like protein                       255   6e-76    
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             255   6e-76    
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             255   6e-76    
ref|XP_006659842.1|  PREDICTED: monocopper oxidase-like protein S...    256   7e-76    
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   254   7e-76    
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             255   7e-76    
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         255   7e-76    
emb|CDY68834.1|  BnaCnng60730D                                          255   7e-76    
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    255   8e-76    
dbj|BAK04971.1|  predicted protein                                      255   8e-76    
ref|XP_010547155.1|  PREDICTED: monocopper oxidase-like protein S...    256   8e-76    
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             255   8e-76    
emb|CDP19581.1|  unnamed protein product                                255   9e-76    
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             254   9e-76    
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             255   1e-75    
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    254   1e-75    
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             254   1e-75    
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             254   1e-75    
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-75    
ref|NP_565554.1|  protein SKU5 similar 16                               254   1e-75    
ref|XP_010472357.1|  PREDICTED: L-ascorbate oxidase homolog             254   1e-75    
emb|CBI18561.3|  unnamed protein product                                256   1e-75    
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        254   1e-75    
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             254   1e-75    
ref|NP_001241709.1|  uncharacterized protein LOC100856887               248   1e-75    
gb|KEH20499.1|  multi-copper oxidase-like protein                       254   1e-75    
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    252   1e-75    
gb|ACF78692.1|  unknown                                                 256   1e-75    
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-75    
gb|AGJ03718.1|  multicopper oxidase                                     254   2e-75    
ref|XP_009129727.1|  PREDICTED: monocopper oxidase-like protein SKU5    256   2e-75    
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             254   2e-75    
ref|XP_007140706.1|  hypothetical protein PHAVU_008G134900g             256   2e-75    
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             254   2e-75    
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             254   2e-75    
ref|XP_006395182.1|  hypothetical protein EUTSA_v10003863mg             255   2e-75    
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    254   2e-75    
emb|CDY48757.1|  BnaA02g30180D                                          255   2e-75    
emb|CDY55201.1|  BnaCnng28410D                                          254   2e-75    
dbj|BAC55686.1|  putative pectinesterase                                255   2e-75    
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       253   3e-75    
gb|AAM97070.1|  pectinesterase, putative                                253   3e-75    
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             253   3e-75    
ref|NP_564479.1|  SKU5 similar 6                                        253   3e-75    
gb|AAL24296.1|  Unknown protein                                         253   3e-75    
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog             251   3e-75    
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             253   3e-75    
gb|EEE68063.1|  hypothetical protein OsJ_26072                          255   4e-75    
ref|XP_001777221.1|  predicted protein                                  253   4e-75    
ref|XP_006366164.1|  PREDICTED: monocopper oxidase-like protein S...    254   4e-75    
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         253   4e-75    
gb|EPS57861.1|  hypothetical protein M569_16956                         251   4e-75    
ref|NP_193932.1|  protein SKU5 similar 4                                253   4e-75    
ref|XP_004964279.1|  PREDICTED: monocopper oxidase-like protein S...    254   4e-75    
ref|XP_002865637.1|  predicted protein                                  253   4e-75    
gb|KHG03845.1|  L-ascorbate oxidase                                     253   5e-75    
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             253   5e-75    
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             253   5e-75    
ref|XP_010662409.1|  PREDICTED: monocopper oxidase-like protein SKU5    254   5e-75    
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             253   6e-75    
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             253   6e-75    
dbj|BAK06240.1|  predicted protein                                      254   6e-75    
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             253   6e-75    
ref|NP_569041.1|  protein SKU5 similar 17                               253   6e-75    
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             253   7e-75    
ref|XP_010417106.1|  PREDICTED: L-ascorbate oxidase homolog             253   7e-75    
ref|NP_001056550.1|  Os06g0104300                                       254   7e-75    
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   252   7e-75    
dbj|BAB08634.1|  pectinesterase like protein                            252   8e-75    
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             253   8e-75    
gb|EEC82126.1|  hypothetical protein OsI_26158                          252   9e-75    
gb|ADB28926.1|  multicopper oxidase protein                             245   9e-75    
gb|KEH29685.1|  multi-copper oxidase-like protein                       252   1e-74    
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-74    
gb|AFW57321.1|  hypothetical protein ZEAMMB73_772531                    251   1e-74    
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-74    
emb|CDY29530.1|  BnaA06g14400D                                          254   1e-74    
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             252   1e-74    
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             252   1e-74    
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-74    
ref|XP_010100824.1|  Monocopper oxidase-like protein SKU5               253   1e-74    
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-74    
gb|EEE67250.1|  hypothetical protein OsJ_24405                          252   1e-74    
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             252   1e-74    
ref|XP_010676176.1|  PREDICTED: monocopper oxidase-like protein SKU5    253   1e-74    



>ref|XP_009625489.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X2 [Nicotiana 
tomentosiformis]
Length=518

 Score =   506 bits (1302),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/305 (77%), Positives = 272/305 (89%), Gaps = 4/305 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETS---PLVAKGIL  171
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ++ DY++VA PK++++NE+S    L   GIL
Sbjct  197  EGSYTNQITLDSLDVHVGQSYSVLVTADQNEADYFMVATPKMYKSNESSDSKSLEGIGIL  256

Query  172  HYAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQT  351
            HYA S+    +GPLP GPDPFD++FS+NQAKSI WNLT GAARPNPQGTFNV+N+TL+QT
Sbjct  257  HYANSLTTV-SGPLPSGPDPFDIEFSVNQAKSITWNLTTGAARPNPQGTFNVSNVTLTQT  315

Query  352  FVLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            F+LHGSKGEI G PRY+VNNVSY TP+TPLKLAD+FVNG+GVY+LD FPTHSV DAA YG
Sbjct  316  FILHGSKGEINGWPRYVVNNVSYLTPETPLKLADFFVNGSGVYQLDQFPTHSVNDAAAYG  375

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+VSG HKGWLEIVF N L VMDSWHLDGFG HVVG+G+G+WTPAARETYN++DPVVRS
Sbjct  376  ASVVSGIHKGWLEIVFNNDLDVMDSWHLDGFGFHVVGFGNGDWTPAARETYNIFDPVVRS  435

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTAVYVFLDNPGMWNLRSQH+K+WYLGQ+L+IRV DD+PNPAKE+ PP NLL
Sbjct  436  TVQVYPGKWTAVYVFLDNPGMWNLRSQHLKNWYLGQELFIRVFDDNPNPAKERQPPQNLL  495

Query  892  LCGMF  906
            LCGMF
Sbjct  496  LCGMF  500



>ref|XP_009625488.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X1 [Nicotiana 
tomentosiformis]
Length=571

 Score =   507 bits (1305),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 236/305 (77%), Positives = 272/305 (89%), Gaps = 4/305 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETS---PLVAKGIL  171
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ++ DY++VA PK++++NE+S    L   GIL
Sbjct  250  EGSYTNQITLDSLDVHVGQSYSVLVTADQNEADYFMVATPKMYKSNESSDSKSLEGIGIL  309

Query  172  HYAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQT  351
            HYA S+    +GPLP GPDPFD++FS+NQAKSI WNLT GAARPNPQGTFNV+N+TL+QT
Sbjct  310  HYANSLTTV-SGPLPSGPDPFDIEFSVNQAKSITWNLTTGAARPNPQGTFNVSNVTLTQT  368

Query  352  FVLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            F+LHGSKGEI G PRY+VNNVSY TP+TPLKLAD+FVNG+GVY+LD FPTHSV DAA YG
Sbjct  369  FILHGSKGEINGWPRYVVNNVSYLTPETPLKLADFFVNGSGVYQLDQFPTHSVNDAAAYG  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+VSG HKGWLEIVF N L VMDSWHLDGFG HVVG+G+G+WTPAARETYN++DPVVRS
Sbjct  429  ASVVSGIHKGWLEIVFNNDLDVMDSWHLDGFGFHVVGFGNGDWTPAARETYNIFDPVVRS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTAVYVFLDNPGMWNLRSQH+K+WYLGQ+L+IRV DD+PNPAKE+ PP NLL
Sbjct  489  TVQVYPGKWTAVYVFLDNPGMWNLRSQHLKNWYLGQELFIRVFDDNPNPAKERQPPQNLL  548

Query  892  LCGMF  906
            LCGMF
Sbjct  549  LCGMF  553



>ref|XP_009759912.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nicotiana sylvestris]
Length=764

 Score =   507 bits (1306),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 236/305 (77%), Positives = 274/305 (90%), Gaps = 4/305 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETS---PLVAKGIL  171
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ++ DY++VA PK++++NE+S    L   GIL
Sbjct  443  EGSYTNQITLDSLDVHVGQSYSVLVTADQNEADYFMVANPKMYKSNESSGSKSLEGIGIL  502

Query  172  HYAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQT  351
            HYA S+    +GPLP GPDPFD++FS+NQAKSI WNLT GAARPNPQGTFNV+N+TL+QT
Sbjct  503  HYANSLTTV-SGPLPSGPDPFDIEFSVNQAKSITWNLTTGAARPNPQGTFNVSNVTLTQT  561

Query  352  FVLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            F+LHGSKGEI G PRY+VNNVSY TP+TPLKLADYFVNG+GVY+LD FPTHSV DAA YG
Sbjct  562  FILHGSKGEINGWPRYVVNNVSYLTPETPLKLADYFVNGSGVYQLDRFPTHSVNDAAAYG  621

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
            VS+VSG HKGWLEIVF+N L VMDSWHLDGFG +VVG+G+G+WTPAARETYN+++PVVRS
Sbjct  622  VSVVSGIHKGWLEIVFKNDLDVMDSWHLDGFGFYVVGFGNGDWTPAARETYNIFNPVVRS  681

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTAVYVFLDNPGMWNLRSQH+K+WYLGQ+L+IRV DD+PNPAKE+ PP NLL
Sbjct  682  TVQVYPGRWTAVYVFLDNPGMWNLRSQHLKNWYLGQELFIRVFDDNPNPAKERQPPQNLL  741

Query  892  LCGMF  906
            LCGMF
Sbjct  742  LCGMF  746



>ref|XP_006345997.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Solanum 
tuberosum]
Length=546

 Score =   495 bits (1275),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 232/300 (77%), Positives = 266/300 (89%), Gaps = 3/300 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV ADQ++ DYYIVA PK+ +++ET  L   GILHYA
Sbjct  250  EGSYTNQITLDSLDVHVGQSYSVLVIADQNEADYYIVATPKMFKSDET--LEGIGILHYA  307

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+    +GP+P+GPDPFD+ FS+NQAKSI WN+T GAARPNPQGTFNV+N+TL+QTF+L
Sbjct  308  NSLTTV-SGPVPDGPDPFDIAFSVNQAKSITWNMTTGAARPNPQGTFNVSNVTLAQTFIL  366

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGSKGEI G PRY+VNNVSY TPDTPLKLAD FVNG+GVY+LD FPTHSV D+A YGVS+
Sbjct  367  HGSKGEINGWPRYVVNNVSYFTPDTPLKLADMFVNGSGVYQLDQFPTHSVHDSASYGVSV  426

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            VSG HKGWLEIVF+N L VMDSWHLDGFG +VVG+G+G+WTP ARETYN++DPVVRSTVQ
Sbjct  427  VSGIHKGWLEIVFKNDLNVMDSWHLDGFGFYVVGFGNGDWTPVARETYNIFDPVVRSTVQ  486

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WT VYVFLDNPGMWNLRSQH+K+WYLGQQL+IRV DD+PNPAKE+ PP NLLLCG
Sbjct  487  VYPGRWTVVYVFLDNPGMWNLRSQHLKNWYLGQQLFIRVFDDNPNPAKERKPPQNLLLCG  546



>ref|XP_004240186.1| PREDICTED: monocopper oxidase-like protein SKU5 [Solanum lycopersicum]
Length=547

 Score =   490 bits (1261),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 231/300 (77%), Positives = 264/300 (88%), Gaps = 3/300 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ++ DYYIVA PK+  +NET  L   GILHYA
Sbjct  251  EGSYTNQITLDSLDVHVGQSYSVLVTADQNEADYYIVATPKMFRSNET--LEGIGILHYA  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+    +G +P+GP+PFD+ FS+NQAKSI WNLT GAARPNPQGTFNV+N+TL+QTF+L
Sbjct  309  NSLTTV-SGSVPDGPEPFDIAFSVNQAKSITWNLTTGAARPNPQGTFNVSNVTLAQTFIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGSK EI G  RY+VNNVSY TPDTPLKLAD FVNG+GVY+LD FPTHSV D+A YGVS+
Sbjct  368  HGSKSEINGWTRYVVNNVSYFTPDTPLKLADMFVNGSGVYQLDQFPTHSVHDSASYGVSV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            VSG HKGWLEIVF N L VMDSWHLDGFG +VVG+G+G+WTPAARETYN++DPVVRSTVQ
Sbjct  428  VSGIHKGWLEIVFINDLDVMDSWHLDGFGFYVVGFGNGDWTPAARETYNIFDPVVRSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            +YPG WTAVYVFLDNPGMWNLRSQH+K+WYLGQQL+IRV DD+PNPAKE+ PP NLLLCG
Sbjct  488  IYPGRWTAVYVFLDNPGMWNLRSQHLKNWYLGQQLFIRVFDDNPNPAKERKPPQNLLLCG  547



>ref|XP_006485345.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Citrus 
sinensis]
Length=565

 Score =   483 bits (1243),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 225/302 (75%), Positives = 264/302 (87%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL SLDVHVGQSYSVLV+ADQ++ DYYIVA+PKL   N++S LV  G+LHY+
Sbjct  251  EGSYTNQITLRSLDVHVGQSYSVLVTADQNEADYYIVASPKLISTNDSSNLVGLGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  ++  GPLP GPDPFDL FS+NQAKS+RWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  311  NS-KSQVTGPLPIGPDPFDLDFSMNQAKSVRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GSK EI G PRY++NNVSY T +TPLKLADYFVNG+GVY+LD FPT+SV D A  GVS+
Sbjct  370  QGSKAEISGWPRYVINNVSYLTLETPLKLADYFVNGSGVYQLDWFPTNSVNDEATRGVSV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF N+L V+DSWHLDGFG HVVG+G GEW P +R TYN++DPVVRSTVQ
Sbjct  430  VTGNHKGWIELVFNNNLDVIDSWHLDGFGFHVVGFGIGEWAPESRSTYNLFDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +++W+LGQ+LYIRVH+ DPNPAKE+PPP NLLLCG
Sbjct  490  VYPGGWTAVYAFLDNPGMWNLRSQLLQNWFLGQELYIRVHNSDPNPAKERPPPENLLLCG  549

Query  901  MF  906
            +F
Sbjct  550  IF  551



>gb|KDO47580.1| hypothetical protein CISIN_1g009960mg [Citrus sinensis]
Length=521

 Score =   480 bits (1235),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/300 (75%), Positives = 262/300 (87%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL SLDVHVGQSYSVLV+ADQ++ DYYIVA+PKL   N++S LV  G+LHY+
Sbjct  196  EGSYTNQITLRSLDVHVGQSYSVLVTADQNEADYYIVASPKLISTNDSSNLVGLGVLHYS  255

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  ++  GPLP GPDPFDL FS+NQAKS+RWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  256  NS-KSQVTGPLPIGPDPFDLDFSMNQAKSVRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  314

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GSK EI G PRY++NNVSY T +TPLKLADYFVNG+GVY+LD FPT+SV D A  GVS+
Sbjct  315  QGSKAEISGWPRYVINNVSYLTLETPLKLADYFVNGSGVYQLDWFPTNSVNDEATRGVSV  374

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF N+L V+DSWHLDGFG HVVG+G GEW P +R TYN++DPVVRSTVQ
Sbjct  375  VTGNHKGWIELVFNNNLDVIDSWHLDGFGFHVVGFGIGEWAPESRSTYNLFDPVVRSTVQ  434

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +++W+LGQ+LYIRVH+ DPNPAKE+PPP NLLLCG
Sbjct  435  VYPGGWTAVYAFLDNPGMWNLRSQLLQNWFLGQELYIRVHNSDPNPAKERPPPENLLLCG  494



>ref|XP_006436531.1| hypothetical protein CICLE_v10033418mg [Citrus clementina]
 gb|ESR49771.1| hypothetical protein CICLE_v10033418mg [Citrus clementina]
Length=562

 Score =   480 bits (1236),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 224/300 (75%), Positives = 262/300 (87%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL SLDVHVGQSYSVLV+ADQ++ DYYIVA+PKL   N++S LV  G+LHY+
Sbjct  251  EGSYTNQITLRSLDVHVGQSYSVLVTADQNEADYYIVASPKLISTNDSSNLVGLGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  ++  GPLP GPDPFDL FS+NQAKS+RWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  311  NS-KSQVTGPLPIGPDPFDLDFSMNQAKSVRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GSK EI G PRY++NNVSY T +TPLKLADYFVNG+GVY+LD FPT+SV D A  GVS+
Sbjct  370  QGSKAEISGWPRYVINNVSYLTLETPLKLADYFVNGSGVYQLDWFPTNSVNDEATRGVSV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF N+L V+DSWHLDGFG HVVG+G GEW P +R TYN++DPVVRSTVQ
Sbjct  430  VTGNHKGWIELVFNNNLDVIDSWHLDGFGFHVVGFGIGEWAPESRSTYNLFDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +++W+LGQ+LYIRVH+ DPNPAKE+PPP NLLLCG
Sbjct  490  VYPGGWTAVYAFLDNPGMWNLRSQLLQNWFLGQELYIRVHNSDPNPAKERPPPENLLLCG  549



>emb|CDO99811.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   472 bits (1215),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 221/300 (74%), Positives = 258/300 (86%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ+ L+SLDVHVGQSYSVLV+ADQD+ DYY+VA PKL  A++ SPLVAKG+LHYA
Sbjct  196  EGSYTNQVVLESLDVHVGQSYSVLVTADQDESDYYMVATPKLLNASDGSPLVAKGLLHYA  255

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GPLP GPDP+D+ FS+ QAKSIRWNLT GAARPNPQGTFN+TNITLSQTF+L
Sbjct  256  NS-ANTVSGPLPSGPDPYDIDFSVGQAKSIRWNLTTGAARPNPQGTFNITNITLSQTFIL  314

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS  EI G PR+ VNNVSY  P+TPLKLAD FVNG+GVY+LD FPT S+ DAA  G S+
Sbjct  315  HGSLTEIDGLPRFAVNNVSYLAPNTPLKLADEFVNGSGVYQLDVFPTQSINDAAACGASV  374

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            VSG HKGWLEIV +N L ++DSWHLDGFG +VVG+G+G+WTP +R +YN++DPVVRSTVQ
Sbjct  375  VSGIHKGWLEIVLKNDLGIVDSWHLDGFGFYVVGFGEGDWTPESRASYNLFDPVVRSTVQ  434

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTAVYVFLDNPGMWNLRS+H+K+WYLGQ+LYIRV+D DPNP KE PPP N+LLCG
Sbjct  435  VYPQRWTAVYVFLDNPGMWNLRSEHLKNWYLGQELYIRVNDPDPNPGKENPPPENVLLCG  494



>ref|XP_008379888.1| PREDICTED: monocopper oxidase-like protein SKU5 [Malus domestica]
 ref|XP_008356988.1| PREDICTED: monocopper oxidase-like protein SKU5 [Malus domestica]
Length=566

 Score =   471 bits (1212),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/302 (73%), Positives = 261/302 (86%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QI LDSLDVHVGQSYSVLV+A+Q+  DYY+VA+PKL   +E + LV  G+LHY+
Sbjct  252  EGSYTDQIALDSLDVHVGQSYSVLVTANQNAADYYMVASPKLVNTSEFTSLVGIGVLHYS  311

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+ + +GPLP+GPDPFDL FS++QAKSIRWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  312  NSVS-QVSGPLPDGPDPFDLDFSVDQAKSIRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  370

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++   PRY+VNNVSYRTP+TPLKLAD++VNG GVY+LD FPTH V D A YGVS+
Sbjct  371  QSSVADLGDEPRYVVNNVSYRTPETPLKLADFYVNGTGVYQLDAFPTHYVNDDAAYGVSV  430

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF N L  MDSWHLDGFG +VVG+G+G+W+  +R+TYN+YDPVVRSTVQ
Sbjct  431  VTGIHKGWIEIVFMNTLDAMDSWHLDGFGFYVVGFGNGDWSTDSRDTYNLYDPVVRSTVQ  490

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +KHWYLGQ+LY+RV+D DPNPAKE PPP NLL CG
Sbjct  491  VYPGGWTAVYAFLDNPGMWNLRSQLLKHWYLGQELYVRVYDADPNPAKESPPPENLLRCG  550

Query  901  MF  906
            +F
Sbjct  551  IF  552



>ref|XP_008233433.1| PREDICTED: monocopper oxidase-like protein SKU5 [Prunus mume]
Length=570

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 218/303 (72%), Positives = 261/303 (86%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QITLDSLDVHVGQSYSVLV+A+Q+D DYY+VA+PKL  A++ + LV  G+LHY+
Sbjct  252  EGSYTDQITLDSLDVHVGQSYSVLVTANQNDADYYMVASPKLINASDFTSLVGIGVLHYS  311

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S++ + +GPLP GPDPFDL FS+NQAKSIRWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  312  NSIS-QVSGPLPVGPDPFDLHFSVNQAKSIRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  370

Query  361  HGSKGEIRG-TPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
              S  ++    PRY+VNNV+Y TP+TPLKLADY+VNG GVY+LD FP  SV   A  GVS
Sbjct  371  QSSIADLYDQIPRYVVNNVTYSTPETPLKLADYYVNGTGVYQLDAFPVQSVNANASCGVS  430

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V+G HKGW+EIV +N+L  MDSWHLDGFG +VVG+G G+WT  +R+TYN++DPVVRSTV
Sbjct  431  VVTGIHKGWIEIVLKNNLDAMDSWHLDGFGFYVVGFGIGDWTAKSRDTYNLFDPVVRSTV  490

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPGGW+AVY FLDNPGMWNLRSQ +KHWYLGQ+LY+RVHD DPNPAKE+PPP NLLLC
Sbjct  491  QVYPGGWSAVYAFLDNPGMWNLRSQLLKHWYLGQELYVRVHDPDPNPAKERPPPENLLLC  550

Query  898  GMF  906
            GMF
Sbjct  551  GMF  553



>ref|XP_004142507.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cucumis 
sativus]
Length=548

 Score =   466 bits (1198),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 254/302 (84%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ  LDSLDVHVGQSYSVLV+A+Q D DY+IVA+PKL  A E S LV  G+LHY+
Sbjct  235  EGSYTNQTILDSLDVHVGQSYSVLVTANQVDADYFIVASPKLLNATEFSSLVGVGVLHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SVA +P GPLP GPDPFDL FS+NQAKSIRWN+T GAARPNPQGTFNVTN+T+SQTFVL
Sbjct  295  NSVA-QPLGPLPTGPDPFDLDFSVNQAKSIRWNMTTGAARPNPQGTFNVTNVTISQTFVL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G I G P+ +VNNVSY T DTPLKLAD  VNG+GVY+LD+FP  SV   A +GVS+
Sbjct  354  QNSVGMINGLPQAVVNNVSYLTIDTPLKLADLLVNGSGVYQLDEFPVQSVNLNASFGVSV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF+N+   +DSWHLDGFG + VG+G+G+WTP  R TYN++DPVVRSTVQ
Sbjct  414  VTGNHKGWIEIVFKNNWEFIDSWHLDGFGFYTVGFGNGDWTPELRNTYNLFDPVVRSTVQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WTAVY FLDNPGMWNLRSQ +K+W+LGQ+LY+RVHD DPNPAKE+PPP NLL+CG
Sbjct  474  VYPGAWTAVYSFLDNPGMWNLRSQLLKNWFLGQELYLRVHDSDPNPAKERPPPENLLICG  533

Query  901  MF  906
            +F
Sbjct  534  VF  535



>ref|XP_011076960.1| PREDICTED: monocopper oxidase-like protein SKU5 [Sesamum indicum]
Length=571

 Score =   466 bits (1200),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 220/303 (73%), Positives = 256/303 (84%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQI LDSLDVHVGQSYSVLV+A+QD+ DYY+VA PKL   +    LVAKGIL Y 
Sbjct  253  EGSYTNQIVLDSLDVHVGQSYSVLVTANQDEADYYMVATPKLFNIDNHDSLVAKGILRYE  312

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV     G +P+GPDPFD+ FSI+QAKSIRWN++ GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  313  NSVLPV-QGSVPDGPDPFDVGFSIDQAKSIRWNMSTGAARPNPQGTFNVTNVTLSQTFIL  371

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS+  I G P Y+VNNVSY TP TPLKLADYF NG+GVY+LD FP  S  D A YGVS+
Sbjct  372  HGSRDVINGVPSYVVNNVSYLTPSTPLKLADYFRNGSGVYQLDAFPVQSSNDIASYGVSV  431

Query  541  VSGTHKGWLEIVFQNHLA-VMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            V+G HKGWLEIVF+N L+  MDSWHLDGFG +VVG+G+GEWTP +R TYN+YDPVVRSTV
Sbjct  432  VTGVHKGWLEIVFKNDLSDEMDSWHLDGFGFYVVGFGEGEWTPESRSTYNLYDPVVRSTV  491

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPG WTAVYVFLDNPGMWNLRSQ++ HW++GQ+LY+RVHD DPNPAKE+PPP N+L+C
Sbjct  492  QVYPGRWTAVYVFLDNPGMWNLRSQNLMHWFMGQELYVRVHDPDPNPAKERPPPQNVLMC  551

Query  898  GMF  906
            G+F
Sbjct  552  GIF  554



>gb|KGN52232.1| hypothetical protein Csa_5G622490 [Cucumis sativus]
Length=564

 Score =   466 bits (1198),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 254/302 (84%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ  LDSLDVHVGQSYSVLV+A+Q D DY+IVA+PKL  A E S LV  G+LHY+
Sbjct  251  EGSYTNQTILDSLDVHVGQSYSVLVTANQVDADYFIVASPKLLNATEFSSLVGVGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SVA +P GPLP GPDPFDL FS+NQAKSIRWN+T GAARPNPQGTFNVTN+T+SQTFVL
Sbjct  311  NSVA-QPLGPLPTGPDPFDLDFSVNQAKSIRWNMTTGAARPNPQGTFNVTNVTISQTFVL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G I G P+ +VNNVSY T DTPLKLAD  VNG+GVY+LD+FP  SV   A +GVS+
Sbjct  370  QNSVGMINGLPQAVVNNVSYLTIDTPLKLADLLVNGSGVYQLDEFPVQSVNLNASFGVSV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF+N+   +DSWHLDGFG + VG+G+G+WTP  R TYN++DPVVRSTVQ
Sbjct  430  VTGNHKGWIEIVFKNNWEFIDSWHLDGFGFYTVGFGNGDWTPELRNTYNLFDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WTAVY FLDNPGMWNLRSQ +K+W+LGQ+LY+RVHD DPNPAKE+PPP NLL+CG
Sbjct  490  VYPGAWTAVYSFLDNPGMWNLRSQLLKNWFLGQELYLRVHDSDPNPAKERPPPENLLICG  549

Query  901  MF  906
            +F
Sbjct  550  VF  551



>emb|CBI31393.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   464 bits (1194),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 252/302 (83%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QITLDSLDVHVGQSYSVLV+A+Q + DYYIVA PK+    + S LV KG+LHYA
Sbjct  197  EGSYTQQITLDSLDVHVGQSYSVLVTANQKEADYYIVATPKMLSTTDNSSLVGKGVLHYA  256

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP GPDPFD  FS++QAKSIRWN+TAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  257  NS-NTPVSGPLPSGPDPFDRAFSVDQAKSIRWNMTAGAARPNPQGTFNVSNVTLSQTFIL  315

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S   I G PRY+VNNVSY T DTPLKLAD F NG+ VY+LD FP  SVKDAA+YGV +
Sbjct  316  HASMANISGLPRYVVNNVSYLTLDTPLKLADQFANGSDVYQLDQFPVQSVKDAAEYGVFV  375

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+E+VF+N L VMD+WHLDGFG +VVG+GDG+W P  R TYN+ DPVVRST Q
Sbjct  376  STGNHKGWIELVFKNDLDVMDAWHLDGFGFYVVGFGDGDWQPELRSTYNLLDPVVRSTTQ  435

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ++K+WYLGQ+LY+RV+D DPNPAKE+PPP N+LLCG
Sbjct  436  VYPGGWTAVYAFLDNPGMWNLRSQNLKNWYLGQELYVRVYDPDPNPAKERPPPENILLCG  495

Query  901  MF  906
             +
Sbjct  496  QY  497



>ref|XP_004168806.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cucumis 
sativus]
Length=564

 Score =   465 bits (1197),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 254/302 (84%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ  LDSLDVHVGQSYSVLV+A+Q D DY+IVA+PKL  A E S LV  G+LHY+
Sbjct  251  EGSYTNQTILDSLDVHVGQSYSVLVTANQVDADYFIVASPKLLNATEFSSLVGVGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SVA +P GPLP GPDPFDL FS+NQAKSIRWN+T GAARPNPQGTFNVTN+T+SQTFVL
Sbjct  311  NSVA-QPLGPLPTGPDPFDLDFSLNQAKSIRWNMTTGAARPNPQGTFNVTNVTISQTFVL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G I G P+ +VNNVSY T DTPLKLAD  VNG+GVY+LD+FP  SV   A +GVS+
Sbjct  370  QNSVGMINGLPQAVVNNVSYLTIDTPLKLADLLVNGSGVYQLDEFPVQSVNLNASFGVSV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF+N+   +DSWHLDGFG + VG+G+G+WTP  R TYN++DPVVRSTVQ
Sbjct  430  VTGNHKGWIEIVFKNNWEFIDSWHLDGFGFYTVGFGNGDWTPELRNTYNLFDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WTAVY FLDNPGMWNLRSQ +K+W+LGQ+LY+RVHD DPNPAKE+PPP NLL+CG
Sbjct  490  VYPGAWTAVYSFLDNPGMWNLRSQLLKNWFLGQELYLRVHDSDPNPAKERPPPENLLICG  549

Query  901  MF  906
            +F
Sbjct  550  VF  551



>ref|XP_002271754.1| PREDICTED: monocopper oxidase-like protein SKU5 [Vitis vinifera]
Length=586

 Score =   466 bits (1198),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 252/302 (83%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QITLDSLDVHVGQSYSVLV+A+Q + DYYIVA PK+    + S LV KG+LHYA
Sbjct  252  EGSYTQQITLDSLDVHVGQSYSVLVTANQKEADYYIVATPKMLSTTDNSSLVGKGVLHYA  311

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP GPDPFD  FS++QAKSIRWN+TAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  312  NS-NTPVSGPLPSGPDPFDRAFSVDQAKSIRWNMTAGAARPNPQGTFNVSNVTLSQTFIL  370

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S   I G PRY+VNNVSY T DTPLKLAD F NG+ VY+LD FP  SVKDAA+YGV +
Sbjct  371  HASMANISGLPRYVVNNVSYLTLDTPLKLADQFANGSDVYQLDQFPVQSVKDAAEYGVFV  430

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+E+VF+N L VMD+WHLDGFG +VVG+GDG+W P  R TYN+ DPVVRST Q
Sbjct  431  STGNHKGWIELVFKNDLDVMDAWHLDGFGFYVVGFGDGDWQPELRSTYNLLDPVVRSTTQ  490

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ++K+WYLGQ+LY+RV+D DPNPAKE+PPP N+LLCG
Sbjct  491  VYPGGWTAVYAFLDNPGMWNLRSQNLKNWYLGQELYVRVYDPDPNPAKERPPPENILLCG  550

Query  901  MF  906
             F
Sbjct  551  KF  552



>ref|XP_008446813.1| PREDICTED: monocopper oxidase-like protein SKU5 [Cucumis melo]
Length=564

 Score =   464 bits (1194),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/302 (72%), Positives = 253/302 (84%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ  LDSLDVHVGQSYSVLV+A+Q D DY+IVA+PKL  A E S LV  G+LHY+
Sbjct  251  EGSYTNQTILDSLDVHVGQSYSVLVTANQVDADYFIVASPKLLNATEFSSLVGVGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S AA+P GPLP GPDPFDL FS+NQAKSIRWN+T GAARPNPQGTFNVTN+T+SQTFVL
Sbjct  311  NS-AAQPVGPLPTGPDPFDLDFSVNQAKSIRWNMTTGAARPNPQGTFNVTNVTISQTFVL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G P+ +VNNVSY T DTPLKLAD+ VNG+GVY+LD+FP  SV   A +GVS+
Sbjct  370  ENSVTMINGLPQAVVNNVSYLTIDTPLKLADFLVNGSGVYQLDEFPVQSVNLNASFGVSV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+EIV +N+   +DSWHLDGFG + VG+G+G+WTP  R TYN++DPVVRSTVQ
Sbjct  430  ATGNHKGWIEIVLKNNWEFIDSWHLDGFGFYTVGFGNGDWTPELRNTYNLFDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +K+W+LGQ+LY+RVHD DPNPAKE+PPP NLLLCG
Sbjct  490  VYPGGWTAVYAFLDNPGMWNLRSQLLKNWFLGQELYLRVHDSDPNPAKERPPPENLLLCG  549

Query  901  MF  906
            +F
Sbjct  550  VF  551



>emb|CAN69084.1| hypothetical protein VITISV_028171 [Vitis vinifera]
Length=721

 Score =   469 bits (1206),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/302 (72%), Positives = 252/302 (83%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QITLDSLDVHVGQSYSVLV+A+Q + DYYIVA PK+    + S LV KG+LHYA
Sbjct  387  EGSYTQQITLDSLDVHVGQSYSVLVTANQKEADYYIVATPKMLSTTDNSSLVGKGVLHYA  446

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP GPDPFD  FS++QAKSIRWN+TAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  447  NS-NTPVSGPLPSGPDPFDRAFSVDQAKSIRWNMTAGAARPNPQGTFNVSNVTLSQTFIL  505

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S   I G PRY+VNNVSY T DTPLKLAD F NG+ VY+LD FP  SVKDAA+YGV +
Sbjct  506  HASMANISGLPRYVVNNVSYLTXDTPLKLADQFANGSDVYQLDQFPVQSVKDAAEYGVFV  565

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+E+VF+N L VMD+WHLDGFG +VVG+GDG+W P  R TYN+ DPVVRST Q
Sbjct  566  XTGNHKGWIELVFKNDLDVMDAWHLDGFGFYVVGFGDGDWQPELRSTYNLLDPVVRSTTQ  625

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ++K+WYLGQ+LY+RV+D DPNPAKE+PPP N+LLCG
Sbjct  626  VYPGGWTAVYAFLDNPGMWNLRSQNLKNWYLGQELYVRVYDPDPNPAKERPPPENILLCG  685

Query  901  MF  906
             F
Sbjct  686  KF  687



>gb|KCW65287.1| hypothetical protein EUGRSUZ_G027441, partial [Eucalyptus grandis]
Length=373

 Score =   455 bits (1171),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 212/300 (71%), Positives = 250/300 (83%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQI +DSLDVHVGQSYSVLV+ADQD+ DYY+VA PK+   N+ S L   G+LHY+
Sbjct  75   EGSYTNQIMVDSLDVHVGQSYSVLVTADQDEADYYMVATPKMFRVNDLSSLAGIGVLHYS  134

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+ +  GPLP GPDPFD  F++ QA+SIRWNLT GAARPNPQGTFNV+N+TL+QTFVL
Sbjct  135  NSVS-QVGGPLPAGPDPFDWNFTVTQARSIRWNLTTGAARPNPQGTFNVSNVTLAQTFVL  193

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S GEI G+ RY+VNNVSY   +TPLKLADYF NG+GVY+L  FPT SV + A YG+S+
Sbjct  194  QNSIGEIEGSARYVVNNVSYYILNTPLKLADYFRNGSGVYQLGAFPTRSVNEDAAYGISV  253

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V G HKGWLEIVF+N+L VMDSWHLDGFG +VV +G G+W   AR  YN+YDPVVRST Q
Sbjct  254  VPGIHKGWLEIVFKNNLDVMDSWHLDGFGFYVVAFGLGDWDEGARAGYNLYDPVVRSTTQ  313

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTA+Y FLDNPGMWNLRSQH+++WYLG++LYIRVHD DPNPAKE+PPP NL+LCG
Sbjct  314  VYPGGWTALYAFLDNPGMWNLRSQHLQNWYLGEELYIRVHDPDPNPAKEQPPPDNLILCG  373



>ref|XP_007219525.1| hypothetical protein PRUPE_ppa022550mg [Prunus persica]
 gb|EMJ20724.1| hypothetical protein PRUPE_ppa022550mg [Prunus persica]
Length=551

 Score =   461 bits (1187),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 216/301 (72%), Positives = 259/301 (86%), Gaps = 2/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QITLDSLDVHVGQSYSVLV+A+Q+D DYY+VA+PKL  A++ + LV  G+LHY+
Sbjct  252  EGSYTDQITLDSLDVHVGQSYSVLVTANQNDADYYMVASPKLINASDFTSLVGIGVLHYS  311

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S++ + +GPLP GPDPFDL FS+NQAKSIRWNLTAGAARPNPQGTFNV+N+TLSQTF+L
Sbjct  312  NSIS-QVSGPLPVGPDPFDLHFSVNQAKSIRWNLTAGAARPNPQGTFNVSNVTLSQTFIL  370

Query  361  HGSKGEIRG-TPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
              S  ++    PRY+VNNV+Y TP+TPLKLADY+VNG GVY+LD FP  SV   A  GVS
Sbjct  371  QSSTADLYDQIPRYVVNNVTYSTPETPLKLADYYVNGTGVYQLDAFPVQSVNADASCGVS  430

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V+G HKGW+EIV +N+L  MDSWHLDGFG +VVG+G G+WT  +R+TYN++DPVVRSTV
Sbjct  431  VVTGIHKGWIEIVLKNNLNEMDSWHLDGFGFYVVGFGIGDWTVKSRDTYNLFDPVVRSTV  490

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPGGW+AVY FLDNPGMWNLRSQ +KHWYLGQ+LY+RVHD DPNPAKE+PPP NLLLC
Sbjct  491  QVYPGGWSAVYAFLDNPGMWNLRSQLLKHWYLGQELYVRVHDPDPNPAKERPPPENLLLC  550

Query  898  G  900
            G
Sbjct  551  G  551



>ref|XP_010068843.1| PREDICTED: monocopper oxidase-like protein SKU5 [Eucalyptus grandis]
Length=565

 Score =   457 bits (1176),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 213/302 (71%), Positives = 252/302 (83%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQI +DSLDVHVGQSYSVLV+ADQD+ DYY+VA PK+   N+ S L   G+LHY+
Sbjct  251  EGSYTNQIMVDSLDVHVGQSYSVLVTADQDEADYYMVATPKMFRVNDLSSLAGIGVLHYS  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+ +  GPLP GPDPFD  F++ QA+SIRWNLT GAARPNPQGTFNV+N+TL+QTFVL
Sbjct  311  NSVS-QVGGPLPAGPDPFDWNFTVTQARSIRWNLTTGAARPNPQGTFNVSNVTLAQTFVL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S GEI G+ RY+VNNVSY   +TPLKLADYF NG+GVY+L  FPT SV + A YG+S+
Sbjct  370  QNSIGEIEGSARYVVNNVSYYILNTPLKLADYFRNGSGVYQLGAFPTRSVNEDAAYGISV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V G HKGWLEIVF+N+L VMDSWHLDGFG +VV +G G+W   AR  YN+YDPVVRST Q
Sbjct  430  VPGIHKGWLEIVFKNNLDVMDSWHLDGFGFYVVAFGLGDWDEGARAGYNLYDPVVRSTTQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTA+Y FLDNPGMWNLRSQH+++WYLG++LYIRVHD DPNPAKE+PPP NL+LCG
Sbjct  490  VYPGGWTALYAFLDNPGMWNLRSQHLQNWYLGEELYIRVHDPDPNPAKEQPPPDNLILCG  549

Query  901  MF  906
            +F
Sbjct  550  IF  551



>ref|XP_010940536.1| PREDICTED: monocopper oxidase-like protein SKS1 [Elaeis guineensis]
Length=572

 Score =   454 bits (1167),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/302 (70%), Positives = 251/302 (83%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QI LDSLDVHVGQSYSVL +ADQ + DYYIVA+P   + +    +    +LHYA
Sbjct  248  EGSYTDQIVLDSLDVHVGQSYSVLFTADQQESDYYIVASPTQIDTSNYPKINGVAVLHYA  307

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   + +GPLP GPD  D  FSINQAKSIRWNLT GAARPNPQGTFNVT++T+SQTF+L
Sbjct  308  NS-NTQLSGPLPPGPDQLDRDFSINQAKSIRWNLTTGAARPNPQGTFNVTDVTISQTFIL  366

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS+ E+ G   Y +NNVSY  P TPLKLADYFVNG+GVY+LD FPT+SV   A  G S+
Sbjct  367  HGSEAELGGRRCYTINNVSYLMPSTPLKLADYFVNGSGVYQLDAFPTNSVNQKAALGTSV  426

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF+N   VMDSWHLDGFG +VVG+GDGEW+PA+R+TYN+Y+PVVRSTVQ
Sbjct  427  VTGNHKGWIEIVFKNDFDVMDSWHLDGFGFYVVGFGDGEWSPASRDTYNLYNPVVRSTVQ  486

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY FLDNPGMWNLRSQ +++WYLGQ++Y+RVHDDDPNPAKE+PPP NLLLCG
Sbjct  487  VYPGGWTAVYAFLDNPGMWNLRSQCLENWYLGQEMYVRVHDDDPNPAKERPPPENLLLCG  546

Query  901  MF  906
            +F
Sbjct  547  IF  548



>gb|EYU39668.1| hypothetical protein MIMGU_mgv1a002399mg [Erythranthe guttata]
Length=679

 Score =   455 bits (1171),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 219/301 (73%), Positives = 251/301 (83%), Gaps = 3/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEA-NETSPLVAKGILHY  177
            EGSYT+QI LDSLDVHVGQSYSVLV+A+QD+ DYYIVA PK ++      PLVAKGILHY
Sbjct  254  EGSYTDQIVLDSLDVHVGQSYSVLVTANQDEADYYIVATPKFYKTIGPNDPLVAKGILHY  313

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
              SV+     P+P GPDPFD+ FSINQAKSIRWN++ GAARPNPQGTFNVTN+T+SQTFV
Sbjct  314  ENSVSTV-QNPVPHGPDPFDVDFSINQAKSIRWNMSVGAARPNPQGTFNVTNVTVSQTFV  372

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            LHGS   I  +P Y+VNNV+Y TP TPLKLAD+F NG+GVY LD FP  SV   A YGVS
Sbjct  373  LHGSMALINHSPNYVVNNVAYLTPSTPLKLADHFKNGSGVYRLDRFPVDSVNRVASYGVS  432

Query  538  IVSGTHKGWLEIVFQNHLAV-MDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            +V+G HKGWLEIVF+N L   MDSWHLDGFG +VVG+GDGEWT  +R+TYN+YDPVVRST
Sbjct  433  VVTGVHKGWLEIVFKNDLLYEMDSWHLDGFGFYVVGFGDGEWTVGSRKTYNLYDPVVRST  492

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            VQVYPG WTAVYVFLDNPGMWNLRSQ++ HWY+GQ+LYIRVHD+DPNPAKE+ PP NLL 
Sbjct  493  VQVYPGKWTAVYVFLDNPGMWNLRSQNLVHWYMGQELYIRVHDNDPNPAKERAPPQNLLR  552

Query  895  C  897
            C
Sbjct  553  C  553



>ref|XP_009597646.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nicotiana tomentosiformis]
Length=411

 Score =   445 bits (1144),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 214/302 (71%), Positives = 240/302 (79%), Gaps = 4/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQD  DYYIVA  K+  + +   L    +LHY 
Sbjct  56   EGSYTNQITLDSLDVHVGQSYSVLVTADQDSADYYIVATAKMANSTQLKTLEVVSVLHYE  115

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S   KPA GPLP GPDPFD+ FSI+QA+SIRWNLT GAARPNPQG+FNV+N+TLSQTFV
Sbjct  116  NS--TKPADGPLPNGPDPFDVNFSISQARSIRWNLTTGAARPNPQGSFNVSNVTLSQTFV  173

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNG-AGVYELDDFPTHSVKDAADYGV  534
            L  S  +  G   Y +NNVSY TP TPLKLADY++NG AGVYELD FP +S      YG 
Sbjct  174  LQNSVNKKNGMINYAINNVSYATPQTPLKLADYYLNGGAGVYELDKFPANSSLPETVYGT  233

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
             ++SG HKGWLEIVF+N   VMDSWHLDGFG  VVGYG G WTP +R TYN+YDPVVRST
Sbjct  234  FVISGEHKGWLEIVFKNEFKVMDSWHLDGFGFFVVGYGSGNWTPKSRRTYNLYDPVVRST  293

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            VQVYP GWTAVYV+LDNPGMWNLRSQ++KHWYLGQ+LYIRV+D DPNPAKE  PP NLL 
Sbjct  294  VQVYPKGWTAVYVYLDNPGMWNLRSQNLKHWYLGQELYIRVYDSDPNPAKEHLPPKNLLY  353

Query  895  CG  900
            CG
Sbjct  354  CG  355



>ref|XP_004308756.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Fragaria 
vesca subsp. vesca]
Length=564

 Score =   450 bits (1158),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 251/303 (83%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QITLDSLDVHVGQSYSVLV+A+QD+ DYY+VA+PKL + ++ S LV  G+LHY+
Sbjct  247  EGSYTDQITLDSLDVHVGQSYSVLVTANQDEADYYMVASPKLLKTSDYSSLVGIGVLHYS  306

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+   +GPLPEGPDP D  FS+NQA+SIRWNLT GAARPNPQG+FNV+N+TLSQTFVL
Sbjct  307  NSVSTV-SGPLPEGPDPLDDDFSMNQARSIRWNLTVGAARPNPQGSFNVSNVTLSQTFVL  365

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDA-ADYGVS  537
              +  +I   PRY+VNNVSY T  TPLKLADY VNG+GVY+LD FP  S     A YGVS
Sbjct  366  ESTVAQIHDLPRYVVNNVSYYTVPTPLKLADYCVNGSGVYQLDTFPVKSENSTDASYGVS  425

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V+G HKGW+EIVF+N L VMDSWH DGFG  VVGYG G+WT  +R TYN+YDPVVRSTV
Sbjct  426  VVTGIHKGWIEIVFKNDLFVMDSWHFDGFGFFVVGYGKGDWTEESRSTYNLYDPVVRSTV  485

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTAVY FLDN GMWNLRSQ +KHWYLGQ+LY+RV D DP+PAKE+PPP NLLLC
Sbjct  486  QVYPEGWTAVYAFLDNVGMWNLRSQLLKHWYLGQELYVRVFDADPDPAKERPPPDNLLLC  545

Query  898  GMF  906
            G+F
Sbjct  546  GIF  548



>ref|XP_002311058.1| hypothetical protein POPTR_0008s03200g [Populus trichocarpa]
 gb|EEE88425.1| hypothetical protein POPTR_0008s03200g [Populus trichocarpa]
Length=547

 Score =   448 bits (1153),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 214/300 (71%), Positives = 245/300 (82%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ++ DYYIVA+P L   +        G+LHY+
Sbjct  249  EGSYTNQITLDSLDVHVGQSYSVLVTADQNEADYYIVASPLLLNTSSPGGFDGVGVLHYS  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+     GPLP GPDPFDL  S+NQA+SIRWNLTAGAARPN QG FNVTN+TLSQTF+L
Sbjct  309  NSLTPV-KGPLPGGPDPFDLDSSVNQARSIRWNLTAGAARPNRQGAFNVTNVTLSQTFIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS  EI G  RY VNNVSY T +TPLKLAD+FVNG+GVY+LD FP + V   A YGVS+
Sbjct  368  DGSTAEIEGAQRYAVNNVSYYTLNTPLKLADHFVNGSGVYQLDRFPVNFVNAKAAYGVSV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF N L  MD+WHLDGFG +VVG+G+G W P AR  YN+YDPVVRSTVQ
Sbjct  428  VTGIHKGWIELVFVNSLNTMDAWHLDGFGFYVVGFGNGLWGPEARNDYNIYDPVVRSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVY FLDNPGMWNLRSQ +K+WYLGQ+LYIRV DDDPNPAKE+PPP+NLLLCG
Sbjct  488  VYPNGWTAVYAFLDNPGMWNLRSQSLKNWYLGQELYIRVFDDDPNPAKERPPPNNLLLCG  547



>ref|XP_007010042.1| Cupredoxin superfamily protein [Theobroma cacao]
 gb|EOY18852.1| Cupredoxin superfamily protein [Theobroma cacao]
Length=588

 Score =   446 bits (1147),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 213/304 (70%), Positives = 252/304 (83%), Gaps = 4/304 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQITL+SLDVHVGQSYSVLV+ADQ+++DYYIVAAPK+  A+E S L+  G+LHY 
Sbjct  251  EGSYVNQITLNSLDVHVGQSYSVLVTADQEEKDYYIVAAPKMINASEFSSLLGVGVLHYD  310

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S    PA G LP GPDPFD+QFSI+QAKSIRWNLTAGAARPNPQGTFNV+N+TLSQ F+
Sbjct  311  NSTI--PARGLLPSGPDPFDIQFSIDQAKSIRWNLTAGAARPNPQGTFNVSNVTLSQAFL  368

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNG-AGVYELDDFPTHSVKDAADYGV  534
            L GS  EI GTPRY VNN+SY TPDTPLKLAD + NG +GV+ELD FPT+S    A  GV
Sbjct  369  LQGSAAEINGTPRYTVNNISYLTPDTPLKLADAYANGGSGVFELDKFPTNSSNLEAVNGV  428

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
             + +G HKGW+E+VF+N L  +D+WHLDGFG  VVG GD EWTP +R +YN YDPVVRST
Sbjct  429  FVATGIHKGWIELVFKNDLEFIDTWHLDGFGFFVVGLGDEEWTPDSRSSYNTYDPVVRST  488

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            +QVYPG WTAV+ +LDNPGMWNLRSQ +K+WYLGQ+LY+RV+D DP+PAKE+ PP NLLL
Sbjct  489  MQVYPGRWTAVFAYLDNPGMWNLRSQLLKNWYLGQELYLRVYDPDPDPAKERTPPENLLL  548

Query  895  CGMF  906
            CG+F
Sbjct  549  CGIF  552



>ref|XP_008780211.1| PREDICTED: monocopper oxidase-like protein SKU5 [Phoenix dactylifera]
Length=573

 Score =   442 bits (1138),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 248/302 (82%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QI LDSLDVHVGQSYSVL +A+Q + DYYIVA+P   +      +    +LHYA
Sbjct  248  EGSYTDQIVLDSLDVHVGQSYSVLFTANQQESDYYIVASPTQIDTRNYPNINGVAVLHYA  307

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   + +GPLP GPD  D  FSINQAKSIRWNLT GAARPNPQGTFNVTN+T+SQTF+L
Sbjct  308  NS-NTQLSGPLPPGPDQLDRVFSINQAKSIRWNLTTGAARPNPQGTFNVTNVTISQTFIL  366

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS+ E+     Y +NNVSY T  TPLKLADYFVNG+GVY+LD FPT+SV   A  G S+
Sbjct  367  HGSEAELGDRRCYTINNVSYLTLSTPLKLADYFVNGSGVYQLDAFPTNSVNQEAALGTSV  426

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF+N L VMDSWHLDGFG +VVG+GDGEW PA+RETYN+Y+PVVRSTVQ
Sbjct  427  VTGNHKGWIELVFKNDLDVMDSWHLDGFGFYVVGFGDGEWNPASRETYNLYNPVVRSTVQ  486

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY +LDNPGMWNLRSQ +++WYLG+++Y+RVHD+D NPAKE+PPP NLLLCG
Sbjct  487  VYPGGWTAVYAYLDNPGMWNLRSQRLENWYLGEEMYVRVHDNDLNPAKERPPPENLLLCG  546

Query  901  MF  906
            +F
Sbjct  547  IF  548



>ref|XP_011031806.1| PREDICTED: monocopper oxidase-like protein SKU5 [Populus euphratica]
Length=547

 Score =   441 bits (1135),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 211/300 (70%), Positives = 244/300 (81%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQ+TLDSLDVHVGQSYSVLV+ADQ++ DYYIVA+P L  ++        G+L Y+
Sbjct  249  EGSYTNQMTLDSLDVHVGQSYSVLVTADQNEADYYIVASPLLLNSSSPGGFDGVGVLRYS  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+     GPLP GPDPFDL  S+NQA+SIRWNLTAGAARPN QG FNVTN+TLSQ F+L
Sbjct  309  NSLTPV-NGPLPGGPDPFDLDSSVNQARSIRWNLTAGAARPNRQGAFNVTNVTLSQNFIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS  EI G  RY VNNVSY T +TPLKLAD+FVNG+GVY+LD FP + V   A YGVS+
Sbjct  368  DGSTAEIGGAQRYAVNNVSYYTLNTPLKLADHFVNGSGVYQLDRFPVNFVNAKAAYGVSV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+E+VF N L  MD+WHLDGFG +VVG+G+G W P AR  YN+YDPVVRSTVQ
Sbjct  428  VTGIHKGWIELVFVNSLNTMDAWHLDGFGFYVVGFGNGLWGPEARNDYNIYDPVVRSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVY FLDNPGMWNLRSQ +K+WYLGQ+LYIRV DDDPNPAKE+PPP+NLLLCG
Sbjct  488  VYPNGWTAVYAFLDNPGMWNLRSQSLKNWYLGQELYIRVFDDDPNPAKERPPPNNLLLCG  547



>emb|CDP17254.1| unnamed protein product [Coffea canephora]
Length=534

 Score =   434 bits (1116),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 209/301 (69%), Positives = 238/301 (79%), Gaps = 2/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLD+LDVHVGQSYSVLV+ADQ+  DYYIVA+PK+      S L+A G+LHY 
Sbjct  235  EGSYTNQITLDTLDVHVGQSYSVLVTADQNAADYYIVASPKMIAETNQSSLIAVGVLHYE  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +  P GPLP+GPDPFD+  SI QA+S+RWNLT GAARPNPQGTFNV+N+TLSQ+F+L
Sbjct  295  NS-STPPNGPLPKGPDPFDINSSITQARSVRWNLTTGAARPNPQGTFNVSNVTLSQSFLL  353

Query  361  HGS-KGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            HG     + G   Y VNNVSY TP+T LKLADY +NG+GVY LDDFP H +   A  G  
Sbjct  354  HGGVTANLDGFVHYTVNNVSYDTPNTALKLADYALNGSGVYLLDDFPVHHISPLAVKGTF  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + SG HKGWLEIVF NH   +DSWHLDGFG + VGYG G WTP  R TYN+YDPVVRSTV
Sbjct  414  VRSGNHKGWLEIVFFNHHQNIDSWHLDGFGFYTVGYGYGNWTPEFRSTYNLYDPVVRSTV  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTAVY +LDNPGMWNLRSQ +KHWYLGQ+LY+RVHD DPNPAKE PPP NLL C
Sbjct  474  QVYPKGWTAVYAYLDNPGMWNLRSQSLKHWYLGQELYVRVHDPDPNPAKEHPPPENLLYC  533

Query  898  G  900
            G
Sbjct  534  G  534



>ref|XP_006361718.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Solanum 
tuberosum]
Length=530

 Score =   433 bits (1113),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 208/300 (69%), Positives = 235/300 (78%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL+SLDVHVGQSYSVLV+ADQD  DYYIVA  K+  + +   L   G+LHY 
Sbjct  232  EGSYTNQITLNSLDVHVGQSYSVLVTADQDAADYYIVATAKMANSTQLKTLQVIGVLHYE  291

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +   GP+P GPDPFD+ FSI+QA+SIRWNLT GAARPNPQGTFNV+N+TLSQTFVL
Sbjct  292  NSTKSA-DGPIPNGPDPFDVNFSISQARSIRWNLTTGAARPNPQGTFNVSNVTLSQTFVL  350

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S     G   Y +NNVSY TP TPLKLADY++NGAGVYELD FP +       YG  +
Sbjct  351  QNSLNYKNGMINYAINNVSYATPKTPLKLADYYLNGAGVYELDKFPANVSLPEVVYGTFV  410

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            VSG HKGWLEIVF+N L VMDSWHLDGF   VVGYG G W P +R TYN+YDPVVRSTVQ
Sbjct  411  VSGEHKGWLEIVFKNELQVMDSWHLDGFSFFVVGYGFGNWKPESRSTYNLYDPVVRSTVQ  470

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVYV+LDNPGMWNLRSQ +K+W+LGQ+LYIRV+D DPNPAKE  PP NLL CG
Sbjct  471  VYPKGWTAVYVYLDNPGMWNLRSQKLKNWFLGQELYIRVYDSDPNPAKELIPPKNLLYCG  530



>ref|XP_008233434.1| PREDICTED: monocopper oxidase-like protein SKU5 [Prunus mume]
Length=609

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 205/302 (68%), Positives = 247/302 (82%), Gaps = 2/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN+ITLDSLDVHVGQSYSVLV+ADQ+  DYY+VA+PK+  A++ +     G+LHY 
Sbjct  252  EGSYTNKITLDSLDVHVGQSYSVLVTADQNVSDYYMVASPKMFNASDVTRF-GIGVLHYD  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S    P+G LP+GPDPFD +FSI+QA+SIRWNLT GAARPNPQGTFNV N+TLSQTF+L
Sbjct  311  KSTTP-PSGSLPKGPDPFDQKFSIHQAQSIRWNLTTGAARPNPQGTFNVHNVTLSQTFIL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  EI G P++ VNNVSY  PDTPLKLAD F+NG+GVY+LD+F T+S       GV +
Sbjct  370  QASTAEINGLPQFTVNNVSYLAPDTPLKLADQFLNGSGVYKLDEFSTNSSNFETVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             SG HKGW+E+VF N L  MD+WHLDGFG +VVG+G G+W+P +R  YN+YDPVVRSTVQ
Sbjct  430  ASGKHKGWIELVFHNDLEGMDAWHLDGFGFYVVGFGTGKWSPKSRSKYNLYDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKEK  P+NLLLCG
Sbjct  490  VYPGGWTAVYAYLDNPGMWNLRSQHLKNWYLGEELYLRVYDADPNPAKEKRAPNNLLLCG  549

Query  901  MF  906
             F
Sbjct  550  EF  551



>ref|XP_002311059.2| hypothetical protein POPTR_0008s03210g [Populus trichocarpa]
 gb|EEE88426.2| hypothetical protein POPTR_0008s03210g [Populus trichocarpa]
Length=587

 Score =   433 bits (1114),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/303 (68%), Positives = 241/303 (80%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQI +DSLDVHVGQSYSVLV+ADQ   DYYIVA PK+    +   LV  G+LHY 
Sbjct  247  EGSYTNQIMVDSLDVHVGQSYSVLVTADQKAADYYIVATPKMVNTTKYGNLVGVGVLHYL  306

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +    GPLP GPDP+DLQFSINQAKSI+WN+T GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  307  NS-STMATGPLPSGPDPYDLQFSINQAKSIKWNMTTGAARPNPQGTFNVTNVTLSQTFIL  365

Query  361  HGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
             GS+ G+  G   Y VN+V Y+  DTPLKLAD   NG+GVYELD F T+S      +GV 
Sbjct  366  TGSRVGDTYGFSYYTVNDVRYKETDTPLKLADLMTNGSGVYELDKFSTNSSNGNLRHGVF  425

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + SG HKGWLEIV +N L V+DSWHLDG+G +VVG+GDG+WTP +R  YN+YDPVVRST+
Sbjct  426  VASGNHKGWLEIVLKNDLDVIDSWHLDGYGFYVVGFGDGDWTPESRNNYNLYDPVVRSTI  485

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTAVY +LDNPGMWNLRSQ +K+WYLGQQLY+RV+D DPNPAKE+PPP NLLLC
Sbjct  486  QVYPKRWTAVYAYLDNPGMWNLRSQSLKNWYLGQQLYLRVYDADPNPAKERPPPDNLLLC  545

Query  898  GMF  906
            G F
Sbjct  546  GAF  548



>ref|XP_002532786.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF29605.1| multicopper oxidase, putative [Ricinus communis]
Length=576

 Score =   432 bits (1112),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 203/301 (67%), Positives = 243/301 (81%), Gaps = 1/301 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QITLDSLDVHVGQSYSVLV+ADQ+  DYYIVA PK+   NE +   A G+LHY 
Sbjct  253  EGSYTTQITLDSLDVHVGQSYSVLVTADQNAADYYIVATPKMVNENEINNFAAVGVLHYD  312

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      GPLP GPDPF++QFSI+Q+KSIRWNLT GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  313  NS-TVNATGPLPSGPDPFNVQFSIDQSKSIRWNLTTGAARPNPQGTFNVTNVTLSQTFIL  371

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             G+K EI     + VN++SY T DTPLKLADY  N + V++LD F T+S      +GV +
Sbjct  372  QGTKAEIGSESFHTVNDISYITQDTPLKLADYEGNWSDVFQLDQFSTNSTNGGPKHGVFV  431

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             SG HKGW+E+VF+N+L VMD+WHLDGFG +VVG+GD +WTP +R TYN+YDPVVRSTVQ
Sbjct  432  ASGNHKGWIELVFKNNLDVMDAWHLDGFGFYVVGFGDRDWTPKSRATYNLYDPVVRSTVQ  491

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVY +LDNPGMWNLRSQ++ +WYLGQ+LY+RV+D DPNPAKE+PPP NLL+CG
Sbjct  492  VYPKGWTAVYAYLDNPGMWNLRSQNLDNWYLGQELYLRVYDADPNPAKERPPPDNLLVCG  551

Query  901  M  903
             
Sbjct  552  F  552



>ref|XP_004308757.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Fragaria 
vesca subsp. vesca]
Length=607

 Score =   432 bits (1112),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 204/302 (68%), Positives = 239/302 (79%), Gaps = 2/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN ITLD LDVHVGQSYSVLV+ADQ   DYY++A PKL    + +     G+LHY 
Sbjct  258  EGSYTNAITLDYLDVHVGQSYSVLVTADQATSDYYMLATPKLVNVTDMTKF-GIGVLHYD  316

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A   GPLP GPDPFD++ SINQA SIRWNLT GAARPNPQG+FNV N+TLSQTF+L
Sbjct  317  SSTTAA-GGPLPIGPDPFDIELSINQANSIRWNLTTGAARPNPQGSFNVHNVTLSQTFIL  375

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  EI GTP++ VNNVSY TPDTPLKLAD+ VNG+GVYELD+F T+S     + GV +
Sbjct  376  SASTAEIDGTPKFTVNNVSYLTPDTPLKLADHLVNGSGVYELDEFSTNSTIVKPERGVFV  435

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             SG HKGW+E+VF N L VMDSWHLDGFG  VVGYG G+W+P +R TYN+YDPVVRSTVQ
Sbjct  436  ASGIHKGWIELVFHNDLDVMDSWHLDGFGFFVVGYGRGKWSPKSRSTYNLYDPVVRSTVQ  495

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GW+A Y +LDNPGMWNLRSQ +K+WYLG++LY+RV+D DPNP KE+P P N+LLCG
Sbjct  496  VYPRGWSAAYAYLDNPGMWNLRSQQLKNWYLGEELYVRVYDADPNPEKERPSPDNILLCG  555

Query  901  MF  906
             F
Sbjct  556  KF  557



>gb|KCW51528.1| hypothetical protein EUGRSUZ_J01040 [Eucalyptus grandis]
Length=476

 Score =   426 bits (1096),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 241/300 (80%), Gaps = 1/300 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QIT+DSLD+HVGQSYSVLV+ADQ   DY+I A PKL    E+  L+A G+LHY 
Sbjct  178  EGSYTAQITVDSLDIHVGQSYSVLVTADQAKADYFITATPKLVRVEESGELIALGVLHYK  237

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +  P  P+P GPDPF + FSI QAKSIRWN+TAGAARPNPQG FNV+ +T +QTFVL
Sbjct  238  NS-SGPPRYPIPPGPDPFHMGFSIRQAKSIRWNMTAGAARPNPQGMFNVSRVTPNQTFVL  296

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS  +I G PRY VNNVSY T +TPLKLADY VNG+GVY+LD +P  SV   A+ GV +
Sbjct  297  HGSTAKIDGAPRYAVNNVSYHTLETPLKLADYLVNGSGVYQLDSYPVRSVNPVAESGVFV  356

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+E+VF N L VMDSWHLDGFG +VVG+G+G WTP  R TYN +DPVVRSTVQ
Sbjct  357  ATGVHKGWIELVFSNGLDVMDSWHLDGFGFYVVGFGNGTWTPRLRSTYNTHDPVVRSTVQ  416

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WTAVY +LDNPGMWNLRSQH KHWYLGQ+LY+RV+D DP+PAKE+PPP NLLLCG
Sbjct  417  VYPGKWTAVYAYLDNPGMWNLRSQHSKHWYLGQELYVRVYDADPDPAKERPPPENLLLCG  476



>ref|XP_010034312.1| PREDICTED: monocopper oxidase-like protein SKU5 [Eucalyptus grandis]
Length=578

 Score =   429 bits (1104),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 242/302 (80%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT QIT+DSLD+HVGQSYSVLV+ADQ   DY+I A PKL    E+  L+A G+LHY 
Sbjct  251  EGSYTAQITVDSLDIHVGQSYSVLVTADQAKADYFITATPKLVRVEESGELIALGVLHYK  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +  P  P+P GPDPF + FSI QAKSIRWN+TAGAARPNPQG FNV+ +T +QTFVL
Sbjct  311  NS-SGPPRYPIPPGPDPFHMGFSIRQAKSIRWNMTAGAARPNPQGMFNVSRVTPNQTFVL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            HGS  +I G PRY VNNVSY T +TPLKLADY VNG+GVY+LD +P  SV   A+ GV +
Sbjct  370  HGSTAKIDGAPRYAVNNVSYHTLETPLKLADYLVNGSGVYQLDSYPVRSVNPVAESGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G HKGW+E+VF N L VMDSWHLDGFG +VVG+G+G WTP  R TYN +DPVVRSTVQ
Sbjct  430  ATGVHKGWIELVFSNGLDVMDSWHLDGFGFYVVGFGNGTWTPRLRSTYNTHDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG WTAVY +LDNPGMWNLRSQH KHWYLGQ+LY+RV+D DP+PAKE+PPP NLLLCG
Sbjct  490  VYPGKWTAVYAYLDNPGMWNLRSQHSKHWYLGQELYVRVYDADPDPAKERPPPENLLLCG  549

Query  901  MF  906
             F
Sbjct  550  KF  551



>ref|XP_007220122.1| hypothetical protein PRUPE_ppa021300mg [Prunus persica]
 gb|EMJ21321.1| hypothetical protein PRUPE_ppa021300mg [Prunus persica]
Length=551

 Score =   428 bits (1100),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/300 (68%), Positives = 244/300 (81%), Gaps = 2/300 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ+  DYY+VA+PK+  A++ +     G+LHY 
Sbjct  252  EGSYTNQITLDSLDVHVGQSYSVLVTADQNASDYYMVASPKMFNASDVTRF-GIGVLHYD  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S    P G LP GPDPF+ +FSI+QA+SIRWNLT GAARPNPQGTFNV N+TLSQTF+L
Sbjct  311  KSTTP-PNGSLPRGPDPFNQKFSIHQAQSIRWNLTTGAARPNPQGTFNVHNVTLSQTFIL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  EI G P++ VNNVSY  PDTPLKLAD F+NG+GVY+LD+F T+S       GV +
Sbjct  370  RASIAEINGLPQFTVNNVSYLAPDTPLKLADQFLNGSGVYKLDEFSTNSSNFKTVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             SG HKGW+E+VF N L  MD+WHLDGFG +VVG+G G+W+  +R  YN++DPVVRSTVQ
Sbjct  430  ASGKHKGWIELVFHNDLEGMDAWHLDGFGFYVVGFGTGKWSQKSRSKYNLHDPVVRSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKEKP P+NLLLCG
Sbjct  490  VYPGGWTAVYAYLDNPGMWNLRSQHLKNWYLGEELYLRVYDADPNPAKEKPAPNNLLLCG  549



>ref|XP_004250496.1| PREDICTED: monocopper oxidase-like protein SKU5 [Solanum lycopersicum]
Length=530

 Score =   427 bits (1098),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/301 (69%), Positives = 235/301 (78%), Gaps = 3/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL+SLDVHVGQSYSVLV+ADQD  DYYIVA  K+  + +   L   G+LHY 
Sbjct  232  EGSYTNQITLNSLDVHVGQSYSVLVTADQDAADYYIVATAKMANSTQLKTLQVVGVLHYE  291

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S   KPA GP+P GP PFD+ FSI+QA+SIRWNLT GAARPNPQGTFNV+N+TLSQTFV
Sbjct  292  NS--TKPANGPIPNGPGPFDVNFSISQARSIRWNLTTGAARPNPQGTFNVSNVTLSQTFV  349

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S     G   Y +NNVSY TP TPLKLADY++NGAGVYELD FP +       YG  
Sbjct  350  LQNSLNYKNGMINYAINNVSYATPKTPLKLADYYLNGAGVYELDKFPANVSLPEVVYGTF  409

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +VSG HKGWLEIVF+N L VMDSWHLDGF   VVGYG G W P +R  YN++DP+VRSTV
Sbjct  410  VVSGEHKGWLEIVFKNELQVMDSWHLDGFSFFVVGYGFGNWKPESRSRYNLHDPIVRSTV  469

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTAVYV+LDNPGMWNLRSQ +K+W+LGQ+LYIRV+D DPNPAKE  PP NLL C
Sbjct  470  QVYPKGWTAVYVYLDNPGMWNLRSQKLKNWFLGQELYIRVYDSDPNPAKELIPPKNLLYC  529

Query  898  G  900
            G
Sbjct  530  G  530



>ref|XP_006436530.1| hypothetical protein CICLE_v10033561mg [Citrus clementina]
 gb|ESR49770.1| hypothetical protein CICLE_v10033561mg [Citrus clementina]
Length=552

 Score =   426 bits (1096),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 238/302 (79%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN+I LDSLDVHVGQSYSVLV+AD++  DYYIVA+PKL  A+  S +    +LHY 
Sbjct  249  EGSYTNKIKLDSLDVHVGQSYSVLVTADKNPADYYIVASPKLSHADANSSIYGVAVLHYD  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S    P G  P+G DPF+LQ SI+QAK IRWNLT GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  309  NS-TTPPIGIPPKGLDPFNLQLSIDQAKDIRWNLTTGAARPNPQGTFNVTNVTLSQTFIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS   I G P Y VNNVSY TP+TPLKLAD F NG+GVYELD FP ++    A  GV +
Sbjct  368  QGSLAGIDGAPLYTVNNVSYLTPETPLKLADQFANGSGVYELDKFPVNASNIDAIRGVFV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G H+GW+EIV +N L V+DSWHLDGFG + VGYG G+W P  R  YN+YDPVVRSTVQ
Sbjct  428  ATGIHRGWIEIVLKNELEVIDSWHLDGFGFYTVGYGIGDWNPQLRSRYNLYDPVVRSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            +YPG WTAVY +LDNPGMWNLRSQ +K+W+LGQ+LY+RV+D DPNP KE+PPP NLLLCG
Sbjct  488  IYPGAWTAVYAYLDNPGMWNLRSQLLKNWHLGQELYVRVYDADPNPNKERPPPENLLLCG  547

Query  901  MF  906
            +F
Sbjct  548  LF  549



>ref|XP_006838121.1| hypothetical protein AMTR_s00106p00062610 [Amborella trichopoda]
 gb|ERN00690.1| hypothetical protein AMTR_s00106p00062610 [Amborella trichopoda]
Length=362

 Score =   419 bits (1078),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 192/301 (64%), Positives = 240/301 (80%), Gaps = 1/301 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QI LDSLDVHVGQSYSVLV+ADQ+  +Y++VA+P+L    +   L+   +LHY 
Sbjct  37   EGSYTSQIMLDSLDVHVGQSYSVLVTADQNAGNYFMVASPRLVTTADNPNLMGIAVLHYD  96

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A P G LP GPD  D +FS+NQA+SIRWN+T GAARPNPQGTFNVTN+T++QTF+L
Sbjct  97   SSTTA-PIGSLPVGPDQLDQEFSVNQARSIRWNMTTGAARPNPQGTFNVTNVTINQTFIL  155

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H    EI G  R+ VNN+SY TP TPLKLAD+ +NG+GVY LD FPT++V   A    S+
Sbjct  156  HSFPVEIEGNTRFTVNNISYLTPTTPLKLADHALNGSGVYILDAFPTNAVSPVAAINTSV  215

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V+G HKGW+EIVF N+  ++D+WHLDGFG +VVG+G+G W+  +R TYN++DPVVRSTVQ
Sbjct  216  VTGIHKGWIEIVFANNAPLVDTWHLDGFGFYVVGFGEGVWSKESRATYNLFDPVVRSTVQ  275

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWT +Y FLDNPGMWNLRSQ +++W+LGQ+LYIRVH+DDPNPAKE+PPP NLL C 
Sbjct  276  VYPAGWTVIYAFLDNPGMWNLRSQRLQNWFLGQELYIRVHNDDPNPAKERPPPDNLLTCV  335

Query  901  M  903
            M
Sbjct  336  M  336



>ref|XP_011031807.1| PREDICTED: monocopper oxidase-like protein SKU5 [Populus euphratica]
Length=595

 Score =   427 bits (1099),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 239/303 (79%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQI +DSLDVHVGQSYSVLV+ADQ   DYYIVA PK+    E + LV  G+LHY 
Sbjct  242  EGSYTNQIMVDSLDVHVGQSYSVLVTADQKAADYYIVATPKMVNITEYANLVGIGVLHYL  301

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +   AGPLP GPDP+DLQFSINQAK+I+WN+T GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  302  NS-STMAAGPLPSGPDPYDLQFSINQAKAIKWNMTTGAARPNPQGTFNVTNVTLSQTFIL  360

Query  361  HGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
             GS+  +  G P Y VN+V Y   DTPLKLAD   NG+GVYELD F T+S      +GV 
Sbjct  361  TGSRAWDTSGFPYYTVNDVWYTETDTPLKLADLMTNGSGVYELDKFSTNSSNGNLRHGVF  420

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + SG HKGWLEIV +N L V+DSWHLDG+  +VVG+GDG WTP +R  YN+YDPVVRST+
Sbjct  421  VASGNHKGWLEIVLKNDLDVIDSWHLDGYSFYVVGFGDGNWTPESRNNYNLYDPVVRSTI  480

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTAVY +LDNPGMWNLRSQ +K+ YLGQQLY+RV+D DPNPAKE+PPP NLLLC
Sbjct  481  QVYPKRWTAVYAYLDNPGMWNLRSQSLKNRYLGQQLYLRVYDADPNPAKERPPPDNLLLC  540

Query  898  GMF  906
            G F
Sbjct  541  GAF  543



>ref|XP_006485346.1| PREDICTED: monocopper oxidase-like protein SKS1-like [Citrus 
sinensis]
Length=594

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 202/302 (67%), Positives = 237/302 (78%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN+I LDSLDVHVGQSYSVLV+AD++  DYYIVA+PKL  A+  S +    +LHY 
Sbjct  249  EGSYTNKIKLDSLDVHVGQSYSVLVTADKNPADYYIVASPKLSHADANSSIYGVAVLHYD  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S    P G  P+G DPF+LQ SI+QAK IRWNLT GAARPNPQGTFNVTN+TLSQTF+L
Sbjct  309  NS-TTPPIGIPPKGLDPFNLQLSIDQAKDIRWNLTTGAARPNPQGTFNVTNVTLSQTFIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS   I G P Y VNNVSY TP+TPLKLAD F NG+GVYELD FP ++    A  GV +
Sbjct  368  QGSLAGIDGAPLYTVNNVSYLTPETPLKLADQFANGSGVYELDKFPVNASNIDAIRGVFV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +G H+GW+EIV +N L V+DSWHLDGFG + VGYG G+W P  R  YN+YDPVVRSTVQ
Sbjct  428  ATGIHRGWIEIVLKNELEVIDSWHLDGFGFYTVGYGIGDWNPQLRSRYNLYDPVVRSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            +YPG WTAVY +LDNPGMWNLRSQ +K+W+LGQ+LY+RV+D DPNP KE+PPP NLLLCG
Sbjct  488  IYPGAWTAVYAYLDNPGMWNLRSQLLKNWHLGQELYVRVYDADPNPNKERPPPENLLLCG  547

Query  901  MF  906
             F
Sbjct  548  NF  549



>ref|XP_009369004.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=584

 Score =   424 bits (1090),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 247/302 (82%), Gaps = 2/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ   DYY+VA+PK+  A + +     G+LHY 
Sbjct  254  EGSYTNQITLDSLDVHVGQSYSVLVTADQTVSDYYMVASPKMFNATDVNKF-GIGVLHYD  312

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G LP GPDPFD +FSINQAKSIRWNLT GAARPNPQG+FNV N+TLSQTF+L
Sbjct  313  NSTTPA-SGSLPTGPDPFDQEFSINQAKSIRWNLTTGAARPNPQGSFNVHNVTLSQTFIL  371

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S  EI G P++ VNNVSY  PDTPLKLAD F+NG+G+Y+LD F T+S    +  GV +
Sbjct  372  HASIAEIFGLPQFTVNNVSYLAPDTPLKLADQFLNGSGIYDLDKFSTNSSNVESVRGVFV  431

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +GTHKGW+E+VFQN L  MD+WHLDGFG  VVG+G G+W P +R +YN+YDPVVRSTVQ
Sbjct  432  ATGTHKGWIELVFQNDLEDMDAWHLDGFGFFVVGFGTGKWKPESRSSYNLYDPVVRSTVQ  491

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKE+PPPSNLLLCG
Sbjct  492  VYPGGWSAVYAYLDNPGMWNLRSQHLKNWYLGEELYVRVYDADPNPAKERPPPSNLLLCG  551

Query  901  MF  906
             F
Sbjct  552  AF  553



>ref|XP_009351243.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=585

 Score =   423 bits (1088),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 247/302 (82%), Gaps = 2/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ   DYY+VA+PK+  A + +     G+LHY 
Sbjct  254  EGSYTNQITLDSLDVHVGQSYSVLVTADQTVSDYYMVASPKMFNATDVNKF-GIGVLHYD  312

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G LP GPDPFD +FSINQAKSIRWNLT GAARPNPQG+FNV N+TLSQTF+L
Sbjct  313  NSTTPA-SGSLPTGPDPFDREFSINQAKSIRWNLTTGAARPNPQGSFNVHNVTLSQTFIL  371

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S  EI G P++ VNNVSY  PDTPLKLAD F+NG+G+Y+LD F T+S    +  GV +
Sbjct  372  HASIAEIFGLPQFTVNNVSYLAPDTPLKLADQFLNGSGIYDLDKFSTNSSNVESVRGVFV  431

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +GTHKGW+E+VFQN L  MD+WHLDGFG  VVG+G G+W P +R +YN+YDPVVRSTVQ
Sbjct  432  ATGTHKGWIELVFQNDLEDMDAWHLDGFGFFVVGFGTGKWKPESRSSYNLYDPVVRSTVQ  491

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKE+PPPSNLLLCG
Sbjct  492  VYPGGWSAVYAYLDNPGMWNLRSQHLKNWYLGEELYVRVYDADPNPAKERPPPSNLLLCG  551

Query  901  MF  906
             F
Sbjct  552  AF  553



>ref|XP_009369002.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
 ref|XP_009342484.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=585

 Score =   423 bits (1088),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 208/302 (69%), Positives = 247/302 (82%), Gaps = 2/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ   DYY+VA+PK+  A + +     G+LHY 
Sbjct  254  EGSYTNQITLDSLDVHVGQSYSVLVTADQTVSDYYMVASPKMFNATDVNKF-GIGVLHYD  312

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G LP GPDPFD +FSINQAKSIRWNLT GAARPNPQG+FNV N+TLSQTF+L
Sbjct  313  NSTTPA-SGSLPTGPDPFDQEFSINQAKSIRWNLTTGAARPNPQGSFNVHNVTLSQTFIL  371

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S  EI G P++ VNNVSY  PDTPLKLAD F+NG+G+Y+LD F T+S    +  GV +
Sbjct  372  HASIAEIFGLPQFTVNNVSYLAPDTPLKLADQFLNGSGIYDLDKFSTNSSNVESVRGVFV  431

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +GTHKGW+E+VFQN L  MD+WHLDGFG  VVG+G G+W P +R +YN+YDPVVRSTVQ
Sbjct  432  ATGTHKGWIELVFQNDLEDMDAWHLDGFGFFVVGFGTGKWKPESRSSYNLYDPVVRSTVQ  491

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKE+PPPSNLLLCG
Sbjct  492  VYPGGWSAVYAYLDNPGMWNLRSQHLKNWYLGEELYVRVYDADPNPAKERPPPSNLLLCG  551

Query  901  MF  906
             F
Sbjct  552  AF  553



>ref|XP_006606920.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Glycine 
max]
Length=549

 Score =   418 bits (1075),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 236/301 (78%), Gaps = 3/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q+  DYYIVA+PKL  A   + LV   +LHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQNAVDYYIVASPKLSNATNNNTLVGVAVLHYD  310

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S    PA G LP GPDPFDLQFSINQAKSIRWNLT GAARPNPQG FNVTN+T+ +TF+
Sbjct  311  NSTT--PANGSLPSGPDPFDLQFSINQAKSIRWNLTTGAARPNPQGMFNVTNVTIIETFI  368

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L+ S   I G  RY VNNVSY  PDTPLKLAD+F NG GVYELD F  ++    A  GV 
Sbjct  369  LNASTATIDGLSRYSVNNVSYLIPDTPLKLADFFSNGTGVYELDAFSKNTSNANAVRGVF  428

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + S  HKGW EIV +N+L ++D+WHLDG+   VVG G+G+W P +R +YN+YDPV RSTV
Sbjct  429  VASALHKGWTEIVLENNLDIIDTWHLDGYSFFVVGMGEGDWNPESRSSYNLYDPVARSTV  488

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPGGW++VYV+ DNPGMWNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLC
Sbjct  489  QVYPGGWSSVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDADPNPAKEKPPPQNLLLC  548

Query  898  G  900
            G
Sbjct  549  G  549



>ref|XP_008376280.1| PREDICTED: monocopper oxidase-like protein SKU5 [Malus domestica]
Length=567

 Score =   418 bits (1075),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 207/300 (69%), Positives = 245/300 (82%), Gaps = 2/300 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN+ITLDSLDVHVGQSYSVLV+ADQ   DYY++A+PKL  A + S     G+LHY 
Sbjct  245  EGSYTNKITLDSLDVHVGQSYSVLVTADQTVSDYYMMASPKLFNATDVSKF-GIGVLHYD  303

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP GPDPFD +FSINQAKSIR NLT GAARPNPQG+FNV N+TLSQTF+L
Sbjct  304  NSTTPA-SGPLPTGPDPFDREFSINQAKSIRLNLTTGAARPNPQGSFNVHNVTLSQTFIL  362

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            H S  EI G P++ VNNVSY  PDTPLKLAD F+NG+G+Y+LD F T+S    +  GV +
Sbjct  363  HSSTAEIFGLPQFTVNNVSYLAPDTPLKLADQFLNGSGIYDLDKFSTNSSNVESVRGVFV  422

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             +GTHKGW+E+VFQN L  MD+WHLDGFG  VVG+G G+W P +R TYN+YDPVVRSTVQ
Sbjct  423  ATGTHKGWIELVFQNDLEDMDAWHLDGFGFFVVGFGAGKWKPESRSTYNLYDPVVRSTVQ  482

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG W+AVY +LDNPGMWNLRSQH+K+WYLG++LY+RV+D DPNPAKE+PPPSNLLLCG
Sbjct  483  VYPGEWSAVYAYLDNPGMWNLRSQHLKNWYLGEELYVRVYDADPNPAKERPPPSNLLLCG  542



>ref|XP_007144243.1| hypothetical protein PHAVU_007G140000g [Phaseolus vulgaris]
 gb|ESW16237.1| hypothetical protein PHAVU_007G140000g [Phaseolus vulgaris]
Length=605

 Score =   418 bits (1075),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 237/302 (78%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+QD  DYY+VA+PK+  A   + LV   +LHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQDAADYYVVASPKMSNATNNNTLVGVAVLHYN  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      G LP GPDPFD+QFSINQAKSI+WNLT GAARPNPQGTFNV+N+T+S+TF+L
Sbjct  311  NSTTPA-KGSLPSGPDPFDVQFSINQAKSIKWNLTTGAARPNPQGTFNVSNVTISETFIL  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            + S   I G   Y VNNVSY TPDTPLKLADYF NG GVYELD F  +S    A  GV +
Sbjct  370  NASIATIDGLSHYTVNNVSYLTPDTPLKLADYFSNGTGVYELDAFSKNSSNAEAVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  HKGW EIV +N+L ++D+WHLDG+   VVG G+GEW+  +R +YN+YDPV RS+VQ
Sbjct  430  ASALHKGWTEIVLKNNLDIIDTWHLDGYSFFVVGMGEGEWSRESRSSYNLYDPVGRSSVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVYV+ DNPGMWNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLCG
Sbjct  490  VYPGGWSAVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDPDPNPAKEKPPPPNLLLCG  549

Query  901  MF  906
             +
Sbjct  550  KY  551



>ref|XP_003555477.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Glycine 
max]
 gb|KHN00956.1| Monocopper oxidase-like protein SKU5 [Glycine soja]
Length=661

 Score =   418 bits (1075),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 232/302 (77%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q   DYYIVA+PK+  A   + LV   +LHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQSAADYYIVASPKMSNATNNNTLVGVAVLHYD  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      G LP GPDPFDLQFSINQAKSIRWNLT GAARPNPQGTFNV N+ +S+TF+ 
Sbjct  311  NSTTPA-TGSLPSGPDPFDLQFSINQAKSIRWNLTTGAARPNPQGTFNVKNVAISETFIF  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   + G  RY VNNVSY TP+TPLKLADYF NG GVYELD +  +S    A  GV +
Sbjct  370  QASTAVVDGLYRYTVNNVSYLTPNTPLKLADYFSNGTGVYELDAYSKNSSNVNAVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  HKGW EIV +N+L ++D+WHLDG+   VVG G+GEW P +R +YN+ DPV RSTVQ
Sbjct  430  ASALHKGWTEIVLKNNLDIIDTWHLDGYSFFVVGIGEGEWNPESRSSYNLNDPVARSTVQ  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVYV+ DNPGMWNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLCG
Sbjct  490  VYPGGWSAVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDADPNPAKEKPPPQNLLLCG  549

Query  901  MF  906
             F
Sbjct  550  FF  551



>ref|XP_004496129.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cicer arietinum]
Length=598

 Score =   414 bits (1064),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 234/302 (77%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q+  DYYIVA+PK+  A + + LV   +LHY 
Sbjct  249  EGSYVNQINLESLDVHVGQSYSVLVTANQNAADYYIVASPKMSNATQNNSLVGIAMLHYD  308

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   +  G LP GPDPFDL+FSI+QA SIRWNLT GAARPNPQGTFNVTN+T+SQT +L
Sbjct  309  NS-TTQANGSLPSGPDPFDLEFSISQANSIRWNLTTGAARPNPQGTFNVTNVTISQTLIL  367

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I  +PRY VNNVSY TPDTPLKLAD+F N +GVY+LD +  ++    A   V +
Sbjct  368  QASTATIDRSPRYTVNNVSYLTPDTPLKLADHFSNSSGVYQLDAYSKNASNVIAVRDVFV  427

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  HKGW EIV +N L  +D+WHLDG+   VVG G+GEW   +R +YN++DPV RSTVQ
Sbjct  428  ASAVHKGWAEIVLKNTLTTIDAWHLDGYSFFVVGLGEGEWKEESRSSYNLFDPVARSTVQ  487

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            V+PGGW+AVYV+ DNPGMWNLRSQ+++ WYLGQ+LY+RV+D DPNPAKE+PPP NLLLCG
Sbjct  488  VFPGGWSAVYVYPDNPGMWNLRSQNLQSWYLGQELYVRVYDPDPNPAKERPPPQNLLLCG  547

Query  901  MF  906
             F
Sbjct  548  KF  549



>ref|XP_003535482.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Glycine 
max]
Length=622

 Score =   415 bits (1066),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 234/302 (77%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q   DYYIVA+PK+  A   + LV   ILHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQSAADYYIVASPKMSNATNNNTLVGVAILHYD  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A    G LP GPDPFD+QFSINQ KSIRWNLT GAARPNPQGTFNV N+T+++TF+ 
Sbjct  311  NSTAPA-TGSLPSGPDPFDVQFSINQTKSIRWNLTTGAARPNPQGTFNVRNVTIAETFIF  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VNNVSY TP+TPLKLADYF NG GVY+LD +  ++    A  GV +
Sbjct  370  QASTAVIDGLSRYTVNNVSYLTPNTPLKLADYFSNGTGVYKLDAYSKNTSNANAVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  +KGW EIV +N+L ++D+WHLDG+   VVG G+GEW P +R +YN+YDPV RSTV 
Sbjct  430  ASALYKGWTEIVLKNNLDIIDTWHLDGYSFFVVGIGEGEWNPESRSSYNLYDPVARSTVP  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVYV+ DNPG+WNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLCG
Sbjct  490  VYPGGWSAVYVYPDNPGIWNLRSQNLESWYLGEELYVRVYDADPNPAKEKPPPQNLLLCG  549

Query  901  MF  906
            +F
Sbjct  550  LF  551



>gb|KHN37884.1| Monocopper oxidase-like protein SKU5 [Glycine soja]
Length=651

 Score =   414 bits (1063),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 233/302 (77%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q    YYIVA+PK+  A   + LV   ILHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQSAAVYYIVASPKMSNATNNNTLVGVAILHYD  310

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A    G LP GPDPFD+QFSINQ KSIRWNLT GAARPNPQGTFNV N+T+++TF+ 
Sbjct  311  NSTAPA-TGSLPSGPDPFDVQFSINQTKSIRWNLTTGAARPNPQGTFNVRNVTIAETFIF  369

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VNNVSY TP+TPLKLADYF NG GVYELD +  ++    A  GV +
Sbjct  370  QASTAVIDGLSRYTVNNVSYLTPNTPLKLADYFSNGTGVYELDAYSKNTSNANAVRGVFV  429

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  +KGW EIV +N+L ++D+WHLDG+   VVG G+GEW P +R +YN+YDPV RSTV 
Sbjct  430  ASALYKGWTEIVLKNNLDIIDTWHLDGYSFFVVGIGEGEWNPESRSSYNLYDPVARSTVP  489

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGW+AVYV+ DNPG+WNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLCG
Sbjct  490  VYPGGWSAVYVYPDNPGIWNLRSQNLESWYLGEELYVRVYDADPNPAKEKPPPQNLLLCG  549

Query  901  MF  906
            +F
Sbjct  550  LF  551



>ref|XP_011084388.1| PREDICTED: monocopper oxidase-like protein SKS2 [Sesamum indicum]
Length=615

 Score =   409 bits (1051),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 211/301 (70%), Positives = 242/301 (80%), Gaps = 2/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVHVGQSYSVLV+ADQ   DYYIVA PK     + + + A G+LHY 
Sbjct  254  EGSYTNQITLDSLDVHVGQSYSVLVTADQYPADYYIVATPKWVNLTKPNAIAAVGLLHYD  313

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +   GPLP GPDPFD+ FS+NQA++I  N++ G ARPNPQG+FNVTN+TLSQTF+L
Sbjct  314  NSTESV-NGPLPNGPDPFDIDFSLNQAQAITLNMSTGGARPNPQGSFNVTNVTLSQTFLL  372

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS   I G PRY VNNV+Y TP TPLKLAD F+NG+GVYELD FP HS   A   G  +
Sbjct  373  RGSLAVIDGYPRYTVNNVTYVTPSTPLKLADQFLNGSGVYELDAFPIHSSLPAPVNGTFV  432

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARET-YNVYDPVVRSTV  717
            VSGTHKGWLEIVF+N L ++DSWHLDGFG  VVG+G GEWTP AR T YN  DPVVRSTV
Sbjct  433  VSGTHKGWLEIVFKNDLDMIDSWHLDGFGFFVVGFGLGEWTPEARSTMYNFDDPVVRSTV  492

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPGGWTAVYV+LDNPGMWNLRSQ+++HWYLGQ+LYIRV+D DPNPAKE+ PP+NLL C
Sbjct  493  QVYPGGWTAVYVYLDNPGMWNLRSQNLRHWYLGQELYIRVYDPDPNPAKERSPPNNLLFC  552

Query  898  G  900
            G
Sbjct  553  G  553



>gb|KEH43313.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=594

 Score =   407 bits (1046),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 197/302 (65%), Positives = 233/302 (77%), Gaps = 4/302 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI LDSLDVHVGQSYSVLV+A+Q+  DYYIVA+PK+   N    LV   +LHY 
Sbjct  242  EGSYVNQIDLDSLDVHVGQSYSVLVTANQNPADYYIVASPKMSLNNS---LVGIAVLHYD  298

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   +  GPLP GPDPFDL+FSINQAKSIRWNLTAGAARPNPQGTFNVTN+T+SQTF+L
Sbjct  299  NS-TTQANGPLPIGPDPFDLEFSINQAKSIRWNLTAGAARPNPQGTFNVTNVTISQTFIL  357

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I     + VNNVSY TP TPLKLAD+F NG+GVYELD +  ++    A   V +
Sbjct  358  EASTATIDQVSFHTVNNVSYSTPKTPLKLADHFSNGSGVYELDAYSKNTSNVKAVRDVFV  417

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  HK W EIV +N L  +DSWHLDG+   VVGYG+GEW   +R +YN++DPVVRSTVQ
Sbjct  418  ASALHKEWAEIVVKNTLTNIDSWHLDGYSFFVVGYGEGEWKEESRSSYNLFDPVVRSTVQ  477

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            V+PGGW+AVYV+ DNPGMWNLRSQ++K WYLG++LY+RV D +PNPAKEKPPP NLLLCG
Sbjct  478  VFPGGWSAVYVYPDNPGMWNLRSQNLKSWYLGEELYVRVFDPNPNPAKEKPPPQNLLLCG  537

Query  901  MF  906
             +
Sbjct  538  KY  539



>ref|XP_007144242.1| hypothetical protein PHAVU_007G139900g [Phaseolus vulgaris]
 gb|ESW16236.1| hypothetical protein PHAVU_007G139900g [Phaseolus vulgaris]
Length=720

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 234/302 (77%), Gaps = 1/302 (0%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+QD  DYYIVA+PK+  A   + LV   +LHY 
Sbjct  252  EGSYVNQIELESLDVHVGQSYSVLVTANQDAADYYIVASPKMSSATNNNTLVGVAVLHYN  311

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      G LP GPDPFD+QFSINQAKSI+WNLT GAARPNPQGTF+V+++T+S+TF+L
Sbjct  312  NSTTPA-KGYLPSGPDPFDVQFSINQAKSIKWNLTTGAARPNPQGTFSVSSVTISETFIL  370

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
            + S   I G   Y VNNVSY TPDTPLKLADYF NG GVYELD F  +S    A  GV +
Sbjct  371  NASIATIDGLSHYTVNNVSYLTPDTPLKLADYFSNGTGVYELDAFSKNSSNAEAVRGVFV  430

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
             S  HKGW EIV +N+L ++D+WHLDG    VVG G+GEW   +R +YN+YDPV RS+VQ
Sbjct  431  ASALHKGWTEIVLKNNLDIIDTWHLDGHSFFVVGMGEGEWNRESRSSYNLYDPVGRSSVQ  490

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPG W+AVYV+ DNPGMWNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP NLLLCG
Sbjct  491  VYPGWWSAVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDPDPNPAKEKPPPPNLLLCG  550

Query  901  MF  906
             +
Sbjct  551  KY  552



>gb|KHN00955.1| Monocopper oxidase-like protein SKU5 [Glycine soja]
Length=542

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 193/294 (66%), Positives = 230/294 (78%), Gaps = 3/294 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q+  DYYIVA+PKL  A   + LV   +LHY 
Sbjct  251  EGSYVNQIELESLDVHVGQSYSVLVTANQNAVDYYIVASPKLSNATNNNTLVGVVVLHYD  310

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S    PA G LP GPDPFDLQFSINQAKSIRWNLT GAARPNPQG FNVTN+T+ +TF+
Sbjct  311  NSTT--PANGSLPSGPDPFDLQFSINQAKSIRWNLTTGAARPNPQGMFNVTNVTIIETFI  368

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L+ S   I G  RY VNNVSY  PDTPLKLAD+F NG GVYELD F  ++    A  GV 
Sbjct  369  LNASTATIDGLSRYSVNNVSYLIPDTPLKLADFFSNGTGVYELDAFSKNTSNANAVRGVF  428

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + S  HKGW EIV +N+L ++D+WHLDG+   VVG G+G+W P +R +YN+YDPV RSTV
Sbjct  429  VASALHKGWTEIVLENNLDIIDTWHLDGYSFFVVGMGEGDWNPESRSSYNLYDPVARSTV  488

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPP  879
            QVYPGGW++VYV+ DNPGMWNLRSQ+++ WYLG++LY+RV+D DPNPAKEKPPP
Sbjct  489  QVYPGGWSSVYVYPDNPGMWNLRSQNLQSWYLGEELYVRVYDADPNPAKEKPPP  542



>ref|XP_003533163.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Glycine 
max]
Length=840

 Score =   409 bits (1051),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 196/301 (65%), Positives = 233/301 (77%), Gaps = 3/301 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSY NQI L+SLDVHVGQSYSVLV+A+Q+  DYYIVA+PKL  A   + LV   +LHY 
Sbjct  542  EGSYVNQIELESLDVHVGQSYSVLVTANQNAVDYYIVASPKLSNATNNNTLVGVVVLHYD  601

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S    PA G LP GPDPFDLQFSINQAKSIRWNLT GAARPNPQG F+VTN+T+ +TF+
Sbjct  602  NSTT--PANGSLPSGPDPFDLQFSINQAKSIRWNLTTGAARPNPQGMFHVTNVTIIETFI  659

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L+ S   I G  RY VNNVSY  PDTPLKLAD+F N  GVYELD F  ++      +GV 
Sbjct  660  LNASTTTIDGLSRYSVNNVSYLIPDTPLKLADFFSNRTGVYELDAFSKNTSNANVVHGVF  719

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            I S  HKGW EIV +N+L ++D+WHLDG+   VVG G+G+W P +R +YN+YDPV RSTV
Sbjct  720  IASALHKGWTEIVLENNLDIIDTWHLDGYSFFVVGMGEGDWNPESRSSYNLYDPVARSTV  779

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPGGW++VYV+ DNPGMWNLRSQ+++ WYLG+ LY+RV+D DPNP KEKPPP NLLLC
Sbjct  780  QVYPGGWSSVYVYPDNPGMWNLRSQNLQSWYLGEDLYVRVYDADPNPTKEKPPPQNLLLC  839

Query  898  G  900
            G
Sbjct  840  G  840



>gb|EYU32431.1| hypothetical protein MIMGU_mgv1a025826mg [Erythranthe guttata]
Length=568

 Score =   397 bits (1020),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 208/303 (69%), Positives = 235/303 (78%), Gaps = 2/303 (1%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITL+SLDVHVGQSYSVLV+A+Q   DYYIVA PK       +   A G+LHY 
Sbjct  230  EGSYTNQITLNSLDVHVGQSYSVLVAANQIPGDYYIVATPKWVNLTNPNATAAVGLLHYD  289

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      G LP GPDPFD+ FS++QA+SI WNLTAGAARPNPQGTFNV+N+TLSQTFVL
Sbjct  290  NS-NTTVNGLLPTGPDPFDIGFSLDQARSITWNLTAGAARPNPQGTFNVSNVTLSQTFVL  348

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I GTPRY VNNV+Y T  TPLKLADY++NG+G+Y+LD FP HS    A     +
Sbjct  349  RQSFALINGTPRYTVNNVTYLTTHTPLKLADYYLNGSGIYDLDAFPVHSSLPGAVKAPFV  408

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAAR-ETYNVYDPVVRSTV  717
            VSGTHKGWLEIVF N L  +DSWHLDG+G  VVG+G G+WTP  R  TYN  DPVVRSTV
Sbjct  409  VSGTHKGWLEIVFINVLDTIDSWHLDGYGFFVVGFGVGDWTPEVRVTTYNFVDPVVRSTV  468

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTAVYV+LDNPGMWNLRSQ++ HWYLGQ+LYIRV D D NPAKEKPPP NLL C
Sbjct  469  QVYPKGWTAVYVYLDNPGMWNLRSQNLIHWYLGQELYIRVFDPDLNPAKEKPPPDNLLFC  528

Query  898  GMF  906
            G+F
Sbjct  529  GVF  531



>emb|CDO99810.1| unnamed protein product [Coffea canephora]
Length=575

 Score =   365 bits (936),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 188/305 (62%), Positives = 223/305 (73%), Gaps = 7/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT+QI LDSLDVHVGQSYSVLV+ DQ+  DYYIVA+PKL +    + LVA G+LHY 
Sbjct  254  EGSYTDQILLDSLDVHVGQSYSVLVTMDQNVADYYIVASPKLVDETNQTSLVAVGVLHYN  313

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSI---RWNLTAGAARPNPQGTFNVTNITLSQT  351
            GS    P GPLP+    +  + SI   +SI   RWNLTAGAARPN QG+FN++  T+SQ 
Sbjct  314  GS-NTPPNGPLPKDSTEYHKK-SIVLTQSIHVYRWNLTAGAARPNSQGSFNISKATISQN  371

Query  352  FVLHGS-KGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADY  528
            F LHG    E  G   Y VNNVSY TPDTPLKLADY +NG+GVY LD +P +        
Sbjct  372  FNLHGGLAAEFNGILGYTVNNVSYLTPDTPLKLADYALNGSGVYSLDKYPANYTFPLTVK  431

Query  529  GVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
            G  +VSG HK + EIVF N+   +DSWHLDGFG   VGYG+G WTP +R  YN+ +PVVR
Sbjct  432  GTFVVSGIHKAYAEIVFVNNHEAIDSWHLDGFGFWAVGYGNGSWTPQSRTEYNIINPVVR  491

Query  709  STV-QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSN  885
            STV QVYP GWT+VY +LDNPGMWNLRSQ +++WYLGQ+LYIRV+D DPNPAKE+PPP N
Sbjct  492  STVQQVYPKGWTSVYAYLDNPGMWNLRSQILEYWYLGQELYIRVYDPDPNPAKERPPPEN  551

Query  886  LLLCG  900
            LL CG
Sbjct  552  LLCCG  556



>gb|KHN35422.1| Monocopper oxidase-like protein SKU5, partial [Glycine soja]
Length=298

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/269 (62%), Positives = 203/269 (75%), Gaps = 3/269 (1%)
 Frame = +1

Query  16   NQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYAGSVAA  195
            NQI L+SLDVHVGQSYSVLV+ +Q+  DYYIVA+PKL  A   + LV   +LHY  S   
Sbjct  1    NQIELESLDVHVGQSYSVLVTTNQNIADYYIVASPKLSNATNNNTLVGVVVLHYDNSTT-  59

Query  196  KPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVLHGSK  372
             PA G LP GPDPFD+QFSINQ KSIRWNLT GAARPNPQG F+VTN+T+ +TF+L+ S 
Sbjct  60   -PANGSLPSGPDPFDMQFSINQEKSIRWNLTTGAARPNPQGMFHVTNVTIIETFILNAST  118

Query  373  GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSIVSGT  552
              I G   Y VNNVSY  PDTPLKLAD+F N  GVYELD F  ++    A  GV + S  
Sbjct  119  TTIDGLSCYSVNNVSYLIPDTPLKLADFFSNRTGVYELDAFSKNTSNANAVRGVFVASAL  178

Query  553  HKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQVYPG  732
            HKGW EIV +N+L ++D+WHLDG+   VVG G+G+W P +R +YN+YDP+ RSTVQVYPG
Sbjct  179  HKGWTEIVLENNLDIIDTWHLDGYSFFVVGMGEGDWNPESRSSYNLYDPIARSTVQVYPG  238

Query  733  GWTAVYVFLDNPGMWNLRSQHVKHWYLGQ  819
            GW++VYV+ DNPGMWNLRSQ+++ WYLG+
Sbjct  239  GWSSVYVYPDNPGMWNLRSQNLQSWYLGK  267



>gb|KDO47579.1| hypothetical protein CISIN_1g042677mg [Citrus sinensis]
Length=504

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 180/303 (59%), Positives = 217/303 (72%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTN+I LDSLDVHVGQSYSVLV+AD++  DYYIVA+PKL  A+  S +    +LHY 
Sbjct  196  EGSYTNKIKLDSLDVHVGQSYSVLVTADKNPADYYIVASPKLSHADANSSIYGVAVLHYD  255

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAAR--PNPQGTFNVTNITLS--Q  348
             S    P G  P+G DPF+LQ SI+QAK IR        R   N    F+  N T +  +
Sbjct  256  NSTTP-PIGIPPKGLDPFNLQLSIDQAKDIRGCFVNSYHRNTRNILTYFSEINATFTYLR  314

Query  349  TFVLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADY  528
            + V+    G I G P Y VNNVSY TP+TPLKLAD F NG+GVYELD FP ++    A  
Sbjct  315  SKVMRSLAG-IDGAPLYTVNNVSYLTPETPLKLADKFANGSGVYELDKFPVNASNVDAIR  373

Query  529  GVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
            GV + +G H+GW+EIV +N L V+DSWHLDGFG + VGYG G+W P  R  YN+YDPVVR
Sbjct  374  GVFVATGIHRGWIEIVLKNELEVIDSWHLDGFGFYTVGYGIGDWNPQLRSRYNLYDPVVR  433

Query  709  STVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNL  888
            STVQVYPG WTAVY +LDNPGMWNLRSQ +K+W+LGQ+LY+RV+D DPNP KE+PPP NL
Sbjct  434  STVQVYPGAWTAVYAYLDNPGMWNLRSQLLKNWHLGQELYVRVYDADPNPNKERPPPENL  493

Query  889  LLC  897
            LLC
Sbjct  494  LLC  496



>ref|XP_009369006.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=322

 Score =   343 bits (880),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 226/302 (75%), Gaps = 22/302 (7%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS T+QI+LDSLDVHVGQSYSVLV+A+Q+  DYY+V++PKL   +E + LV  G+LH++
Sbjct  31   EGSCTDQISLDSLDVHVGQSYSVLVTANQNAADYYMVSSPKLVNTSEFASLVGIGVLHHS  90

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+ + +GPLP+GPDPFDL FS++QAK IRWNLTAGAARPN QGTFNV+N+TLSQTF+L
Sbjct  91   NSVS-QVSGPLPDGPDPFDLDFSVDQAKFIRWNLTAGAARPNLQGTFNVSNVTLSQTFIL  149

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
             GS  +++G PRY+VNNVSY+TP+TPLKLADY++NG G+Y+LD FP HSV D A YG  +
Sbjct  150  QGSVADLKGEPRYVVNNVSYKTPETPLKLADYYINGTGMYQLDAFPIHSVNDDAAYGRDL  209

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
                H+     V +N +      H  GF +    +G+G+W+  +R+TYN+YDPVVRS VQ
Sbjct  210  --NPHR-----VDRNCVHEQSGCH--GF-LAFRWFGNGDWSTDSRDTYNLYDPVVRSIVQ  259

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYPGGWTAV  FLDNPGMWNLR  +           +RV+D DPNPAKE   P NLL CG
Sbjct  260  VYPGGWTAV-AFLDNPGMWNLRGNNS----------VRVYDADPNPAKELLLPENLLRCG  308

Query  901  MF  906
            +F
Sbjct  309  IF  310



>ref|XP_010090444.1| Monocopper oxidase-like protein SKS1 [Morus notabilis]
 gb|EXB39459.1| Monocopper oxidase-like protein SKS1 [Morus notabilis]
Length=951

 Score =   352 bits (904),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 163/214 (76%), Positives = 183/214 (86%), Gaps = 1/214 (0%)
 Frame = +1

Query  268  IRWNLTAGAARPNPQGTFNVTNITLSQTFVLHGSKGEIRGTPRYLVNNVSYRTPDTPLKL  447
            + WNLT GAARPNPQGTFNVTN+TLSQTF+L  S  EI G+ R  VNNVSY TPDTPLKL
Sbjct  464  VGWNLTTGAARPNPQGTFNVTNVTLSQTFILQDSGAEINGSIRRGVNNVSYYTPDTPLKL  523

Query  448  ADYFVNGAGVYELDDFPTHSVKDAADYGVSIVSGTHKGWLEIVFQN-HLAVMDSWHLDGF  624
            ADYFVNG+GVY+LD FPTHSV D A YG+S+VSG HKGW EIVF N + A +DSWH DGF
Sbjct  524  ADYFVNGSGVYQLDAFPTHSVNDNASYGISVVSGIHKGWHEIVFHNKYFAFIDSWHFDGF  583

Query  625  GMHVVGYGDGEWTPAARETYNVYDPVVRSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKH  804
            G +VVG+G+G+WTP  R TYN+YDPVVRSTVQVYPGGWTAVY FLDNPGMWNLRSQ +KH
Sbjct  584  GFYVVGFGNGDWTPEQRSTYNLYDPVVRSTVQVYPGGWTAVYAFLDNPGMWNLRSQVLKH  643

Query  805  WYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCGMF  906
            WYLGQ+LY+RV D DPNPAKE+PPP NLLLCG+F
Sbjct  644  WYLGQELYVRVFDADPNPAKERPPPENLLLCGIF  677


 Score =   310 bits (795),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 160/243 (66%), Positives = 187/243 (77%), Gaps = 6/243 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANET--SPLVAKGILH  174
            EGSYTNQI LDSLDVHVGQSYSVLV+A+Q+  DYYIVA PKL + N+T    LV  G+LH
Sbjct  250  EGSYTNQIVLDSLDVHVGQSYSVLVTANQNQADYYIVATPKLVDLNDTDYKDLVGVGVLH  309

Query  175  YAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            Y+ S     +GPLP+GP PFD++FS+NQAKSIRWNLT GAARPNPQGTFNVTN+TLSQTF
Sbjct  310  YSNSTTPV-SGPLPDGPGPFDIEFSVNQAKSIRWNLTTGAARPNPQGTFNVTNVTLSQTF  368

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +L  S  EI G+ R  VNNVSY TPDTPLKLADYFVNG+GVY+LD FPTHSV D A YG+
Sbjct  369  ILQDSGAEINGSIRRGVNNVSYYTPDTPLKLADYFVNGSGVYQLDAFPTHSVNDNASYGI  428

Query  535  SIVSGTHKGWLEIVFQN-HLAVMDSWHLDGFGMHVVGYG--DGEWTPAARETYNVYDPVV  705
            S+VSG HKGW EIVF N + A +DSWH DGFG +VVG+    G   P  + T+NV +  +
Sbjct  429  SVVSGIHKGWHEIVFHNKYFAFIDSWHFDGFGFYVVGWNLTTGAARPNPQGTFNVTNVTL  488

Query  706  RST  714
              T
Sbjct  489  SQT  491


 Score =   212 bits (540),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 125/182 (69%), Gaps = 23/182 (13%)
 Frame = +1

Query  361  HGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
              S+G +I G PR+ VNNVSY  P+ PL LAD+FVNG+G YELD + T S    A  GV 
Sbjct  705  QASRGAQIGGVPRFTVNNVSYLIPEIPLNLADHFVNGSGTYELDKYQTDSTYPNAVQGVF  764

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            + SGTH+GW+++VF                      GDGEW P  R TYNV+DPVVRSTV
Sbjct  765  VASGTHEGWIQLVF----------------------GDGEWIPKVRSTYNVFDPVVRSTV  802

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYPG WTAVY +LDNPGMWNLRSQH++HWY  ++LY+RV+D DPNPAKEKP P NL + 
Sbjct  803  QVYPGRWTAVYAYLDNPGMWNLRSQHLRHWYFVEELYVRVYDPDPNPAKEKPIPDNLKVL  862

Query  898  GM  903
            G+
Sbjct  863  GI  864



>emb|CDP02462.1| unnamed protein product [Coffea canephora]
Length=540

 Score =   297 bits (760),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 158/300 (53%), Positives = 203/300 (68%), Gaps = 6/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q T DSLDVHVGQS +VLV+ DQ  +DYYIVA+ +  E      L A  +LHY 
Sbjct  240  EGSHVIQNTYDSLDVHVGQSATVLVTFDQPPKDYYIVASTRFTE----KVLTATAVLHYT  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GPLP GP P D+Q+S+NQAK++RWNLTA AARPNPQG+F+   I++++ FVL
Sbjct  296  NSRTAV-SGPLPAGPAPKDVQWSLNQAKTLRWNLTANAARPNPQGSFHYGKISVTKRFVL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  R+ VN VSY  PDTPLKLAD+F N  GV+ L+   +     +  YGVS+
Sbjct  355  ANSAPLINGKQRFAVNGVSYVNPDTPLKLADHF-NIPGVFGLNSIESSPSGVSPHYGVSV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +S +   ++EIVFQN+   + SWHLDG+   VVGYG G+WT A+R TYN+ D + R T Q
Sbjct  414  LSTSLHDFMEIVFQNNERSLQSWHLDGYDFWVVGYGAGQWTQASRATYNLEDALTRHTAQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS   +  YLGQQ+Y+RV+   P+ A E   P+N+LLCG
Sbjct  474  VYPNSWTAILVSLDNQGMWNLRSAIWEKQYLGQQVYLRVYTPTPSLANEYDIPTNVLLCG  533



>ref|XP_010680450.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010680451.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=538

 Score =   286 bits (732),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/300 (51%), Positives = 198/300 (66%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DS+DVHVGQS S+LV+ DQ  +DYYIVA+ +  +      L A G+LHY+
Sbjct  239  EGSHVLQNLYDSIDVHVGQSLSILVTLDQPPKDYYIVASTRFTKI----VLSATGVLHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A+ +GPLP  P   +L +S+ QA++ RWNLTA AARPNPQG+F+   I +S+TFVL
Sbjct  295  NS-GAQVSGPLPPAPAG-ELHWSMEQARTFRWNLTANAARPNPQGSFHYGTIPISKTFVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  R+ VN VS+  PDTPLKLADYF N  GV+ L+   +     AA  G S+
Sbjct  353  ANSAPLINGKQRFAVNQVSFINPDTPLKLADYF-NIPGVFSLNSIQSSPSGGAARLGTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++ +H  ++E+VFQN    M SWHLDG+   VVG+G G+WT A+R+ YN+ D + R T Q
Sbjct  412  LAASHHDFIEVVFQNDENAMQSWHLDGYDFWVVGFGAGKWTQASRKGYNLKDALTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS      YLGQQLY+RV +   + A E  PPSNLLLCG
Sbjct  472  VYPNSWTAILVSLDNQGMWNVRSAMWPRQYLGQQLYLRVWNTAQSLANEYNPPSNLLLCG  531



>ref|XP_002969915.1| hypothetical protein SELMODRAFT_410532 [Selaginella moellendorffii]
 gb|EFJ29039.1| hypothetical protein SELMODRAFT_410532 [Selaginella moellendorffii]
Length=537

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 199/301 (66%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT Q   DSLDVHVGQSYSVL++ DQ  +D+YI+A  +         L    +LHY 
Sbjct  240  EGSYTAQALYDSLDVHVGQSYSVLITTDQSPKDFYIMATSRF----SLPELTGVAVLHYT  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S + + +GP P GP   D+ FS NQA++I+WNLTAGAARPNPQG+F+   I +S+T  L
Sbjct  296  NSFS-RVSGPFPAGPAVGDINFSFNQARTIKWNLTAGAARPNPQGSFHYGLINISKTVKL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  R+ VN +SY  P TPLKLAD++  G GV+  +  P +    +   G S+
Sbjct  355  ANSAPAINGKQRFAVNGISYMHPGTPLKLADFYKIG-GVFSPNSIPDYPDGRSPYNGASV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +SGT++ ++EI+FQN+   + SWH+DG+   VVG G G+WT ++R TYN+ D V RSTVQ
Sbjct  414  LSGTYRSFMEIIFQNNENPVQSWHIDGYAFFVVGMGPGDWTTSSRLTYNLVDAVARSTVQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNLLLC  897
            VY   WTA+ + LDN GMWN+RSQ+V   YLGQ+ Y+R V+ +DPN   E P P N+LLC
Sbjct  474  VYAKSWTAIMLELDNVGMWNVRSQNVIRQYLGQEFYMRVVNPEDPNGINE-PIPQNVLLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_010326262.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X2 [Solanum 
lycopersicum]
Length=508

 Score =   284 bits (726),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 212/342 (62%), Gaps = 8/342 (2%)
 Frame = +1

Query  1     EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
             EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+P+   ++++S  V   +LHY
Sbjct  171   EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNGSSDYYIVASPRFVNSSDSSKSVGVSVLHY  230

Query  178   AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             + S     +GPLP+ P   D  FS++QA+SIRWN++AGAARPNPQG+F    IT++  FV
Sbjct  231   SNS-QGPASGPLPDPPMESDTFFSMSQARSIRWNVSAGAARPNPQGSFKYGEITVTDVFV  289

Query  358   LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
             LH    E I G  R  ++ +SY  P TPLKLA+ F N   V++LD FP   +   A    
Sbjct  290   LHNRPAELIEGKWRTTLSGISYLAPSTPLKLAEQF-NIPSVFKLD-FPNKMMNRPAKVDT  347

Query  535   SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
             S+++GT+K ++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  348   SVINGTYKAFVEIIFQNNDTTVQSYHLDGYAFFVVGMDYGLWTENSRSTYNKWDGVARCT  407

Query  715   VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
              QV+PG WTA+ VFLDNPG+WNLR+Q++  WYLGQ+ YI V + +     E P P+N + 
Sbjct  408   TQVFPGAWTAILVFLDNPGIWNLRAQNLDSWYLGQETYINVVNPE---NSELPVPANTIF  464

Query  895   CGMFatspspapapqaGG*LHILVKKISI*FYHCVINVLDNL  1020
             CG  +                 L+K + + F   V+++L N 
Sbjct  465   CGALSPLQKDQARRVNFSCAPSLMKTMKLIFIGFVVSLLGNF  506



>ref|XP_002981392.1| hypothetical protein SELMODRAFT_178788 [Selaginella moellendorffii]
 gb|EFJ17580.1| hypothetical protein SELMODRAFT_178788 [Selaginella moellendorffii]
Length=537

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 199/301 (66%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT Q   DSLDVHVGQSYSVL++ DQ  +D+YI+A  +         +    +LHY 
Sbjct  240  EGSYTAQALYDSLDVHVGQSYSVLITTDQSPKDFYIMATSRF----SLPEITGVAVLHYT  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S + + +GP P GP   D+ FS NQA++I+WNLTAGAARPNPQG+F+   I +S+T  L
Sbjct  296  NSFS-RVSGPFPAGPAVGDINFSFNQARTIKWNLTAGAARPNPQGSFHYGLINISKTVKL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  R+ VN +SY  P TPLKLAD++  G GV+  +  P +    +   G S+
Sbjct  355  ANSAPAINGKQRFAVNGISYMHPGTPLKLADFYKIG-GVFSPNSIPEYPDGRSPYNGASV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +SGT++ ++EI+FQN+   + SWH+DG+   VVG G G+WT ++R TYN+ D V RSTVQ
Sbjct  414  LSGTYRSFMEIIFQNNENPVQSWHIDGYAFFVVGMGPGDWTTSSRLTYNLVDAVARSTVQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNLLLC  897
            VY   WTA+ + LDN GMWN+RSQ+V   YLGQ+ Y+R V+ +DPN   E P P N+LLC
Sbjct  474  VYAKSWTAIMLELDNVGMWNVRSQNVIRQYLGQEFYMRVVNPEDPNGINE-PIPQNVLLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_006345715.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Solanum 
tuberosum]
Length=583

 Score =   286 bits (731),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/302 (49%), Positives = 201/302 (67%), Gaps = 8/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+P+   ++++S LV   +LHY
Sbjct  246  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASPRFVNSSDSSKLVGVSVLHY  305

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P   D  FS++QA+SIRWN++AGAARPNPQG+F    IT++  FV
Sbjct  306  SNS-QGPASGPLPDPPMESDTFFSMSQARSIRWNVSAGAARPNPQGSFKYGEITVTDVFV  364

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            LH    E I G  R  ++ +SY  P TPLKLA+ F N  GV++LD FP   +   A    
Sbjct  365  LHNRPAELIEGKWRTTLSGISYLAPSTPLKLAEQF-NIPGVFKLD-FPNKMMNRPAKVDT  422

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT+K ++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  423  SVINGTYKAFVEIIFQNNDTTVQSYHLDGYAFFVVGMDYGLWTENSRSTYNKWDGVARCT  482

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ VFLDNPG+WNLR+Q++  WYLGQ+ Y+ V + +     E P P+N + 
Sbjct  483  TQVFPGAWTAILVFLDNPGIWNLRAQNLDSWYLGQETYVSVVNPE---NSELPVPANTIF  539

Query  895  CG  900
            CG
Sbjct  540  CG  541



>ref|XP_001771342.1| predicted protein [Physcomitrella patens]
 gb|EDQ63902.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   285 bits (728),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/310 (48%), Positives = 202/310 (65%), Gaps = 11/310 (4%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT Q +L++LDVHVGQSYSV+V+ADQ   DYYI+A+P+   A          ++HY+
Sbjct  237  EGSYTQQKSLNNLDVHVGQSYSVIVTADQASRDYYIMASPRFENATTFYDAAGVALMHYS  296

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP P GPDP D+ FS+ QA+SI WNLTAGAARPNPQG+F+  +I  SQTF+ 
Sbjct  297  DSNVIA-SGPHPLGPDPDDISFSLEQARSITWNLTAGAARPNPQGSFHYGSIDPSQTFIF  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPT-HSVKDAA-----  522
              S   I G  R+ +NN+S+    TPLKLAD++   +GVY LD +P+ +S ++       
Sbjct  356  KNSGPAIDGHHRFAINNISFVPTTTPLKLADFYNISSGVYTLDAWPSIYSQQEIMPIFEP  415

Query  523  DYGVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPV  702
                ++VSG +K ++E+VF+N+ A + SWHLDG+   VVG   G W+P +R  YN  D V
Sbjct  416  TLATAVVSGQYKAFVEMVFENNEATLQSWHLDGYAFWVVGMDHGRWSPTSRSQYNNVDAV  475

Query  703  VRSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDP----NPAKEK  870
             R T QV+P  WTAV V LDN G+WNLRS++++  YLGQ+LY+RV + +     +P  E 
Sbjct  476  ARCTTQVFPQSWTAVMVMLDNVGVWNLRSENLQRQYLGQELYLRVVNPEVLPMHSPYSET  535

Query  871  PPPSNLLLCG  900
            P P N L CG
Sbjct  536  PIPDNALHCG  545



>ref|XP_004247026.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X1 [Solanum 
lycopersicum]
Length=584

 Score =   283 bits (725),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 212/342 (62%), Gaps = 8/342 (2%)
 Frame = +1

Query  1     EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
             EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+P+   ++++S  V   +LHY
Sbjct  247   EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNGSSDYYIVASPRFVNSSDSSKSVGVSVLHY  306

Query  178   AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             + S     +GPLP+ P   D  FS++QA+SIRWN++AGAARPNPQG+F    IT++  FV
Sbjct  307   SNS-QGPASGPLPDPPMESDTFFSMSQARSIRWNVSAGAARPNPQGSFKYGEITVTDVFV  365

Query  358   LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
             LH    E I G  R  ++ +SY  P TPLKLA+ F N   V++LD FP   +   A    
Sbjct  366   LHNRPAELIEGKWRTTLSGISYLAPSTPLKLAEQF-NIPSVFKLD-FPNKMMNRPAKVDT  423

Query  535   SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
             S+++GT+K ++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  424   SVINGTYKAFVEIIFQNNDTTVQSYHLDGYAFFVVGMDYGLWTENSRSTYNKWDGVARCT  483

Query  715   VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
              QV+PG WTA+ VFLDNPG+WNLR+Q++  WYLGQ+ YI V + +     E P P+N + 
Sbjct  484   TQVFPGAWTAILVFLDNPGIWNLRAQNLDSWYLGQETYINVVNPE---NSELPVPANTIF  540

Query  895   CGMFatspspapapqaGG*LHILVKKISI*FYHCVINVLDNL  1020
             CG  +                 L+K + + F   V+++L N 
Sbjct  541   CGALSPLQKDQARRVNFSCAPSLMKTMKLIFIGFVVSLLGNF  582



>ref|XP_009792346.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nicotiana sylvestris]
Length=595

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 198/302 (66%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+P+   ++  S  V   +LHY
Sbjct  255  EGSYTVQQNYTSLDIHVGQSYSFLVTLDQNASSDYYIVASPRFVNSSGWSKSVGVAVLHY  314

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+  D  FS++QA+SIRWN++A AARPNPQG+F    IT++  FV
Sbjct  315  SNS-QGPASGPLPDPPNESDTFFSMSQARSIRWNVSASAARPNPQGSFRYGEITVTDVFV  373

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            LH    E I G PR  ++ +SY  P TPLKLA  F N  GV++LD FP   +   A    
Sbjct  374  LHNRPAELIEGKPRTTLSGISYLAPSTPLKLAQQF-NVPGVFKLD-FPNKMMNRPAKVDT  431

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT+K ++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  432  SIINGTYKAFVEIIFQNNDTTVQSYHLDGYAFFVVGMDYGLWTENSRSTYNKWDGVARCT  491

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ VFLDN G+WNLR+Q++  WYLGQ+ YI V + +     + P P+N++ 
Sbjct  492  TQVFPGAWTAILVFLDNDGIWNLRAQNLDSWYLGQETYISVVNPETTDKNDVPLPANVIY  551

Query  895  CG  900
            CG
Sbjct  552  CG  553



>ref|XP_009791835.1| PREDICTED: monocopper oxidase-like protein SKS1, partial [Nicotiana 
sylvestris]
Length=508

 Score =   280 bits (717),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 144/222 (65%), Positives = 163/222 (73%), Gaps = 4/222 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYTNQITLDSLDVH+GQSYSVLV+A QD   YYIVA  K+  + +   L    +LHY 
Sbjct  280  EGSYTNQITLDSLDVHMGQSYSVLVTAHQDTAHYYIVATAKMANSTQLQTLEVVAVLHYE  339

Query  181  GSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S   KPA GPLP GPDPFD+ FSI+QA+SIR NLT GAARPNPQG+FNV+N+TLSQTFV
Sbjct  340  NS--TKPANGPLPNGPDPFDVNFSISQARSIRLNLTTGAARPNPQGSFNVSNVTLSQTFV  397

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVN-GAGVYELDDFPTHSVKDAADYGV  534
            L  S  +  G   Y +NNVSY TP TPLKLADY++N GAGVYELD FP +S      YG 
Sbjct  398  LQNSVNKKNGMINYAINNVSYVTPQTPLKLADYYLNGGAGVYELDKFPANSSLPETVYGT  457

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEW  660
             +VSG HKGWLEIVF+N L VMDSWHLDGFG  VVG     W
Sbjct  458  FVVSGEHKGWLEIVFKNELKVMDSWHLDGFGFFVVGARTQNW  499



>ref|XP_009401796.1| PREDICTED: monocopper oxidase-like protein SKU5 [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   281 bits (719),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/305 (49%), Positives = 201/305 (66%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LD+HVGQSYS LV+ DQ+   DYY+VA+ +    +  + +    ILHY
Sbjct  254  EGSYTVQQNYTNLDIHVGQSYSFLVTMDQNASSDYYMVASARFVNESRWARVTGVAILHY  313

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+ P D +D  FS+NQA+SIRWNL+AGAARPNPQG+F   +I +SQ F
Sbjct  314  SNS-KGKASGPLPDPPNDVYDKTFSMNQARSIRWNLSAGAARPNPQGSFRYGSINVSQVF  372

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       IRGT R  +N +SY  P TPL+LAD +    GVY LD FPT  +K A   G
Sbjct  373  VLRNKPPVVIRGTHRATLNGISYTAPATPLRLADEY-KLKGVYTLD-FPTRPLKGAPKVG  430

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++EI+FQN+   + ++H+DG+   VVG   GEWT  +R TYN  D V R 
Sbjct  431  RSLINGTYRGFMEIIFQNNDTKVQTYHVDGYAFFVVGMDYGEWTEESRGTYNKGDGVARC  490

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            + QV+PG WTA+ V LDN G+WN+R+Q++  WYLGQ+ YIRV + +     E P P N L
Sbjct  491  STQVFPGAWTAILVSLDNVGIWNVRAQNLDTWYLGQETYIRVINPEDTNKTELPVPDNAL  550

Query  892  LCGMF  906
             CG+ 
Sbjct  551  YCGLL  555



>ref|XP_002967301.1| hypothetical protein SELMODRAFT_86988 [Selaginella moellendorffii]
 gb|EFJ31900.1| hypothetical protein SELMODRAFT_86988 [Selaginella moellendorffii]
Length=537

 Score =   279 bits (714),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 193/300 (64%), Gaps = 6/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT Q   DSLDVHVGQSYSV+++ DQ   D++IVA+ +         L     LHY+
Sbjct  238  EGSYTVQNFYDSLDVHVGQSYSVIITTDQAPGDFHIVASSRFG----VPVLTGLATLHYS  293

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S +    G LP GPDP D+ FS NQA SIRWNLTAGAARPNPQG+F+   I +S+T  L
Sbjct  294  NSPSTL-GGTLPPGPDPGDVGFSFNQAWSIRWNLTAGAARPNPQGSFHYGVINVSRTIKL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              +   I G  R+ VN++SY  PDTPLKLADY+    GV+ L+  P          G S+
Sbjct  353  FNTAPMINGKQRFAVNDISYFNPDTPLKLADYY-KIPGVFSLNSIPDSPYFSTPFLGTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  +  ++EI+FQN+  V+ SWH+DG+   VVG+G G W   +R TYN+YD V RST Q
Sbjct  412  LNVDYHSFIEIIFQNNEEVIQSWHIDGYQFFVVGFGPGAWNDTSRLTYNLYDAVARSTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+++ LDN GMW +RSQ+    YLGQ LY+RV++ +   + E P PSN+L CG
Sbjct  472  VYPMSWTAIFMSLDNVGMWEIRSQNPARQYLGQDLYMRVYNPEEARSTETPIPSNVLRCG  531



>ref|XP_009626424.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nicotiana tomentosiformis]
Length=595

 Score =   280 bits (717),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 198/302 (66%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+P+   +++ S  V   +LHY
Sbjct  255  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASPRFVNSSDWSKSVGVAVLHY  314

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+  D  FS++QA+SIRWN++A AARPNPQG+F    IT++  FV
Sbjct  315  SNS-QGPASGPLPDPPNESDTFFSMSQARSIRWNVSASAARPNPQGSFRYGEITVTDVFV  373

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            LH    E I G  R  ++ +SY  P TPLKLA  F N  GV++LD FP   +   A    
Sbjct  374  LHNRPAELIEGKRRTTLSGISYLAPSTPLKLAQQF-NVPGVFKLD-FPNKMMNRPAKVDT  431

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT+K ++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  432  SIINGTYKAFVEIIFQNNDTTVQSYHLDGYAFFVVGMDYGLWTENSRSTYNKWDGVARCT  491

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ VFLDN G+WNLR+Q++  WYLGQ+ Y+ V + +     + P P+N++ 
Sbjct  492  TQVFPGAWTAILVFLDNDGIWNLRAQNLDSWYLGQETYVSVVNPETTDKNDVPLPANVIY  551

Query  895  CG  900
            CG
Sbjct  552  CG  553



>gb|ACN40384.1| unknown [Picea sitchensis]
Length=591

 Score =   280 bits (715),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 198/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSY +Q    +LD+HVGQSYS LV+ DQ+   DYY+VA+ +       S +    ILHY
Sbjct  250  EGSYASQQNYTNLDIHVGQSYSFLVTMDQNASSDYYMVASARFVNTTIWSNVTGVAILHY  309

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K  GPLP+GPD + D  FS+NQA+SIRWN++AGAARPNPQG+F    I ++Q F
Sbjct  310  SNS-KGKAKGPLPDGPDDYYDKYFSMNQARSIRWNVSAGAARPNPQGSFKYGQINVTQVF  368

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL     E I G  R  +N +SY+ P TPLKLAD + N  GV++LD FP   +       
Sbjct  369  VLKNKPPELINGKRRCTLNGISYQAPATPLKLADRY-NLTGVFKLD-FPNAPMNRPPKLD  426

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++EI+ QN+   + S+H+DG+   VVG   G+WT  +R TYN +D V RS
Sbjct  427  TSIINGTYRGFMEIILQNNDTTVQSYHMDGYAFFVVGMDYGDWTENSRGTYNKWDGVARS  486

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+P  WTA+ V LDN GMWNLR++++  WYLGQ+ Y+RV + + N   E P PSN L
Sbjct  487  TAQVFPNAWTAILVSLDNVGMWNLRAENLDAWYLGQETYVRVVNPEINNKTELPLPSNAL  546

Query  892  LCG  900
             CG
Sbjct  547  YCG  549



>ref|XP_009397600.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=556

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/307 (48%), Positives = 193/307 (63%), Gaps = 12/307 (4%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT +   DSLD+HVGQSYSVLV+ADQ     YYIVA+ +  E +    L    I++Y
Sbjct  246  EGSYTLKQYYDSLDIHVGQSYSVLVTADQPPSTSYYIVASSRFVELD----LFGVAIINY  301

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
                  KP+G +PEGP PFD  +S+ QA+SIRW+L  GAARPNPQG++   +I +S+T V
Sbjct  302  DDGSNKKPSGGIPEGPSPFDYNYSMEQARSIRWDLKVGAARPNPQGSYRYGHINISRTIV  361

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L   +  I    RY +N VS+  PDTPLKLADYF    GV+   + P          G  
Sbjct  362  LQNDEVMIGDRTRYAINGVSFVYPDTPLKLADYF-GIPGVFMAGEVPDEPSGRKPTIGTP  420

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V   +K ++EI+FQN+ + + SWHLDG+   VVG  +G+W   +R TYN+ D + RSTV
Sbjct  421  VVDAIYKSFVEIIFQNNESSIQSWHLDGYNFFVVGMEEGKWNFCSRSTYNMVDAIFRSTV  480

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDD------PNPAKEKPPP  879
            QVYP  WTA+ V  DN GMWN+RSQ ++   LGQ+LY+RV+ DD      PNP  E P  
Sbjct  481  QVYPNSWTAILVAFDNMGMWNIRSQELERRQLGQELYMRVNWDDANNNTVPNPRDEMPFS  540

Query  880  SNLLLCG  900
             +LLLCG
Sbjct  541  PDLLLCG  547



>ref|XP_004232058.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=538

 Score =   278 bits (710),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 193/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS SVLV+ DQ  +DYYIVA+ +    + T    A  +LHY 
Sbjct  239  EGSHVLQNFYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFSRISFT----ATSVLHYT  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P  P    + +S+ QA++ RWNLT+ AARPNPQG+F+   IT+S+TFV+
Sbjct  295  NS-QTPVSGPVPPAPTG-QMHWSMLQARTFRWNLTSNAARPNPQGSFHYGKITISRTFVM  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLAD+F N  GV+ L+    +    + + G ++
Sbjct  353  ANSAPLINGKLRYAVNSVSYVNPDTPLKLADHF-NIPGVFNLNSIQAYPSGGSPNLGTAV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
               +H  ++EIVFQN  A M SWHLDG+   VVG+G G+WT A+R  YN+ D + R T Q
Sbjct  412  FPTSHHDFIEIVFQNDEATMQSWHLDGYDFWVVGFGSGKWTQASRNKYNLVDALTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS      YLGQQ+Y+RV+D  P+ A E   P+N LLCG
Sbjct  472  VYPKSWTAILVSLDNQGMWNLRSAMWDRQYLGQQVYLRVYDPTPSLANEYDIPTNALLCG  531



>ref|XP_010099197.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB77069.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=454

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 193/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q +  S+DVH+GQSYSVLV+ADQ  +DYY+V + +      +  L    +LHY+
Sbjct  152  EGSHTLQNSFSSIDVHLGQSYSVLVTADQPPKDYYVVVSSRF----TSKVLTTTAVLHYS  207

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   + +GP+P GP   ++ +S+NQA+SIRWNLTA   RPNPQG+++   I  S+T VL
Sbjct  208  NSFQ-RVSGPVPGGPTT-EIAWSLNQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIVL  265

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLADYF  G GV+ L   PT+     A    S+
Sbjct  266  ANSNAWINGKQRYAVNSVSYVPPDTPLKLADYFKIG-GVFNLGSIPTNPTWGGAYLQTSV  324

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +S  ++ ++EIVFQN    + SWH+DG+   VVG   G+WTPA+R+ YN+ D V R T Q
Sbjct  325  MSANYREFVEIVFQNWENEVQSWHIDGYSFFVVGMDGGQWTPASRQRYNLRDAVARCTTQ  384

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS++    YLGQQ Y RV  +  +   E P P + LLCG
Sbjct  385  VYPRSWTAIYMALDNVGMWNIRSENWARQYLGQQFYFRVFTNTNSWRDEYPIPRDALLCG  444



>ref|XP_009392633.1| PREDICTED: monocopper oxidase-like protein SKU5 [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   279 bits (713),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 197/302 (65%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDD-EDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYYIVA+ +   +     L    ILHY
Sbjct  261  EGSYTVQQNYTNMDIHVGQSYSYLVTMDQNAINDYYIVASARFSNSTTRDRLTGVAILHY  320

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+GPD  D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  321  SNS-QGPASGPLPDGPDEGDTYFSMNQARSIRWNVSAGAARPNPQGSFRYGEITVTDVYV  379

Query  358  LHGSKGEI-RGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L     EI  G  R  +N +SY  P TPLKLA  F +  GVY+LD FP   +   A    
Sbjct  380  LLNRPAEIINGQMRNTLNGISYIAPFTPLKLAQQF-DVPGVYKLD-FPNRMMNRPAKVDT  437

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT+KG++EI+FQN+   + S+H+DG+   VVG   G WT  +R TYN +D V RST
Sbjct  438  SIINGTYKGFMEIIFQNNDTTIQSYHMDGYAFFVVGMDFGIWTENSRGTYNKWDGVARST  497

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            +QVYPG WTA+ V+LDN G+WNLR++++  W+ GQ++YI V + + +   E P P N + 
Sbjct  498  IQVYPGAWTAILVYLDNVGIWNLRAENLDTWFRGQEVYISVVNPEDSNKTELPVPDNAIF  557

Query  895  CG  900
            CG
Sbjct  558  CG  559



>ref|XP_002960418.1| hypothetical protein SELMODRAFT_229918 [Selaginella moellendorffii]
 gb|EFJ37957.1| hypothetical protein SELMODRAFT_229918 [Selaginella moellendorffii]
Length=537

 Score =   276 bits (706),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 192/300 (64%), Gaps = 6/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT Q   DSLDVHVGQSYSV+++ DQ   D++IVA+ +         L     LHY+
Sbjct  238  EGSYTVQNFYDSLDVHVGQSYSVIITTDQAPGDFHIVASSRFG----VPVLTGLATLHYS  293

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +   G LP GPDP D+ FS NQA SIRWNLTAGAARPNPQG+F+   I +S+T  L
Sbjct  294  NS-PSTLGGTLPPGPDPGDVGFSFNQAWSIRWNLTAGAARPNPQGSFHYGVINVSRTIKL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              +   I G  R+ VN++SY  PDTPLKLADY+    GV+ L+  P          G S+
Sbjct  353  FNTAPMINGKQRFAVNDISYFNPDTPLKLADYY-KIPGVFSLNSIPDSPYFSTPFLGTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  +  ++EI+FQN+  V+ SWH+DG+   VVG+G G W   +R TYN+YD V RST Q
Sbjct  412  LNVDYHSFIEIIFQNNEEVIQSWHIDGYQFFVVGFGPGAWNDTSRLTYNLYDAVARSTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+++ LDN GMW +RSQ+    YLGQ LY+RV++ +   + E   PSN+L CG
Sbjct  472  VYPMSWTAIFMSLDNVGMWEIRSQNPARQYLGQDLYMRVYNPEEARSTETAIPSNVLRCG  531



>ref|XP_010908415.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X2 [Elaeis 
guineensis]
Length=565

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 196/302 (65%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +    +  + +    ILHY
Sbjct  260  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASSDYYMVASARFVSPDMRNRVTGVAILHY  319

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+GPD  D  FS+NQA+SIRWN++AGAARPNPQG+F   +IT++  +V
Sbjct  320  SDS-QGSASGPLPDGPDEADTYFSMNQARSIRWNVSAGAARPNPQGSFRYGDITVTDVYV  378

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L     E + G  R  +N +SY  P TPLKLA  F N  G+Y+LD FP   +   A +  
Sbjct  379  LLNRPAELVNGQLRTTLNAISYVAPSTPLKLAQQF-NVPGIYKLD-FPNRMMNRPAKFDT  436

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT+KG+ EI+FQN+ + + S+H+DG+   VVG   G WT  +R TYN +D V R T
Sbjct  437  SIINGTYKGFTEIIFQNNDSTVQSYHMDGYAFFVVGMDYGTWTENSRGTYNKWDGVARCT  496

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V+LDN G+WNLR Q++  WYLGQ++Y+ V + +     E   P N + 
Sbjct  497  TQVFPGAWTAILVYLDNVGIWNLRVQNLDRWYLGQEVYVSVVNPEVTNKTEFSLPDNAIF  556

Query  895  CG  900
            CG
Sbjct  557  CG  558



>ref|XP_006338228.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=538

 Score =   275 bits (704),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 191/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS SVLV+ DQ  +DYYIVA+ +    N T    A  +LHY 
Sbjct  239  EGSHVLQNFYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFSRINFT----ATSVLHYT  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P  P    + +S+ QA++ RWNLT+ AARPNPQG+F+   IT+S+TFV+
Sbjct  295  NS-QTPVSGPMPPAPAG-QMHWSMLQARTFRWNLTSNAARPNPQGSFHYGKITISRTFVM  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLAD+F N  GV+ L+    +    +   G ++
Sbjct  353  ANSAPLINGKLRYAVNSVSYVNPDTPLKLADHF-NIPGVFNLNSIQAYPSGGSPYLGTAV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
               +H  ++EIVFQN  A M SWHLDG+   VVG+G  +WT A+R  YN+ D + R T Q
Sbjct  412  FPTSHHDFIEIVFQNDEATMQSWHLDGYDFWVVGFGSDKWTQASRNKYNLVDALTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS      YLGQQ+Y+RV+D  P+ A E   P+N LLCG
Sbjct  472  VYPKSWTAILVSLDNQGMWNLRSAMWDRQYLGQQVYLRVYDPTPSLANEYDIPTNALLCG  531



>ref|XP_009382348.1| PREDICTED: monocopper oxidase-like protein SKU5 [Musa acuminata 
subsp. malaccensis]
Length=597

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/303 (49%), Positives = 200/303 (66%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LDVHVGQSYS LV+ DQ+   DYYIVA+ +    +  S +    ILHY
Sbjct  259  EGSYTVQQNYTNLDVHVGQSYSFLVTMDQNASSDYYIVASARFVNESRWSRVTGVAILHY  318

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+ P+ F D  FS+NQA+SIRWNL+AGAARPNPQG+F   +I +SQ +
Sbjct  319  SDS-KGKASGPLPDPPNDFYDKTFSMNQARSIRWNLSAGAARPNPQGSFRYGSINVSQVY  377

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +SY  P+TPL+LAD +    GVY LD FP+  +K A   G
Sbjct  378  VLKNKPPVVINGKRRATLNGISYSPPETPLRLADEY-KLKGVYTLD-FPSRPLKGAPKTG  435

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++EI+FQN+   + ++H+DG+   VVG   GEWT  +R TYN  D V R 
Sbjct  436  RSLINGTYRGFMEIIFQNNDTKVQTYHMDGYAFFVVGMDYGEWTEESRGTYNKGDGVARC  495

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            + QV+PG WTA+ V LDN G+WN+R+Q++  WYLGQ++Y+RV + +     E P P N L
Sbjct  496  STQVFPGAWTAILVSLDNVGIWNVRAQNLDSWYLGQEVYVRVINPENTNKTELPIPDNAL  555

Query  892  LCG  900
             CG
Sbjct  556  YCG  558



>ref|XP_010908414.1| PREDICTED: monocopper oxidase-like protein SKU5 isoform X1 [Elaeis 
guineensis]
Length=600

 Score =   276 bits (706),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 196/302 (65%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +    +  + +    ILHY
Sbjct  260  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASSDYYMVASARFVSPDMRNRVTGVAILHY  319

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+GPD  D  FS+NQA+SIRWN++AGAARPNPQG+F   +IT++  +V
Sbjct  320  SDS-QGSASGPLPDGPDEADTYFSMNQARSIRWNVSAGAARPNPQGSFRYGDITVTDVYV  378

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L     E + G  R  +N +SY  P TPLKLA  F N  G+Y+LD FP   +   A +  
Sbjct  379  LLNRPAELVNGQLRTTLNAISYVAPSTPLKLAQQF-NVPGIYKLD-FPNRMMNRPAKFDT  436

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT+KG+ EI+FQN+ + + S+H+DG+   VVG   G WT  +R TYN +D V R T
Sbjct  437  SIINGTYKGFTEIIFQNNDSTVQSYHMDGYAFFVVGMDYGTWTENSRGTYNKWDGVARCT  496

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V+LDN G+WNLR Q++  WYLGQ++Y+ V + +     E   P N + 
Sbjct  497  TQVFPGAWTAILVYLDNVGIWNLRVQNLDRWYLGQEVYVSVVNPEVTNKTEFSLPDNAIF  556

Query  895  CG  900
            CG
Sbjct  557  CG  558



>ref|XP_009777142.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS SVLV+ DQ  +DYYIVA+ +       + L A  +LHY+
Sbjct  239  EGSHVIQSLYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFTR----TVLTATAVLHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GP+P  P    + +S+ QA++ RWNLTA AARPNPQGTF+   IT+S++FVL
Sbjct  295  NSQTSV-SGPMPSAPAG-QMHWSMLQARTFRWNLTANAARPNPQGTFHYGKITISRSFVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY  PDTPLKLAD+F N  GV+ L+   T     +     ++
Sbjct  353  ANSAPLINGKLRYAVNRVSYVNPDTPLKLADHF-NIPGVFSLNSIQTFPSDGSPYLATAV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
               +H  ++EIVFQN+ A M SWHLDG+   VVG+G G WT A+R  YN+ D   R T Q
Sbjct  412  FPASHHDFIEIVFQNNEATMQSWHLDGYDFWVVGFGSGTWTQASRNKYNLVDAPTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS      YLGQQ+Y+RV++   + A E   P+N LLCG
Sbjct  472  VYPKSWTAILVSLDNQGMWNLRSAMWDRQYLGQQVYLRVYNPTQSLANEYYIPTNALLCG  531



>ref|XP_006661934.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Oryza brachyantha]
Length=594

 Score =   276 bits (705),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 204/306 (67%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LDVHVGQSYS L++ADQ+   DYY+VA+ ++   +    +    +L Y
Sbjct  250  EGSYTTQQNYTNLDVHVGQSYSFLLAADQNASSDYYVVASARMVNDSLWRRVTGVAVLRY  309

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   + +GPLP+ P D +D  FS+NQA+S+RWNL+AGAARPNPQG+F  ++I ++Q +
Sbjct  310  SNS-GGRASGPLPDPPQDQYDKSFSMNQARSVRWNLSAGAARPNPQGSFRYSSINVTQAY  368

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L G+   EI G  R  +N +S+  P+TPL+LAD +    GVY LD FP   ++ A   G
Sbjct  369  LLRGTAPVEIAGRRRATLNGLSFTPPETPLRLADAY-GVRGVYSLD-FPERPIRGAPRMG  426

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++FQN+   M S+H+DG+   VVG   GEWT  +R TYN  D V RS
Sbjct  427  RSIINGTYRGFMELIFQNNDTRMQSYHMDGYAFFVVGMDYGEWTEDSRGTYNKGDGVARS  486

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            TVQVYPG W AV V LDN G+WN+RS+++  WYLGQ++Y+R V+ +D     E   P N 
Sbjct  487  TVQVYPGAWAAVLVSLDNVGVWNVRSENLDSWYLGQEVYVRVVNPEDTGNKTEMAIPDNA  546

Query  889  LLCGMF  906
            L CG  
Sbjct  547  LYCGQL  552



>ref|XP_010255119.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nelumbo nucifera]
Length=540

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T QI  DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +      ++ L    +LHY 
Sbjct  241  EGSHTIQIIYDSLDVHVGQSVAVLVTLNQSPKDYYIVASTRF----TSTVLTTTAVLHYT  296

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G LP GP  + + +S+ QA++ RWNLTA AARPNPQG+F+   I  S+T VL
Sbjct  297  NS-HTPVSGQLPSGPS-YQIDWSMQQARTFRWNLTASAARPNPQGSFHYGQIKPSRTIVL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  +I G  RY VN VSY   DTPLKLADYF N  GV+ L+   T      A    ++
Sbjct  355  ANSAPQINGKQRYAVNRVSYINSDTPLKLADYF-NIPGVFSLNSIQTAPSGGPALLATAV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++E+VFQN+   + SWHLDG+   VVGYG G+WTPA+R  YN+ D + R T Q
Sbjct  414  MPASLHEFIEVVFQNNENTIQSWHLDGYDFWVVGYGHGQWTPASRNGYNLIDTLTRHTAQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT ++V LDN GMWNLRS   +  YLGQQ Y+RV + D  PA E   P N LLCG
Sbjct  474  VYPNSWTTIWVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNQDKTPANEYDIPPNALLCG  533



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   274 bits (700),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 193/301 (64%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+VA+ +      TSP L   G +HY
Sbjct  242  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPGQDYYLVASSRF-----TSPILTTTGTVHY  296

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            A S A K +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I L++T+V
Sbjct  297  ANS-AGKVSGPPPGGPT-IQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYV  354

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S
Sbjct  355  LQNSAGQVNGKQRYGVNSVSFVPADTPLKLADYFKIG-GVFRVGSISDRPTGGGLYLDTS  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R  YN+ D V R T 
Sbjct  414  VLGADYRAFVEIVFQNNEDIIQSWHLDGYSFFVVGMDGGQWTTASRSAYNLRDAVSRCTT  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWNLR++     YLGQQLY+RV+    +   E P P N LLC
Sbjct  474  QVYPKSWTAIYIPLDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNALLC  533

Query  898  G  900
            G
Sbjct  534  G  534



>ref|XP_011033926.1| PREDICTED: monocopper oxidase-like protein SKU5 [Populus euphratica]
Length=592

 Score =   275 bits (702),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 196/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +   GILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESQWKRVTGVGILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPE P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  TNS-KGKAKGPLPEAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ +S+  P TP++LAD F    GVY+LD FP   +  ++   
Sbjct  372  VLKNKPLVKINGKRRATLSGISFVNPATPIRLADQF-KVKGVYKLD-FPNKPLTGSSKME  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+HL G+ + VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHLSGYAVFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ Y+R+ + +     E P P N L
Sbjct  490  TVQVYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYVRIVNPEETNKTELPIPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|XP_009594576.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   273 bits (698),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 188/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS SVLV+ DQ  +DYYIVA+ +       + L A  +LHY+
Sbjct  239  EGSHVIQSLYDSLDVHVGQSMSVLVTLDQPPKDYYIVASTRFTR----TVLTATAVLHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GP+P  P    + +S+ QA++ RWNLT  AARPNPQGTF+   IT+S+TFVL
Sbjct  295  NS-KASVSGPMPSAPAG-QMHWSMLQARTFRWNLTENAARPNPQGTFHYGKITISRTFVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY  PDTPLKLAD+F N  GV+ L+   T     +     ++
Sbjct  353  ANSAPLINGKLRYAVNRVSYVNPDTPLKLADHF-NIPGVFSLNSIQTFPSDGSPYLATAV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
               +H  ++EIVFQN+ A M SWHLDG+   VVG+G   WT A+R  YN+ D   R T Q
Sbjct  412  FPASHHDFIEIVFQNNEATMQSWHLDGYDFWVVGFGSRTWTQASRNKYNLVDAPTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS      YLGQQ+Y+RV++   + A E   P+N LLCG
Sbjct  472  VYPKSWTAILVSLDNQGMWNLRSAMWDRQYLGQQVYLRVYNPTQSLANEYDIPTNALLCG  531



>gb|EPS63456.1| hypothetical protein M569_11328, partial [Genlisea aurea]
Length=326

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS   Q   DS+DVHVGQ+ SVLV+ADQ   DYY+ A+ +       S L    +LHY+
Sbjct  32   EGSNVIQNLYDSIDVHVGQTMSVLVTADQAPRDYYVAASTRF----APSLLTVAAVLHYS  87

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G +P GP   D+  S++QA+S+RWNLT+ AARPNPQG+F+   IT S+T +L
Sbjct  88   TSTT-PVSGAVPAGPAD-DISGSVDQARSLRWNLTSNAARPNPQGSFHYGQITPSRTVIL  145

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN +SY  PDTPLKLADYF + AGV+ +D   +    +AA  G S+
Sbjct  146  ANSAPIINGKQRYAVNGISYVNPDTPLKLADYF-SIAGVFSVDSIQSSPTGNAAALGTSV  204

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++EIVFQN    + SWHLDG+   VVG+G G+W+P +R TYN+ D + R T Q
Sbjct  205  LGTSLHEFVEIVFQNDEDSIQSWHLDGYDFWVVGFGGGQWSPLSRLTYNLDDALTRHTTQ  264

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT + V LDN GMWN+RS      YLGQQ Y+RV++   + A E   PSN LLCG
Sbjct  265  VYPNSWTTILVSLDNQGMWNVRSASWGRQYLGQQFYLRVYNPTQSLANEYNIPSNALLCG  324



>ref|XP_008787012.1| PREDICTED: monocopper oxidase-like protein SKU5 [Phoenix dactylifera]
Length=597

 Score =   274 bits (701),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 198/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +    ILHY
Sbjct  256  EGSYTVQQNYTNLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESRWVRVTGVAILHY  315

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+ P D +D  +S+NQA+SIRWNL++GAAR NPQG+F   +I ++Q +
Sbjct  316  SNS-KGKASGPLPDPPQDFYDKTYSMNQARSIRWNLSSGAARTNPQGSFRYASINVTQLY  374

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL  +    I G  R  +N +SY  P TPL+LAD + N  GVY LD FPT  +K A+  G
Sbjct  375  VLKNTPPVVINGKSRSTINGISYSPPATPLRLADLY-NIEGVYTLD-FPTRPLKGASKIG  432

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT +G++EIVFQN+   + S+H+DG+   VVG   GEWT  +R TYN  D V R 
Sbjct  433  RSVINGTFRGFMEIVFQNNDTKVQSYHMDGYSFFVVGMDYGEWTEDSRGTYNKGDGVARC  492

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN G WN+R+Q++  WYLGQ++Y+RV + +     E P P N L
Sbjct  493  TTQVFPGAWTAILVSLDNVGFWNVRAQNLDSWYLGQEVYVRVVNPEMTNKTELPVPDNAL  552

Query  892  LCG  900
             CG
Sbjct  553  YCG  555



>ref|XP_010093686.1| Monocopper oxidase-like protein SKU5 [Morus notabilis]
 gb|EXB54466.1| Monocopper oxidase-like protein SKU5 [Morus notabilis]
Length=591

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 194/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS L++ DQ+   DYYIVA+ +    +    +    ILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLLTTDQNASSDYYIVASARFVNESRWKRVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K  GPLPEGP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  SNS-KGKVHGPLPEGPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTNIY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      EI G  R  +N +S+  P TP++LAD+F    G Y+LD FP   +  A    
Sbjct  371  VLKNKPPVEINGKRRATLNGISFVNPSTPIRLADWFKVKGG-YKLD-FPNRPLTGAPKLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++EI+ QN+   M ++HLDG+   VVG   GEWT  +R TYN +D + R+
Sbjct  429  TSVINGTYRGFMEIILQNNETKMQTYHLDGYAFFVVGMDYGEWTENSRGTYNKWDGIART  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            + QVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ YI+V + +     E P P N L
Sbjct  489  SAQVYPGAWTAILVSLDNVGIWNLRTENLDSWYLGQETYIKVVNPEATNKTELPIPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  FCG  551



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYI  + +      T  L    ILHY+
Sbjct  242  EGTHTLQTTHSSLDVHVGQSYSVLVTADQTAQDYYIAVSTRF----TTKILTTTAILHYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A K +GP+P GP   ++ +S+NQA+SIR NLTA   RPNPQG+++   I L++T  L
Sbjct  298  NS-AKKVSGPIPGGPTT-EIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINLTRTIKL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN+VS+   DTPLK+ADYF  G GV+ +   P +          S+
Sbjct  356  ESSAAQVNGKQRYAVNSVSFVPADTPLKIADYFKIG-GVFRVGSMPDYPTGKKMYLDTSV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWH++G+   VVG   G WTPA+R  YN+ D V R T Q
Sbjct  415  MGADFRAFVEIVFQNHENIVQSWHINGYSFWVVGMDGGVWTPASRNQYNLRDAVSRCTTQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+R++     YLGQQ Y+RV+    +P  E P P N LLCG
Sbjct  475  VYPKSWTAIYIALDNVGMWNIRTEFWARQYLGQQFYMRVYSPVESPRDEYPIPKNALLCG  534



>ref|XP_007201183.1| hypothetical protein PRUPE_ppa003275mg [Prunus persica]
 gb|EMJ02382.1| hypothetical protein PRUPE_ppa003275mg [Prunus persica]
Length=588

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 201/304 (66%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   DYYIVA+P+   ++  +      ILHY
Sbjct  250  EGSYTVQQNYANMDIHVGQSFSFLVTMDQNASSDYYIVASPRFVNSSSWARATGVAILHY  309

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  310  SNS-QGPASGPLPDPPNDYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGEITVTDVYV  368

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPLKLA  F N +GVY+LD FPT  +   A    
Sbjct  369  ILNRPPELINGKWRTTLNGISYLPPSTPLKLAQQF-NISGVYKLD-FPTKLMNRPAKVDT  426

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + ++HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  427  SLINGTFKGFMEIIFQNNDTTVQNYHLDGYAFFVVGMDIGVWTENSRSTYNKWDGVARCT  486

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  WYLGQ++Y+ V + + + + E P P N++ 
Sbjct  487  TQVFPGAWTAILVPLDNSGIWNLRAQNLDSWYLGQEVYVSVVNTEIDQS-EAPLPDNIIY  545

Query  895  CGMF  906
            CG+ 
Sbjct  546  CGLL  549



>gb|EMS64364.1| Monocopper oxidase-like protein SKU5 [Triticum urartu]
Length=404

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 196/307 (64%), Gaps = 10/307 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +     +   L    ILHY
Sbjct  98   EGSYTSQQNYSNMDIHVGQSYSFLVTMDQNASTDYYVVASARF--VADPDKLTGVAILHY  155

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP  PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  156  SNS-QGPASGPLPAAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  214

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GV++LD FP H +       
Sbjct  215  LLQSRPPELIDGQLRSTINGISYIAPSTPLILAQLF-NVPGVFKLD-FPNHPMNRLPKVD  272

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  273  TSVINGTYKGFMEIIFQNNATTVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVARS  332

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRV--HDDDPNPAKEKPPPSN  885
            T+QV+PG WTAV VFLDN G+WNLR +++  WY+GQ+LYI V   ++D +     P P N
Sbjct  333  TIQVFPGAWTAVLVFLDNAGIWNLRVENLDSWYMGQELYISVVNPEEDHSDKTPLPLPDN  392

Query  886  LLLCGMF  906
             + CG  
Sbjct  393  TIFCGAL  399



>ref|XP_010459724.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Camelina sativa]
Length=548

 Score =   272 bits (696),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 191/300 (64%), Gaps = 8/300 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG +T Q    SLDVHVGQSYSV+V+A+Q  +DYYIV + +         L+  G+LHY+
Sbjct  250  EGRHTIQTQFSSLDVHVGQSYSVIVTANQPAKDYYIVVSSRF----TPQTLITGGVLHYS  305

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GPLP+ PDP  + +S+NQA+SIR NLTAG  RPNPQG+++   I +++T  L
Sbjct  306  NSAGAV-SGPLPDVPDP--MSWSLNQARSIRTNLTAGGPRPNPQGSYHYGMINVTRTIRL  362

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G+I+G PRY VN  S+   DTPLKLADYF    GVY+      H    A     S+
Sbjct  363  VTSAGQIQGKPRYAVNRASFYPSDTPLKLADYF-KIDGVYKPGSISDHPTSGALFPMTSV  421

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   H+ ++EIVFQN   ++ SWH DG+   VVG   G+W+ A+R+ YN+ D V R TVQ
Sbjct  422  LQADHRAFVEIVFQNWDNIVQSWHFDGYSFFVVGMEFGKWSTASRKIYNLNDAVSRCTVQ  481

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLRS+  +  YLGQQLY+RV+    +   E   P N LLCG
Sbjct  482  VYPRSWTAIYVALDNVGMWNLRSELWERQYLGQQLYMRVYTTSTSLRDEYQIPKNALLCG  541



>ref|XP_004292333.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Fragaria 
vesca subsp. vesca]
Length=588

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 198/304 (65%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   DYY+VA+P+   ++  +      ILHY
Sbjct  250  EGSYTVQQNYANMDIHVGQSFSFLVTMDQNASSDYYVVASPRFVNSSSWAKATGVAILHY  309

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ FD  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  310  SNS-QGPASGPLPDPPNDFDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGEITVTDLYV  368

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY TP TPLKLA  F N +GVY+LD FP   +   A    
Sbjct  369  ILNRPAELINGKWRTTLNGISYLTPSTPLKLAQQF-NISGVYKLD-FPNKLMNRPAKLDT  426

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + ++HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  427  SLINGTFKGFMEIIFQNNDTTVQNYHLDGYAFFVVGMDIGVWTENSRGTYNKWDGVARCT  486

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LD+ G+WNLR+Q++  WYLGQ+LY+ V + + N   E   P N + 
Sbjct  487  TQVFPGAWTAILVSLDSAGIWNLRAQNLDSWYLGQELYVSVVNPE-NDGSEAALPDNAIY  545

Query  895  CGMF  906
            CG+ 
Sbjct  546  CGVL  549



>gb|AGE09595.1| SKU5-like protein, partial [Eucalyptus cladocalyx]
Length=517

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 191/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DS+DVHVGQS +VLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  221  EGSHTVQNMYDSIDVHVGQSLAVLVTLNQPPKDYYIVASTRFTK----TVLNATAVLHYT  276

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+    +GPLP GP  +   +S+ QA++IRWNLTA AARPNPQG+F+   I +S+T VL
Sbjct  277  NSLTPV-SGPLPAGPT-YQKHWSMKQARTIRWNLTASAARPNPQGSFHYGKIAISRTIVL  334

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLADYF N AGV+  +   +     +A    S+
Sbjct  335  ANSAPLINGKRRYAVNGVSYINADTPLKLADYF-NIAGVFSTNSLQSVPSGGSASLATSV  393

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++EIVFQN    + SWHLDG+   VVGYG G+WTPA+R+ YN+ D   R T Q
Sbjct  394  MPASLHEFIEIVFQNSENTVQSWHLDGYDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQ  453

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT++ V LDN GMWNLRS   +  YLGQQ Y+RV   D + A E   PSN LLCG
Sbjct  454  VYPRAWTSILVSLDNQGMWNLRSAAWERQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  513



>ref|XP_010459725.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Camelina sativa]
Length=537

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 191/300 (64%), Gaps = 8/300 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG +T Q    SLDVHVGQSYSV+V+A+Q  +DYYIV + +         L+  G+LHY+
Sbjct  239  EGRHTIQTQFSSLDVHVGQSYSVIVTANQPAKDYYIVVSSRF----TPQTLITGGVLHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GPLP+ PDP  + +S+NQA+SIR NLTAG  RPNPQG+++   I +++T  L
Sbjct  295  NSAGAV-SGPLPDVPDP--MSWSLNQARSIRTNLTAGGPRPNPQGSYHYGMINVTRTIRL  351

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G+I+G PRY VN  S+   DTPLKLADYF    GVY+      H    A     S+
Sbjct  352  VTSAGQIQGKPRYAVNRASFYPSDTPLKLADYF-KIDGVYKPGSISDHPTSGALFPMTSV  410

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   H+ ++EIVFQN   ++ SWH DG+   VVG   G+W+ A+R+ YN+ D V R TVQ
Sbjct  411  LQADHRAFVEIVFQNWDNIVQSWHFDGYSFFVVGMEFGKWSTASRKIYNLNDAVSRCTVQ  470

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLRS+  +  YLGQQLY+RV+    +   E   P N LLCG
Sbjct  471  VYPRSWTAIYVALDNVGMWNLRSELWERQYLGQQLYMRVYTTSTSLRDEYQIPKNALLCG  530



>ref|XP_011080540.1| PREDICTED: monocopper oxidase-like protein SKU5 [Sesamum indicum]
Length=595

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 198/304 (65%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYYIVA+P+   A+  +      ILHY
Sbjct  255  EGSYTVQQNYSNMDIHVGQSYSFLVTMDQNASSDYYIVASPRFVNASAWTKAPGVAILHY  314

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F   +IT++  +V
Sbjct  315  SNS-QGPASGPLPDPPNEYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGDITVTDVYV  373

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TP+KLA  F N +GV++LD FP   +   A    
Sbjct  374  IINRPAELIDGKRRTTLNGISYIVPSTPVKLAQQF-NVSGVFKLD-FPNRFMNRPAKVDT  431

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  432  SLINGTFKGFMEIIFQNNDTSVQSYHLDGYAFFVVGMDYGVWTENSRSTYNKWDGVARCT  491

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN GMWNLR+Q++  WYLGQ++Y+ V + + N   E   P N + 
Sbjct  492  TQVFPGAWTAILVSLDNAGMWNLRTQNLDSWYLGQEVYVSVVNPE-NDNNEVQLPENAIY  550

Query  895  CGMF  906
            CG+ 
Sbjct  551  CGVL  554



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   271 bits (694),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYI  + +         L    ILHY+
Sbjct  242  EGTHTVQTTYSSLDVHVGQSYSVLVTADQAAQDYYIAVSTRF----TNKVLTTTAILHYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A K +GP+P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I +S+T  L
Sbjct  298  NS-AKKVSGPIPGGPTT-QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN+VS+R  DTPLKLADYF  G GV+ +                S+
Sbjct  356  ESSAAQVNGKQRYAVNSVSFRPADTPLKLADYFKIG-GVFRVGSISDSPTGKKMYLDTSV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWHLDG+   VVG   G WTPA+R+ YN+ D V R T Q
Sbjct  415  MGADFRAFVEIVFQNHENIVQSWHLDGYSFWVVGMDGGVWTPASRDQYNLRDAVSRCTTQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLR++     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  475  VYPKSWTAIYVALDNVGMWNLRTEFWARQYLGQQFYLRVYSPVMSIRDEYPIPKNALLCG  534



>ref|XP_010070498.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW59310.1| hypothetical protein EUGRSUZ_H01991 [Eucalyptus grandis]
Length=538

 Score =   271 bits (693),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 194/300 (65%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS +VLV+ +Q  +DYY+VA+ +  +    + L A  ILHY+
Sbjct  239  EGSHTVQNIYDSLDVHVGQSVTVLVTLNQPPKDYYVVASTRFTK----TVLTATAILHYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S ++  +GPLP GP   ++ +S+ QA++ RWNLTA AARPNPQG+F+   IT S+T VL
Sbjct  295  NSHSSV-SGPLPAGPT-IEVDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPSRTIVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN  S+   DTPLKLADYF N  GV+  D   T     +     S+
Sbjct  353  ANSAPLINGKQRYAVNGASFINADTPLKLADYF-NIPGVFRTDSLQTSPSGGSPSIATSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++EIVFQN+   + SWHLDG+   VVGYG+G+WTPA+R +YN+ D + R T Q
Sbjct  412  IPASLHDFIEIVFQNNENTVQSWHLDGYDFWVVGYGNGQWTPASRSSYNLVDTLTRHTAQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT++Y+ LDN GMWN+RS   +  YLGQQ Y+RV +   + A E   PSN LLCG
Sbjct  472  VYPNSWTSIYMSLDNQGMWNVRSAIWERQYLGQQFYLRVWNPVQSLANEYNIPSNALLCG  531



>ref|XP_002303520.1| monocopper oxidase precursor family protein [Populus trichocarpa]
 gb|EEE78499.1| monocopper oxidase precursor family protein [Populus trichocarpa]
Length=592

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +   GILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESQWKRVTGVGILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLP+ P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  TNS-KGKAKGPLPDAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD F    GVY+LD FP   +  ++   
Sbjct  372  VLKNKPLVTINGKRRATLSGISFVNPATPIRLADQF-KVKGVYKLD-FPNKPLTGSSKME  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+HL G+ + VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHLSGYAVFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ Y+R+ + +     E P P N L
Sbjct  490  TVQVYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYVRIVNPEETNKTELPIPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|XP_011085509.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085510.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
 ref|XP_011085511.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   271 bits (693),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS +VLV+ DQ  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  238  EGSHVLQNMYDSLDVHVGQSVTVLVTLDQSPKDYYIVASTRFTK----TVLTAIAVLHYT  293

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S AA  +GP+P GP   D+ +S++QA+S RWNLT+ AARPNPQG+F+   IT S+T VL
Sbjct  294  NSRAAI-SGPVPSGPTD-DIAWSMDQARSYRWNLTSNAARPNPQGSFHYGKITTSRTIVL  351

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY +N  S+   DTPLKLADYF N  GV+ ++   T     +     S+
Sbjct  352  ANSAPIINGKQRYAINGNSFINSDTPLKLADYF-NIPGVFSINSIQTAPSDSSNKLATSV  410

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++E+VFQN+   + SWHLDG+   VVG+G G+WT A+R+ YN+ D + R T Q
Sbjct  411  MGASLHEFIEVVFQNNEDTIQSWHLDGYDFWVVGFGTGQWTQASRKAYNLVDALTRHTTQ  470

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWNLRS      YLGQQ Y+RV++  P+ A E   P+N LLCG
Sbjct  471  VYPKSWTAILVSLDNQGMWNLRSAMWGRQYLGQQFYLRVYNPTPSLANEYDIPNNALLCG  530



>ref|XP_004984344.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Setaria 
italica]
Length=586

 Score =   272 bits (696),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 197/303 (65%), Gaps = 9/303 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    +LD+HVGQSYS LV+ DQ+   DYY+VA+ +  +A     L    +LHY
Sbjct  248  EGSYTSQQNYTNLDIHVGQSYSFLVTMDQNASTDYYVVASARFVDAAIIDKLTGVAVLHY  307

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ P D +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  308  SNS-QGPASGPLPDPPNDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  366

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GVY+LD FP H +       
Sbjct  367  LLQSRPPELIDGKLRSTLNEISYIAPSTPLVLAQLF-NVPGVYKLD-FPNHPMNRLPKVD  424

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  425  TSIINGTYKGFMEIIFQNNATTVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  484

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QV+PG WTA+ VFLDN G+WNLR Q++  WYLGQ++YI V + + N +     P N +
Sbjct  485  TIQVFPGAWTAILVFLDNAGIWNLRVQNLDTWYLGQEVYINVVNPEDNSSTL---PDNAI  541

Query  892  LCG  900
             CG
Sbjct  542  FCG  544



>gb|EEC67281.1| hypothetical protein OsI_34261 [Oryza sativa Indica Group]
Length=609

 Score =   273 bits (697),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 200/306 (65%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LDVHVGQSYS LV+ DQ+   DYY+VA+ ++        +    +L Y
Sbjct  264  EGSYTTQQNYTNLDVHVGQSYSFLVTTDQNASSDYYVVASARMVNDTVWRRVAGVAVLRY  323

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   + +GPLP+ P D FD  FS+NQA+S+RWNL+AGAARPNPQG+F  ++I ++Q +
Sbjct  324  SNS-RGRASGPLPDPPQDQFDKSFSMNQARSVRWNLSAGAARPNPQGSFRYSSINVTQAY  382

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L  +    I G  R  +N +S+  P+TPL+LAD +    GVY LD FP   ++ A   G
Sbjct  383  LLRSTAPVTINGRRRATLNGLSFTPPETPLRLADAY-GVRGVYSLD-FPERPLRGAPRMG  440

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++FQN+   M S+H+DG+   VVG   GEWT  +R TYN  D V RS
Sbjct  441  RSIINGTYRGFMELIFQNNDTRMQSYHMDGYAFFVVGMDYGEWTEDSRGTYNKGDGVARS  500

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            TVQVYPG W AV V LDN G+WN+RS+++  WYLGQ++Y+R V+ +D     E   P N 
Sbjct  501  TVQVYPGAWAAVLVSLDNVGVWNVRSENLDSWYLGQEVYVRVVNPEDTGNKTEMAIPDNA  560

Query  889  LLCGMF  906
            L CG  
Sbjct  561  LFCGQL  566



>ref|XP_006440373.1| hypothetical protein CICLE_v10019410mg [Citrus clementina]
 ref|XP_006477247.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Citrus 
sinensis]
 gb|ESR53613.1| hypothetical protein CICLE_v10019410mg [Citrus clementina]
 gb|KDO48373.1| hypothetical protein CISIN_1g007735mg [Citrus sinensis]
Length=591

 Score =   272 bits (695),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 194/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +    ILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESQWKRVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPEGP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  312  TNS-KGKARGPLPEGPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTEVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL     E I G  R  ++ +S+  P TP++LAD+F    G Y+LD FPT  V       
Sbjct  371  VLRNKPPEMIDGKRRATLSGISFVNPSTPIRLADWF-KVKGAYKLD-FPTKPVTGPPRME  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M ++H+ G+   VVG   GEWT  +R TYN +D + R+
Sbjct  429  TSVINGTYRGFMEVILQNNDTKMHAYHMSGYAFFVVGMDYGEWTDNSRGTYNKWDGIART  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  489  TTQVYPGAWTAILVSLDNVGIWNLRTENLDSWYLGQETYVRVVNPEATNKTEFPIPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  FCG  551



>gb|KDP25629.1| hypothetical protein JCGZ_20785 [Jatropha curcas]
Length=593

 Score =   272 bits (695),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 193/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +    ILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESQWKRVTGVAILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLP+ P D FD  FS+NQA+SIRWN++A  ARPNPQG+F    I +++ +
Sbjct  313  TNS-KGKAKGPLPDAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGTINVTEIY  371

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD F    GVY+LD FPT  ++      
Sbjct  372  VLKNKPPVTINGKKRTTLSGISFVNPSTPIRLADQF-KVKGVYKLD-FPTKPLEGPPKME  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  490  TVQVYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYVRVVNPEKTNKTELPIPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|XP_006643620.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Oryza brachyantha]
Length=595

 Score =   272 bits (695),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/306 (47%), Positives = 197/306 (64%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +  +A     L    ILHY
Sbjct  258  EGSYTSQQNYTNMDIHVGQSYSFLVTMDQNATTDYYVVASARFVDAAAADKLTGVAILHY  317

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  318  SNS-QGPASGPLPDAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  376

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GVY+LD FP   +       
Sbjct  377  LLQSRPPELIDGQMRATLNGISYIAPSTPLMLAQLF-NIPGVYKLD-FPNRPINRPPKLD  434

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  435  TSIINGTYKGFMEIIFQNNATAVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  494

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            T+QV+PG WT+V VFLDN G+WNLR +++  WYLGQ++YI  V+ +D +     P P N 
Sbjct  495  TIQVFPGAWTSVLVFLDNAGIWNLRVENLDAWYLGQEVYISVVNPEDSSNKTVLPLPDNA  554

Query  889  LLCGMF  906
            + CG  
Sbjct  555  IFCGAL  560



>ref|XP_006847483.1| hypothetical protein AMTR_s00163p00059030 [Amborella trichopoda]
 gb|ERN09064.1| hypothetical protein AMTR_s00163p00059030 [Amborella trichopoda]
Length=592

 Score =   272 bits (695),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 197/306 (64%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHE-ANETSPLVAKGILH  174
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYYIVA+P+L   A   + L+   ILH
Sbjct  252  EGSYTIQQNYTNMDIHVGQSYSFLVTMDQNASSDYYIVASPRLFNPAASWTGLIGVAILH  311

Query  175  YAGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQT  351
            Y+ S     +GPLP+ P D +D  FS+NQA+SI+WN++AGAARPNPQG+F    I ++  
Sbjct  312  YSNS-QGPASGPLPDPPNDEYDKYFSMNQARSIKWNVSAGAARPNPQGSFKYGQIPVTDV  370

Query  352  FVLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADY  528
            +VL     E I G PR  +N +SY  P TPL+LA  F N  GV++LD FP   +      
Sbjct  371  YVLLNRAPEMINGKPRTALNGLSYIAPTTPLRLAQQF-NVPGVFKLD-FPNQMMDRPPKL  428

Query  529  GVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
              SI++ T++G+ EI+FQN+   + S+HLDG+   VVG   GEWT  +R TYN +D V R
Sbjct  429  DTSIINATYRGFFEIIFQNNDTSVQSYHLDGYAFFVVGMDYGEWTENSRGTYNKWDGVAR  488

Query  709  STVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNL  888
             T QV+PG WTA+ V LDN GMWNLR+Q++  WYLGQ+ Y+ + + + N   E P P N 
Sbjct  489  CTTQVFPGAWTAILVSLDNDGMWNLRTQNLDSWYLGQETYMSIVNPEINGKTEMPLPDNA  548

Query  889  LLCGMF  906
            L CG+ 
Sbjct  549  LYCGVL  554



>ref|XP_010028301.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 ref|XP_010028302.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55013.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
 gb|KCW55014.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=538

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DS+DVHVGQS +VLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  239  EGSHTVQNMYDSIDVHVGQSMAVLVTLNQPPKDYYIVASTRFTK----TVLNATAVLHYT  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+    +GPLP GP  +   +S+ QA++IRWNLTA AARPNPQG+++   I +S+T VL
Sbjct  295  NSLTPV-SGPLPAGPT-YQKHWSMKQARTIRWNLTASAARPNPQGSYHYGKIAISRTIVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLADYF N AGV+  +   +     +A    S+
Sbjct  353  ANSAPLINGKQRYAVNGVSYINSDTPLKLADYF-NIAGVFSTNSLQSVPSGGSASLATSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++EIVFQN+   + SWHLDG+   VVGYG G+WTPA+R+ YN+ D   R T Q
Sbjct  412  MPASLHEFIEIVFQNNENAVQSWHLDGYDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT++ V LDN GMWNLRS   +  YLGQQ Y+RV   D + A E   PSN LLCG
Sbjct  472  VYPRAWTSILVSLDNQGMWNLRSAAWERQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  531



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 147/301 (49%), Positives = 192/301 (64%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+VA+ +      TSP L   G +HY
Sbjct  242  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPGQDYYLVASSRF-----TSPILTTTGTVHY  296

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            A S A K +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I L++T+V
Sbjct  297  ANS-AGKVSGPPPGGPT-IQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYV  354

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S
Sbjct  355  LQNSAGQVNGKQRYGVNSVSFVPADTPLKLADYFKIG-GVFRVGSISDRPTGGGLYLDTS  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R  YN+ D V R T 
Sbjct  414  VLGADYRAFVEIVFQNNEDIIQSWHLDGYSFFVVGMDGGQWTTASRNAYNLRDAVSRCTT  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWNLR++     YLGQQLY+RV+    +   E P P N  LC
Sbjct  474  QVYPKSWTAIYIPLDNVGMWNLRTEFWARQYLGQQLYLRVYTPSTSIRDEYPIPRNARLC  533

Query  898  G  900
            G
Sbjct  534  G  534



>ref|XP_010919477.1| PREDICTED: monocopper oxidase-like protein SKU5 [Elaeis guineensis]
Length=597

 Score =   272 bits (695),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 198/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LD+HVGQSYS LV+ DQ+   DYYIVA+ +    +  + +    ILHY
Sbjct  256  EGSYTVQQNYTNLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESRWTRVTGVAILHY  315

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+ P D +D  +S+NQA+SIRWN++AGAARPNPQG+F   +I ++Q +
Sbjct  316  SNS-KGKASGPLPDPPQDFYDKTYSMNQARSIRWNVSAGAARPNPQGSFRYASINVTQVY  374

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            ++  +    I    R  +N +SY  P TPL+LAD + N  GVY LD FPT  +K A   G
Sbjct  375  LMKNTPPVVINRKRRSTINGISYSPPATPLRLADLY-NLKGVYTLD-FPTRPLKGAPKLG  432

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT +G++EI+FQN+   + ++H+DG+   VVG   GEWT  +R TYN  D V R 
Sbjct  433  KSVINGTFRGFMEIIFQNNDTKVQTYHMDGYSFFVVGMDYGEWTEDSRGTYNKGDGVARC  492

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN G WN+R+Q++  WYLGQ++YIRV + +     E P P N L
Sbjct  493  TTQVFPGAWTAILVSLDNVGFWNVRAQNLDSWYLGQEVYIRVVNPEMTNKTELPVPDNAL  552

Query  892  LCG  900
             CG
Sbjct  553  YCG  555



>emb|CBI18560.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T DSLDVHVGQS +VLV+ DQ  +DYYIVA+ +  +      L A  +LHY 
Sbjct  236  EGSHTLQNTYDSLDVHVGQSIAVLVTLDQLPKDYYIVASTRFTK----QILTATAVLHYT  291

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P GP  + + +S+ QA++ RWNLTA AARPNPQG+F+   IT S+T +L
Sbjct  292  NS-HTPVSGPVPAGPT-YQIHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIML  349

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   + G  RY VN VSY   DTPLKLADYF N  GV+ ++         ++    S+
Sbjct  350  VNSAPRLNGKQRYAVNGVSYINADTPLKLADYF-NIPGVFSVNSIQDLPSGGSSFLSTSV  408

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  H  ++E+VFQN+   + SWHLDG+   VVGYG G+WTPA R++YN+ D + R T Q
Sbjct  409  MAANHHDFIEVVFQNNENTIQSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQ  468

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT ++V LDN GMWN+RS   +  YLGQQ Y+RV +   +PA E   P N LLCG
Sbjct  469  VYPRSWTTIWVSLDNQGMWNMRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  528



>ref|XP_009358973.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=589

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 200/304 (66%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   DYYIVA+P+   ++  +  +   ILHY
Sbjct  250  EGSYTVQQNYANMDIHVGQSFSFLVTMDQNATSDYYIVASPRFVNSSSWAKAIGVAILHY  309

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  +S+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  310  SNS-QGPASGPLPDPPNDYDTYYSMNQARSIRWNVSAGAARPNPQGSFKYGEITVTDVYV  368

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPLKLA  F N +GVY+LD FP   +   A    
Sbjct  369  ILNRPAELINGKWRTTLNGISYIPPSTPLKLAQQF-NISGVYKLD-FPNKLMNRPAKVDT  426

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++E++FQN+   + ++HLDG+   +VG   G WT  +R TYN +D V RST
Sbjct  427  SLINGTFKGFMEVIFQNNDTTVQNYHLDGYAFFIVGMDVGVWTENSRSTYNKWDGVARST  486

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  WYLGQ++Y+ V + + +   EK  P N + 
Sbjct  487  TQVFPGSWTAILVVLDNAGIWNLRAQNLDSWYLGQEVYVSVVNPEFD-GDEKSLPDNTIY  545

Query  895  CGMF  906
            CG+ 
Sbjct  546  CGLL  549



>ref|XP_006840959.1| hypothetical protein AMTR_s00085p00024720 [Amborella trichopoda]
 gb|ERN02634.1| hypothetical protein AMTR_s00085p00024720 [Amborella trichopoda]
Length=594

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 198/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYTNQ+   ++D+HVGQSYS LV+ DQ+   DYYIVA+ +       + +    ILHY
Sbjct  252  EGSYTNQVNFTTMDIHVGQSYSFLVTMDQNASSDYYIVASARFVNETTWARVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ P+ F D  +S+NQA+++RWN++AGAARPNPQG+F   +I ++Q +
Sbjct  312  SNS-KGPASGPLPDPPNDFYDKTWSMNQARNVRWNVSAGAARPNPQGSFRYGSINVTQLY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +S+  P TPLKLAD + N +GVY++D FPT         G
Sbjct  371  VLKNKPPVMIGGKRRTTLNEISFSYPPTPLKLADRY-NISGVYKMD-FPTRPTNGPPRIG  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++G +KG++EI+ QN+   + ++H+DG+   VVG   GEWT  +R  YN +D V R 
Sbjct  429  TSIINGDYKGFMEIILQNNDTSVQNYHMDGYAFFVVGMDYGEWTENSRGLYNKWDGVARC  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN GMWNLR++++  WYLGQ++YIRV + + N   E P P N L
Sbjct  489  TTQVFPGAWTAILVSLDNVGMWNLRAENLDTWYLGQEVYIRVFNPEINNKTELPVPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  YCG  551



>emb|CDP03969.1| unnamed protein product [Coffea canephora]
Length=600

 Score =   271 bits (694),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/302 (47%), Positives = 199/302 (66%), Gaps = 6/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYYIVA+P+   ++  +  +   ILHY
Sbjct  261  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASSDYYIVASPRFVNSSAWTKAIGVSILHY  320

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S+    +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  321  SNSLGPA-SGPLPDPPNEYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGQITVTDVYV  379

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPLKLA  F N  GV++LD FP   +   A    
Sbjct  380  ILNRPPELIDGKWRTTLNGISYLAPSTPLKLAQQF-NIPGVFKLD-FPNRLMNRPAKVDT  437

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+HLDG+   VVG  +G WT  +R TYN +D V R T
Sbjct  438  SVINGTFKGFMEIIFQNNDTTVQSYHLDGYAFFVVGMDNGVWTENSRSTYNKWDGVARCT  497

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  W+LGQ++Y+ V + + +   E P P N + 
Sbjct  498  TQVFPGAWTAILVSLDNAGIWNLRAQNLDSWHLGQEVYLSVVNLEMD-KNELPLPDNTIY  556

Query  895  CG  900
            CG
Sbjct  557  CG  558



>ref|XP_002270831.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
Length=536

 Score =   270 bits (690),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T DSLDVHVGQS +VLV+ DQ  +DYYIVA+ +  +      L A  +LHY 
Sbjct  237  EGSHTLQNTYDSLDVHVGQSIAVLVTLDQLPKDYYIVASTRFTK----QILTATAVLHYT  292

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P GP  + + +S+ QA++ RWNLTA AARPNPQG+F+   IT S+T +L
Sbjct  293  NS-HTPVSGPVPAGPT-YQIHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIML  350

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   + G  RY VN VSY   DTPLKLADYF N  GV+ ++         ++    S+
Sbjct  351  VNSAPRLNGKQRYAVNGVSYINADTPLKLADYF-NIPGVFSVNSIQDLPSGGSSFLSTSV  409

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  H  ++E+VFQN+   + SWHLDG+   VVGYG G+WTPA R++YN+ D + R T Q
Sbjct  410  MAANHHDFIEVVFQNNENTIQSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQ  469

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT ++V LDN GMWN+RS   +  YLGQQ Y+RV +   +PA E   P N LLCG
Sbjct  470  VYPRSWTTIWVSLDNQGMWNMRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  529



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   270 bits (689),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 189/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYIV + +      TSP L   G+L Y
Sbjct  239  EGTHTLQTTFSSLDVHVGQSYSVLVTADQPAQDYYIVVSSRF-----TSPVLTTTGVLRY  293

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S A   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   I  ++T  
Sbjct  294  SNS-AGPVSGPIPGGPT-IQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIR  351

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G++ G  RY VN+VS+   DTPLKLADYF    GV+ +     H          S
Sbjct  352  LASSAGQVNGKQRYAVNSVSFTPADTPLKLADYF-KIDGVFRVGSISDHPTGGGIYLDTS  410

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++EIVF+N   ++ SWHLDG+   VVG   G+WTPA+R  YN+ D V R TV
Sbjct  411  VMQADYRAFVEIVFENPEDIVQSWHLDGYSFFVVGMDGGQWTPASRNEYNLRDAVARCTV  470

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLC
Sbjct  471  QVYPNSWTAIYVALDNVGMWNVRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLC  530

Query  898  G  900
            G
Sbjct  531  G  531



>emb|CAN72538.1| hypothetical protein VITISV_028749 [Vitis vinifera]
Length=592

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T DSLDVHVGQS +VLV+ DQ  +DYYIVA+ +  +      L A  +LHY 
Sbjct  293  EGSHTLQNTYDSLDVHVGQSIAVLVTLDQLPKDYYIVASTRFTK----QILTATAVLHYT  348

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P GP  + + +S+ QA++ RWNLTA AARPNPQG+F+   IT S+T +L
Sbjct  349  NS-HTPVSGPVPAGPT-YQIHWSMKQARTYRWNLTASAARPNPQGSFHYGKITPSRTIML  406

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   + G  RY VN VSY   DTPLKLADYF N  GV+ ++         ++    S+
Sbjct  407  XNSAPRLNGKQRYAVNGVSYINXDTPLKLADYF-NIPGVFSVNSIQDLPSGGSSFLSTSV  465

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  H  ++E+VFQN+   + SWHLDG+   VVGYG G+WTPA R++YN+ D + R T Q
Sbjct  466  MAANHHDFIEVVFQNNENTIQSWHLDGYDFWVVGYGFGQWTPARRKSYNLIDALTRHTAQ  525

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT ++V LDN GMWN+RS   +  YLGQQ Y+RV +   +PA E   P N LLCG
Sbjct  526  VYPRSWTTIWVSLDNQGMWNMRSAVWERQYLGQQFYLRVFNPVHSPANEYDIPKNALLCG  585



>gb|KCW55012.1| hypothetical protein EUGRSUZ_I00988 [Eucalyptus grandis]
Length=591

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/300 (49%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DS+DVHVGQS +VLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  292  EGSHTVQNMYDSIDVHVGQSMAVLVTLNQPPKDYYIVASTRFTK----TVLNATAVLHYT  347

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+    +GPLP GP  +   +S+ QA++IRWNLTA AARPNPQG+++   I +S+T VL
Sbjct  348  NSLTPV-SGPLPAGPT-YQKHWSMKQARTIRWNLTASAARPNPQGSYHYGKIAISRTIVL  405

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLADYF N AGV+  +   +     +A    S+
Sbjct  406  ANSAPLINGKQRYAVNGVSYINSDTPLKLADYF-NIAGVFSTNSLQSVPSGGSASLATSV  464

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   ++EIVFQN+   + SWHLDG+   VVGYG G+WTPA+R+ YN+ D   R T Q
Sbjct  465  MPASLHEFIEIVFQNNENAVQSWHLDGYDFWVVGYGFGQWTPASRKIYNLVDAPTRHTAQ  524

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT++ V LDN GMWNLRS   +  YLGQQ Y+RV   D + A E   PSN LLCG
Sbjct  525  VYPRAWTSILVSLDNQGMWNLRSAAWERQYLGQQFYLRVWTPDHSLANEYGIPSNALLCG  584



>ref|XP_008235896.1| PREDICTED: monocopper oxidase-like protein SKU5 [Prunus mume]
Length=588

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 200/304 (66%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   DYYIVA+P+   ++  +      +LHY
Sbjct  250  EGSYTVQQNYANMDIHVGQSFSFLVTMDQNASSDYYIVASPRFVNSSLWARATGVAVLHY  309

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  310  SNS-QGPASGPLPDPPNDYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGEITVTDVYV  368

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPL LA  F N +GVY+LD FPT  +   A    
Sbjct  369  ILNRPPELINGKWRTTLNGISYLPPSTPLNLAQKF-NISGVYKLD-FPTKLMNRPAKVDT  426

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN    + ++HLDG+   VVG   G WT  +R TYN +D V RST
Sbjct  427  SLINGTFKGFMEIIFQNDDTTVQNYHLDGYAFFVVGMDIGVWTENSRSTYNKWDGVARST  486

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  WYLGQ++Y+ V + + + + E P P N++ 
Sbjct  487  TQVFPGAWTAILVPLDNSGIWNLRAQNLDSWYLGQEVYVSVVNTEIDQS-EAPLPDNIIY  545

Query  895  CGMF  906
            CG+ 
Sbjct  546  CGLL  549



>ref|XP_002527262.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF35106.1| multicopper oxidase, putative [Ricinus communis]
Length=596

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/304 (47%), Positives = 202/304 (66%), Gaps = 7/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q   +++D+HVGQSYS LV+ DQ+   DYYIVA+P+ + ++  +      ILHY
Sbjct  253  EGSYTVQQNYENMDIHVGQSYSFLVTMDQNASSDYYIVASPR-YTSSAWNKAAGVAILHY  311

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  312  SNS-QGPASGPLPDPPNEYDTFFSMNQARSIRWNVSAGAARPNPQGSFKYGEITVTDVYV  370

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L   + E I G  R  +N +SY  P TPLKLA  + N +GVY+LD FP   +        
Sbjct  371  LLNRRAELIDGKWRTALNGISYLAPSTPLKLAQQY-NISGVYKLD-FPNRIMNRPPKVDA  428

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+H+DG+   VVG   G WT  +R TYN +D V RST
Sbjct  429  SLINGTFKGFMEIIFQNNDTTVQSYHVDGYAFFVVGMDFGVWTENSRGTYNKWDGVARST  488

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            +QV+PG WTA+ V LDN GMWN+R+Q++  WYLGQ++Y+ V + + + A E   P N + 
Sbjct  489  IQVFPGAWTAILVSLDNAGMWNIRAQNLNSWYLGQEVYVSVVNPEID-ASEIALPDNAIF  547

Query  895  CGMF  906
            CG+ 
Sbjct  548  CGLL  551



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 190/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYI  + +      +  L +  +LHYA
Sbjct  243  EGTHTVQTTYTSLDVHVGQSYSVLVTADQTPQDYYIAVSTRF----TSKVLTSTAVLHYA  298

Query  181  GSVAAKP-AGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S  A+P +GP+P GP   ++ +SINQA+SIR NLTA   RPNPQG+++   I +++T  
Sbjct  299  NS--ARPVSGPVPGGPTS-EIDWSINQARSIRTNLTASGPRPNPQGSYHYGLINITRTIK  355

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G I G  RY VN+VSY   DTPLKLADYF N +GV+ +       +        S
Sbjct  356  LVSSAGLINGKQRYAVNSVSYVPADTPLKLADYF-NISGVFRVGSISDSPIARKMHLDTS  414

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++E+VF+N  +++ SWHL+G+   VVG   G WTP  R  YN+ D + R T 
Sbjct  415  VMGADYRAFIEVVFENRESIVQSWHLNGYAFWVVGMDGGLWTPERRNEYNLRDAISRCTT  474

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWN+R++H    YLGQQ Y+RVH    +   E P P N LLC
Sbjct  475  QVYPKSWTAIYIALDNVGMWNMRTEHWARQYLGQQFYLRVHTPSTSIRDEYPIPKNALLC  534

Query  898  G  900
            G
Sbjct  535  G  535



>ref|XP_007047154.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
 gb|EOX91311.1| SKU5 similar 17 isoform 3 [Theobroma cacao]
Length=406

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  107  EGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTK----TVLTATAVLHYT  162

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP  P  +   +S+ QA++ RWNLT+ AARPNPQG+F+   IT ++T VL
Sbjct  163  NS-QTPVSGPLPAAP-AYQYHWSMQQARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVL  220

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VS+  PDTPLKLADYF N  GV+ +          AA    S+
Sbjct  221  ANSGSLINGKLRYTVNGVSFVNPDTPLKLADYF-NIPGVFSMSSIQDLPSGGAATVATSV  279

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V  +   ++E+VFQN+   M SWHLDG+   VVG+G G+W P  R TYN+ D + R T Q
Sbjct  280  VPTSLHDFIEVVFQNNENTMQSWHLDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQ  339

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y+RV     + A E   PSN+LLCG
Sbjct  340  VYPNSWTAILVSLDNQGMWNMRSAMWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCG  399



>ref|XP_003537368.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Glycine max]
 ref|XP_006590664.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Glycine max]
Length=537

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 192/301 (64%), Gaps = 7/301 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +  E    +PL    +LHYA
Sbjct  236  EGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTE----TPLTTTAVLHYA  291

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S ++   GP+P  P D +D  +S+ QA++ RWNLTA AARPNPQG+F+   IT ++   
Sbjct  292  NSFSSA-LGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIK  350

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY  PDTPLKLADYF N  G++ ++             G S
Sbjct  351  LANSAPLINGKLRYAVNSVSYVNPDTPLKLADYF-NIPGIFSVNLLQNSPSNGPGYIGTS  409

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   ++E++FQN+   M SWHLDG+   V+G+G G+WT A+R+TYN+ D + R T 
Sbjct  410  VLQTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTT  469

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQ Y+RV D   + A E   P+N+LLC
Sbjct  470  QVYPKSWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWDAQKSLANEYDIPNNVLLC  529

Query  898  G  900
            G
Sbjct  530  G  530



>gb|KHN42054.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   269 bits (688),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 192/301 (64%), Gaps = 7/301 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +  E    +PL    +LHYA
Sbjct  236  EGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTE----TPLTTTAVLHYA  291

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S ++   GP+P  P D +D  +S+ QA++ RWNLTA AARPNPQG+F+   IT ++   
Sbjct  292  NSFSSA-LGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIK  350

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY  PDTPLKLADYF N  G++ ++             G S
Sbjct  351  LANSAPLINGKLRYAVNSVSYVNPDTPLKLADYF-NIPGIFSVNLLQNSPSNGPGYIGTS  409

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   ++E++FQN+   M SWHLDG+   V+G+G G+WT A+R+TYN+ D + R T 
Sbjct  410  VLQTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTT  469

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQ Y+RV D   + A E   P+N+LLC
Sbjct  470  QVYPKSWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWDAQKSLANEYDIPNNVLLC  529

Query  898  G  900
            G
Sbjct  530  G  530



>ref|XP_008809034.1| PREDICTED: monocopper oxidase-like protein SKU5 [Phoenix dactylifera]
Length=594

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 200/305 (66%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EG+YT Q    +LD+HVGQSYS LV+ DQ+   DYYIVA+P+    +  + +    ILHY
Sbjct  252  EGTYTMQQNYTNLDIHVGQSYSFLVTMDQNASSDYYIVASPRFVNESLWTRVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+GP+ F D  +S+NQA+SIR N+T+GAARPNPQG+F   +I ++Q +
Sbjct  312  SNS-KGKASGPLPDGPNDFYDKTWSMNQAQSIRTNVTSGAARPNPQGSFRYGSINVTQVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +SY  P TPL+LAD + +  G+Y LD FPT  +      G
Sbjct  371  VLKNKPPVVINGKRRATLNGISYSPPATPLRLADDY-DKKGIYTLD-FPTRPLDGPPRIG  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++EI+FQN+  ++ ++H+DG+   V G   GEWT  +R  YN +D V R 
Sbjct  429  ASVINGTYRGFMEIIFQNNDTIVQTYHMDGYAFFVAGMAYGEWTEDSRSQYNKWDGVSRC  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTAV V LDN G WN+R++++  WYLGQ++YI+V + + N   E P P N L
Sbjct  489  TTQVFPGAWTAVLVSLDNVGFWNVRAENLDTWYLGQEVYIKVVNPESNDKTESPKPDNAL  548

Query  892  LCGMF  906
             CG+ 
Sbjct  549  YCGVL  553



>ref|XP_004515738.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cicer arietinum]
Length=591

 Score =   270 bits (691),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 199/303 (66%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++   +    +   GILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARMVNESRWKRVTGVGILHY  311

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLP GPD  FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  312  TNS-KGKARGPLPPGPDDQFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTEIY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ +SY+ P TP++LAD F    GVY+LD FP++ +       
Sbjct  371  VLKNKAPVKIDGKRRATLSGISYKNPATPIRLADQF-KLKGVYKLD-FPSNPLTGPPRVE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++G+++G++EI+ QN+   M ++HL+G+   VVG   G+W+  +R TYN +D + R+
Sbjct  429  ASVINGSYRGFMEIILQNNDTKMHTYHLNGYAFFVVGMDFGDWSENSRGTYNKWDGIART  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QVYPG WTA+ V LDN G+WNLR++++  WYLGQ+ YIRV + +P+   E P P N L
Sbjct  489  TAQVYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYIRVVNPEPSNKTEFPIPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  FCG  551



>ref|XP_010539786.1| PREDICTED: monocopper oxidase-like protein SKU5 [Tarenaya hassleriana]
Length=587

 Score =   270 bits (690),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 196/303 (65%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQ++S LV+ DQ+   DYYIVA+ +    +    +   GIL Y
Sbjct  248  EGSYTVQQNYTSLDIHVGQTFSFLVTMDQNTSTDYYIVASARFVNESRWRRVTGVGILQY  307

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLP+ P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  308  TNS-KGKARGPLPDAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTEVY  366

Query  355  VLHGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ VS+  P TP++LAD F    G+Y+LD FPT  +       
Sbjct  367  VLRNVPPVKINGKRRTTLSGVSFVNPSTPIRLADQF-KLKGIYKLD-FPTRPLTGPPKME  424

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+H++G+   VVG   GEWT  +R TYN +D + RS
Sbjct  425  TSVINGTYRGFMEVILQNNETRMQSYHMNGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  484

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG WTA+ + LDN G+WN+R++++  WYLGQ+ YIRV + + N   E P P N+L
Sbjct  485  TIQVYPGAWTAILISLDNVGVWNIRTENLDSWYLGQETYIRVVNPENNNKTEFPMPDNVL  544

Query  892  LCG  900
             CG
Sbjct  545  YCG  547



>ref|XP_009339705.1| PREDICTED: monocopper oxidase-like protein SKU5 [Pyrus x bretschneideri]
Length=591

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 193/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +   GILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESNWKRVTGVGILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K AGPLP GP D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  TNS-KGKAAGPLPAGPQDEFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S++ P TP++LAD+F      Y+LD FP   +  A    
Sbjct  371  VLKNKPPVMINGKRRTTLSGISFKNPSTPIRLADWF-KVKNAYKLD-FPARPLTGAPKLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++ T +G++EI+ QN+   M S+H+DG+   VVG   GEWT  +R TYN +D + RS
Sbjct  429  TSVINATFRGFIEIILQNNDTKMQSYHVDGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG W+A+ + LDN G+WN+R++++  WYLGQ+ Y+RV + + N   E P P N L
Sbjct  489  TVQVYPGAWSAILISLDNVGIWNIRAENLDSWYLGQETYMRVVNPEANNKTELPIPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  YCG  551



>ref|XP_007049589.1| SKU5 similar 3 [Theobroma cacao]
 gb|EOX93746.1| SKU5 similar 3 [Theobroma cacao]
Length=594

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 199/304 (65%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYYIVA+P+   +++ + +    ILHY
Sbjct  255  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASNDYYIVASPRFVNSSDWAKVTGVAILHY  314

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    I ++  +V
Sbjct  315  SNS-QGPASGPLPDPPNDYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGQIIVTDVYV  373

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TP+KLA  F N  GVY+LD FP   +        
Sbjct  374  ILNKPAELIDGKWRTTLNGISYLAPSTPIKLAQQF-NIPGVYKLD-FPNRLMNRPPKTDT  431

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RST
Sbjct  432  SLINGTFKGFMEIIFQNNDTTVQSYHLDGYAFFVVGMDFGVWTENSRGTYNKWDGVARST  491

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ + LDN G+WNLR+Q++  WYLGQ++Y+ V + + + + E P P N + 
Sbjct  492  TQVFPGAWTAILISLDNAGIWNLRAQNLDSWYLGQEVYVSVLNPEVDQS-EVPLPENAIY  550

Query  895  CGMF  906
            CG+ 
Sbjct  551  CGIL  554



>ref|XP_010255117.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
 ref|XP_010255118.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nelumbo nucifera]
Length=545

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 190/305 (62%), Gaps = 12/305 (4%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T QI  DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +      ++ L    +LHY 
Sbjct  241  EGSHTIQIIYDSLDVHVGQSVAVLVTLNQSPKDYYIVASTRF----TSTVLTTTAVLHYT  296

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G LP GP  + + +S+ QA++ RWNLTA AARPNPQG+F+   I  S+T VL
Sbjct  297  NS-HTPVSGQLPSGPS-YQIDWSMQQARTFRWNLTASAARPNPQGSFHYGQIKPSRTIVL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  +I G  RY VN VSY   DTPLKLADYF N  GV+ L+   T      A    ++
Sbjct  355  ANSAPQINGKQRYAVNRVSYINSDTPLKLADYF-NIPGVFSLNSIQTAPSGGPALLATAV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGD-----GEWTPAARETYNVYDPVV  705
            +  +   ++E+VFQN+   + SWHLDG+   VVGYG+     G+WTPA+R  YN+ D + 
Sbjct  414  MPASLHEFIEVVFQNNENTIQSWHLDGYDFWVVGYGECRYGHGQWTPASRNGYNLIDTLT  473

Query  706  RSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSN  885
            R T QVYP  WT ++V LDN GMWNLRS   +  YLGQQ Y+RV + D  PA E   P N
Sbjct  474  RHTAQVYPNSWTTIWVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNQDKTPANEYDIPPN  533

Query  886  LLLCG  900
             LLCG
Sbjct  534  ALLCG  538



>ref|XP_004147587.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cucumis 
sativus]
 ref|XP_004172694.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Cucumis 
sativus]
 gb|KGN50219.1| hypothetical protein Csa_5G160220 [Cucumis sativus]
Length=592

 Score =   270 bits (690),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 194/305 (64%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +    ILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESLWKRVTGVAILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K AGPLPE P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  SNS-KGKAAGPLPEAPKDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD F    GVY+LD FPT  +       
Sbjct  372  VLKNKPPVSINGKMRTTLSGISFVNPSTPIRLADQF-KLKGVYKLD-FPTRPLTGPPKAE  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+H++G+   VVG   GEW+  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHMNGYAFFVVGMDYGEWSENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG WTA+ V LDN G+WN+R++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  490  TIQVYPGAWTAILVSLDNVGIWNIRTENLDSWYLGQETYVRVVNPEATNKTELPMPDNAL  549

Query  892  LCGMF  906
             CG  
Sbjct  550  FCGQL  554



>ref|XP_002269725.2| PREDICTED: monocopper oxidase-like protein SKU5 [Vitis vinifera]
 emb|CBI35585.3| unnamed protein product [Vitis vinifera]
Length=595

 Score =   270 bits (690),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 195/304 (64%), Gaps = 5/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+P+   ++  +      ILHY
Sbjct  254  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASSDYYMVASPRFVNSSAWAKATGVAILHY  313

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+  D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  314  SNS-QGPASGPLPDPPNDLDTFFSMNQARSIRWNVSAGAARPNPQGSFRYGQITVTDVYV  372

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L     E I G  R  +N +SY  P TPLKLA  F N  G+Y++D FP   +        
Sbjct  373  LLNRPAELIDGKYRTTLNGISYLAPSTPLKLAQQF-NIPGIYKID-FPNRLMNRPPKVDT  430

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            SI++GT++G++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R T
Sbjct  431  SIINGTYRGFMEIIFQNNDTTVQSYHLDGYAFFVVGMDYGVWTENSRGTYNKWDGVARCT  490

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR++++  WYLGQ++Y+ V + +     E P P N + 
Sbjct  491  TQVFPGAWTAILVSLDNVGIWNLRTENLNTWYLGQEVYVNVVNPEITDKTELPLPDNAIY  550

Query  895  CGMF  906
            CG+ 
Sbjct  551  CGVL  554



>gb|KDO58565.1| hypothetical protein CISIN_1g007633mg [Citrus sinensis]
Length=595

 Score =   270 bits (689),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 200/305 (66%), Gaps = 8/305 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   DYYIVA+P+   ++E + +    ILHY
Sbjct  256  EGSYTVQQNYTNMDIHVGQSFSFLVTTDQNASSDYYIVASPRFVNSSEWNKVTGVAILHY  315

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S+    +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  316  SNSLGPA-SGPLPDPPNAYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGQITVTDVYV  374

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPL LA  F N  G Y+LD FP   +  A     
Sbjct  375  ILNRPAELIEGKWRTTLNGISYLPPSTPLMLAQQF-NIPGAYKLD-FPYKLMSRAPKVDT  432

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT+KG++EI+FQN+   + S+H+DG+   VVG   G WT  +R TYN +D V RST
Sbjct  433  SLINGTYKGFMEIIFQNNDTTVQSYHMDGYAFFVVGMDFGVWTENSRGTYNKWDGVARST  492

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKP-PPSNLL  891
             QV+PG WTA+ V+LDN G+WNLR++++  WYLGQ++Y+ V   +P   K  P  P N +
Sbjct  493  TQVFPGAWTAILVYLDNAGIWNLRAENLDTWYLGQEVYVNVI--NPEIDKSAPLLPDNAI  550

Query  892  LCGMF  906
             CG+ 
Sbjct  551  YCGLL  555



>ref|XP_003517277.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=540

 Score =   268 bits (685),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 192/301 (64%), Gaps = 7/301 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +  E    +PL    +LHYA
Sbjct  239  EGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDYYIVASTRFTE----TPLTTTAVLHYA  294

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S ++   GP+P  P D +D  +S+ QA++ RWNLTA AARPNPQG+F+   IT ++   
Sbjct  295  NSFSSA-LGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIK  353

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY  PDTPLKLADYF N  GV+ ++             G S
Sbjct  354  LANSAPLINGKLRYAVNSVSYVNPDTPLKLADYF-NIPGVFSVNLLQNSPSNGPGYIGTS  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   ++E++FQN+   M SWHLDG+   V+G+G G+WT A+R+TYN+ D + R T 
Sbjct  413  VLQTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTA  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQ Y+RV +   + A E   P+N+LLC
Sbjct  473  QVYPKSWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQKSLANEYDIPNNVLLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   268 bits (685),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 188/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q +  SLDVHVGQSYSVLV+ADQ  +DYYI  + +  E      L +  +LHY+
Sbjct  240  EGTHTLQTSYSSLDVHVGQSYSVLVTADQAAKDYYIAVSSRFTE----KVLTSSAVLHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV+   +GPLP GP    + +S+NQA+SIR NLTA   RPNPQG+++   I +++T  L
Sbjct  296  NSVSPV-SGPLPGGPTT-QIDYSLNQARSIRTNLTASGPRPNPQGSYHYGLINITRTIKL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              + G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +   P            S+
Sbjct  354  GNTAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIG-GVFRIGSIPDQPSGKKMYLDTSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVF+N  +++ SWHLDG+   VVG   G WTPA+R  YN+ D V R T Q
Sbjct  413  MGADFRAFVEIVFENRESIIQSWHLDGYSFWVVGMNGGVWTPASRNQYNLRDAVSRCTTQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTAVY+ LDN GMWNLR++     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  473  VYPKSWTAVYIALDNVGMWNLRTEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNALLCG  532



>ref|XP_003568965.2| PREDICTED: monocopper oxidase-like protein SKU5 [Brachypodium 
distachyon]
Length=1027

 Score =   277 bits (709),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/304 (48%), Positives = 199/304 (65%), Gaps = 7/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +  +A+    L    +L Y
Sbjct  257  EGSYTSQQNYSNMDIHVGQSYSFLVTMDQNASTDYYVVASARFVDASTVDKLTGVAVLRY  316

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  317  SNS-QGPASGPLPDAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  375

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY TP TPL LA  F N  GVY+LD FP H +       
Sbjct  376  LLQSRPPELIDGKLRSTINGISYITPSTPLILAQLF-NVPGVYKLD-FPNHPMNRLPKVD  433

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  434  TSIINGTYKGFMEIIFQNNATTVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  493

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            T+QV+PG WTAV VFLDN G+WNLR +++  WYLGQ++YI  V+ +D +     P P N 
Sbjct  494  TIQVFPGAWTAVLVFLDNAGVWNLRVENLDSWYLGQEVYISVVNPEDSSDKTVLPLPDNT  553

Query  889  LLCG  900
            + CG
Sbjct  554  IFCG  557



>ref|XP_002874771.1| hypothetical protein ARALYDRAFT_911635 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51030.1| hypothetical protein ARALYDRAFT_911635 [Arabidopsis lyrata subsp. 
lyrata]
Length=587

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 141/303 (47%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARVVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +S++ P TP++LAD F     VY+LD FP   +   A   
Sbjct  368  VLRNMPPVTINGKRRTTLNGISFKNPSTPIRLADKF-KVKDVYKLD-FPKRPLTGPAKVE  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + +DNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISMDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   268 bits (685),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+V + +      +  L   G+L Y+
Sbjct  239  EGTHTLQTTFSSLDVHVGQSYSVLVTADQPAQDYYVVVSSRF----TSDVLTTTGVLRYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            GS A   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   I  ++T  L
Sbjct  295  GS-AGGVSGPIPGGPT-IQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLADYF    GVY +    +           S+
Sbjct  353  ASSAGQVNGKQRYAVNSVSFNPADTPLKLADYF-KIDGVYRVGSIQSQPTGGGIYLDTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVF+N   ++ SWHLDG+   VVG   G+WTP +R  YN+ D V R TVQ
Sbjct  412  MQTDYRTFIEIVFENSEDIVQSWHLDGYSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLRS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  472  VYPSSWTAIYIALDNVGMWNLRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>gb|KHN46930.1| L-ascorbate oxidase like [Glycine soja]
Length=307

 Score =   261 bits (666),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 137/300 (46%), Positives = 182/300 (61%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL++ DQ  +DYYIV + +         L +  ILHY+
Sbjct  7    EGTHTIQTTYSSLDVHVGQSYSVLITVDQAPKDYYIVVSTRF----TNKILTSTAILHYS  62

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S      GP+P GP    + +SI QA+SIR NLTA   RPNPQG+++   I +S+T  L
Sbjct  63   NS-QQSVFGPIPSGPTT-QIDWSIKQARSIRTNLTASGPRPNPQGSYHYGLINISRTITL  120

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++    RY VN+VS+   DTPLKLADYF N  G++++   P            S+
Sbjct  121  VSSTAQVNKKQRYAVNSVSFTPADTPLKLADYF-NIGGIFQVGSIPDSPSGRPMYLDTSV  179

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++E+VFQNH  ++ SWH+DG+   VVG   G WTP +R  YN+ D V RST Q
Sbjct  180  MGADFRAFVEVVFQNHENIIQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQ  239

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  240  VYPKSWTAIYMALDNVGMWNMRSEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNALLCG  299



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   268 bits (685),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 192/302 (64%), Gaps = 10/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLV--AKGILH  174
            EG++T Q T  SLDVHVGQSYSVL +ADQ  +DYYIV   +      T+P+V    GILH
Sbjct  245  EGTHTLQTTFSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRF-----TAPVVLNTTGILH  299

Query  175  YAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            Y+ S A   +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I  ++T 
Sbjct  300  YSNS-AGPVSGPFPGGPTT-QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTRTI  357

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            ++  S G++ G  RY VN+VS+  PDTP+KLADYF    GV++ +               
Sbjct  358  IVANSAGQVNGKQRYGVNSVSFVAPDTPMKLADYF-KIQGVFKENSISDRPYGGGLYLDT  416

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++  ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R  YN+ D V R T
Sbjct  417  SVLTLPYRAFVEIVFQNNENIVQSWHLDGYSFFVVGMDGGQWTTASRNQYNLRDGVSRCT  476

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            +QVYP  WTA+Y+ LDN GMWNLR++     YLGQQ Y+RV+ D  +   E P P N LL
Sbjct  477  IQVYPKAWTAIYIPLDNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEYPIPKNALL  536

Query  895  CG  900
            CG
Sbjct  537  CG  538



>gb|EYU30502.1| hypothetical protein MIMGU_mgv1a003271mg [Erythranthe guttata]
Length=595

 Score =   269 bits (688),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 194/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS L++ DQ+   DYYIVA+ +         +    +LHY
Sbjct  256  EGSYTVQQNYTSLDIHVGQSYSFLLTTDQNASSDYYIVASARFVNETTWQRVTGVAVLHY  315

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K +GPLP+ P D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  316  TNS-KGKASGPLPDPPQDQFDRTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTEVY  374

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD +    GVY+LD FPT  +  A   G
Sbjct  375  VLENKPPVTIDGKRRSTLSGISFANPATPIRLADEY-KVKGVYKLD-FPTRPLTGAPRIG  432

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M ++H+ G+   VVG   G WT  +R TYN +D V RS
Sbjct  433  TSVINGTYRGFMEVILQNNETKMHTYHMSGYAFFVVGMDYGVWTENSRGTYNKWDGVARS  492

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QVYPG WTA+ + LDN G+WNLR++++  WYLGQ+ Y+RV + +PN   E P P N L
Sbjct  493  TTQVYPGAWTAILISLDNVGVWNLRTENLDSWYLGQETYVRVVNPEPNNKTEFPMPDNAL  552

Query  892  LCG  900
             CG
Sbjct  553  FCG  555



>ref|XP_004300548.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=539

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS+SVL++ DQ  +DYYIV + +         L A  +LHY+
Sbjct  240  EGSHTQQNIYDSLDVHVGQSFSVLLTLDQPPKDYYIVTSTRFTR----RVLTATAVLHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GP+P GP  +   +S+ QA++ RWNLTA AARPNPQG+++   I  ++T VL
Sbjct  296  NSHTSV-SGPVPAGPR-YQFHWSMQQARTFRWNLTANAARPNPQGSYHYGQIVPTKTIVL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I GT RY  N VSY  PDTPLKLADYF N  GV+  D   +      A     +
Sbjct  354  ASSAPLINGTLRYAFNRVSYVNPDTPLKLADYF-NIPGVFSFDAIQSVPSGGPAILATPV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +H  +LEIVFQN+   M S HLDG+    VGYG G+W PA R TYN+ D + R TVQ
Sbjct  413  LPSSHHDFLEIVFQNNERTMQSVHLDGYDFWPVGYGSGQWQPAKRRTYNLVDALTRHTVQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            V+P  W+ + V LDN GMWNLRS   +  YLGQQLY+RV +   N A E   PSN L+CG
Sbjct  473  VFPNSWSTILVSLDNQGMWNLRSALWERQYLGQQLYLRVWNPTQNLANEYNIPSNALMCG  532



>ref|XP_008437127.1| PREDICTED: monocopper oxidase-like protein SKU5 [Cucumis melo]
Length=592

 Score =   269 bits (687),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 193/305 (63%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +    ILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESLWKRVTGVAILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K  GPLPE P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  SNS-KGKAIGPLPEAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD F    GVY+LD FPT  +       
Sbjct  372  VLKNKPPVSINGKMRTTLSGISFVNPSTPIRLADQF-KLKGVYKLD-FPTRPLTGPPKAE  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+H++G+   VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHMNGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG WTA+ V LDN G+WN+R++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  490  TIQVYPGAWTAILVSLDNVGVWNIRTENLDSWYLGQETYVRVVNPEATNKTELPMPDNAL  549

Query  892  LCGMF  906
             CG  
Sbjct  550  FCGQL  554



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+V + +      +  L   G+L Y+
Sbjct  239  EGTHTLQTTFSSLDVHVGQSYSVLVTADQPAQDYYVVVSSRF----TSDVLTTTGVLRYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            GS A   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   I  ++T  L
Sbjct  295  GS-AGGVSGPIPGGPT-IQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLADYF    GVY +    +           S+
Sbjct  353  ASSAGQVNGKQRYAVNSVSFNPADTPLKLADYF-KIDGVYRVGSIQSQPTGGGIYLDTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVF+N   ++ SWHLDG+   VVG   G+WTP +R  YN+ D V R TVQ
Sbjct  412  MQTDYRTFIEIVFENSEDIVQSWHLDGYSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLRS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  472  VYPSSWTAIYIALDNVGMWNLRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+V + +      +  L   G+L Y+
Sbjct  239  EGTHTLQTTFSSLDVHVGQSYSVLVTADQPAQDYYVVVSSRF----TSDVLTTTGVLRYS  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            GS A   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   I  ++T  L
Sbjct  295  GS-AGGVSGPIPGGPT-IQIDWSLNQARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLADYF    GVY +    +           S+
Sbjct  353  ASSAGQVNGKQRYAVNSVSFNPADTPLKLADYF-KIDGVYRVGSIQSQPTGGGIYLDTSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVF+N   ++ SWHLDG+   VVG   G+WTP +R  YN+ D V R TVQ
Sbjct  412  MQTDYRTFIEIVFENSEDIVQSWHLDGYSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLRS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  472  VYPSSWTAIYIALDNVGMWNLRSEFWARQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCG  531



>ref|XP_002465266.1| hypothetical protein SORBIDRAFT_01g035180 [Sorghum bicolor]
 gb|EER92264.1| hypothetical protein SORBIDRAFT_01g035180 [Sorghum bicolor]
Length=590

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/303 (48%), Positives = 196/303 (65%), Gaps = 9/303 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    +LD+HV QSYS LV+ DQ+   DYY+VA+ +  +A     L    ILHY
Sbjct  252  EGSYTSQQNYTNLDIHVSQSYSFLVTMDQNASTDYYVVASARFVDAAVVDKLTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ P D +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  312  SNS-QGPASGPLPDPPNDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GV++LD FP H +       
Sbjct  371  LLQSRAPELIDGKLRSTLNEISYIAPSTPLVLAQIF-NVPGVFKLD-FPNHPMNRLPKVD  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  429  TSIINGTYKGFMEIIFQNNATNVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QV+PG WTA+ VFLDN G+WNLR Q++  WYLGQ++YI V + + N +     P N +
Sbjct  489  TIQVFPGAWTAILVFLDNAGIWNLRVQNLDTWYLGQEVYINVVNPEDNSSTI---PDNAI  545

Query  892  LCG  900
             CG
Sbjct  546  FCG  548



>ref|XP_010271560.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nelumbo nucifera]
Length=546

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 190/312 (61%), Gaps = 23/312 (7%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDD-EDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    +LD+HVGQSYSVLV+A+Q     Y++VA  +         L    ++HY
Sbjct  241  EGSYTLQQYYQTLDIHVGQSYSVLVTANQKSGMSYHMVAVSRF----SVPELAGAAVIHY  296

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             GS      GPLP GPDPFD ++SI QA+SIRW+L  GAARPNPQG+F    I +S+T +
Sbjct  297  PGS-QGNSKGPLPTGPDPFDYRYSIEQARSIRWDLAVGAARPNPQGSFRYGLINVSRTII  355

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAAD----  525
            L      I    RY VN +S+   DTPLKLADYF  G      D F  +++ D  D    
Sbjct  356  LENDMTVIGSRQRYTVNGISFVHSDTPLKLADYFQLG------DVFAINAIPDKPDGRNP  409

Query  526  -YGVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPV  702
              G S++   ++ ++ IVFQN L  M +WH DG+   VVG  +G+W  + R  YN+ D V
Sbjct  410  ALGTSVMDLRYRDFIHIVFQNPLPTMQTWHFDGYNFFVVGMDEGKWDESKRLAYNMLDAV  469

Query  703  VRSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVH---DDDPN--PAK-  864
             RSTVQVYP  WTA+ V LDN GMWN RSQ  + WYLGQ+LY+RV     DDP+  PA+ 
Sbjct  470  SRSTVQVYPNAWTAIMVELDNQGMWNFRSQDAEKWYLGQELYVRVKGEGQDDPSTVPARD  529

Query  865  EKPPPSNLLLCG  900
            E P P+N++ CG
Sbjct  530  ELPIPTNVIRCG  541



>ref|XP_003550083.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN12128.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/301 (50%), Positives = 189/301 (63%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q T D+LDVHVGQS +VLV+ +Q  +DYYIVA+ +         L A  +LHY+
Sbjct  240  EGSHIVQNTYDTLDVHVGQSAAVLVTLNQPPKDYYIVASTRFSR----KVLTATAVLHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GPLP  P  +   +S+ QA++ RWNLTA AARPNPQG+++   IT ++T VL
Sbjct  296  NS-NSPASGPLPS-PPIYQYHWSVKQARTYRWNLTANAARPNPQGSYHYGKITPTKTIVL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTH-SVKDAADYGVS  537
              S   I G  RY VN VSY   DTPLKLADYF N  G+Y +D   T  S    A    S
Sbjct  354  SNSAPLINGKLRYAVNKVSYVNSDTPLKLADYF-NIPGIYSVDSIQTLPSESTPASIATS  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V  +   ++E+VFQN+   M SWHLDG+   VVGYG G+WTPA R TYN+ D + R T 
Sbjct  413  VVPTSLHDFIEVVFQNNENAMQSWHLDGYDFWVVGYGFGQWTPAKRRTYNLVDALTRHTT  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQLY+RV   + + A E   P+N LLC
Sbjct  473  QVYPNAWTTILVSLDNQGMWNLRSAIWERQYLGQQLYLRVWTSERSLANEYDIPNNALLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_007156841.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
 gb|ESW28835.1| hypothetical protein PHAVU_002G021900g [Phaseolus vulgaris]
Length=540

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 192/301 (64%), Gaps = 7/301 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS S+LV+ +Q  +DYYIVA+ +  E    +PL    +LHY+
Sbjct  239  EGSHTIQNIYDSLDVHVGQSVSLLVTLNQPPKDYYIVASTRFTE----TPLTTTAVLHYS  294

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S ++   GP+P  P D +D  +S+ QA++ RWNLTA AARPNPQG+F+   IT ++   
Sbjct  295  NSFSSA-LGPVPPSPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIK  353

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY  PDTPLKLADYF N  G++ ++               S
Sbjct  354  LANSAPSINGKLRYAVNSVSYVNPDTPLKLADYF-NIPGIFSVNLLQNTPSSGPGYIATS  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   ++E++FQN+   M SWHLDG+   V+GYG G+W+ A+R+TYN+ D + R T 
Sbjct  413  VLPTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGYGFGQWSDASRKTYNLVDALTRHTA  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+ V LDN GMWNLRS   +  YLGQQ Y+RV +   + A E   P+N+LLC
Sbjct  473  QVYPKSWTAILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQRSLANEYDIPNNVLLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>emb|CDP09915.1| unnamed protein product [Coffea canephora]
Length=593

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++   ++   +   GILHY
Sbjct  254  EGSYTVQQNYSSLDIHVGQSYSFLVTMDQNASSDYYIVASARMVNESQWQKVTGVGILHY  313

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K +GPLP+ P D FD  FS+NQA+SIRWN+TA  ARPNPQG+F   +I +++ +
Sbjct  314  TNS-KGKASGPLPDPPQDQFDKTFSMNQARSIRWNVTASGARPNPQGSFRYGSINVTEVY  372

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       + G  R  ++ VS+  P TP++LAD +    GVY+LD FPT  +  +    
Sbjct  373  VLKNKPPVTVNGKQRATLSGVSFVNPATPIRLADQY-KVKGVYKLD-FPTRPLTGSPRME  430

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++ QN+   M ++H+ G+   VVG   GEWT  +R TYN +D + R 
Sbjct  431  TSIINGTYRGFMEVILQNNDTKMHTYHMSGYNFFVVGMDFGEWTENSRGTYNKWDGIARV  490

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTAV V LDN G+WNLR++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  491  TTQVFPGAWTAVLVSLDNVGVWNLRTENLDSWYLGQETYVRVVNPEATNKTELPIPDNAL  550

Query  892  LCG  900
             CG
Sbjct  551  FCG  553



>ref|XP_006287348.1| hypothetical protein CARUB_v10000546mg [Capsella rubella]
 gb|EOA20246.1| hypothetical protein CARUB_v10000546mg [Capsella rubella]
Length=587

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 194/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQ+YS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  250  EGSYTVQQNYTSLDIHVGQTYSFLVTMDQNASADYYIVASARVVNETIWRRVTGVGILHY  309

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  310  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  368

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  +N +S++ P TP++LAD  +   GVY+LD FP   +       
Sbjct  369  VLRNMPPVKIDGKRRTTLNGISFKNPSTPIRLADK-LKVKGVYKLD-FPKRPLTGPPKME  426

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  427  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  486

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P+N+L
Sbjct  487  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPANVL  546

Query  892  LCG  900
             CG
Sbjct  547  YCG  549



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL++ADQ   DYYIV + +    N    L   G+L Y 
Sbjct  239  EGTHTLQTTFSSLDVHVGQSYSVLITADQPARDYYIVVSSQFTSEN----LTTTGVLRYN  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GP+P GP    + +S+NQA++IR NLTA   RPNPQGT++   I  ++T  L
Sbjct  295  NS-AGPVSGPIPGGPTD-QINWSLNQARAIRTNLTASGPRPNPQGTYHYGKINTTRTIRL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN++S+   DTPLKLADY+    GV+ +     H          S+
Sbjct  353  ASSAGQVNGKLRYAVNSISFIPADTPLKLADYY-KIDGVFRVGSISDHPTGGEIYQDASV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVF+N   ++ SWHL+G+   VVG   GEWTP +R  YN++D V R TVQ
Sbjct  412  MQADYRAFVEIVFENPEDIVQSWHLNGYSFFVVGMDGGEWTPESRNEYNLHDAVSRCTVQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VY   WTA+YV LDN GMWN+RS+  +  YLGQQ Y+RVH +  +P  E P P N LLCG
Sbjct  472  VYRKSWTAIYVALDNVGMWNVRSEDWERQYLGQQFYLRVHTNSTSPRDEYPIPKNSLLCG  531



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYIVA+ +      T      G LHY 
Sbjct  242  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPGQDYYIVASSRFTTPILT----TTGTLHYT  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A + +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I  ++T+VL
Sbjct  298  NS-AGRVSGPPPGGPT-IQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINTTKTYVL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S+
Sbjct  356  ENSAGQVNGKQRYGVNSVSFVPADTPLKLADYFKIG-GVFRVGSISDRPTGGGLYLDTSV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++E VFQN+  ++ SWHLDG+   VVG   G+WTPA+R+ YN+ D V R TVQ
Sbjct  415  LGADYRTFVEFVFQNNEDIIQSWHLDGYSFFVVGLDGGQWTPASRKEYNLRDAVSRCTVQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLR++     YLGQQLY+RV+    +   E P P N LLCG
Sbjct  475  VYPKSWTAIYVALDNVGMWNLRTEFWARQYLGQQLYLRVYTPSTSIRDEYPIPKNALLCG  534



>ref|XP_008373811.1| PREDICTED: monocopper oxidase-like protein SKU5 [Malus domestica]
Length=591

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 193/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +   GILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESNWKRVTGVGILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K AGPLP GP D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  TNS-KGKAAGPLPVGPQDEFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  +  ++ +S++ P TP++LAD+F      Y LD FPT  +  A    
Sbjct  371  VLKNKPPVMINGKRQATLSGISFKNPSTPIRLADWF-KVKNAYTLD-FPTRPLTGAPKLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++ T +G++EI+ QN+   M S+H+DG+   VVG   GEWT  +R TYN +D + RS
Sbjct  429  TSVINATFRGFIEIILQNNDTKMQSYHVDGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG W+A+ + LDN G+WN+R++++  WYLGQ+ Y+RV + + N   E P P N L
Sbjct  489  TVQVYPGAWSAILISLDNVGIWNIRTENLDSWYLGQETYMRVVNPEANNKTELPIPDNSL  548

Query  892  LCG  900
             CG
Sbjct  549  YCG  551



>tpg|DAA45410.1| TPA: hypothetical protein ZEAMMB73_672798 [Zea mays]
Length=691

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 196/303 (65%), Gaps = 9/303 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    +LD+HVGQSYS LV+ DQ+   DYY+VA+ +  +A     L    ILHY
Sbjct  353  EGSYTSQQNYTNLDIHVGQSYSFLVTMDQNASTDYYVVASARFVDAAVVDKLTGVAILHY  412

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ P D +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  F
Sbjct  413  SNS-QGPASGPLPDPPNDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVF  471

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GV++LD FP H +       
Sbjct  472  LLQSRAPELIDGKLRSTLNEISYIAPSTPLVLAQIF-NVPGVFKLD-FPNHPMNRLPKVD  529

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  530  TSIINGTYKGFMEIIFQNNATNVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  589

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QV+PG WTA+ VFLDN G+WNLR Q++  WYLGQ++YI V + + +       P N +
Sbjct  590  TIQVFPGAWTAILVFLDNAGIWNLRVQNLDTWYLGQEVYINVVNPEDSSTTL---PDNAI  646

Query  892  LCG  900
             CG
Sbjct  647  FCG  649



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 192/302 (64%), Gaps = 10/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLV--AKGILH  174
            EG++T Q T  SLDVHVGQSYSVL +ADQ  +DYYIV   +      T+P+V    GILH
Sbjct  245  EGTHTLQTTYSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRF-----TAPVVLNTTGILH  299

Query  175  YAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            Y+ S A   +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I  ++T 
Sbjct  300  YSNS-AGPVSGPFPGGPTT-QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTRTI  357

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            ++  S G++ G  RY VN+VS+  PDTP+KLADYF    GV++ +               
Sbjct  358  IVANSAGQVNGKQRYGVNSVSFIAPDTPMKLADYF-KIQGVFKENSISDRPYGGGLYLDT  416

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++  ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R  YN+ D V R T
Sbjct  417  SVLTLPYRAFVEIVFQNNEDIVQSWHLDGYSFFVVGMDGGQWTTASRNQYNLRDGVSRCT  476

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            +QVYP  WTA+Y+ LDN GMWNLR++     YLGQQ Y+RV+ D  +   E P P N LL
Sbjct  477  IQVYPKAWTAIYIPLDNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEYPIPKNALL  536

Query  895  CG  900
            CG
Sbjct  537  CG  538



>ref|XP_006447987.1| hypothetical protein CICLE_v10014680mg [Citrus clementina]
 ref|XP_006492225.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Citrus 
sinensis]
 gb|ESR61227.1| hypothetical protein CICLE_v10014680mg [Citrus clementina]
Length=595

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/305 (46%), Positives = 200/305 (66%), Gaps = 8/305 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQS+S LV+ DQ+   +YYIVA+P+   ++E + +    ILHY
Sbjct  256  EGSYTVQQNYTNMDIHVGQSFSFLVTTDQNASSEYYIVASPRFVNSSEWNKVTGVAILHY  315

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S+    +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  316  SNSLGPA-SGPLPDPPNAYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGQITVTDVYV  374

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPL LA  F N  G Y+LD FP   +  A     
Sbjct  375  ILNRPAELIEGKWRTTLNGISYLPPSTPLMLAQQF-NIPGAYKLD-FPYKLMNRAPKVDT  432

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT+KG++EI+FQN+   + S+H+DG+   VVG   G WT  +R TYN +D V RST
Sbjct  433  SLINGTYKGFMEIIFQNNDTTVQSYHMDGYAFFVVGMDFGVWTENSRGTYNKWDGVARST  492

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKP-PPSNLL  891
             QV+PG WTA+ V+LDN G+WNLR++++  WYLGQ++Y+ V   +P   K  P  P N +
Sbjct  493  TQVFPGAWTAILVYLDNAGIWNLRAENLDTWYLGQEVYVNVI--NPEIDKSAPLLPDNAI  550

Query  892  LCGMF  906
             CG+ 
Sbjct  551  YCGLL  555



>ref|XP_008381156.1| PREDICTED: monocopper oxidase-like protein SKU5 [Malus domestica]
Length=591

 Score =   268 bits (685),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +   GILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESNWKRVTGVGILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K AGPLP GP D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  TNS-KGKAAGPLPAGPQDEFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S++ P TP++LAD+F      Y+LD FP   +       
Sbjct  371  VLKNKPPVMINGKRRTTLSGISFKNPSTPIRLADWF-KVKNAYKLD-FPARPLTGTPKLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++ T +G++EI+ QN+   M S+H+DG+   VVG   GEWT  +R TYN +D + RS
Sbjct  429  TSVINTTFRGFIEIILQNNDTKMQSYHVDGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG W+A+ + LDN G+WN+R++++  WYLGQ+ Y+RV + + N   E P P N L
Sbjct  489  TVQVYPGAWSAILISLDNVGIWNIRAENLDSWYLGQETYMRVVNPEANNKTELPIPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  YCG  551



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   266 bits (681),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL +ADQ  +DYYIV   +      ++ L   G+LHY+
Sbjct  245  EGTHTLQTTYSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRF----TSTVLNTTGVLHYS  300

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GP P GP   ++ +SINQA+SIR NLTA   RPNPQG+++   I  ++T ++
Sbjct  301  NSAGAV-SGPFPGGPT-IEVDWSINQARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIV  358

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+  PDTP+KLADYF    GV++ +               ++
Sbjct  359  ANSAGQVNGKQRYGVNSVSFVAPDTPMKLADYF-KIQGVFKENGITDRPYGGGLYLDTAV  417

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  ++ ++EIVFQN   ++ SWHLDG+   VVG   G+WT A+R+ YN+ D V R T Q
Sbjct  418  LTVPYRAYVEIVFQNDEDILQSWHLDGYSFFVVGMDGGQWTTASRDQYNLRDAVARCTAQ  477

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLR++     YLGQQ Y+RV+ D  +   E P P N LLCG
Sbjct  478  VYPKAWTAIYIPLDNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEFPIPKNALLCG  537



>ref|XP_007211279.1| hypothetical protein PRUPE_ppa003224mg [Prunus persica]
 gb|EMJ12478.1| hypothetical protein PRUPE_ppa003224mg [Prunus persica]
Length=591

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYY+VA+ +         +    ILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASSDYYVVASARFVNETHWKKVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K AGPLPE P D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  TNS-KGKAAGPLPEAPNDEFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD+     GVY+LD FPT  +  A    
Sbjct  371  VLKNKPPVVINGRRRTTLSGISFVNPSTPIRLADW-KKLKGVYKLD-FPTRPLTGAPRLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT +G++EI+ QN+   M S+H+DG+   VVG   G+WT  +R TYN +D + RS
Sbjct  429  TSVINGTFRGFIEIILQNNDTKMQSYHVDGYAFFVVGMDYGDWTENSRGTYNKWDGIARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTA+ + LDN G+WN+R++++  WYLGQ+ YIRV + +     E P P N L
Sbjct  489  TVQVYPGAWTAILISLDNVGVWNIRAENLDSWYLGQETYIRVVNPEATNKTELPAPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  FCG  551



>gb|KDP45242.1| hypothetical protein JCGZ_15107 [Jatropha curcas]
Length=596

 Score =   268 bits (684),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 198/304 (65%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q   +++D+HVGQSYS LV+ DQ+   DYYIVA+ +   ++  +      ILHY
Sbjct  257  EGSYTVQQNYENMDIHVGQSYSFLVTMDQNATSDYYIVASSRYVNSSTWTKATGVAILHY  316

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F   +IT++  +V
Sbjct  317  SNS-QGPASGPLPDLPNEYDTYFSMNQARSIRWNVSAGAARPNPQGSFKYGDITVTDVYV  375

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY  P TPLKLA  + N +GVY+LD FP   +        
Sbjct  376  ILNKPAELIDGKLRSTLNGISYLPPSTPLKLAQQY-NISGVYKLD-FPNRLMNRPPKVDT  433

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN    + S+H+DG+   VVG   G WT  +R TYN +D V R T
Sbjct  434  SLINGTFKGFMEIIFQNDDTTVQSYHMDGYAFFVVGMDFGVWTENSRGTYNKWDGVARCT  493

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  WYLGQ++Y+ V + + + + E P P N + 
Sbjct  494  TQVFPGAWTAILVSLDNAGIWNLRTQNLNTWYLGQEVYVSVVNPEID-SSEIPLPDNCIY  552

Query  895  CGMF  906
            CG+ 
Sbjct  553  CGLL  556



>dbj|BAF01800.1| pollen-specific protein [Arabidopsis thaliana]
Length=331

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 185/294 (63%), Gaps = 6/294 (2%)
 Frame = +1

Query  34   SLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHYAGSVAAKPAGP  210
            SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GIL Y  S   K  G 
Sbjct  4    SLDIHVGQSYSFLVTMDQNASSDYYIVASARVVNETIWRRVTGVGILKYTNS-KGKAKGQ  62

Query  211  LPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVLHGSKG-EIR  384
            LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +VL       I 
Sbjct  63   LPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVYVLRNMPPVTIS  122

Query  385  GTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSIVSGTHKGW  564
            G  R  +N +S++ P TP++LAD  +    VY+LD FP   +   A    SI++GT++G+
Sbjct  123  GKRRTTLNGISFKNPSTPIRLADK-LKVKDVYKLD-FPKRPLTGPAKVATSIINGTYRGF  180

Query  565  LEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQVYPGGWTA  744
            +E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RST+QVYPG W+A
Sbjct  181  MEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARSTIQVYPGAWSA  240

Query  745  VYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCGMF  906
            + + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L CG  
Sbjct  241  ILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVLYCGAL  294



>ref|XP_008238616.1| PREDICTED: monocopper oxidase-like protein SKU5 [Prunus mume]
Length=591

 Score =   267 bits (683),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYY+VA+ +         +    ILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASSDYYVVASARFVNETHWKKVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K AGPLPE P D FD  +S+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  312  TNS-KGKAAGPLPEAPNDEFDKTYSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD+     G+Y+LD FPT  +  A    
Sbjct  371  VLKNKPPVVINGRRRTTLSGISFVNPSTPIRLADW-KKLKGIYKLD-FPTRPLTGAPRLE  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT +G++EI+ QN+   M S+H+DG+   VVG   G+WT  +R TYN +D + RS
Sbjct  429  TSVINGTFRGFIEIILQNNDTKMQSYHVDGYAFFVVGMDYGDWTENSRGTYNKWDGIARS  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG WTA+ + LDN G+WN+R++++  WYLGQ+ YIRV + +     E P P N L
Sbjct  489  TVQVYPGAWTAILISLDNVGVWNIRAENLDSWYLGQETYIRVVNPEATNKTELPAPDNAL  548

Query  892  LCG  900
             CG
Sbjct  549  FCG  551



>gb|AAD41439.1|AC007727_28 Strong similarity to gb|X96932 ascorbate oxidase-related protein 
PS60 from Nicotiana tabacum and is a member of the PF|00394 
Multicopper oxidase family. This gene is cut off, partial 
[Arabidopsis thaliana]
Length=359

 Score =   261 bits (666),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 146/304 (48%), Positives = 193/304 (63%), Gaps = 16/304 (5%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q    SLDVHVGQSYSVL++ADQ  +DYYIV + +      +  L+  G+LHY+
Sbjct  48   EGTHTIQTPFSSLDVHVGQSYSVLITADQPAKDYYIVVSSRF----TSKILITAGVLHYS  103

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GP+PE P    L++S +QA++I+ NL A   RPNPQGT++   I +++T  L
Sbjct  104  NS-AGPVSGPIPEAP--IQLRWSFDQARAIKTNLAASGPRPNPQGTYHYGKIKVTRTIKL  160

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVY---ELDDFPTHSVKDAADYG  531
              S G I G  RY VN+ S+   DTPLKLADYF   AGVY    + D PTH     A Y 
Sbjct  161  ASSAGNINGKQRYAVNSASFYPTDTPLKLADYF-KIAGVYNPGSIPDQPTH----GAIYP  215

Query  532  VSIVSGT-HKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
            V+ V  T +K ++EIVF+N   ++ +WHLDG+   VVG   G+W+ A+R+ YN+ D V R
Sbjct  216  VTSVMQTDYKAFVEIVFENWEDIVQTWHLDGYSFFVVGMELGKWSAASRKVYNLNDAVSR  275

Query  709  STVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNL  888
             TVQVYP  WTA+YV LDN GMWNLRS+  +  YLGQQ Y+RV+    +   E   P N 
Sbjct  276  CTVQVYPRSWTAIYVSLDNVGMWNLRSELWERQYLGQQFYMRVYTPSTSLRDEYLIPKNA  335

Query  889  LLCG  900
            LLCG
Sbjct  336  LLCG  339



>ref|XP_004245738.1| PREDICTED: monocopper oxidase-like protein SKU5 [Solanum lycopersicum]
Length=589

 Score =   267 bits (683),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LVS DQ+   DYYIVA+ +    ++   +   GIL Y
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVSMDQNASSDYYIVASARFVNQSQWQRVTGVGILKY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPE P D FD  FS+NQA+SIRWN+TA  ARPNPQG+F   +I +++ +
Sbjct  313  TNS-KGKAHGPLPEPPQDEFDKTFSMNQARSIRWNVTASGARPNPQGSFRYGSINVTEIY  371

Query  355  VLHGSKGEI-RGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            V+  +  ++  G  R  +N +S+  P TP++LAD +    GVY+LD FPT  +       
Sbjct  372  VVQNTPPKVVDGKRRTTLNGISFVNPKTPIRLADQY-KLKGVYKLD-FPTAPLTGPPKME  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++FQN+   M ++H+ G+   VVG   G W+  +R TYN +D + R+
Sbjct  430  TSIINGTYRGFMEVIFQNNDTKMHTYHMSGYAFFVVGMDFGVWSNNSRGTYNKWDGIART  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN G+WNLR++++  W+LGQ+ YIRV + +P    E P P N L
Sbjct  490  TTQVFPGAWTAILVSLDNVGVWNLRTENLDSWFLGQETYIRVVNSEPTNKTELPMPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   266 bits (679),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T DSLD+H+GQSYSVLV+ADQ  +DYYIVA+ +      +  L    +LHY+
Sbjct  241  EGTHTLQNTYDSLDIHLGQSYSVLVTADQPAQDYYIVASTRF----TSQVLATTAVLHYS  296

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GPLP GP    + +S+ QA+SIR NLTA   RPNPQG+++   I  ++T  L
Sbjct  297  NS-AGTVSGPLPGGPTT-QIDWSLEQARSIRRNLTASGPRPNPQGSYHYGLINTTRTIRL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VS+   DTPLKLADYF N +GV+ L   P       A    S+
Sbjct  355  ASSASIINGKQRYAVNSVSFIPADTPLKLADYF-NISGVFSLGSIPVGPTGGGAYLQTSV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++   +G+ EIVF+N    + SWH+DG    VVG   G+WTPA+R TYN+ D + R TVQ
Sbjct  414  MAADFRGYTEIVFENPEDTLQSWHIDGHNFFVVGMDGGQWTPASRLTYNLRDTISRCTVQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTAVY+ LDN GMWN+RS++    YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  474  VYPKSWTAVYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPAKSWRDEYPIPRNALLCG  533



>gb|KFK26934.1| monocopper oxidase-like protein sku5 [Arabis alpina]
Length=555

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 193/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASADYYIVASARVVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRW+++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGQLPPGPQDEFDKTFSMNQARSIRWDVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I+G  R  ++ VS++ P TP++LAD      GVY+LD FP   +      G
Sbjct  368  VLRNMPPVMIKGKRRTTLSGVSFQNPSTPIRLADKH-KIHGVYKLD-FPKRPLTGPPRVG  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++ QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVILQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGAPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_004972824.1| PREDICTED: monocopper oxidase-like protein SKS1-like [Setaria 
italica]
Length=589

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 195/305 (64%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EG+YTNQ    +LD+HVGQSYS LV+ DQ+   DYYIVA+P+     + S +    IL Y
Sbjct  247  EGTYTNQQNYTNLDIHVGQSYSFLVTMDQNASTDYYIVASPRFISNPQWSQVTGVAILQY  306

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+ P D +D  +SINQAKSIR N +AGAARPNPQG+F+  +I ++QTF
Sbjct  307  SNS-KGKASGPLPDAPNDYYDKYYSINQAKSIRMNTSAGAARPNPQGSFHYGSINITQTF  365

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +SY  P+TPL+LAD   N  GVY   DFP       A   
Sbjct  366  VLKNEAPLRINGKQRRTINRISYSPPETPLRLADLH-NLTGVYT-TDFPAMPSNIPARVA  423

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++ ++KG+LEI+FQN+   + ++HLDG+   VVG   GEWTP  R  Y+ +D + R 
Sbjct  424  SSVLNASYKGFLEIIFQNNDTDIQTYHLDGYSFFVVGMDYGEWTPDRRNEYSRWDAISRC  483

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PGGWTAV + LDN G+WNLR++ + +WY GQ++Y++V D       E   P N+L
Sbjct  484  TTQVFPGGWTAVLISLDNVGIWNLRAEKLDNWYRGQEVYVKVADPLGYNITEMIMPDNVL  543

Query  892  LCGMF  906
             CG+ 
Sbjct  544  YCGIL  548



>ref|XP_006368173.1| monocopper oxidase precursor family protein [Populus trichocarpa]
 gb|ERP64742.1| monocopper oxidase precursor family protein [Populus trichocarpa]
Length=592

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 190/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +    ILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESQWKRVTGVAILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPE P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  TNS-KGKAKGPLPEAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  ++ +S+  P TP++LAD F    G Y+LD FP   +       
Sbjct  372  VLKNKPLVTINGKRRATLSGISFVNPTTPIRLADQF-KVKGAYKLD-FPETPLTGPPKMA  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+HL G+ + VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMHSYHLSGYAVFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQ YPG WTA+ V LDN G+WNLR++++  WYLGQ+ YIR+ + +     E P P N L
Sbjct  490  TVQAYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYIRIVNPEETNKTELPIPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|NP_192979.1| multi-copper oxidase-like protein SKU5 [Arabidopsis thaliana]
 ref|NP_001190704.1| multi-copper oxidase-like protein SKU5 [Arabidopsis thaliana]
 sp|Q9SU40.1|SKU5_ARATH RecName: Full=Monocopper oxidase-like protein SKU5; AltName: 
Full=Skewed roots; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL62306.1|AF439406_1 multi-copper oxidase-related protein [Arabidopsis thaliana]
 emb|CAB41712.1| putative pollen-specific protein [Arabidopsis thaliana]
 emb|CAB78285.1| putative pollen-specific protein [Arabidopsis thaliana]
 gb|AEE83128.1| multi-copper oxidase-like protein SKU5 [Arabidopsis thaliana]
 gb|AEE83129.1| multi-copper oxidase-like protein SKU5 [Arabidopsis thaliana]
Length=587

 Score =   267 bits (682),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 191/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GIL Y
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARVVNETIWRRVTGVGILKY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGQLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +S++ P TP++LAD  +    VY+LD FP   +   A   
Sbjct  368  VLRNMPPVTISGKRRTTLNGISFKNPSTPIRLADK-LKVKDVYKLD-FPKRPLTGPAKVA  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL +ADQ  +DYYIV   +      ++ L   GILHY+
Sbjct  245  EGTHTLQTTYSSLDVHVGQSYSVLFTADQPGQDYYIVVTSRF----TSTVLNTTGILHYS  300

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GP P GP   ++ +S+NQA+SIR NLTA   RPNPQG+++   I  ++T ++
Sbjct  301  NSAGAV-SGPFPGGPT-IEVDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIV  358

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+  PDTP+K+ADYF    GV++ +               ++
Sbjct  359  ANSAGQVNGNQRYGVNSVSFIAPDTPMKIADYF-KIQGVFKENGITDRPYGGGLYLDTAV  417

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  ++ ++EIVFQN   ++ SWHLDG+   VVG   G+WT A+R+ YN+ D V R T Q
Sbjct  418  LTVPYRAYVEIVFQNDEDILQSWHLDGYSFFVVGMDGGQWTTASRDQYNLRDAVARCTTQ  477

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLR++     YLGQQ Y+RV+ D  +   E P P N LLCG
Sbjct  478  VYPKAWTAIYIPLDNVGMWNLRTEFWARQYLGQQFYLRVYTDSTSLRDEFPIPKNALLCG  537



>ref|XP_007047152.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
 gb|EOX91309.1| SKU5 similar 17 isoform 1 [Theobroma cacao]
Length=538

 Score =   265 bits (678),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 144/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  239  EGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTK----TVLTATAVLHYT  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP  P  +   +S+ QA++ RWNLT+ AARPNPQG+F+   IT ++T VL
Sbjct  295  NS-QTPVSGPLPAAP-AYQYHWSMQQARTYRWNLTSNAARPNPQGSFHYGKITTTKTIVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VS+  PDTPLKLADYF N  GV+ +          AA    S+
Sbjct  353  ANSGSLINGKLRYTVNGVSFVNPDTPLKLADYF-NIPGVFSMSSIQDLPSGGAATVATSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V  +   ++E+VFQN+   M SWHLDG+   VVG+G G+W P  R TYN+ D + R T Q
Sbjct  412  VPTSLHDFIEVVFQNNENTMQSWHLDGYDFWVVGFGSGQWAPKKRRTYNLIDALTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y+RV     + A E   PSN+LLCG
Sbjct  472  VYPNSWTAILVSLDNQGMWNMRSAMWERQYLGQQFYLRVWTPVRSFANEYDIPSNVLLCG  531



>ref|XP_004145114.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004153223.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004158002.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=542

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 190/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q T  SLD+H+GQSYSVLV+A+Q  +DYY+V + +      TSP L    +LHY
Sbjct  240  EGSHTLQNTYSSLDIHLGQSYSVLVTANQPPKDYYVVVSSRF-----TSPILTTTAVLHY  294

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S   K +GP+P GP   ++ +S+ QA+SIRWNLTA   RPNPQG+++   I  S+T V
Sbjct  295  SNS-WQKVSGPVPGGPTT-EIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIV  352

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  R+ VN+VS+   DTPLKLADYF    GV+ L++ PT+     A    S
Sbjct  353  LANSAPVINGKQRFAVNSVSFVQADTPLKLADYF-KIPGVFNLNNIPTNPTWGNAYLQTS  411

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++    + ++EIVFQN    + SWH+ G+   VVG   G+WTPA+R  YN+ D V R T 
Sbjct  412  VMGSNFREYIEIVFQNWENTVQSWHISGYSFFVVGMDGGQWTPASRSRYNLRDTVARCTT  471

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLC
Sbjct  472  QVYPKSWTAIYMALDNVGMWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLC  531

Query  898  G  900
            G
Sbjct  532  G  532



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   266 bits (679),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 190/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q + DS+DVHVGQSYSVL++ADQ  +DYYIV + +         L +   LHY+
Sbjct  241  EGTHTVQTSYDSIDVHVGQSYSVLITADQAPKDYYIVVSTRF----TNRVLTSTAALHYS  296

Query  181  GSVAAKP-AGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S   +P +GP+P GP    + +SI QA+SIR NLTA   RPNPQG+++   I +S+T  
Sbjct  297  NS--QQPLSGPIPAGPTT-QIDWSIQQARSIRTNLTASGPRPNPQGSYHYGMINISRTIK  353

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S  ++ G  RY VN+VS+   DTPLKLADYF  G GV+++   P      +     S
Sbjct  354  LESSAAQVNGKQRYAVNSVSFVPADTPLKLADYFKIG-GVFQVGSIPDTPSGRSMYTDTS  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++    + ++EIVFQNH +++ SWH+DG+   VVG   G WTP +R  YN+ D V RST 
Sbjct  413  VMGADFRAFVEIVFQNHESIVQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTT  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+ D  +   E P P N LLC
Sbjct  473  QVYPKSWTAIYMALDNVGMWNVRSEFWARQYLGQQFYMRVYSDAGSIRDEYPIPKNALLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_009348086.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q + DSLD+HVGQS SVLV+ +Q  +DYYIVA+ +         L A  +LHY 
Sbjct  242  EGSHTIQNSYDSLDIHVGQSVSVLVTLNQAPKDYYIVASTRFTRL----VLTATSVLHYT  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GP+P GP    + +S+ QA++ RWNLTA AARPNPQG+F+   +T ++T VL
Sbjct  298  NSHTSV-SGPVPAGPTG-QIHWSMEQARTFRWNLTANAARPNPQGSFHYGKVTPTKTIVL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY  N VSY  PDTP+KLADYF N  GV+ L+   T     +A     +
Sbjct  356  ANSAPLINGKQRYAFNRVSYVNPDTPVKLADYF-NIPGVFSLNSIQTAPSDGSASLATPV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +H  ++EIVFQN+   + S HLDG+   VVGYG G WTPA R TYN+ D + R T Q
Sbjct  415  MPVSHHDFIEIVFQNNEKSVQSMHLDGYDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT +   LDN GMWNLRS   +  YLGQQ Y+RV +   N A E   PSN LLCG
Sbjct  475  VYPNSWTTILASLDNQGMWNLRSAIWERQYLGQQFYLRVWNPVQNLANEYTIPSNALLCG  534



>ref|XP_009347241.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=541

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 146/300 (49%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q + DSLD+HVGQS SVLV+ +Q  +DYYIVA+ +         L A  +LHY 
Sbjct  242  EGSHTIQNSYDSLDIHVGQSVSVLVTLNQAPKDYYIVASTRFTRL----VLTATSVLHYT  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GP+P GP    + +S+ QA++ RWNLTA AARPNPQG+F+   +T ++T VL
Sbjct  298  NSHTSV-SGPVPAGPTG-QIHWSMEQARTFRWNLTANAARPNPQGSFHYGKVTPTKTIVL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY  N VSY  PDTP+KLADYF N  GV+ L+   T     +A     +
Sbjct  356  ANSAPLINGKQRYAFNRVSYVNPDTPVKLADYF-NIPGVFSLNSIQTAPSDGSASLATPV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +H  ++EIVFQN+   + S HLDG+   VVGYG G WTPA R TYN+ D + R T Q
Sbjct  415  MPVSHHDFIEIVFQNNEKSVQSMHLDGYDFWVVGYGSGPWTPAKRTTYNLVDTLTRHTAQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WT +   LDN GMWNLRS   +  YLGQQ Y+RV +   N A E   PSN LLCG
Sbjct  475  VYPNSWTTILASLDNQGMWNLRSAIWERQYLGQQFYLRVWNPVQNLANEYTIPSNALLCG  534



>ref|XP_011039229.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   265 bits (678),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 188/302 (62%), Gaps = 9/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q   +SLDVHVGQS +VLV  +   +DYYIVA+ +      T P L    +L Y
Sbjct  240  EGSHTMQEVYNSLDVHVGQSVTVLVKFNSAVKDYYIVASSRF-----TKPILTTTALLRY  294

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            AGS    P+ PLP GP  + + +S+ QA++IR NLTA AARPNPQG+F+   I + +T V
Sbjct  295  AGS-NTPPSLPLPIGPT-YHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTIKVVKTLV  352

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  +  +I G  RY VN +SY  P TPLKLAD++ N  GV+ L+   T  V   A  G S
Sbjct  353  LANTAEKINGKLRYAVNGISYVDPSTPLKLADWY-NIPGVFSLNSMKTTPVNTPAVLGTS  411

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V      ++EIVFQN+   + SWHL G   +VV YGD  W P+ R+ YN+ D V R TV
Sbjct  412  VVGTELHDFVEIVFQNNENTIQSWHLSGTSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTV  471

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWNLRS      YLGQQLY+RV +D+ +   E  PP N L C
Sbjct  472  QVYPTAWTAIYVSLDNKGMWNLRSAIWARRYLGQQLYVRVWNDERSLYTETDPPPNTLFC  531

Query  898  GM  903
            G+
Sbjct  532  GL  533



>gb|KHN36198.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   265 bits (678),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 191/301 (63%), Gaps = 7/301 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS +VLV+ +Q  +D YIVA+ +  E    +PL    +LHYA
Sbjct  239  EGSHTVQNLYDSLDVHVGQSVAVLVTLNQPPKDCYIVASTRFTE----TPLTTTAVLHYA  294

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S ++   GP+P  P D +D  +S+ QA++ RWNLTA AARPNPQG+F+   IT ++   
Sbjct  295  NSFSSA-LGPVPAPPVDKYDFDWSMKQARTYRWNLTANAARPNPQGSFHYGKITPTKVIK  353

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY  PDTPLKLADYF N  GV+ ++             G S
Sbjct  354  LANSAPLINGKLRYAVNSVSYVNPDTPLKLADYF-NIPGVFSVNLLQNSPSNGPGYIGTS  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   ++E++FQN+   M SWHLDG+   V+G+G G+WT A+R+TYN+ D + R T 
Sbjct  413  VLQTSLHDFIEVIFQNNENTMQSWHLDGYDFWVIGHGFGQWTDASRKTYNLVDALTRHTA  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQ Y+RV +   + A E   P+N+LLC
Sbjct  473  QVYPKSWTTILVSLDNQGMWNLRSAIWERQYLGQQFYLRVWNAQKSLANEYDIPNNVLLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_011018259.1| PREDICTED: monocopper oxidase-like protein SKU5 [Populus euphratica]
Length=592

 Score =   266 bits (681),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 191/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    ++   +    ILHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASTDYYIVASARFVNESQWKRVTGVAILHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPE P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  313  TNS-KGKAKGPLPEAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTDVY  371

Query  355  VLHGSK-GEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ +S+  P TP++LAD F    G Y+LD FP   +       
Sbjct  372  VLKNKPLVKINGKRRATLSGISFVNPTTPIRLADQF-KVKGAYKLD-FPETPLTGPPKMA  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+HL G+ + VVG   GEWT  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMHSYHLSGYAVFVVGMDYGEWTENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQ YPG WTA+ V LDN G+WNLR++++  WYLGQ+ Y+R+ + +     E P P N L
Sbjct  490  TVQAYPGAWTAILVSLDNVGVWNLRTENLDSWYLGQETYVRIVNPEKTNKTELPIPDNAL  549

Query  892  LCG  900
             CG
Sbjct  550  FCG  552



>ref|XP_011013815.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=537

 Score =   265 bits (677),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 188/302 (62%), Gaps = 9/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q   +SLDVHVGQS +VLV  +   +DYYIVA+ +      T P L    +L Y
Sbjct  240  EGSHTMQEVYNSLDVHVGQSVTVLVKFNSAVKDYYIVASSRF-----TKPILTTTALLRY  294

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            AGS    P+ PLP GP  + + +S+ QA++IR NLTA AARPNPQG+F+   I + +T V
Sbjct  295  AGS-NTPPSLPLPIGPT-YHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTIKVVKTLV  352

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  +  +I G  RY VN +SY  P TPLKLAD++ N  GV+ L+   T  V   A  G S
Sbjct  353  LANTAEKINGKLRYAVNGISYVDPSTPLKLADWY-NIPGVFSLNSMKTTPVNTPAVLGTS  411

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V      ++EIVFQN+   + SWHL G   +VV YGD  W P+ R+ YN+ D V R TV
Sbjct  412  VVGTELHDFVEIVFQNNENTIQSWHLSGTSFYVVAYGDNVWNPSMRKRYNLLDAVSRYTV  471

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWNLRS      YLGQQLY+RV +D+ +   E  PP N L C
Sbjct  472  QVYPTAWTAIYVSLDNKGMWNLRSAIWARRYLGQQLYVRVWNDERSLYTETDPPPNTLFC  531

Query  898  GM  903
            G+
Sbjct  532  GL  533



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 144/301 (48%), Positives = 191/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYY+VA+ +      TSP L   G +HY
Sbjct  242  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPGQDYYVVASSRF-----TSPILTTTGTVHY  296

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            A S  A  +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I  ++T+V
Sbjct  297  ANSAGAV-SGPPPGGPT-IQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINXNKTYV  354

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S
Sbjct  355  LENSAGQVNGKQRYGVNSVSFVPADTPLKLADYFKIG-GVFRVGSISDKPTGGGLYLDTS  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R+ YN+ D V R T 
Sbjct  414  VLGADYRTFVEIVFQNNEDIIQSWHLDGYSFFVVGMDGGQWTTASRDAYNLRDAVSRCTT  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+++ LDN GMWNLR++     YLGQQLY+RV+    +   E P P N  LC
Sbjct  474  QVYPKSWTAIHIALDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSLRDEFPIPRNARLC  533

Query  898  G  900
            G
Sbjct  534  G  534



>emb|CDY01453.1| BnaA07g12260D [Brassica napus]
Length=545

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 184/300 (61%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   +SLDVHVGQS SVLV+ +Q  +DYYIVA  +      TS L   G+L Y+
Sbjct  246  EGSHVLQNVYESLDVHVGQSLSVLVTLNQPSKDYYIVATSRY----TTSKLSVTGLLRYS  301

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G +P  P P DL +S+NQA+S RWNLTA AARPNPQG+F+   IT +++FV 
Sbjct  302  NS-GVPASGDMPP-PPPEDLDWSLNQARSFRWNLTANAARPNPQGSFHYGTITPTKSFVF  359

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLAD+F N  GV+  +               S+
Sbjct  360  SNSAPLINGKQRYAVNGVSYVNSDTPLKLADHF-NIPGVFSTNAIQRVPSSSPVTVATSV  418

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V  +   +LE+VFQN+   M SWHLDG+   VVG+G G+WTP  R  YN+ D + R T Q
Sbjct  419  VQASLHDFLEVVFQNNEESMQSWHLDGYDFWVVGFGSGQWTPEQRPLYNLVDALTRHTTQ  478

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y++V D   + A E  PP NLLLCG
Sbjct  479  VYPKSWTAILVSLDNQGMWNMRSAIWERQYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  538



>ref|XP_011081204.1| PREDICTED: monocopper oxidase-like protein SKU5 [Sesamum indicum]
Length=592

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/304 (46%), Positives = 195/304 (64%), Gaps = 8/304 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQ+YS LV+ DQ+   DYYIVA+ +         +   GILHY
Sbjct  252  EGSYTVQQNYTSLDIHVGQTYSFLVTMDQNASSDYYIVASARFVNETTWRRVTGVGILHY  311

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K +GPLP+ P D FD  +S+NQA+SIRWN+TA  ARPNPQG+F   +I +++ +
Sbjct  312  TNS-KGKASGPLPDPPQDQFDKTYSMNQARSIRWNVTASGARPNPQGSFRYGSINVTEVY  370

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLAD-YFVNGAGVYELDDFPTHSVKDAADY  528
            VL       I G  R  ++ +S+  P TP++LAD Y V GA  Y+LD FPT  +      
Sbjct  371  VLRNKPPVTIDGKRRTTLSGISFVNPSTPIRLADQYKVKGA--YKLD-FPTRPLTGPPRM  427

Query  529  GVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
              SI++GT++G++E++ QN+   + ++H+ G+   VVG   GEWT  +R TYN +D + R
Sbjct  428  ETSIINGTYRGFMEVILQNNDTKVQTYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIAR  487

Query  709  STVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNL  888
            +T QVYPG WTA+ + LDN G+WNLR++++  WYLGQ+ Y+RV + +PN   E P P N 
Sbjct  488  TTAQVYPGAWTAILISLDNVGVWNLRTENLDSWYLGQETYVRVINPEPNNKTEFPIPDNA  547

Query  889  LLCG  900
            L CG
Sbjct  548  LFCG  551



>ref|XP_006355491.1| PREDICTED: monocopper oxidase-like protein SKU5-like [Solanum 
tuberosum]
Length=598

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LVS DQ+   DYYIVA+ +    ++   +   GIL Y
Sbjct  259  EGSYTVQQNYTSLDIHVGQSYSFLVSMDQNASSDYYIVASARFVNQSQWQRVTGVGILKY  318

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLPE P D FD  FS+NQA+SIRWN+TA  ARPNPQG+F   +I +++ +
Sbjct  319  TNS-KGKAHGPLPEPPQDEFDKTFSMNQARSIRWNVTASGARPNPQGSFRYGSINVTEIY  377

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            V+  +  + + G  R  +N +S+  P TP++LAD +    GVY+LD FPT  +       
Sbjct  378  VVQNTPPQMVDGKRRTTLNGISFVNPKTPIRLADQY-KLKGVYKLD-FPTAPLTGPPKME  435

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++EI+ QN+   M ++H+ G+ + VVG   G W+  +R TYN +D + R+
Sbjct  436  TSIINGTYRGFMEIILQNNDTKMHTYHMSGYAVFVVGMDFGVWSNNSRGTYNKWDGIART  495

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN G+WNLR++++  W+LGQ+ YIRV + +P    E P P N L
Sbjct  496  TTQVFPGAWTAILVSLDNVGVWNLRTENLDSWFLGQETYIRVVNSEPTNKTELPMPDNTL  555

Query  892  LCG  900
             CG
Sbjct  556  FCG  558



>ref|XP_008806480.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=542

 Score =   265 bits (677),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLDVH+GQSYSVLV+ADQ   DYYIV + +      ++ L    +LHY+
Sbjct  240  EGSHTLQNTYSSLDVHLGQSYSVLVTADQPPSDYYIVVSTRF----TSTALTTTSVLHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   KP  P P GP   ++  S+NQA+SIRWNLTA   RPNPQG+++   +  ++T  L
Sbjct  296  NSFR-KPVDPPPGGPTT-EIDLSVNQARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VS+   DTPLKLAD++    GV+ L   P +          S+
Sbjct  354  ANSAPIINGKQRYAVNSVSFIPADTPLKLADFY-KIPGVFSLGSIPDNPTFGGGYLQTSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++   +G++EIVF+N+   + SWH+DG+   VVG   G+WT A+RE+YN+ D V R TVQ
Sbjct  413  MAADFRGYVEIVFENYEDTLQSWHIDGYSFWVVGMDGGQWTAASRESYNLRDAVNRCTVQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVY+ LDN GMWN+RS++    YLGQQ YIRV+    +   E P P N LLCG
Sbjct  473  VYPKGWTAVYMALDNVGMWNVRSENWARQYLGQQFYIRVYSPANSWRDEYPIPRNALLCG  532



>ref|XP_006396765.1| hypothetical protein EUTSA_v10028533mg [Eutrema salsugineum]
 gb|ESQ38218.1| hypothetical protein EUTSA_v10028533mg [Eutrema salsugineum]
Length=585

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARIVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I+G  R  ++ VS+  P TP++LAD      GVY+LD FP   +       
Sbjct  368  VLRNMPPVKIKGKRRTTLSGVSFVNPSTPIRLADKH-KVKGVYKLD-FPKRPLTGPPRAS  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++ QN+   M S+H+ G+    VG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVILQNNDTKMQSYHMSGYAFFAVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P+N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGAPANVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>dbj|BAK00320.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 200/310 (65%), Gaps = 12/310 (4%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLDVHVGQSYS L++ DQ+   DYY+VA+ ++   +    +    +L Y
Sbjct  246  EGSYTTQQNYTSLDVHVGQSYSFLLTTDQNASSDYYVVASARMVNESLWQRVTGVAVLRY  305

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S  A  +GPLP  P D FD   S+NQA+S+RWNL+AGAARPNPQG+F   +I ++Q +
Sbjct  306  SNSGGAA-SGPLPNPPQDQFDKTLSMNQARSVRWNLSAGAARPNPQGSFRYASINVTQAY  364

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLAD-YFVNGAGVYELDDFPTHSVKDAA--  522
            +L  +   EI G  R  +N +S+  P+TPL+LAD Y V GA  Y LD FP     DAA  
Sbjct  365  LLRSTAPVEIGGKRRAALNGLSFSPPETPLRLADAYGVEGA--YTLD-FPDRPDPDAAAR  421

Query  523  -DYGVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDP  699
                 S+++GT++G++E++FQN+   M S+H+DG+ + VVG   GEWT  +R TYN  D 
Sbjct  422  PRVARSVINGTYRGFMELIFQNNDTRMQSYHVDGYAVFVVGMDYGEWTEGSRGTYNKGDS  481

Query  700  VVRSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPP  876
            V RSTVQVYPG WTAV V LDN G WN+RSQ++  WYLGQ++Y+R V+ +D     E   
Sbjct  482  VARSTVQVYPGAWTAVLVSLDNVGFWNVRSQNLDSWYLGQEVYVRVVNPEDGADKTEMAV  541

Query  877  PSNLLLCGMF  906
            P N L CG  
Sbjct  542  PRNALFCGQL  551



>ref|XP_009769792.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=538

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/300 (49%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DS DVHVGQS S+LV+ DQ  +DYYIVA+        T+ L    +LHY 
Sbjct  239  EGSHVIQNLYDSFDVHVGQSLSILVTLDQPPKDYYIVAS----TRFTTTVLTTTAVLHYT  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +GP+P GP P   Q+S+ QA++ RWNLT+ AARPNPQG+F+   IT S+T VL
Sbjct  295  NSQTAV-SGPVPAGP-PDQFQWSLMQARTFRWNLTSNAARPNPQGSFHYGKITPSRTIVL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLAD+F N  GV+ L+   T     +     S+
Sbjct  353  ANSAPLISGKQRYAVNSVSYVNPDTPLKLADHF-NIPGVFSLNSIQTVPTAASPSLATSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +  +   +LEIVFQN+   + SWHLDG+   V+G+G G W   +R+ YN+ D + R T Q
Sbjct  412  LPASLHEFLEIVFQNNEDTVQSWHLDGYDFWVIGFGSGTWMQDSRKEYNLVDALTRHTTQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLRS      YLGQQ+Y+RV++  P+ A E   P+N LLCG
Sbjct  472  VYPKSWTAIYVSLDNQGMWNLRSAIWDRQYLGQQVYLRVYNPTPSLANEYDIPTNALLCG  531



>ref|XP_003608760.1| Monocopper oxidase-like protein SKU5 [Medicago truncatula]
 gb|AES90957.1| monocopper oxidase SKS1-like protein [Medicago truncatula]
Length=590

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 195/303 (64%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ +    +    +   GILHY
Sbjct  251  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESRWQRVTGVGILHY  310

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K  G LP GPD  FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  311  SNS-KGKARGHLPPGPDDQFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTEIY  369

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ +S+  P TP++LAD++    GVY+LD FPT  +  +    
Sbjct  370  VLKNKPPVKIDGKRRATLSGISFANPATPIRLADHY-KLKGVYKLD-FPTKPLTGSPRVE  427

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++G+ +G++EI+ QN+   M ++HL G+   VVG   G+W+  +R TYN +D + RS
Sbjct  428  TSVINGSFRGFMEIILQNNDTKMHTYHLSGYAFFVVGMDFGDWSENSRGTYNKWDGIARS  487

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QVYPG WTAV V LDN G+WNLR++++  WYLGQ+ YIRV + +P    E P P N L
Sbjct  488  TAQVYPGAWTAVLVSLDNVGVWNLRTENLDSWYLGQETYIRVVNPEPTNKTELPMPDNAL  547

Query  892  LCG  900
             CG
Sbjct  548  KCG  550



>ref|XP_010455683.1| PREDICTED: monocopper oxidase-like protein SKU5 [Camelina sativa]
Length=586

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASADYYIVASARVVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  +  +N +S++ P TP++LAD  +   GVY+LD FP   +       
Sbjct  368  VLRNMPPVMINGKRKTTLNGISFKNPSTPIRLADK-LKVKGVYKLD-FPKRPLTGPPKVE  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_007155969.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
 gb|ESW27963.1| hypothetical protein PHAVU_003G247700g [Phaseolus vulgaris]
Length=543

 Score =   264 bits (675),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 187/301 (62%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   D+LDVHVGQS +VLV+ +Q  +DYYIVA+ +      T    A  +LHY+
Sbjct  241  EGSHTLQNVYDTLDVHVGQSATVLVTLNQPPKDYYIVASTRFSRKMFT----ATAVLHYS  296

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GPLP  P      +S+ QA++ RWNLTA AARPNPQG+++   IT ++T VL
Sbjct  297  NS-NSPASGPLPS-PPIHQYHWSVKQARTYRWNLTANAARPNPQGSYHYGEITPTKTIVL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTH-SVKDAADYGVS  537
              S   I G  RY VN VSY  PDTPLKLADYF N  G+Y +D   +  S    +    S
Sbjct  355  SNSASLINGKLRYTVNKVSYVNPDTPLKLADYF-NIPGIYSVDSLQSLPSDNTPSSVATS  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V      ++E+VFQN+     SWHLDG+   VVGYG GEWTPA R TYN+ D + R T 
Sbjct  414  VVPTDLHDFIEVVFQNNENTTQSWHLDGYDFWVVGYGFGEWTPAKRRTYNLVDALTRHTA  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WT + V LDN GMWNLRS   +  YLGQQLY+RV   + + A E   P N+LLC
Sbjct  474  QVYPNAWTGILVSLDNQGMWNLRSAMWERQYLGQQLYLRVWTSERSLANEYDIPDNVLLC  533

Query  898  G  900
            G
Sbjct  534  G  534



>gb|EMT17309.1| Monocopper oxidase-like protein SKU5 [Aegilops tauschii]
Length=821

 Score =   270 bits (691),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 144/306 (47%), Positives = 197/306 (64%), Gaps = 9/306 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPK-LHEANETSPLVAKGILH  174
            EGSYT+Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ + + +      L    ILH
Sbjct  109  EGSYTSQQNYSNMDIHVGQSYSFLVTMDQNASTDYYVVASARFVTDPGAVDKLTGVAILH  168

Query  175  YAGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQT  351
            Y+ S     +GPLP  PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  
Sbjct  169  YSNS-QGPASGPLPAAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDV  227

Query  352  FVLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADY  528
            ++L     E I G  R  +N +SY  P TPL LA  F N  GV++LD FP H +      
Sbjct  228  YLLQSQPPELIDGQLRSTINGISYIAPSTPLILAQLF-NVPGVFKLD-FPNHPMNRLPKV  285

Query  529  GVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVR  708
              S+++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V R
Sbjct  286  DTSVINGTYKGFMEIIFQNNATTVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVAR  345

Query  709  STVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRV--HDDDPNPAKEKPPPS  882
            ST+QV+PG WTAV VFLDN G+WNLR +++  WY+GQ+LYI V   ++D +     P P 
Sbjct  346  STIQVFPGAWTAVLVFLDNAGIWNLRVENLDSWYMGQELYISVVNPEEDHSDKTPLPLPD  405

Query  883  NLLLCG  900
            N + CG
Sbjct  406  NTIFCG  411



>ref|XP_009134269.1| PREDICTED: monocopper oxidase-like protein SKU5 [Brassica rapa]
 emb|CDX90830.1| BnaA03g25100D [Brassica napus]
Length=585

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARIVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  309  TNS-KGKATGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTEVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ +S+  P TP++LAD      GVY+LD FP   +       
Sbjct  368  VLRNMPPVKINGKRRTTLSGISFVNPSTPIRLADKH-KVKGVYKLD-FPKRPLTGPPRRE  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++ QN+   M S+H+ G+    VG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVILQNNDTKMQSYHMSGYAFFAVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P+N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGAPANVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_010422207.1| PREDICTED: monocopper oxidase-like protein SKU5 [Camelina sativa]
Length=586

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASADYYIVASARVVNQTIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  +  +N +S++ P TP++LAD  +   GVY+LD FP   +       
Sbjct  368  VLRNMPPVMINGKRKTTLNGISFKNPSTPIRLADK-LKVKGVYKLD-FPKRPLTGPPKVE  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_010241477.1| PREDICTED: monocopper oxidase-like protein SKU5 [Nelumbo nucifera]
Length=597

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/302 (45%), Positives = 192/302 (64%), Gaps = 5/302 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DYY+VA+ +   ++         ILHY
Sbjct  256  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQNASSDYYVVASARFVNSSVGDRASGVAILHY  315

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S      GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  ++
Sbjct  316  SNS-QGPVLGPLPDPPNEYDTYFSMNQARSIRWNVSAGAARPNPQGSFRYGQITVTDVYI  374

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            L     E I G  R  +N +SY  P TPL+LA  F N  GV++LD FP   +   A    
Sbjct  375  LLNRPAELINGKWRTTLNGISYFAPATPLRLAQQF-NIPGVFKLD-FPNRMMNRPAKVDT  432

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT++G++EI+ QN+   + S+H+DG+   VVG   G WT  +R TYN +D V R T
Sbjct  433  SVINGTYRGFMEIILQNNDTTVQSYHMDGYAFFVVGMDYGVWTENSRGTYNKWDGVARCT  492

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR Q++  WYLGQ++Y+ V + + N   E P P N + 
Sbjct  493  TQVFPGAWTAILVSLDNVGIWNLRVQNLDSWYLGQEVYVSVVNPEVNDKTELPLPDNTIF  552

Query  895  CG  900
            CG
Sbjct  553  CG  554



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 188/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T +SLD+HVGQSYSVLV+ADQ  +DYYI  + +      +  L +  + HY+
Sbjct  235  EGTHTIQTTYESLDIHVGQSYSVLVTADQAPQDYYIAVSTRF----TSQVLTSTAVFHYS  290

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A + +GP+P GP      +S++QA SIR NLTA   RPNPQG+++   + +S+T  L
Sbjct  291  NS-ARQVSGPIPAGPTT-QTGWSLSQALSIRTNLTASGPRPNPQGSYHYGLVNVSRTIKL  348

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN+VS+   DTPLKLADYF  G GV+++     +          S+
Sbjct  349  ESSAAQVSGKQRYAVNSVSFIPADTPLKLADYFKIG-GVFKVGSISDNPTGQKMYLDTSV  407

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWHLDG+   VVG   G+WTPA+R  YN+ D V RST Q
Sbjct  408  MGADFRAFVEIVFQNHENIVQSWHLDGYSFWVVGMDGGKWTPASRNKYNLRDAVSRSTTQ  467

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLRS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  468  VYPKSWTAIYIALDNVGMWNLRSEFWARQYLGQQFYLRVYSPVESARDEYPIPRNALLCG  527



>ref|XP_009407151.1| PREDICTED: monocopper oxidase-like protein SKU5 [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 201/306 (66%), Gaps = 7/306 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EG+YT Q    +LD+HVGQSYS L++ DQ+   DYYIVA+ +    +  + +    ILHY
Sbjct  259  EGTYTVQQNYTNLDIHVGQSYSFLITMDQNASSDYYIVASARFVNESLWTRVTGVAILHY  318

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K AGPLP+ P+ F D  FS+NQA+SIR N++AGAARPNPQG+F   +I ++Q +
Sbjct  319  SNS-KGKAAGPLPDPPNDFYDKTFSMNQARSIRTNVSAGAARPNPQGSFRYGSINVTQVY  377

Query  355  VLHGSKGEI-RGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      I  G  R +++ +SY  P TPL+LAD F +  GVY LD FPT  +      G
Sbjct  378  VLRNMPPVIINGKRRTVLSGISYSPPATPLRLADEF-DKQGVYTLD-FPTRPLDRPPRLG  435

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++EI+FQN+   + ++H+DG+   VVG   GEWT  +R TYN +D V R 
Sbjct  436  TSVINGTYRGFMEIIFQNNDTTVQTYHMDGYAFFVVGMDYGEWTENSRGTYNKWDGVSRC  495

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAK-EKPPPSNL  888
            T QV+PG WTAV V LD+ G WN+R +++  WYLGQ++Y+RV + + N  K E P P N+
Sbjct  496  TTQVFPGAWTAVLVSLDSVGFWNVRVENLDTWYLGQEVYVRVVNPEDNSNKTELPMPDNV  555

Query  889  LLCGMF  906
            L CG+ 
Sbjct  556  LYCGLL  561



>ref|XP_010906622.1| PREDICTED: monocopper oxidase-like protein SKU5 [Elaeis guineensis]
Length=594

 Score =   265 bits (678),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/305 (45%), Positives = 199/305 (65%), Gaps = 6/305 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EG+YT Q    +LD+HVGQSYS LV+ DQ+   DYYIVA+ +    +  + +    ILHY
Sbjct  252  EGTYTMQQNYTNLDIHVGQSYSFLVTMDQNASSDYYIVASARFVNESLWTRVTGVAILHY  311

Query  178  AGSVAAKPAGPLPEGPDPF-DLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S   K +GPLP+GP+ F D  +S+NQA+SIR N+++GAARPNPQG+F   +I ++Q +
Sbjct  312  SNS-KGKASGPLPDGPNDFYDKTWSMNQAQSIRTNVSSGAARPNPQGSFRYGSINVTQVY  370

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  R  +N +SY  P TPL+LAD + +  G+Y LD FPT  +       
Sbjct  371  VLRNKPPVVIDGKRRTTLNGISYSPPATPLRLADEY-DKKGIYTLD-FPTRPLDGPPRIA  428

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT+KG++EI+FQN+  ++ ++H+DG+   VVG   GEWT  +R  YN +D V R 
Sbjct  429  ASVINGTYKGFMEIIFQNNDTIVQTYHMDGYAFFVVGMAYGEWTEDSRSQYNKWDGVSRC  488

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTAV V LDN G WN+R++++  WYLGQ++YI+V + + +   E P P N L
Sbjct  489  TTQVFPGAWTAVLVSLDNVGFWNVRAENLDTWYLGQEVYIKVVNPESSDKTESPIPDNAL  548

Query  892  LCGMF  906
             CG+ 
Sbjct  549  YCGVL  553



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL++ADQ  +DYYIV + +      +  L   G+LHY+
Sbjct  240  EGTHTLQTTYSSLDVHVGQSYSVLITADQPGQDYYIVVSSRF----TSQILTTTGVLHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A P    P G     + +S+NQA+SIR NLTA   RPNPQG+++   I  S+T + 
Sbjct  296  NS--AGPVSGSPPGGPTIQVDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIIF  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VSY  PDTPLKLAD+F    GV++ +               S+
Sbjct  354  ASSAGQVNGKQRYAVNSVSYIQPDTPLKLADFF-KIQGVFKENSISDRPYGGGIYLDTSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  ++ ++EIVFQN   ++ SWHLDG+   VVG   G+WT A+R  YN+ D + R T Q
Sbjct  413  LTVDYRAFVEIVFQNDEDIVQSWHLDGYSFFVVGMDGGQWTTASRNQYNLRDAIARCTTQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLR++     YLGQQLY+RV+    +   E P P N LLCG
Sbjct  473  VYPKSWTAIYVPLDNVGMWNLRTEFWARQYLGQQLYLRVYTTSTSLRDEFPIPKNALLCG  532



>ref|XP_010052867.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW76996.1| hypothetical protein EUGRSUZ_D01344 [Eucalyptus grandis]
Length=544

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T D+LD+H+GQSYSVLV ADQ  +DYY+V + +         L    +LHY+
Sbjct  242  EGSHTLQNTYDALDIHLGQSYSVLVMADQQPQDYYVVVSSRF----TPRVLTTTAVLHYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GP+P GP P  + +S++QA+SIRWNLTA   RPNPQG+++   I  S+T +L
Sbjct  298  NSRQGV-SGPVPAGP-PNHIAWSLSQARSIRWNLTASGPRPNPQGSYHYGMIKTSRTIML  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN  S+   DTPLKLAD+F N AGV+ L   PT     +     S+
Sbjct  356  ANSAPIINGKQRYAVNGASFVPADTPLKLADHF-NIAGVFNLGSMPTSPNSGSGYLQTSV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +S   + ++EIVFQN    + SWH+DG+   V+G   G+WTPA+R  YN+ D V R T Q
Sbjct  415  MSTNFREYVEIVFQNWENTVQSWHIDGYSFFVMGMDGGQWTPASRSRYNLRDTVARCTTQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            V+P  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+ +  +   E P P N LLCG
Sbjct  475  VFPKSWTAIYMALDNVGMWNIRSEDWARQYLGQQFYMRVYTNSNSYRDELPIPKNALLCG  534



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ DQ  +D+YI  + +         L + G LHY+
Sbjct  243  EGTHTIQTTYSSLDVHVGQSYSVLVTMDQPPQDFYIAVSTRF----TNKVLTSTGTLHYS  298

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GP+P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I +S+T  L
Sbjct  299  NS-AHPVSGPVPGGPTT-QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIKL  356

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S+
Sbjct  357  ESSAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIG-GVFRVGSIQDQPTGGNIYLDTSV  415

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    +G++EIVFQNH  ++ SWH+DG+   VVG   G WTPA+R  YN+ D V R T Q
Sbjct  416  MGADFRGFIEIVFQNHENIVQSWHIDGYNFWVVGMNGGVWTPASRNEYNLRDAVSRCTTQ  475

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  476  VYPKSWTAIYVALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCG  535



>ref|XP_008440923.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34061.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=542

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 188/301 (62%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q T  SLD+H+GQSYSVLV+A+Q  +DYY+V + +      TSP L    +LHY
Sbjct  240  EGSHTLQNTYSSLDIHLGQSYSVLVTANQPPKDYYVVVSSRF-----TSPILTTTAVLHY  294

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S   K +GP+P GP   ++ +S+ QA+SIRWNLTA   RPNPQG+++   I  S+T V
Sbjct  295  SNS-WQKVSGPVPGGPTT-EIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIV  352

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  R+ VN VS+   DTPLKLADYF    GV+ L+  PT+     A    S
Sbjct  353  LANSAPVINGKQRFAVNGVSFVQADTPLKLADYF-KIPGVFNLNSIPTNPTWGNAYLQTS  411

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++    + ++EIVFQN    + SWH+ G+   VVG   G+WTPA+R  YN+ D V R T 
Sbjct  412  VMGSNFREYIEIVFQNWENTVQSWHISGYSFFVVGMDGGQWTPASRGRYNLRDTVARCTT  471

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLC
Sbjct  472  QVYPKAWTAIYMALDNVGMWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLC  531

Query  898  G  900
            G
Sbjct  532  G  532



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 183/300 (61%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q    SLDVHVGQSYSVLV+ADQ  +DYYI  + +      +  L    ILHY+
Sbjct  245  EGTHTLQTVFSSLDVHVGQSYSVLVTADQPAQDYYIAVSTRF----TSVVLTTTAILHYS  300

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             SV      P P GP  F + +S+NQA SIR NLTA   RPNPQG+++   I +++T  L
Sbjct  301  NSVGRVSGSP-PAGPT-FQIDWSLNQALSIRTNLTASGPRPNPQGSYHYGLINITRTIRL  358

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G I G  RY VN VS+   DTPLKLADYF  G GV+ L     +          S+
Sbjct  359  ANSAGLINGKQRYAVNGVSFVPADTPLKLADYFKIG-GVFRLGSISDNPTGGQRYLDTSV  417

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVF+NH +++ SWHLDG+   VVG   G+WTP +R+ YN+ D +VR T Q
Sbjct  418  MPADFRAFVEIVFENHESIVQSWHLDGYSFFVVGMDGGKWTPTSRKQYNLRDAIVRCTTQ  477

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLR++     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  478  VYPKSWTAIYVALDNVGMWNLRTEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLCG  537



>ref|XP_010433470.1| PREDICTED: monocopper oxidase-like protein SKU5 [Camelina sativa]
Length=587

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASADYYIVASARVVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL       I G  +  +N +S++ P TP++LAD  +   GVY+LD FP   +       
Sbjct  368  VLRNMPPVMINGKRKTTLNGISFKNPSTPIRLADK-LKVKGVYKLD-FPKRPLTGPPKVE  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E+V QN+   M S+H+ G+   VVG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVVLQNNDTKMQSYHMSGYAFFVVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGHPDNVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_002962196.1| hypothetical protein SELMODRAFT_403803 [Selaginella moellendorffii]
 gb|EFJ37456.1| hypothetical protein SELMODRAFT_403803 [Selaginella moellendorffii]
Length=560

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 187/301 (62%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT +   DSLD+H+GQSYSVLV+ DQ   DYYIVA+ K    +    L    ILHY 
Sbjct  247  EGSYTAKTCFDSLDIHLGQSYSVLVTMDQSPADYYIVASTKFSSGS----LNGVAILHYQ  302

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +G +P GPDP D+ FS+NQA SI+WNLT GAARPNPQG+++   I +++   L
Sbjct  303  NSNTAA-SGTIPAGPDPLDVNFSLNQALSIKWNLTTGAARPNPQGSYHYGQIPITRVIQL  361

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   +    R+ +N  SY TPDTPLKLAD++ N  GV+      T +V        S+
Sbjct  362  SSSSVTLNNQARFAINGQSYLTPDTPLKLADFY-NIDGVFTRGSMRTSAVGSPV-METSV  419

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGE-WTPAARETYNVYDPVVRSTV  717
            +   +K ++E+VF N    + SWHLDG    VVG+G  E W+P++R  YN+ D V RST 
Sbjct  420  LELDYKSFVELVFVNPENEIQSWHLDGMSFWVVGFGFNETWSPSSRSKYNLVDAVSRSTT  479

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTA+   +DN GMWN+RSQ ++  YLGQ+ Y RV + + +   E   P N+LLC
Sbjct  480  QVYPRGWTAILFSVDNVGMWNIRSQCLRRQYLGQEGYARVFNPENSTRTETWIPQNVLLC  539

Query  898  G  900
            G
Sbjct  540  G  540



>gb|KCW57990.1| hypothetical protein EUGRSUZ_H00721 [Eucalyptus grandis]
Length=437

 Score =   261 bits (666),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/305 (47%), Positives = 197/305 (65%), Gaps = 10/305 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ+   DY++ A+P  + + + S      +LHY
Sbjct  97   EGSYTVQQIYTNMDIHVGQSYSFLVTMDQNASTDYFVFASPSFNSS-KFSKAAGVAVLHY  155

Query  178  AGSVAAKPA-GPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S    PA GPLP GP   D   S+NQA+SIRWN++AGAARPNPQG+F   +IT++  +
Sbjct  156  SNSQG--PALGPLP-GPGESDAYVSMNQARSIRWNVSAGAARPNPQGSFRYGDITVTDVY  212

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            V+     E I G  R  +N +SY  P TPLKLA  F N  G+Y+LD FP   +   A   
Sbjct  213  VILNRSPELINGKWRTTLNGISYLPPSTPLKLAQQF-NLLGLYKLD-FPNRLMNRPAKLD  270

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT+KG+LEI+FQN+   + S+HLDG+   VVG   G WT ++R TYN +D V RS
Sbjct  271  TSLINGTYKGFLEIIFQNNGTNVQSYHLDGYAFFVVGMDFGVWTESSRTTYNKWDGVARS  330

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T QV+PG WTA+ V LDN G+WNLR++++  WYLGQ+LY+ V + + N   E   P N +
Sbjct  331  TTQVFPGAWTAILVSLDNAGIWNLRTENLDSWYLGQELYMSVVNQE-NDTNEFQLPDNTI  389

Query  892  LCGMF  906
             CG+ 
Sbjct  390  YCGVL  394



>gb|EEE53691.1| hypothetical protein OsJ_00004 [Oryza sativa Japonica Group]
Length=569

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 196/304 (64%), Gaps = 9/304 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    ++D+HVGQSYS L++ DQ+   DYY+VA+ +     +   L    ILHY
Sbjct  234  EGSYTSQQNYTNMDIHVGQSYSFLLTMDQNASTDYYVVASARF--VPDADKLTGVAILHY  291

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S    P+G LP+ PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  292  SNS-QGPPSGSLPDAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  350

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GVY+LD FP   +       
Sbjct  351  LLQSMPPELIDGQMRATLNGISYIAPSTPLMLAQLF-NVPGVYKLD-FPNRPMNRLPKLD  408

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  409  TSIINGTYKGFMEIIFQNNATSVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVARS  468

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            T+QV+PG WTAV VFLDN G+WNLR +++  WYLGQ++YI  V+ +D +     P P N 
Sbjct  469  TIQVFPGAWTAVLVFLDNAGIWNLRVENLDAWYLGQEVYISVVNPEDSSNKTVLPLPDNA  528

Query  889  LLCG  900
            + CG
Sbjct  529  IFCG  532



>ref|XP_002532575.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF29809.1| multicopper oxidase, putative [Ricinus communis]
Length=593

 Score =   265 bits (677),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 192/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQS+S LV+ DQ+   DYYIVA+ +    ++   +    +LHY
Sbjct  253  EGSYTVQQNYTSLDIHVGQSFSFLVTMDQNASSDYYIVASARFVNESQWRRVTGVAVLHY  312

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  GPLP+ P D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I +++ +
Sbjct  313  TNS-KGKAKGPLPDAPNDEFDKTFSMNQARSIRWNVSASGARPNPQGSFRYGSINVTEVY  371

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L       I G  R  ++ +S+  P TP++LAD F    GVY+LD FPT  +       
Sbjct  372  LLKNKPPVTINGKKRTTLSGISFVNPSTPIRLADQF-KVKGVYKLD-FPTKPLTGPPKME  429

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             S+++GT++G++E++ QN+   M S+H+ G+   VVG   GEW+  +R TYN +D + RS
Sbjct  430  TSVINGTYRGFMEVILQNNDTKMQSYHMSGYAFFVVGMDYGEWSENSRGTYNKWDGIARS  489

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            TVQVYPG W A+ V LDN G+WNLR++++  WYLGQ+ Y+RV + +     E P P N L
Sbjct  490  TVQVYPGAWAAILVSLDNVGVWNLRTENLDSWYLGQETYVRVVNPEATNKTELPLPENAL  549

Query  892  LCG  900
             CG
Sbjct  550  YCG  552



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T DSLD+HVGQSYSVLV+ADQ  +DYYI  + +      +  L +  + HY+
Sbjct  235  EGTHTIQTTYDSLDIHVGQSYSVLVTADQAPQDYYIAVSTRF----TSKVLTSTAVFHYS  290

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   + +GP+P GP      +S++QA SIR NLTA   RPNPQG+++   + +S+T  L
Sbjct  291  NS-GRQVSGPIPAGPTT-QTGWSLSQALSIRTNLTASGPRPNPQGSYHYGLVNVSRTIKL  348

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN+VS+   DTPLKLADYF  G GV+++     +          S+
Sbjct  349  ESSAAQVSGKQRYAVNSVSFIPADTPLKLADYFKIG-GVFKVGSISDNPTGQKMYLDTSV  407

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWHLDG+   VVG   G+WTPA+R  YN+ D V RST Q
Sbjct  408  MGADFRAFVEIVFQNHENIVQSWHLDGYSFWVVGMDGGKWTPASRNEYNLRDAVSRSTTQ  467

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLR++     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  468  VYPKSWTAIYIALDNVGMWNLRTEFWARQYLGQQFYLRVYSPAESARDEYPTPRNALLCG  527



>ref|XP_002978641.1| hypothetical protein SELMODRAFT_418427 [Selaginella moellendorffii]
 gb|EFJ20088.1| hypothetical protein SELMODRAFT_418427 [Selaginella moellendorffii]
Length=588

 Score =   265 bits (676),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 145/304 (48%), Positives = 193/304 (63%), Gaps = 7/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANET--SPLVAKGILH  174
            EGSYT Q   DS+D+ VGQSYS L++   +  DYYIVA+P+    NET  + +   G+LH
Sbjct  246  EGSYTVQQPYDSIDIFVGQSYSFLLNCTANASDYYIVASPRF-VGNETEWANITGVGVLH  304

Query  175  YAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            Y  S  A   GPLPEGP  +D  +S+NQA+ +R NLT GAARPNPQG+F+   I ++QTF
Sbjct  305  YLDS-KALVNGPLPEGPSIYDGGWSVNQARQLRRNLTTGAARPNPQGSFHYGQINVTQTF  363

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            VL  +   I G  R+ VN  S+  P TPL LAD + N  G+Y+L+ FP  +         
Sbjct  364  VLTSTAVSIAGKRRFAVNGFSFEVPSTPLLLADEY-NITGLYKLNSFPEKAGSVVPGLQT  422

Query  535  SIVSGTHKGWLEIVFQN-HLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
            S+V+ T+ G+LEIVFQN     + SWH+DG+   VVGYG G+WT   R  YN +D V RS
Sbjct  423  SVVNATYAGFLEIVFQNPDNNSVQSWHVDGYAAFVVGYGPGQWTENDRGQYNKWDAVSRS  482

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEK-PPPSNL  888
            TVQV+PG WTA+ + LDN G+WN+RS+ +   YLGQ++Y+ V+D   N      P P N+
Sbjct  483  TVQVFPGSWTAIQISLDNVGLWNIRSEDLVRHYLGQEIYMFVNDPSDNIKNTAFPKPDNV  542

Query  889  LLCG  900
            L CG
Sbjct  543  LYCG  546



>ref|XP_010558427.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=539

 Score =   263 bits (673),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLD+HVGQS S+LV+ +Q  +DYYI+A+ +         L   G+L Y+
Sbjct  240  EGSHVIQTDYDSLDIHVGQSLSILVTLNQSPKDYYIMASTRFTR----RVLSVTGLLRYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +G LP+ P P +L +S+ QA++ RWNLTA AARPNPQG+F+   IT ++ FV 
Sbjct  296  NS-RAPASGSLPD-PPPGELVWSMRQARTFRWNLTANAARPNPQGSFHYGKITPTKMFVF  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLADYF N AGV+  +          A    S+
Sbjct  354  SNSAPLINGKQRYAVNGVSYLNSDTPLKLADYF-NIAGVFSTNAIQRVPSNSPATVATSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V      ++E+VFQN+   + SWHLDG+   VVG+G G+WTPA R  YN+ D + R T Q
Sbjct  413  VQTNLHDFIEVVFQNNERTVQSWHLDGYDFWVVGFGSGQWTPAKRSLYNLKDALTRHTTQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y++V +   + A E  PP NLLLCG
Sbjct  473  VYPNSWTAILVSLDNQGMWNMRSAIWERQYLGQQFYLKVWNPIQSLANEYNPPDNLLLCG  532



>gb|EYU46107.1| hypothetical protein MIMGU_mgv1a003243mg [Erythranthe guttata]
Length=597

 Score =   265 bits (677),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/304 (47%), Positives = 194/304 (64%), Gaps = 6/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQD   DYYIVA+P+   A+  +      ILHY
Sbjct  257  EGSYTVQQNYSNMDIHVGQSYSFLVTMDQDASTDYYIVASPRFVNASTWTKASGVAILHY  316

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P  +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  317  SNS-RGPASGPLPDPPHEYDTFFSMNQARSIRWNVSAGAARPNPQGSFRYGQITVTDVYV  375

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E + G  R  +N +SY  P TPL+LA  F    GV++LD FP   +   A    
Sbjct  376  ILNRPPELVDGKWRNTLNGISYIAPSTPLRLAQQF-KVDGVFKLD-FPNRFMNRPAKMDT  433

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+HLDG    VVG   G WT  +R TYN +D V RST
Sbjct  434  SVINGTFKGFMEIIFQNNDTSVQSYHLDGHAFFVVGMDYGVWTENSRSTYNKWDGVARST  493

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLR+Q++  WYLGQ+ YI V + + N   E   P N++ 
Sbjct  494  TQVFPGAWTAILVSLDNAGIWNLRTQNLDSWYLGQESYISVVNPE-NDNDEVQLPDNVIY  552

Query  895  CGMF  906
            CG+ 
Sbjct  553  CGVL  556



>gb|EMT23980.1| Monocopper oxidase-like protein SKU5 [Aegilops tauschii]
Length=621

 Score =   265 bits (678),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 202/308 (66%), Gaps = 10/308 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLDVHVGQSYS L++ DQ+   DYY+VA+ ++   +    +    +L Y
Sbjct  240  EGSYTTQQNYTSLDVHVGQSYSFLLTTDQNASSDYYVVASARIVNESLWQRVTGVAVLRY  299

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S  A  +GPLP+ P D +D   S+NQA+S+RWNL+AGAARPNPQG+F  ++I ++Q +
Sbjct  300  SNSGGAA-SGPLPDPPQDQYDKTLSMNQARSVRWNLSAGAARPNPQGSFRYSSINVTQAY  358

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLAD-YFVNGAGVYELDDFPTHSVKDAA-D  525
            +L  +   EI G  R  +N +S+  P+TPL+LAD Y V GA  Y LD FP     DAA  
Sbjct  359  LLRSTTPVEIGGRRRAALNGLSFSPPETPLRLADAYGVEGA--YTLD-FPERPPPDAAPR  415

Query  526  YGVSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVV  705
               S+++GT++G++E++FQN+   M S+H+DG+ + VVG   GEWT A+R  YN  D V 
Sbjct  416  VARSVINGTYRGFMELIFQNNDTRMQSYHVDGYAVFVVGMDYGEWTEASRGAYNKGDSVA  475

Query  706  RSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPS  882
            RSTVQVYPG WTAV V LDN G WN+RSQ++  WYLGQ++Y+R V+ +D     E   P 
Sbjct  476  RSTVQVYPGAWTAVLVSLDNVGFWNVRSQNLDSWYLGQEVYVRVVNPEDGANKTEMAVPR  535

Query  883  NLLLCGMF  906
            N L CG  
Sbjct  536  NALYCGQL  543



>ref|XP_009144495.1| PREDICTED: monocopper oxidase-like protein SKU5 [Brassica rapa]
 emb|CDX97339.1| BnaA02g21300D [Brassica napus]
Length=586

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 191/303 (63%), Gaps = 6/303 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    SLD+HVGQSYS LV+ DQ+   DYYIVA+ ++        +   GILHY
Sbjct  249  EGSYTVQQNYTSLDIHVGQSYSFLVTMDQNASSDYYIVASARIVNETIWRRVTGVGILHY  308

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
              S   K  G LP GP D FD  FS+NQA+SIRWN++A  ARPNPQG+F   +I ++  +
Sbjct  309  TNS-KGKAKGHLPPGPQDEFDKTFSMNQARSIRWNVSASGARPNPQGSFKYGSINVTDVY  367

Query  355  VLHGSKG-EIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            VL      +I G  R  ++ VS+  P TP++LAD      GVY+LD FP   +       
Sbjct  368  VLRNMPPVKINGKRRTTLSGVSFVNPSTPIRLADKH-KVKGVYKLD-FPKRPLTGPPRME  425

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT++G++E++ QN+   M S+H+ G+    VG   GEWT  +R TYN +D + RS
Sbjct  426  TSIINGTYRGFMEVILQNNDTKMQSYHMSGYAFFAVGMDYGEWTENSRGTYNKWDGIARS  485

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QVYPG W+A+ + LDNPG WNLR++++  WYLGQ+ Y+RV + D N   E   P+N+L
Sbjct  486  TIQVYPGAWSAILISLDNPGAWNLRTENLDSWYLGQETYVRVVNPDENNKTEFGAPANVL  545

Query  892  LCG  900
             CG
Sbjct  546  YCG  548



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/300 (46%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL++ADQ  +DYYIV + +         L +  ILHY+
Sbjct  244  EGTHTIQTTYSSLDVHVGQSYSVLITADQAPKDYYIVVSTRF----TNKILTSTAILHYS  299

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S+ +  +GP+P GP    + +SI QA+SIR NLTA   RPNPQG+++   I +S+T  L
Sbjct  300  NSLQSV-SGPIPGGPTT-QIDWSIKQARSIRTNLTASGPRPNPQGSYHYGLINISRTITL  357

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN++S+R  DTPLKLADYF N   V+++   P            S+
Sbjct  358  VSSAAQVNGKQRYAVNSISFRPVDTPLKLADYF-NIGRVFQVGSIPDSPSGRPMYLDTSV  416

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWH+DG+   VVG   G WTP +R  YN+ D V RST Q
Sbjct  417  MGADFRAFVEIVFQNHENIIQSWHIDGYSFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQ  476

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N +LCG
Sbjct  477  VYPKSWTAIYMALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVGSIRDEYPIPKNAILCG  536



>ref|XP_011096053.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=541

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 186/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLDVH+GQSYSVLV+A+Q  +DYY+V + +      +  L    +LHY 
Sbjct  239  EGSHTLQTTYSSLDVHLGQSYSVLVTANQPAKDYYVVVSSRF----TSKVLTTTAVLHYR  294

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A K +G  P GP   ++ +S+NQA+SIRWNLTA   RPNPQG+++   I  ++T +L
Sbjct  295  NSFA-KVSGYPPGGPTT-EIDWSLNQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIIL  352

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY +PDTPLKLADYF N  GV+ +   P            S+
Sbjct  353  ANSAPYINGKQRYAVNGVSYVSPDTPLKLADYF-NIGGVFSVGSIPDRPNWGNGYLATSV  411

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVFQN    + SWH+DG+   VVG   G+WT A+R  YN+ D V R TVQ
Sbjct  412  MHADYRSFVEIVFQNWENTVQSWHIDGYSFFVVGMDGGQWTQASRSRYNLRDTVARCTVQ  471

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  472  VYPKSWTAIYIALDNVGMWNIRSEDWARQYLGQQFYLRVYTSSKSWRDELPIPRNALLCG  531



>ref|XP_009629876.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   263 bits (673),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 184/300 (61%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLD+H+GQSYSVLV+A+Q  +DYY+V + +         L    +LHY+
Sbjct  242  EGSHTLQTTYTSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTR----RVLTTTAVLHYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   + +GP+P GP    + +SI QA+SIRWNLTA   RPNPQG+++   I  S+T +L
Sbjct  298  NS-WTQVSGPVPGGPTT-QINWSIYQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIIL  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLADYF  G GV+ L              G  +
Sbjct  356  ANSAPYINGKQRYAVNSVSYVDPDTPLKLADYFKIG-GVFNLGSISDQPYNGNGYLGTPV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++   + ++EIVFQN    + SWH+DG+   VVG   G+WTPA+R  YN+ D V R T Q
Sbjct  415  MAANFRSYVEIVFQNWENSVQSWHIDGYSFFVVGMNGGQWTPASRSHYNLRDTVARCTTQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  475  VYPKSWTAIYMALDNVGMWNIRSEDWSRRYLGQQFYLRVYSSSNSWRDELPIPKNALLCG  534



>ref|XP_002310164.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE90614.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=537

 Score =   263 bits (672),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 188/302 (62%), Gaps = 9/302 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q   DSLDVHVGQS +VLV  +   +DY+IVA+ +      T P L    +L Y
Sbjct  240  EGSHTMQEVYDSLDVHVGQSVTVLVKLNSAVKDYFIVASSRF-----TKPILTTTALLRY  294

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            AGS    P+ PLP GP  + + +S+ QA++IR NLTA AARPNPQG+F+   I + + FV
Sbjct  295  AGS-NTPPSLPLPIGPT-YHVHWSMKQARTIRLNLTANAARPNPQGSFHYGTINVVKRFV  352

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
               +  +I G  RY VN +SY  P TPL+LAD++ N  GV+ L+   T  V   A  G S
Sbjct  353  FANTAEKINGKLRYAVNGISYVDPSTPLQLADWY-NIPGVFSLNTMKTTPVNTPAVLGTS  411

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V      ++EIVFQN+   + SWHL G   +VVGYGD  W P+ R+ YN+ D V R TV
Sbjct  412  VVGTELHDFVEIVFQNNENTIQSWHLSGTSFYVVGYGDNVWNPSMRKRYNLLDAVSRHTV  471

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWNLRS      YLGQQLY+RV +++ +   E  PP N L C
Sbjct  472  QVYPTAWTAIYVSLDNKGMWNLRSAIWPRRYLGQQLYVRVWNNERSLFTESDPPPNTLFC  531

Query  898  GM  903
            G+
Sbjct  532  GL  533



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 192/300 (64%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ   DYY+V + +  +   T+     GIL Y+
Sbjct  238  EGTHTLQTTFSSLDVHVGQSYSVLVTADQPARDYYVVVSSRFTDKINTT----TGILRYS  293

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            GS +   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   ++L++T   
Sbjct  294  GS-STPASGPIPGGPT-IQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLVSLARTIRF  351

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G+I G  RY +N+VS+   DTPLKLAD+F   +GVY+++               S+
Sbjct  352  GSSAGQINGKQRYALNSVSFVPADTPLKLADFF-QISGVYKVNSISDRPTGGGMYLDTSV  410

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVF+N+  ++ S+HLDG+   VVG   G+WT A+R  YN+ D + RSTVQ
Sbjct  411  LQADYRTFVEIVFENNEDIVQSYHLDGYAFWVVGMDGGQWTVASRNGYNLRDAISRSTVQ  470

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLRS+     YLGQQLY+RV     +   E P P N LLCG
Sbjct  471  VYPKSWTAIYIALDNVGMWNLRSEFWARQYLGQQLYLRVFTTSTSLRDEFPIPKNALLCG  530



>ref|XP_010028303.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55016.1| hypothetical protein EUGRSUZ_I00990 [Eucalyptus grandis]
Length=538

 Score =   263 bits (672),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 145/302 (48%), Positives = 192/302 (64%), Gaps = 11/302 (4%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLV-AKGILHY  177
            EG +T Q   +SLDVHVGQS +VLV+     +DY++V + +      T P++ A  +LHY
Sbjct  241  EGCHTLQEVYESLDVHVGQSVTVLVTLQWSPKDYFVVCSSRF-----TKPILNATALLHY  295

Query  178  AGSVAAKPAG-PLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
             GS    PA  PLP GP  + + +S+ QA+++R NLTA AARPNPQG+++   I +++T 
Sbjct  296  DGS--NTPASLPLPIGPT-YQIHWSMKQARTLRTNLTANAARPNPQGSYHYGTIQVNRTL  352

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +L  +  +I GT RY VNNVSY  PDTPLKLADYF N  GV+ L+             G 
Sbjct  353  ILANAPTKINGTLRYTVNNVSYVDPDTPLKLADYF-NIPGVFTLNSIKDTPPSGPDALGT  411

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+V  T   ++EI+FQN    + SWHLDG+  + VGYG G+WTP  R+ YN+ D V R T
Sbjct  412  SVVGTTLHDFVEIIFQNTEKAIQSWHLDGYSFYTVGYGSGQWTPDMRKRYNMADAVSRDT  471

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
            VQVYP  W+A+ V LDN GMWNLRS      YLGQQLYIRV +++ +P  E   P N+LL
Sbjct  472  VQVYPLSWSAILVSLDNKGMWNLRSAIWSKQYLGQQLYIRVWNNEKSPYTEYDAPQNVLL  531

Query  895  CG  900
            CG
Sbjct  532  CG  533



>ref|XP_009103469.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=545

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   +SLDVHVGQS SVLV+ +Q  ++YYIVA+ +      TS L   G+L Y+
Sbjct  246  EGSHVLQNVYESLDVHVGQSLSVLVTLNQPSKNYYIVASTRY----TTSKLSVTGLLRYS  301

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G +P  P P DL +S+NQA+S RWNLTA AARPNPQG+F+   IT +++FV 
Sbjct  302  NS-GVPASGDMPP-PPPEDLDWSLNQARSFRWNLTANAARPNPQGSFHYGTITPTKSFVF  359

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S     G  RY VN VSY   DTPLKLAD+F N  GV+  +   +           S+
Sbjct  360  SNSAPLFNGKQRYAVNGVSYVNSDTPLKLADHF-NIPGVFSTNAIQSVPSSSPVTVATSV  418

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V  +   +LE+VFQN+   M SWHLDG+   VVG+G G+WTP  R  YN+ D + R T Q
Sbjct  419  VQASLHDFLEVVFQNNEESMQSWHLDGYDFWVVGFGSGQWTPEQRPLYNLVDALTRHTTQ  478

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y++V D   + A E  PP NLLLCG
Sbjct  479  VYPKSWTAILVSLDNQGMWNMRSAIWERQYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  538



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLDVH+GQSYSVLV+ADQ   DYYIV + +       + L    ILHY+
Sbjct  247  EGSHTLQNTYSSLDVHLGQSYSVLVTADQPPRDYYIVVSTRFTR----TVLTTTAILHYS  302

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   KP GPLP GP    + +S+NQA+SIRWNLTA   RPNPQG+++   +  ++T  L
Sbjct  303  NSFG-KPVGPLPGGPTT-QINWSLNQARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRL  360

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VS+   DTPLKLAD++   +GV+ L   P +          S+
Sbjct  361  ANSAPIINGKQRYAVNSVSFIPADTPLKLADFY-KISGVFSLGSIPYNPAFGGGYLQTSV  419

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++   + ++EI+F+N+   + SWH+DG+   VVG   G+WT A+R++YN+ D V R T+Q
Sbjct  420  MAANFREYVEIIFENYEDTVQSWHIDGYSFWVVGMDGGQWTAASRKSYNLRDTVNRCTLQ  479

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GWTAVY+ LDN GMWN+RS++    YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  480  VYPKGWTAVYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCG  539



>ref|XP_008671991.1| PREDICTED: uncharacterized protein LOC100278306 isoform X1 [Zea 
mays]
Length=1050

 Score =   272 bits (695),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/303 (48%), Positives = 196/303 (65%), Gaps = 9/303 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    +LD+HVGQSYS LV+ DQ+   DYY+VA+ +  +A     L    ILHY
Sbjct  353  EGSYTSQQNYTNLDIHVGQSYSFLVTMDQNASTDYYVVASARFVDAAVVDKLTGVAILHY  412

Query  178  AGSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S     +GPLP+ P D +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  F
Sbjct  413  SNS-QGPASGPLPDPPNDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVF  471

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GV++LD FP H +       
Sbjct  472  LLQSRAPELIDGKLRSTLNEISYIAPSTPLVLAQIF-NVPGVFKLD-FPNHPMNRLPKVD  529

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  530  TSIINGTYKGFMEIIFQNNATNVQSYHLDGYAFFVVGMDYGLWTENSRGTYNKWDGVARS  589

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLL  891
            T+QV+PG WTA+ VFLDN G+WNLR Q++  WYLGQ++YI V + + +       P N +
Sbjct  590  TIQVFPGAWTAILVFLDNAGIWNLRVQNLDTWYLGQEVYINVVNPEDSSTTL---PDNAI  646

Query  892  LCG  900
             CG
Sbjct  647  FCG  649



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 187/300 (62%), Gaps = 8/300 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ  +DYYI  + +      T  L    ILHY+
Sbjct  242  EGTHTLQTTYSSLDVHVGQSYSVLVTADQTAQDYYIAVSTRF----TTKILTTTAILHYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A K +GP+P GP   ++ +S+NQA+SIR  + +   RPNPQG+++   I L++T  L
Sbjct  298  NS-AKKVSGPIPGGPTT-EINWSLNQARSIR-RVPSSGPRPNPQGSYHYGMINLTRTIKL  354

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S  ++ G  RY VN+VS+   DTPLK+ADYF  G GV+ +   P +          S+
Sbjct  355  ESSAAQVNGKQRYAVNSVSFVPADTPLKIADYFKIG-GVFRVGSMPDYPTGKKMYLDTSV  413

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +    + ++EIVFQNH  ++ SWH++G+   VVG   G WTPA+R  YN+ D V R T Q
Sbjct  414  MGADFRAFVEIVFQNHENIVQSWHINGYSFWVVGMDGGVWTPASRNQYNLRDAVSRCTTQ  473

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+R++     YLGQQ Y+RV+    +P  E P P N LLCG
Sbjct  474  VYPKSWTAIYIALDNVGMWNIRTEFWARQYLGQQFYMRVYSPVESPRDEYPIPKNALLCG  533



>ref|XP_010263764.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
 ref|XP_010263765.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=539

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 146/301 (49%), Positives = 187/301 (62%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EGS+T Q   +SLDVHVGQS +VLV+ +Q  +DYYIVA+ +      T P L    ILHY
Sbjct  242  EGSHTVQDFYESLDVHVGQSVAVLVTLNQPPKDYYIVASARF-----TKPILTTTAILHY  296

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP  P  + + +S+ QA++IRWNLTA AARPNPQG+F+   I   +T V
Sbjct  297  SNS-HTPASGPLPIAPT-YHIHWSMKQARTIRWNLTANAARPNPQGSFHYGTIPTVRTLV  354

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  SK +I G  RY VN VSY  P TPLKLADYF N  GV+ L+             G S
Sbjct  355  LANSKSQINGKLRYAVNRVSYVNPTTPLKLADYF-NIPGVFNLNTIQDKPTPGPVFLGTS  413

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            +V      ++EI+FQN+   + SWHLDG+   VVGYG+G+W P  R+ YN+YD   R TV
Sbjct  414  VVGTALHDFVEIIFQNNETSIQSWHLDGYDFWVVGYGNGQWIPVNRKRYNLYDATTRHTV  473

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  W+A+ V LDN GMWNLRS      YLGQ+LY+RV +++ +   E   P N L C
Sbjct  474  QVYPKSWSAILVSLDNKGMWNLRSAIWDRRYLGQELYVRVWNNERSLYTEYDIPPNALRC  533

Query  898  G  900
            G
Sbjct  534  G  534



>emb|CDX81353.1| BnaC09g07640D [Brassica napus]
Length=541

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS S+LV+ +Q  +DYYIVA+ +   +N    L    +L Y+
Sbjct  242  EGSHVMQTDYDSLDVHVGQSLSLLVTLNQSPKDYYIVASTRFVRSN----LSVTALLRYS  297

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +G +P  P P +L +S+ QA++ RWNLTA AARPNPQG+F+   I  +++FV 
Sbjct  298  NS-GVPASGDMPPLP-PGELVWSMRQARTFRWNLTANAARPNPQGSFHYGKINTTKSFVF  355

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLAD+F N  GV+      +      A    S+
Sbjct  356  SNSAPLINGKQRYAVNGVSYVNSDTPLKLADHF-NIPGVFSTSAIQSVPSNSPATVATSV  414

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            V  +   +LEIVFQN+   + SWHLDG+   VVG+G G+WTPA R+ YN+ D + R T Q
Sbjct  415  VKASLHDFLEIVFQNNEKAVQSWHLDGYDFWVVGFGSGQWTPAKRQLYNLVDALTRHTTQ  474

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y++V D   + A E  PP NLLLCG
Sbjct  475  VYPNSWTAILVSLDNQGMWNMRSAIWERQYLGQQFYLKVWDPVQSLANEYNPPDNLLLCG  534



>ref|XP_002965109.1| hypothetical protein SELMODRAFT_230488 [Selaginella moellendorffii]
 gb|EFJ33947.1| hypothetical protein SELMODRAFT_230488 [Selaginella moellendorffii]
Length=560

 Score =   263 bits (673),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 188/301 (62%), Gaps = 8/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGSYT +  +DSLD+H+GQSYSVLV+ DQ   DYYIVA+ K    +    L    ILHY 
Sbjct  247  EGSYTAKTCVDSLDIHLGQSYSVLVTMDQSPADYYIVASTKFSSGS----LNGVAILHYQ  302

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  A  +G +P GPDP D+ FS+NQA SI+WNLT GAARPNPQG+++   I +++   L
Sbjct  303  NSNTAA-SGTIPAGPDPLDVNFSLNQALSIKWNLTTGAARPNPQGSYHYGQIPITRVIQL  361

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   +    R+ +N  SY TPDTPLKLAD++ N  GV+      T +V        S+
Sbjct  362  SSSSVTLNNQARFAINGQSYLTPDTPLKLADFY-NIDGVFTRGSMRTSAVGSPV-METSV  419

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGE-WTPAARETYNVYDPVVRSTV  717
            +   +K ++E+VF N    + SWHLDG    VVG+G  E W+P++R  YN+ D V RST 
Sbjct  420  LELDYKSFVELVFVNPENEIQSWHLDGMSFWVVGFGFNETWSPSSRSKYNLVDAVSRSTT  479

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP GWTA+   +DN GMWN+RSQ ++  YLGQ+ Y RV + + +   E   P N++LC
Sbjct  480  QVYPRGWTAILFSVDNVGMWNIRSQCLRRQYLGQEGYARVFNPENSTRTETWIPQNVILC  539

Query  898  G  900
            G
Sbjct  540  G  540



>ref|XP_010923874.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=542

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 188/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLDVH+GQSYSVLV+ADQ   DYYIV + +      ++ L    ILHY+
Sbjct  240  EGSHTLQNTYSSLDVHLGQSYSVLVTADQPPRDYYIVISTRF----TSTVLTTTSILHYS  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   KP  P P GP   ++  SINQA+SIRWNLTA   RPNPQG+++   +  ++T  L
Sbjct  296  NSFG-KPVDPPPAGPTT-EIDLSINQARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VS+   DTPLKLADY+    GV+ L   P +          S+
Sbjct  354  ANSAPIINGKQRYAVNSVSFIPADTPLKLADYY-KIPGVFSLGSIPDNPTFGGGYLQTSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++   + ++EI+F+N+  ++ SWHLDG+   VVG   G+WT A+RE+YN+ D V R TVQ
Sbjct  413  MAADFRAYVEIIFENYEDIVQSWHLDGYTFWVVGMDGGQWTAASRESYNLRDAVNRCTVQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP GW AVY+ LDN GMWN+RS++    YLGQQ Y+RV+    +   E P P N LLCG
Sbjct  473  VYPKGWAAVYMPLDNVGMWNIRSENWARQYLGQQFYMRVYSPANSWRDEYPIPRNALLCG  532



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   263 bits (672),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 188/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVL +ADQ  +DYYIV + +      T  L   G+LHY+
Sbjct  244  EGTHTLQTTYSSLDVHVGQSYSVLFTADQPGQDYYIVVSSRF----TTQVLTTTGVLHYS  299

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S A   +GP P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I  S+T +L
Sbjct  300  NS-AGSVSGPPPGGPT-IQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGMINTSRTIIL  357

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S G++ G  RY VN+VS+   DTPLKLAD+F    GV++ +               S+
Sbjct  358  ASSAGQVNGKQRYAVNSVSFIPQDTPLKLADFF-KIPGVFKENSISDRPYGGGIYLDTSV  416

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            ++  ++ ++EIVFQN+  ++ SWHLDG+   VVG   G+WT A+R+ YN+ D V R T Q
Sbjct  417  LTVDYRAFVEIVFQNNEDIVQSWHLDGYSFFVVGMDGGQWTSASRDQYNLRDAVARCTAQ  476

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+YV LDN GMWNLR++     YLGQQLY+RV+    +   E P P N L CG
Sbjct  477  VYPMSWTAIYVPLDNVGMWNLRTEFWARQYLGQQLYLRVYTTSTSLRDEYPIPKNALTCG  536



>ref|XP_006425823.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
 ref|XP_006466654.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR39063.1| hypothetical protein CICLE_v10025326mg [Citrus clementina]
Length=539

 Score =   263 bits (671),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 189/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q   DSLDVHVGQS SVLV+ +Q  +DYYIVA+ +  +    + L A  +LHY 
Sbjct  240  EGSHTIQNIYDSLDVHVGQSVSVLVTFNQPPKDYYIVASTRFTK----NVLTATAVLHYT  295

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S  +  +GPLP GP  +++ +S+ QA++ RWNLTA AARPNPQG+F+   I  ++T VL
Sbjct  296  NS-HSPASGPLPTGPT-YEIHWSMKQARTFRWNLTANAARPNPQGSFHYGKINTTRTIVL  353

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN +SY   DTPLKLADYF N  G++ ++   +     A+    S+
Sbjct  354  ANSAPLINGKLRYAVNGISYVNSDTPLKLADYF-NIPGIFSVNSIQSVPSGGASSVATSV  412

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +      ++E+VFQN+   M SWHLDG+   VVGYG G+W    R TYN+ D + R T Q
Sbjct  413  MQVNLHEYIEVVFQNNEKTMQSWHLDGYDFWVVGYGSGQWAAEKRRTYNLADTLTRHTAQ  472

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y++V +   + A E   PSN+L+CG
Sbjct  473  VYPQSWTAILVSLDNQGMWNMRSAIWERQYLGQQFYLKVWNAVHSLANEYDIPSNILVCG  532



>ref|NP_001041735.1| Os01g0100400 [Oryza sativa Japonica Group]
 dbj|BAD45494.1| putative multi-copper oxidase-related protein [Oryza sativa Japonica 
Group]
 dbj|BAE79748.1| putative multi-copper oxidase-related protein [Oryza sativa Japonica 
Group]
 dbj|BAF03649.1| Os01g0100400 [Oryza sativa Japonica Group]
 dbj|BAG95073.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC69759.1| hypothetical protein OsI_00005 [Oryza sativa Indica Group]
Length=593

 Score =   264 bits (675),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 196/304 (64%), Gaps = 9/304 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT+Q    ++D+HVGQSYS L++ DQ+   DYY+VA+ +     +   L    ILHY
Sbjct  258  EGSYTSQQNYTNMDIHVGQSYSFLLTMDQNASTDYYVVASARF--VPDADKLTGVAILHY  315

Query  178  AGSVAAKPAGPLPEGPD-PFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            + S    P+G LP+ PD  +D  FSINQA+SIRWN+TA  ARPNPQG+F+  +IT++  +
Sbjct  316  SNS-QGPPSGSLPDAPDDQYDTAFSINQARSIRWNVTASGARPNPQGSFHYGDITVTDVY  374

Query  355  VLHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG  531
            +L     E I G  R  +N +SY  P TPL LA  F N  GVY+LD FP   +       
Sbjct  375  LLQSMPPELIDGQMRATLNGISYIAPSTPLMLAQLF-NVPGVYKLD-FPNRPMNRLPKLD  432

Query  532  VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
             SI++GT+KG++EI+FQN+   + S+HLDG+   VVG   G WT  +R TYN +D V RS
Sbjct  433  TSIINGTYKGFMEIIFQNNATSVQSYHLDGYAFFVVGMDYGLWTDNSRGTYNKWDGVARS  492

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIR-VHDDDPNPAKEKPPPSNL  888
            T+QV+PG WTAV VFLDN G+WNLR +++  WYLGQ++YI  V+ +D +     P P N 
Sbjct  493  TIQVFPGAWTAVLVFLDNAGIWNLRVENLDAWYLGQEVYISVVNPEDSSNKTVLPLPDNA  552

Query  889  LLCG  900
            + CG
Sbjct  553  IFCG  556



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 190/300 (63%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ADQ   DYYIV + +      T  L   GILHY+
Sbjct  243  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPGHDYYIVVSSRF----STPILTTTGILHYS  298

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            G+   + +GP+P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I L++T++L
Sbjct  299  GA-GGQVSGPIPGGPT-IQIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINLTKTYIL  356

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              + G++ G  RY +N+VS+   DTPLKLADYF   +GV+ +                S+
Sbjct  357  ASAAGQVNGKQRYGINSVSFVPADTPLKLADYF-KISGVFRVGSVSDRPTGGNLYLDTSV  415

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +   ++ ++EIVFQN   ++ S+HLDG+   VVG   G+WT A+R  YN+ D V RST Q
Sbjct  416  LGADYRTFVEIVFQNDEDIVQSYHLDGYQFFVVGMDGGKWTTASRNGYNLRDAVARSTTQ  475

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWNLR++     YLGQQLY+RV+    +   E P P N  LCG
Sbjct  476  VYPFSWTAIYLSLDNVGMWNLRTEFWARQYLGQQLYLRVYTSSTSIRDEYPIPRNARLCG  535



>gb|KHG07318.1| L-ascorbate oxidase [Gossypium arboreum]
Length=536

 Score =   263 bits (671),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 185/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DSLDVHVGQS +VLV+ +Q  +DYYIVA+ +       + L A  +LHYA
Sbjct  237  EGSHVIQNLYDSLDVHVGQSVTVLVTLNQPPKDYYIVASTRFTR----TVLTATAVLHYA  292

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S     +GPLP  P  +   +S+ QA+  RWNLT+ AARPNPQG+F+   IT ++T VL
Sbjct  293  NS-QTPVSGPLPAAP-AYKYHWSMQQARIYRWNLTSNAARPNPQGSFHYGKITPTKTIVL  350

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN VSY   DTPLKLADYF N  G++ ++         AA    S+
Sbjct  351  ANSVSYINGKLRYAVNGVSYVNADTPLKLADYF-NIPGIFSMNAVQGVPSGVAATVATSV  409

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +      +LE+VFQN+   M SWHLDG+   VVG+G G+WTP  R TYN+ D + R T Q
Sbjct  410  MPTNLHDFLEVVFQNNENTMQSWHLDGYDFWVVGFGSGQWTPKKRRTYNLVDALTRHTTQ  469

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+ V LDN GMWN+RS   +  YLGQQ Y+RV +   + A E   PSN+LLCG
Sbjct  470  VYPNSWTAILVSLDNQGMWNMRSASWERQYLGQQFYLRVWNPVRSLANEYDIPSNVLLCG  529



>ref|XP_010686815.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=548

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 190/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q +  SLD+H+GQSYSVLV+ADQ  +DYY+V + +      T P L    +LHY
Sbjct  246  EGTHTMQSSYTSLDIHLGQSYSVLVTADQPPDDYYVVVSSRF-----TKPVLTTTAVLHY  300

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
              S   K +GPLP GP    + +S+NQA SIR NLTA   RPNPQG+++   I L +T V
Sbjct  301  RNS-WKKVSGPLPRGPTT-QIGWSLNQAHSIRMNLTASGPRPNPQGSYHYGMIKLQRTIV  358

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY +N+VSY   DTPLKLADYF N  GVY  +  P+      A    +
Sbjct  359  LANSAAYINGRQRYAINSVSYVQADTPLKLADYF-NIPGVYYSNSMPSSPSWRPAYQQTA  417

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++E+VFQN    + S+H+DG+   VVG   G+WTP +R +YN+ D V RSTV
Sbjct  418  VLQTDYRTFIEMVFQNQEDTVQSYHIDGYAFFVVGMDGGQWTPRSRASYNLRDAVTRSTV  477

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTAVY+ LDN GMWN+RS++    YLGQQ Y+RV+ +  +   E P P N LLC
Sbjct  478  QVYPKAWTAVYMSLDNVGMWNIRSENWIRQYLGQQFYMRVYTNSHSWRDEYPIPKNALLC  537

Query  898  G  900
            G
Sbjct  538  G  538



>ref|XP_002321241.2| hypothetical protein POPTR_0014s17590g [Populus trichocarpa]
 gb|EEE99556.2| hypothetical protein POPTR_0014s17590g [Populus trichocarpa]
Length=590

 Score =   264 bits (674),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 141/304 (46%), Positives = 198/304 (65%), Gaps = 9/304 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q    ++D+HVGQSYS LV+ DQ    DYYIVA+P+   +++ S +    ILHY
Sbjct  253  EGSYTVQQNYTNMDIHVGQSYSFLVTMDQTASSDYYIVASPRYVNSSKASGV---AILHY  309

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            A S     +GPLP+ P+ +D  FS+NQA+SIRWN++AGAARPNPQG+F    IT++  +V
Sbjct  310  ANS-QGPASGPLPDPPNEYDSFFSMNQARSIRWNVSAGAARPNPQGSFKYGQITVTDVYV  368

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G     +N +SY  P TPLKLA  + N  GVY+LD FP   +        
Sbjct  369  IVNRPAELIDGKWCTTLNGISYLPPSTPLKLAQQY-NIPGVYKLD-FPNAQMNRPPKVDT  426

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN+   + S+H+DG+   VVG   G WT  +R TYN +D V RST
Sbjct  427  SLINGTFKGFMEIIFQNNDTAVQSYHMDGYAFFVVGMDFGVWTENSRSTYNKWDGVARST  486

Query  715  VQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLL  894
             QV+PG WTA+ V LDN G+WNLRS+++  WYLGQ++Y+ + + + + + E P P N + 
Sbjct  487  TQVFPGAWTAILVSLDNAGIWNLRSENLDSWYLGQEVYLSIMNPEIDKS-EAPLPDNTIY  545

Query  895  CGMF  906
            CG+ 
Sbjct  546  CGIL  549



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 186/301 (62%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q T  SLDVHVGQSYSVLV+ DQ  +D+YI  + +         L + G LHY 
Sbjct  243  EGTHTIQTTYSSLDVHVGQSYSVLVTMDQPPQDFYIAVSTRF----TNKVLTSAGTLHY-  297

Query  181  GSVAAKP-AGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S  A+P +GP+P GP    + +S+NQA+SIR NLTA   RPNPQG+++   I +S+T  
Sbjct  298  -SNPARPVSGPVPGGPTT-QIDWSLNQARSIRTNLTASGPRPNPQGSYHYGLINISRTIK  355

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S G++ G  RY VN+VS+   DTPLKLADYF  G GV+ +                S
Sbjct  356  LESSAGQVNGKQRYAVNSVSFIPADTPLKLADYFKIG-GVFRVGSIQDQPTGGNIYLDTS  414

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++    +G++EIVFQNH  ++ SWH+DG+   VVG   G WTPA+R  YN+ D V R T 
Sbjct  415  VMGADFRGFIEIVFQNHENIVQSWHIDGYNFWVVGMNGGVWTPASRNEYNLRDAVSRCTT  474

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWN+RS+     YLGQQ Y+RV+    +   E P P N LLC
Sbjct  475  QVYPKSWTAIYVALDNVGMWNVRSEFWARQYLGQQFYLRVYSPVESIRDEYPIPKNALLC  534

Query  898  G  900
            G
Sbjct  535  G  535



>ref|XP_009619786.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=538

 Score =   262 bits (670),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/301 (49%), Positives = 189/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+  Q   DS DVHVGQS S+LV+ DQ  +DYYIVA+        T+ L    +LHY 
Sbjct  239  EGSHVIQNLYDSFDVHVGQSLSILVTLDQSPKDYYIVAS----TRFTTTVLTTTAVLHYT  294

Query  181  GSVAAKPAGPLPEGP-DPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
             S     +GPLP GP D F  Q+S+ QA++ RWNLT+ AARPNPQG+F+   IT S+T V
Sbjct  295  NS-QTPTSGPLPAGPADQF--QWSLMQARTFRWNLTSNAARPNPQGSFHYGKITPSRTIV  351

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY VN+VSY   DTPLKLAD+F N  GV+ L+   T     +     S
Sbjct  352  LANSAPLISGKQRYAVNSVSYVNADTPLKLADHF-NIPGVFSLNSIQTVPNAASPSLATS  410

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++  +   +LEIVFQN+   M SWHLDG+   V+G+G G W+  +R+ YN+ D + R T 
Sbjct  411  VLPASLHEFLEIVFQNNEDTMQSWHLDGYDFWVIGFGSGTWSQDSRKEYNLVDALTRHTT  470

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTA+YV LDN GMWNLRS      YLGQQ+Y+RV++  P+ A E   P+N LLC
Sbjct  471  QVYPKSWTAIYVSLDNQGMWNLRSSMWDRQYLGQQVYLRVYNPTPSLANEYDIPTNALLC  530

Query  898  G  900
            G
Sbjct  531  G  531



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/300 (47%), Positives = 187/300 (62%), Gaps = 7/300 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EGS+T Q T  SLD+H+GQSYSVLV+A+Q  +DYY+V + +      T  L    +LHY+
Sbjct  246  EGSHTLQTTYTSLDIHLGQSYSVLVTANQPPKDYYVVVSSRF----TTRVLTTTAVLHYS  301

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
             S   K +GP P GP    + +S+ QA+SIRWNLTA   RPNPQG+++   I  S+T +L
Sbjct  302  NS-WTKVSGPPPGGPTT-QINWSLYQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIML  359

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVSI  540
              S   I G  RY VN+VSY  PDTPLKLAD+F N  GV+ L           A  G  +
Sbjct  360  ANSAPYINGKQRYAVNSVSYTDPDTPLKLADHF-NIGGVFNLGSISDQPYNGNAYIGTPV  418

Query  541  VSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTVQ  720
            +S   + ++EI+FQN    + SWH+DG+   VVG   G+WTP++R  YN+ D + R TVQ
Sbjct  419  MSANFRSYVEIIFQNWENTVQSWHIDGYSFFVVGMDGGQWTPSSRAHYNLRDTIARCTVQ  478

Query  721  VYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLCG  900
            VYP  WTA+Y+ LDN GMWN+RS++    YLGQQ Y+RV+    +   E P P N +LCG
Sbjct  479  VYPKSWTAIYMALDNVGMWNIRSENWSRRYLGQQFYLRVYSPANSWRDELPIPKNAILCG  538



>ref|XP_010686816.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   263 bits (671),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 190/301 (63%), Gaps = 9/301 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSP-LVAKGILHY  177
            EG++T Q +  SLD+H+GQSYSVLV+ADQ  +DYY+V + +      T P L    +LHY
Sbjct  241  EGTHTMQSSYTSLDIHLGQSYSVLVTADQPPDDYYVVVSSRF-----TKPVLTTTAVLHY  295

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
              S   K +GPLP GP    + +S+NQA SIR NLTA   RPNPQG+++   I L +T V
Sbjct  296  RNS-WKKVSGPLPRGPTT-QIGWSLNQAHSIRMNLTASGPRPNPQGSYHYGMIKLQRTIV  353

Query  358  LHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGVS  537
            L  S   I G  RY +N+VSY   DTPLKLADYF N  GVY  +  P+      A    +
Sbjct  354  LANSAAYINGRQRYAINSVSYVQADTPLKLADYF-NIPGVYYSNSMPSSPSWRPAYQQTA  412

Query  538  IVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRSTV  717
            ++   ++ ++E+VFQN    + S+H+DG+   VVG   G+WTP +R +YN+ D V RSTV
Sbjct  413  VLQTDYRTFIEMVFQNQEDTVQSYHIDGYAFFVVGMDGGQWTPRSRASYNLRDAVTRSTV  472

Query  718  QVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNLLLC  897
            QVYP  WTAVY+ LDN GMWN+RS++    YLGQQ Y+RV+ +  +   E P P N LLC
Sbjct  473  QVYPKAWTAVYMSLDNVGMWNIRSENWIRQYLGQQFYMRVYTNSHSWRDEYPIPKNALLC  532

Query  898  G  900
            G
Sbjct  533  G  533



>ref|XP_004163159.1| PREDICTED: monocopper oxidase-like protein SKU5-like, partial 
[Cucumis sativus]
Length=372

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 196/306 (64%), Gaps = 8/306 (3%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQD-DEDYYIVAAPKLHEANETSPLVAKGILHY  177
            EGSYT Q   +++D+HVGQSYS LV  DQ+   DYYIVA+ +L  ++  +      ILHY
Sbjct  31   EGSYTVQQAYENMDIHVGQSYSFLVMMDQNASSDYYIVASSRLLNSSSLAGTTGVAILHY  90

Query  178  AGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFV  357
            + S     +GPLP+ P+  D  FS+NQA+SIRWN++AGAARPNPQG+FN   IT++  +V
Sbjct  91   SNS-QGPASGPLPDPPNELDTFFSMNQARSIRWNVSAGAARPNPQGSFNYGQITVTDVYV  149

Query  358  LHGSKGE-IRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            +     E I G  R  +N +SY TP TPLK A  F +  GVY+L DFP   +        
Sbjct  150  ILNRPSELINGKWRRTLNGLSYFTPSTPLKHAQQF-SIPGVYKL-DFPNQMMNRPPKLDT  207

Query  535  SIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRST  714
            S+++GT KG++EI+FQN    + ++HLDG+   VVG   G WT  +R TYN +D V R +
Sbjct  208  SLINGTFKGFMEIIFQNSDKNVQTYHLDGYAFFVVGMDFGVWTENSRGTYNKWDGVARCS  267

Query  715  VQV--YPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSNL  888
             QV  +PG WTAV V LDN G+WNLRS+++  WYLGQ+LY+ V + + + + E P P N 
Sbjct  268  TQVTSFPGAWTAVLVSLDNAGIWNLRSENLDSWYLGQELYVSVVNPEIDKS-EIPMPDNT  326

Query  889  LLCGMF  906
            + CG+ 
Sbjct  327  IYCGLL  332



>ref|XP_002984579.1| hypothetical protein SELMODRAFT_445960 [Selaginella moellendorffii]
 gb|EFJ14224.1| hypothetical protein SELMODRAFT_445960 [Selaginella moellendorffii]
Length=588

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/304 (47%), Positives = 192/304 (63%), Gaps = 7/304 (2%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANET--SPLVAKGILH  174
            EGSYT Q   DS+D+ VGQSYS L++   +  DYYIVA+P+    NET  + +   G+LH
Sbjct  246  EGSYTVQQPYDSIDIFVGQSYSFLLNCTANASDYYIVASPRF-VGNETEWANITGVGVLH  304

Query  175  YAGSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTF  354
            Y  S  A   GPLPEGP  +D  +S+NQA+ +R NLT GAARPNPQG+F+   I ++QTF
Sbjct  305  YLDS-KALVNGPLPEGPSIYDGGWSVNQARQLRRNLTTGAARPNPQGSFHYGQINVTQTF  363

Query  355  VLHGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYGV  534
            VL  +   I G  R+ VN  S+  P TPL LAD + N  G+Y+L+ FP            
Sbjct  364  VLTSTAVSIAGKRRFAVNGFSFEVPSTPLLLADEY-NITGLYKLNSFPEKVGSVVPGLQT  422

Query  535  SIVSGTHKGWLEIVFQN-HLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVVRS  711
            S+V+ T+ G+LEI+FQN     + SWH+DG+   VVGYG G+WT   R  YN +D V RS
Sbjct  423  SVVNATYAGFLEIIFQNPDNNSVQSWHVDGYAAFVVGYGPGQWTENDRGQYNKWDAVSRS  482

Query  712  TVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEK-PPPSNL  888
            TVQV+PG WTA+ + LDN G+WN+RS+ +   YLGQ++Y+ V+D   N      P P N+
Sbjct  483  TVQVFPGSWTAIQISLDNVGLWNIRSEDLVRHYLGQEIYMFVNDPSDNIKNTAFPKPDNV  542

Query  889  LLCG  900
            L CG
Sbjct  543  LYCG  546



>gb|AAG52028.1|AC022456_9 pectinesterase, putative, 5' partial; 91413-90223 [Arabidopsis 
thaliana]
Length=308

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 191/305 (63%), Gaps = 17/305 (6%)
 Frame = +1

Query  1    EGSYTNQITLDSLDVHVGQSYSVLVSADQDDEDYYIVAAPKLHEANETSPLVAKGILHYA  180
            EG++T Q    SLDVHVGQSYSVL++ADQ   DYY+V + +  +   T+     G+L Y+
Sbjct  6    EGTHTLQTMFSSLDVHVGQSYSVLITADQSPRDYYVVVSSRFTDKIITT----TGVLRYS  61

Query  181  GSVAAKPAGPLPEGPDPFDLQFSINQAKSIRWNLTAGAARPNPQGTFNVTNITLSQTFVL  360
            GS +   +GP+P GP    + +S+NQA++IR NLTA   RPNPQG+++   I L +T V 
Sbjct  62   GS-STPASGPIPGGPT-IQVDWSLNQARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVF  119

Query  361  HGSKGEIRGTPRYLVNNVSYRTPDTPLKLADYFVNGAGVYELDDFPTHSVKDAADYG---  531
              S G+I G  RY VN+VS+   DTPLKLAD+F   +GVY+++     S+ D   YG   
Sbjct  120  GSSAGQINGKQRYGVNSVSFVPADTPLKLADFF-KISGVYKIN-----SISDKPTYGGLY  173

Query  532  --VSIVSGTHKGWLEIVFQNHLAVMDSWHLDGFGMHVVGYGDGEWTPAARETYNVYDPVV  705
               S++   ++ ++EIVF+N   ++ S+HL+G+   VVG   G+W   +R  YN+ D V 
Sbjct  174  LDTSVLQVDYRTFIEIVFENQEDIVQSYHLNGYSFWVVGMDGGQWKTGSRNGYNLRDAVS  233

Query  706  RSTVQVYPGGWTAVYVFLDNPGMWNLRSQHVKHWYLGQQLYIRVHDDDPNPAKEKPPPSN  885
            RSTVQVYP  WTA+Y+ LDN GMWNLRS+     YLGQQLY+RV     +   E P P N
Sbjct  234  RSTVQVYPKSWTAIYIALDNVGMWNLRSEFWARQYLGQQLYLRVFTSSTSLRDEYPIPKN  293

Query  886  LLLCG  900
              LCG
Sbjct  294  SRLCG  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2533093496640