BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8153_g1_i2 len=2101 path=[201:0-251 452:252-2100]

Length=2101
                                                                      Score     E

ref|XP_004234366.1|  PREDICTED: probable methyltransferase PMT16        931   0.0     
ref|XP_006353348.1|  PREDICTED: probable methyltransferase PMT15-...    926   0.0     
emb|CDP05238.1|  unnamed protein product                                923   0.0     
ref|XP_009610423.1|  PREDICTED: probable methyltransferase PMT15        922   0.0     
ref|XP_011076214.1|  PREDICTED: probable methyltransferase PMT15        922   0.0     
ref|XP_009770932.1|  PREDICTED: probable methyltransferase PMT15        920   0.0     
ref|XP_009801989.1|  PREDICTED: probable methyltransferase PMT15 ...    917   0.0     
ref|XP_009801988.1|  PREDICTED: probable methyltransferase PMT15 ...    913   0.0     
ref|XP_006340522.1|  PREDICTED: probable methyltransferase PMT15-...    912   0.0     
ref|XP_011101180.1|  PREDICTED: probable methyltransferase PMT16        907   0.0     
ref|XP_009626220.1|  PREDICTED: probable methyltransferase PMT15        907   0.0     
ref|XP_004240739.1|  PREDICTED: probable methyltransferase PMT15 ...    900   0.0     
ref|XP_010321993.1|  PREDICTED: probable methyltransferase PMT15 ...    899   0.0     
gb|EYU19524.1|  hypothetical protein MIMGU_mgv1a002864mg                893   0.0     
ref|XP_009609846.1|  PREDICTED: probable methyltransferase PMT15        892   0.0     
ref|XP_009794887.1|  PREDICTED: probable methyltransferase PMT15        886   0.0     
gb|EPS68701.1|  hypothetical protein M569_06064                         880   0.0     
ref|XP_002279420.2|  PREDICTED: probable methyltransferase PMT15 ...    878   0.0     Vitis vinifera
gb|KDP22318.1|  hypothetical protein JCGZ_26149                         878   0.0     
ref|XP_004309222.1|  PREDICTED: probable methyltransferase PMT16-...    871   0.0     
ref|XP_007038610.1|  S-adenosyl-L-methionine-dependent methyltran...    869   0.0     
ref|XP_002510829.1|  ATP binding protein, putative                      868   0.0     Ricinus communis
ref|XP_010255518.1|  PREDICTED: probable methyltransferase PMT15 ...    865   0.0     
ref|XP_006365768.1|  PREDICTED: probable methyltransferase PMT15-...    865   0.0     
ref|XP_007220207.1|  hypothetical protein PRUPE_ppa002720mg             862   0.0     
ref|XP_008377156.1|  PREDICTED: probable methyltransferase PMT16        862   0.0     
ref|XP_002318832.2|  hypothetical protein POPTR_0012s13570g             862   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004228448.2|  PREDICTED: probable methyltransferase PMT15        859   0.0     
ref|XP_010693483.1|  PREDICTED: probable methyltransferase PMT15        858   0.0     
ref|XP_011041603.1|  PREDICTED: probable methyltransferase PMT16        858   0.0     
ref|XP_006445150.1|  hypothetical protein CICLE_v10019272mg             854   0.0     
ref|XP_002321888.2|  hypothetical protein POPTR_0015s13580g             852   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010278559.1|  PREDICTED: probable methyltransferase PMT15        851   0.0     
gb|KDO86012.1|  hypothetical protein CISIN_1g006633mg                   849   0.0     
ref|XP_006490342.1|  PREDICTED: probable methyltransferase PMT15-...    849   0.0     
ref|XP_006421866.1|  hypothetical protein CICLE_v10004550mg             848   0.0     
ref|XP_011030063.1|  PREDICTED: probable methyltransferase PMT15        847   0.0     
ref|XP_007152322.1|  hypothetical protein PHAVU_004G120000g             843   0.0     
ref|XP_003548213.1|  PREDICTED: probable methyltransferase PMT16-...    842   0.0     
ref|XP_010061323.1|  PREDICTED: probable methyltransferase PMT16        838   0.0     
gb|EYU25067.1|  hypothetical protein MIMGU_mgv1a004954mg                833   0.0     
ref|XP_003533217.1|  PREDICTED: probable methyltransferase PMT16-...    838   0.0     
ref|XP_010693482.1|  PREDICTED: probable methyltransferase PMT15        834   0.0     
ref|XP_002511797.1|  ATP binding protein, putative                      832   0.0     Ricinus communis
gb|KEH17379.1|  methyltransferase PMT16, putative                       831   0.0     
gb|KDP28686.1|  hypothetical protein JCGZ_14457                         830   0.0     
ref|XP_004515722.1|  PREDICTED: probable methyltransferase PMT16-...    830   0.0     
ref|XP_008234471.1|  PREDICTED: probable methyltransferase PMT16        828   0.0     
ref|XP_008439398.1|  PREDICTED: probable methyltransferase PMT15        828   0.0     
ref|XP_004140852.1|  PREDICTED: probable methyltransferase PMT15-...    827   0.0     
ref|XP_009400717.1|  PREDICTED: probable methyltransferase PMT15        828   0.0     
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15        828   0.0     
ref|XP_009629797.1|  PREDICTED: probable methyltransferase PMT15        827   0.0     
ref|XP_009343539.1|  PREDICTED: probable methyltransferase PMT15        826   0.0     
ref|XP_008232735.1|  PREDICTED: probable methyltransferase PMT15        825   0.0     
gb|KCW46397.1|  hypothetical protein EUGRSUZ_K00230                     824   0.0     
ref|XP_010035103.1|  PREDICTED: probable methyltransferase PMT15        826   0.0     
ref|XP_008799521.1|  PREDICTED: probable methyltransferase PMT15        825   0.0     
ref|XP_009804054.1|  PREDICTED: probable methyltransferase PMT15        825   0.0     
ref|XP_010919241.1|  PREDICTED: probable methyltransferase PMT15        825   0.0     
ref|XP_010053660.1|  PREDICTED: probable methyltransferase PMT15        825   0.0     
ref|XP_004155808.1|  PREDICTED: probable methyltransferase PMT15-...    825   0.0     
ref|XP_010559094.1|  PREDICTED: probable methyltransferase PMT16        822   0.0     
ref|XP_008438092.1|  PREDICTED: probable methyltransferase PMT15        822   0.0     
ref|XP_007220534.1|  hypothetical protein PRUPE_ppa002801mg             822   0.0     
emb|CDP08881.1|  unnamed protein product                                821   0.0     
ref|XP_006287263.1|  hypothetical protein CARUB_v10000453mg             819   0.0     
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15        818   0.0     
ref|XP_004496597.1|  PREDICTED: probable methyltransferase PMT16-...    818   0.0     
gb|KHG14191.1|  hypothetical protein F383_16741                         817   0.0     
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...    816   0.0     
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...    816   0.0     
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g             816   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006396270.1|  hypothetical protein EUTSA_v10028512mg             815   0.0     
ref|XP_010523726.1|  PREDICTED: probable methyltransferase PMT16        817   0.0     
ref|XP_003623835.1|  hypothetical protein MTR_7g076170                  815   0.0     
ref|XP_008354467.1|  PREDICTED: probable methyltransferase PMT15        814   0.0     
ref|XP_008375906.1|  PREDICTED: probable methyltransferase PMT15        814   0.0     
gb|KFK37364.1|  hypothetical protein AALP_AA4G247100                    814   0.0     
ref|XP_004133882.1|  PREDICTED: probable methyltransferase PMT15-...    814   0.0     
ref|XP_007143370.1|  hypothetical protein PHAVU_007G066900g             812   0.0     
ref|XP_006339462.1|  PREDICTED: probable methyltransferase PMT15-...    813   0.0     
ref|XP_007051920.1|  S-adenosyl-L-methionine-dependent methyltran...    813   0.0     
ref|XP_008383220.1|  PREDICTED: probable methyltransferase PMT15        811   0.0     
ref|NP_182099.1|  putative methyltransferase PMT16                      813   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004229839.1|  PREDICTED: probable methyltransferase PMT15        813   0.0     
ref|XP_010540274.1|  PREDICTED: probable methyltransferase PMT15        813   0.0     
ref|XP_010427380.1|  PREDICTED: probable methyltransferase PMT15        813   0.0     
ref|XP_010419631.1|  PREDICTED: probable methyltransferase PMT15        812   0.0     
ref|XP_002301329.1|  dehydration-responsive family protein              812   0.0     Populus trichocarpa [western balsam poplar]
ref|NP_001047721.1|  Os02g0675700                                       812   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010456248.1|  PREDICTED: probable methyltransferase PMT15        812   0.0     
ref|NP_001053603.1|  Os04g0570800                                       812   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002875017.1|  dehydration-responsive family protein              811   0.0     
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...    810   0.0     
ref|NP_191984.1|  putative methyltransferase PMT15                      809   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EEC73773.1|  hypothetical protein OsI_08448                          810   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_003555372.1|  PREDICTED: probable methyltransferase PMT16-...    808   0.0     
emb|CDY18904.1|  BnaC04g04460D                                          809   0.0     
ref|XP_009128495.1|  PREDICTED: probable methyltransferase PMT15        810   0.0     
ref|XP_002880195.1|  dehydration-responsive family protein              808   0.0     
ref|XP_011023413.1|  PREDICTED: probable methyltransferase PMT15        808   0.0     
ref|XP_009143165.1|  PREDICTED: probable methyltransferase PMT16        807   0.0     
emb|CDX74761.1|  BnaA05g05070D                                          807   0.0     
emb|CDY37061.1|  BnaA04g26390D                                          806   0.0     
ref|XP_006397756.1|  hypothetical protein EUTSA_v10001358mg             806   0.0     
ref|XP_003592303.1|  hypothetical protein MTR_1g101370                  805   0.0     
gb|ABV72578.1|  dehydration-responsive family protein S51               805   0.0     Brassica rapa
ref|XP_009384529.1|  PREDICTED: probable methyltransferase PMT15        805   0.0     
ref|XP_007139952.1|  hypothetical protein PHAVU_008G072400g             804   0.0     
ref|XP_003551650.1|  PREDICTED: probable methyltransferase PMT16-...    801   0.0     
ref|XP_010933874.1|  PREDICTED: probable methyltransferase PMT15        804   0.0     
ref|XP_008668482.1|  PREDICTED: uncharacterized protein LOC100384...    804   0.0     
ref|XP_003580353.1|  PREDICTED: probable methyltransferase PMT15        804   0.0     
ref|XP_006293834.1|  hypothetical protein CARUB_v10022818mg             803   0.0     
ref|XP_010508116.1|  PREDICTED: probable methyltransferase PMT16        803   0.0     
ref|XP_010506552.1|  PREDICTED: probable methyltransferase PMT16        803   0.0     
ref|XP_008663475.1|  PREDICTED: probable methyltransferase PMT15        803   0.0     
ref|XP_009142361.1|  PREDICTED: probable methyltransferase PMT16        802   0.0     
ref|XP_008795397.1|  PREDICTED: probable methyltransferase PMT15        801   0.0     
ref|XP_009399379.1|  PREDICTED: probable methyltransferase PMT15        801   0.0     
ref|XP_010518192.1|  PREDICTED: probable methyltransferase PMT16        800   0.0     
ref|XP_006653692.1|  PREDICTED: probable methyltransferase PMT15-...    798   0.0     
ref|XP_004306838.1|  PREDICTED: probable methyltransferase PMT15-...    800   0.0     
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15        799   0.0     Vitis vinifera
ref|XP_010055225.1|  PREDICTED: probable methyltransferase PMT15 ...    797   0.0     
ref|XP_003533625.1|  PREDICTED: probable methyltransferase PMT15-...    795   0.0     
gb|ACN78962.1|  methyltransferase                                       800   0.0     Glycine max [soybeans]
dbj|BAJ87212.1|  predicted protein                                      795   0.0     
ref|XP_004976536.1|  PREDICTED: probable methyltransferase PMT15-...    794   0.0     
tpg|DAA36414.1|  TPA: hypothetical protein ZEAMMB73_585119              795   0.0     
gb|KEH18956.1|  methyltransferase                                       793   0.0     
dbj|BAJ84848.1|  predicted protein                                      793   0.0     
emb|CDM86771.1|  unnamed protein product                                793   0.0     
dbj|BAJ95401.1|  predicted protein                                      791   0.0     
ref|XP_003570093.1|  PREDICTED: probable methyltransferase PMT15        791   0.0     
ref|XP_002452759.1|  hypothetical protein SORBIDRAFT_04g032010          791   0.0     Sorghum bicolor [broomcorn]
dbj|BAJ98046.1|  predicted protein                                      790   0.0     
ref|XP_007134966.1|  hypothetical protein PHAVU_010G090800g             790   0.0     
ref|XP_003528883.1|  PREDICTED: probable methyltransferase PMT15-...    788   0.0     
ref|XP_006648932.1|  PREDICTED: probable methyltransferase PMT15-...    784   0.0     
ref|XP_010692380.1|  PREDICTED: probable methyltransferase PMT15        783   0.0     
emb|CDY27362.1|  BnaC04g50430D                                          796   0.0     
ref|XP_010250929.1|  PREDICTED: probable methyltransferase PMT18        780   0.0     
ref|XP_004492680.1|  PREDICTED: probable methyltransferase PMT15-...    793   0.0     
ref|XP_006857883.1|  hypothetical protein AMTR_s00069p00110310          776   0.0     
ref|XP_010091548.1|  putative methyltransferase PMT15                   776   0.0     
gb|KHG13750.1|  hypothetical protein F383_08462                         774   0.0     
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...    771   0.0     
ref|XP_004145886.1|  PREDICTED: probable methyltransferase PMT18-...    771   0.0     
ref|XP_004169220.1|  PREDICTED: probable methyltransferase PMT18-...    771   0.0     
gb|ABR16934.1|  unknown                                                 770   0.0     Picea sitchensis
ref|XP_010056104.1|  PREDICTED: probable methyltransferase PMT18        768   0.0     
gb|EEE61530.1|  hypothetical protein OsJ_15834                          763   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18        766   0.0     
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...    764   0.0     
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...    764   0.0     Vitis vinifera
gb|KDP25187.1|  hypothetical protein JCGZ_20343                         763   0.0     
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18        763   0.0     
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18        762   0.0     
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...    761   0.0     
ref|XP_010933740.1|  PREDICTED: probable methyltransferase PMT17        761   0.0     
ref|XP_001778231.1|  predicted protein                                  758   0.0     
ref|XP_006846537.1|  hypothetical protein AMTR_s00018p00198280          759   0.0     
ref|XP_002518966.1|  ATP binding protein, putative                      759   0.0     Ricinus communis
gb|KEH21299.1|  methyltransferase PMT16, putative                       758   0.0     
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17        758   0.0     
ref|XP_003525323.1|  PREDICTED: probable methyltransferase PMT18-...    758   0.0     
ref|XP_004953430.1|  PREDICTED: probable methyltransferase PMT16-...    758   0.0     
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18-...    757   0.0     
ref|XP_008677769.1|  PREDICTED: hypothetical protein isoform X1         758   0.0     
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18        757   0.0     
ref|XP_009389104.1|  PREDICTED: probable methyltransferase PMT17        757   0.0     
ref|NP_001065036.1|  Os10g0510400                                       757   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011070323.1|  PREDICTED: probable methyltransferase PMT18        756   0.0     
gb|EEC67295.1|  hypothetical protein OsI_34283                          756   0.0     Oryza sativa Indica Group [Indian rice]
emb|CDP12267.1|  unnamed protein product                                756   0.0     
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17        755   0.0     
ref|XP_002317647.1|  dehydration-responsive family protein              754   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_003530522.1|  PREDICTED: probable methyltransferase PMT18-...    754   0.0     
ref|XP_010934594.1|  PREDICTED: probable methyltransferase PMT17        754   0.0     
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg             753   0.0     
gb|KHN16709.1|  Putative methyltransferase PMT18                        752   0.0     
ref|XP_008813543.1|  PREDICTED: probable methyltransferase PMT17 ...    753   0.0     
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17        754   0.0     
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18        752   0.0     
ref|XP_008813541.1|  PREDICTED: probable methyltransferase PMT17 ...    753   0.0     
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15        751   0.0     
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18        751   0.0     
gb|AAX94055.2|  dehydration-induced protein                             751   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18        750   0.0     
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18        750   0.0     
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...    749   0.0     
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                    749   0.0     
gb|EEC79826.1|  hypothetical protein OsI_21282                          749   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18        748   0.0     
ref|NP_001056546.2|  Os06g0103900                                       748   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574187.1|  PREDICTED: probable methyltransferase PMT17 ...    748   0.0     
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340          746   0.0     Sorghum bicolor [broomcorn]
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg             746   0.0     
gb|EYU33422.1|  hypothetical protein MIMGU_mgv1a002913mg                746   0.0     
ref|XP_010234899.1|  PREDICTED: probable methyltransferase PMT17 ...    747   0.0     
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18        746   0.0     
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18        745   0.0     
ref|XP_002874627.1|  dehydration-responsive family protein              744   0.0     
dbj|BAK03905.1|  predicted protein                                      747   0.0     
gb|KHM99867.1|  Putative methyltransferase PMT18                        740   0.0     
emb|CDX99539.1|  BnaC09g24530D                                          744   0.0     
ref|XP_002298987.1|  dehydration-responsive family protein              740   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006655679.1|  PREDICTED: probable methyltransferase PMT17-...    744   0.0     
emb|CDX94256.1|  BnaC02g29160D                                          743   0.0     
ref|XP_006655678.1|  PREDICTED: probable methyltransferase PMT17-...    743   0.0     
ref|XP_009596889.1|  PREDICTED: probable methyltransferase PMT18        743   0.0     
ref|XP_009768341.1|  PREDICTED: probable methyltransferase PMT18        743   0.0     
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...    742   0.0     
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg             744   0.0     
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg             743   0.0     
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17        741   0.0     
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...    741   0.0     
gb|EMT22301.1|  hypothetical protein F775_16518                         741   0.0     
ref|XP_008676538.1|  PREDICTED: ankyrin protein kinase-like isofo...    741   0.0     
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17        740   0.0     
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...    740   0.0     
ref|XP_009398109.1|  PREDICTED: probable methyltransferase PMT18        739   0.0     
ref|NP_192782.1|  putative methyltransferase PMT17                      739   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                   739   0.0     
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...    739   0.0     
ref|NP_564419.1|  putative methyltransferase PMT18                      739   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_001148962.1|  ankyrin protein kinase-like                        739   0.0     Zea mays [maize]
ref|XP_002975160.1|  hypothetical protein SELMODRAFT_232460             738   0.0     
ref|XP_002891032.1|  dehydration-responsive family protein              738   0.0     
ref|XP_010529685.1|  PREDICTED: probable methyltransferase PMT18 ...    739   0.0     
ref|XP_010529687.1|  PREDICTED: probable methyltransferase PMT18 ...    739   0.0     
ref|XP_003557272.1|  PREDICTED: probable methyltransferase PMT17        738   0.0     
gb|EMS54302.1|  putative methyltransferase PMT17                        738   0.0     
ref|XP_009397639.1|  PREDICTED: probable methyltransferase PMT17        737   0.0     
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17        736   0.0     
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17        736   0.0     
ref|XP_010542260.1|  PREDICTED: probable methyltransferase PMT17 ...    736   0.0     
ref|XP_010542245.1|  PREDICTED: probable methyltransferase PMT17 ...    737   0.0     
ref|XP_010542252.1|  PREDICTED: probable methyltransferase PMT17 ...    737   0.0     
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17        735   0.0     
ref|XP_010542268.1|  PREDICTED: probable methyltransferase PMT17 ...    736   0.0     
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18        735   0.0     
ref|XP_010542228.1|  PREDICTED: probable methyltransferase PMT17 ...    737   0.0     
ref|XP_006352227.1|  PREDICTED: probable methyltransferase PMT18-...    733   0.0     
ref|XP_004244735.1|  PREDICTED: probable methyltransferase PMT18        734   0.0     
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg             734   0.0     
ref|XP_010542237.1|  PREDICTED: probable methyltransferase PMT17 ...    737   0.0     
ref|XP_008800812.1|  PREDICTED: probable methyltransferase PMT15        744   0.0     
ref|NP_001147806.1|  methyltransferase                                  733   0.0     Zea mays [maize]
ref|XP_009405306.1|  PREDICTED: probable methyltransferase PMT17 ...    732   0.0     
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18        732   0.0     
ref|XP_002437666.1|  hypothetical protein SORBIDRAFT_10g000440          730   0.0     Sorghum bicolor [broomcorn]
emb|CDX84046.1|  BnaC08g07230D                                          729   0.0     
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg             729   0.0     
gb|AAF97349.1|AC021045_6  Unknown Protein                               729   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_001782639.1|  predicted protein                                  728   0.0     
gb|ABR16582.1|  unknown                                                 726   0.0     Picea sitchensis
gb|KFK45055.1|  hypothetical protein AALP_AA1G338100                    726   0.0     
dbj|BAC24840.1|  dehydration-responsive protein-like                    726   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_009405339.1|  PREDICTED: probable methyltransferase PMT17 ...    726   0.0     
emb|CDY44966.1|  BnaA08g06660D                                          723   0.0     
ref|XP_001760613.1|  predicted protein                                  723   0.0     
ref|XP_007160205.1|  hypothetical protein PHAVU_002G301800g             723   0.0     
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18        719   0.0     
ref|XP_001779831.1|  predicted protein                                  717   0.0     
ref|XP_002982140.1|  hypothetical protein SELMODRAFT_115825             716   0.0     
ref|XP_002966153.1|  hypothetical protein SELMODRAFT_143797             714   0.0     
emb|CDY54063.1|  BnaA02g36490D                                          708   0.0     
gb|EMS62160.1|  putative methyltransferase PMT17                        707   0.0     
ref|XP_007155749.1|  hypothetical protein PHAVU_003G228500g             704   0.0     
emb|CBI34642.3|  unnamed protein product                                701   0.0     
gb|KHN21029.1|  Putative methyltransferase PMT14                        701   0.0     
ref|XP_003524439.1|  PREDICTED: probable methyltransferase PMT14-...    702   0.0     
ref|XP_002977565.1|  hypothetical protein SELMODRAFT_443549             702   0.0     
ref|XP_006600888.1|  PREDICTED: probable methyltransferase PMT14 ...    701   0.0     
ref|XP_006436790.1|  hypothetical protein CICLE_v10030990mg             701   0.0     
ref|XP_006385609.1|  hypothetical protein POPTR_0003s08590g             698   0.0     
gb|KDP22915.1|  hypothetical protein JCGZ_01776                         698   0.0     
ref|XP_008781841.1|  PREDICTED: probable methyltransferase PMT2         697   0.0     
ref|XP_010552579.1|  PREDICTED: probable methyltransferase PMT2         696   0.0     
ref|XP_011032031.1|  PREDICTED: probable methyltransferase PMT14        696   0.0     
ref|XP_007039581.1|  S-adenosyl-L-methionine-dependent methyltran...    696   0.0     
ref|XP_010258374.1|  PREDICTED: probable methyltransferase PMT2         696   0.0     
ref|XP_006368452.1|  hypothetical protein POPTR_0001s02930g             695   0.0     
ref|XP_011018632.1|  PREDICTED: probable methyltransferase PMT14 ...    695   0.0     
ref|XP_010529126.1|  PREDICTED: probable methyltransferase PMT14        693   0.0     
ref|XP_006827213.1|  hypothetical protein AMTR_s00010p00259630          693   0.0     
ref|XP_004508998.1|  PREDICTED: probable methyltransferase PMT14-...    692   0.0     
ref|XP_010919849.1|  PREDICTED: probable methyltransferase PMT2         693   0.0     
ref|XP_002528760.1|  ATP binding protein, putative                      692   0.0     
ref|XP_010275323.1|  PREDICTED: probable methyltransferase PMT14        692   0.0     
ref|XP_007051921.1|  S-adenosyl-L-methionine-dependent methyltran...    689   0.0     
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2         692   0.0     
ref|XP_002460211.1|  hypothetical protein SORBIDRAFT_02g024670          691   0.0     
gb|KDO86014.1|  hypothetical protein CISIN_1g006633mg                   688   0.0     
ref|XP_010559283.1|  PREDICTED: probable methyltransferase PMT14        691   0.0     
ref|XP_002282093.2|  PREDICTED: probable methyltransferase PMT14        690   0.0     
ref|XP_004956815.1|  PREDICTED: probable methyltransferase PMT2-l...    689   0.0     
ref|XP_008651354.1|  PREDICTED: uncharacterized protein LOC100279...    688   0.0     
ref|XP_010683197.1|  PREDICTED: probable methyltransferase PMT2         687   0.0     
gb|EAZ09099.1|  hypothetical protein OsI_31366                          687   0.0     
ref|XP_006660624.1|  PREDICTED: probable methyltransferase PMT2-like    687   0.0     
ref|XP_004511207.1|  PREDICTED: probable methyltransferase PMT2-l...    687   0.0     
gb|KDP41191.1|  hypothetical protein JCGZ_15598                         687   0.0     
ref|NP_001152470.1|  ankyrin protein kinase-like                        686   0.0     
ref|NP_001063174.1|  Os09g0415700                                       686   0.0     
ref|XP_002893375.1|  dehydration-responsive family protein              686   0.0     
ref|XP_006438677.1|  hypothetical protein CICLE_v10030989mg             686   0.0     
ref|XP_010110495.1|  putative methyltransferase PMT14                   686   0.0     
ref|XP_006415973.1|  hypothetical protein EUTSA_v10007096mg             686   0.0     
ref|XP_010053567.1|  PREDICTED: probable methyltransferase PMT14        686   0.0     
ref|XP_006656589.1|  PREDICTED: probable methyltransferase PMT15-...    683   0.0     
ref|XP_006303579.1|  hypothetical protein CARUB_v10011097mg             685   0.0     
dbj|BAH19504.1|  AT1G26850                                              685   0.0     
emb|CDY46435.1|  BnaA08g19950D                                          684   0.0     
gb|EMS49438.1|  putative methyltransferase PMT2                         685   0.0     
ref|XP_003578117.1|  PREDICTED: probable methyltransferase PMT2         684   0.0     
ref|XP_004984213.1|  PREDICTED: probable methyltransferase PMT2-l...    684   0.0     
gb|EMT27426.1|  hypothetical protein F775_29617                         684   0.0     
ref|XP_002317981.2|  hypothetical protein POPTR_0012s07080g             684   0.0     
ref|XP_004984212.1|  PREDICTED: probable methyltransferase PMT2-l...    684   0.0     
ref|XP_010498988.1|  PREDICTED: probable methyltransferase PMT2         684   0.0     
emb|CDY40268.1|  BnaA07g09320D                                          684   0.0     
ref|NP_564265.1|  putative methyltransferase PMT2                       684   0.0     
emb|CDY03207.1|  BnaC09g19490D                                          684   0.0     
ref|XP_006602298.1|  PREDICTED: probable methyltransferase PMT2-like    683   0.0     
ref|XP_010532828.1|  PREDICTED: probable methyltransferase PMT2         683   0.0     
ref|XP_010460256.1|  PREDICTED: probable methyltransferase PMT2         683   0.0     
ref|XP_008229546.1|  PREDICTED: probable methyltransferase PMT14        682   0.0     
ref|XP_008389474.1|  PREDICTED: probable methyltransferase PMT2         682   0.0     
emb|CDY45006.1|  BnaCnng12360D                                          682   0.0     
ref|XP_007210880.1|  hypothetical protein PRUPE_ppa003016mg             681   0.0     
ref|XP_008658538.1|  PREDICTED: probable methyltransferase PMT2         681   0.0     
ref|XP_006280182.1|  hypothetical protein CARUB_v10026086mg             681   0.0     
ref|XP_003518725.1|  PREDICTED: probable methyltransferase PMT2-like    681   0.0     
ref|XP_009103114.1|  PREDICTED: probable methyltransferase PMT2         681   0.0     
ref|XP_008441700.1|  PREDICTED: probable methyltransferase PMT2         681   0.0     
ref|XP_009114343.1|  PREDICTED: probable methyltransferase PMT14        681   0.0     
ref|XP_011013091.1|  PREDICTED: probable methyltransferase PMT2         680   0.0     
ref|XP_009390921.1|  PREDICTED: probable methyltransferase PMT2         681   0.0     
ref|XP_009591906.1|  PREDICTED: probable methyltransferase PMT2         681   0.0     
ref|XP_009624681.1|  PREDICTED: probable methyltransferase PMT2         680   0.0     
gb|EPS59468.1|  hypothetical protein M569_15338                         680   0.0     
gb|KHN17371.1|  Putative methyltransferase PMT2                         680   0.0     
ref|XP_006650137.1|  PREDICTED: probable methyltransferase PMT2-like    680   0.0     
emb|CDY16198.1|  BnaA09g29320D                                          679   0.0     
ref|XP_010494834.1|  PREDICTED: probable methyltransferase PMT14        680   0.0     
ref|XP_003517972.1|  PREDICTED: probable methyltransferase PMT2-like    679   0.0     
ref|XP_010257294.1|  PREDICTED: probable methyltransferase PMT2         680   0.0     
ref|XP_004986789.1|  PREDICTED: probable methyltransferase PMT2-like    679   0.0     
ref|XP_009782774.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_009115418.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_009110047.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_009413462.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_003532062.1|  PREDICTED: probable methyltransferase PMT2-l...    679   0.0     
ref|XP_009761475.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_010917038.1|  PREDICTED: probable methyltransferase PMT2         679   0.0     
ref|XP_004238796.1|  PREDICTED: probable methyltransferase PMT2         678   0.0     
ref|NP_001280936.1|  uncharacterized protein LOC103402903               677   0.0     
gb|ABO92980.1|  putative methyltransferase                              677   0.0     
ref|XP_004138921.1|  PREDICTED: probable methyltransferase PMT2-like    677   0.0     
ref|XP_009360348.1|  PREDICTED: probable methyltransferase PMT2         677   0.0     
ref|XP_002511570.1|  ATP binding protein, putative                      677   0.0     
ref|XP_009371899.1|  PREDICTED: probable methyltransferase PMT14 ...    677   0.0     
ref|XP_003628357.1|  hypothetical protein MTR_8g055840                  677   0.0     
ref|NP_001050233.1|  Os03g0379100                                       677   0.0     
ref|XP_008221626.1|  PREDICTED: probable methyltransferase PMT2         677   0.0     
ref|XP_006366112.1|  PREDICTED: probable methyltransferase PMT2-l...    676   0.0     
gb|KHG27439.1|  hypothetical protein F383_15139                         677   0.0     
ref|XP_008339908.1|  PREDICTED: probable methyltransferase PMT2         676   0.0     
ref|XP_007222021.1|  hypothetical protein PRUPE_ppa002971mg             676   0.0     
gb|KHN12213.1|  Putative methyltransferase PMT2                         674   0.0     
ref|XP_010481446.1|  PREDICTED: probable methyltransferase PMT14        676   0.0     
ref|XP_009371893.1|  PREDICTED: probable methyltransferase PMT14 ...    676   0.0     
ref|XP_006354784.1|  PREDICTED: probable methyltransferase PMT2-like    675   0.0     
ref|XP_010089758.1|  putative methyltransferase PMT2                    675   0.0     
gb|EMT05545.1|  hypothetical protein F775_20122                         675   0.0     
ref|XP_002467784.1|  hypothetical protein SORBIDRAFT_01g034010          674   0.0     
ref|XP_003557818.1|  PREDICTED: probable methyltransferase PMT2         674   0.0     
emb|CDP12957.1|  unnamed protein product                                674   0.0     
ref|XP_008448741.1|  PREDICTED: probable methyltransferase PMT14        674   0.0     
ref|XP_010937120.1|  PREDICTED: probable methyltransferase PMT2 i...    674   0.0     
gb|ACJ85858.1|  unknown                                                 674   0.0     
ref|XP_004300275.1|  PREDICTED: probable methyltransferase PMT14-...    673   0.0     
ref|XP_010029610.1|  PREDICTED: probable methyltransferase PMT2 i...    673   0.0     
emb|CAH18000.1|  Ankyrin protein kinase-like                            673   0.0     
ref|XP_002273644.1|  PREDICTED: probable methyltransferase PMT2         674   0.0     
ref|XP_009626042.1|  PREDICTED: probable methyltransferase PMT2         673   0.0     
ref|XP_004241578.1|  PREDICTED: probable methyltransferase PMT2         673   0.0     
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...    673   0.0     
ref|XP_010695192.1|  PREDICTED: probable methyltransferase PMT14        673   0.0     
ref|XP_008659999.1|  PREDICTED: probable methyltransferase PMT2 i...    672   0.0     
ref|XP_009393700.1|  PREDICTED: probable methyltransferase PMT2 i...    672   0.0     
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2         672   0.0     
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2         672   0.0     
gb|EAY79581.1|  hypothetical protein OsI_34717                          671   0.0     
emb|CDX78823.1|  BnaA01g08900D                                          672   0.0     
ref|XP_009393699.1|  PREDICTED: probable methyltransferase PMT2 i...    672   0.0     
emb|CDY35169.1|  BnaA09g18060D                                          676   0.0     
ref|XP_006662085.1|  PREDICTED: probable methyltransferase PMT2-like    671   0.0     
ref|XP_007037318.1|  S-adenosyl-L-methionine-dependent methyltran...    672   0.0     
gb|EAZ17038.1|  hypothetical protein OsJ_32528                          670   0.0     
gb|AAL86466.1|AC077693_5  hypothetical protein                          673   0.0     
ref|NP_001065447.2|  Os10g0569300                                       670   0.0     
ref|XP_009793368.1|  PREDICTED: probable methyltransferase PMT14        671   0.0     
ref|XP_009131372.1|  PREDICTED: probable methyltransferase PMT14        671   0.0     
ref|XP_007153607.1|  hypothetical protein PHAVU_003G049900g             670   0.0     
emb|CDX85977.1|  BnaC06g21570D                                          665   0.0     
ref|XP_002275852.1|  PREDICTED: probable methyltransferase PMT2         670   0.0     
ref|XP_006414159.1|  hypothetical protein EUTSA_v10024685mg             670   0.0     
gb|EYU28744.1|  hypothetical protein MIMGU_mgv1a003087mg                669   0.0     
ref|XP_010937119.1|  PREDICTED: probable methyltransferase PMT2 i...    669   0.0     
ref|XP_009587333.1|  PREDICTED: probable methyltransferase PMT14        669   0.0     
ref|XP_004150171.1|  PREDICTED: probable methyltransferase PMT14-...    669   0.0     
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...    669   0.0     
ref|XP_009380165.1|  PREDICTED: probable methyltransferase PMT2         669   0.0     
gb|EYU22421.1|  hypothetical protein MIMGU_mgv1a003056mg                668   0.0     
ref|XP_003613748.1|  hypothetical protein MTR_5g040360                  668   0.0     
ref|XP_007157631.1|  hypothetical protein PHAVU_002G085900g             668   0.0     
ref|XP_009793104.1|  PREDICTED: probable methyltransferase PMT2         668   0.0     
ref|XP_010066916.1|  PREDICTED: probable methyltransferase PMT2         668   0.0     
ref|XP_004297305.1|  PREDICTED: probable methyltransferase PMT2-like    667   0.0     
gb|ACA66248.1|  putative methyltransferase                              667   0.0     
ref|XP_011021619.1|  PREDICTED: probable methyltransferase PMT2         667   0.0     
gb|ACB54686.1|  methyltransferase                                       667   0.0     
dbj|BAJ85549.1|  predicted protein                                      669   0.0     
ref|XP_010449513.1|  PREDICTED: probable methyltransferase PMT14        666   0.0     
emb|CDP00327.1|  unnamed protein product                                665   0.0     
ref|XP_011015217.1|  PREDICTED: probable methyltransferase PMT2         665   0.0     
ref|XP_010551537.1|  PREDICTED: probable methyltransferase PMT2 i...    665   0.0     
tpg|DAA46388.1|  TPA: hypothetical protein ZEAMMB73_857191              664   0.0     
ref|XP_010434585.1|  PREDICTED: probable methyltransferase PMT14        664   0.0     
gb|KEH17380.1|  methyltransferase PMT16, putative                       660   0.0     
ref|XP_010439911.1|  PREDICTED: probable methyltransferase PMT14        664   0.0     
ref|XP_002311593.1|  hypothetical protein POPTR_0008s14720g             663   0.0     
emb|CBI33946.3|  unnamed protein product                                659   0.0     
ref|XP_011075499.1|  PREDICTED: probable methyltransferase PMT2         663   0.0     
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative          694   0.0     
ref|NP_193537.2|  putative methyltransferase PMT14                      663   0.0     
gb|KDP31241.1|  hypothetical protein JCGZ_11617                         662   0.0     
ref|XP_009772034.1|  PREDICTED: probable methyltransferase PMT2         662   0.0     
ref|XP_002315803.2|  hypothetical protein POPTR_0010s10420g             662   0.0     
gb|KHG10506.1|  hypothetical protein F383_11349                         662   0.0     
ref|XP_011025778.1|  PREDICTED: probable methyltransferase PMT2         662   0.0     
emb|CDX93797.1|  BnaA09g23970D                                          657   0.0     
gb|EMS59429.1|  putative methyltransferase PMT17                        661   0.0     
ref|XP_011071001.1|  PREDICTED: probable methyltransferase PMT2         661   0.0     
ref|XP_002868016.1|  dehydration-responsive family protein              661   0.0     
ref|XP_011027055.1|  PREDICTED: probable methyltransferase PMT2         661   0.0     
ref|XP_006439600.1|  hypothetical protein CICLE_v10019341mg             660   0.0     
dbj|BAH19630.1|  AT4G18030                                              660   0.0     
ref|XP_006398351.1|  hypothetical protein EUTSA_v10000856mg             655   0.0     
emb|CDP12320.1|  unnamed protein product                                674   0.0     
gb|KHG23981.1|  hypothetical protein F383_09020                         658   0.0     
ref|XP_003574364.1|  PREDICTED: probable methyltransferase PMT2         658   0.0     
ref|XP_009595709.1|  PREDICTED: probable methyltransferase PMT2         658   0.0     
gb|EPS64080.1|  hypothetical protein M569_10695                         658   0.0     
ref|XP_004245869.1|  PREDICTED: probable methyltransferase PMT14        657   0.0     
gb|KDO82910.1|  hypothetical protein CISIN_1g0105922mg                  652   0.0     
ref|XP_004235979.1|  PREDICTED: probable methyltransferase PMT2         656   0.0     
emb|CAA17146.1|  putative protein                                       656   0.0     
ref|XP_007046111.1|  S-adenosyl-L-methionine-dependent methyltran...    655   0.0     
ref|XP_006476610.1|  PREDICTED: probable methyltransferase PMT2-l...    655   0.0     
ref|XP_007210881.1|  hypothetical protein PRUPE_ppa003018mg             655   0.0     
gb|EAZ35683.1|  hypothetical protein OsJ_19971                          654   0.0     
ref|XP_006358580.1|  PREDICTED: probable methyltransferase PMT14-...    654   0.0     
ref|XP_006283339.1|  hypothetical protein CARUB_v10004377mg             653   0.0     
ref|XP_010668105.1|  PREDICTED: probable methyltransferase PMT2         652   0.0     
gb|KHN21848.1|  Putative methyltransferase PMT2                         650   0.0     
ref|XP_003523024.1|  PREDICTED: probable methyltransferase PMT2-l...    650   0.0     
ref|XP_010091504.1|  putative methyltransferase PMT2                    650   0.0     
gb|KHN01216.1|  Putative methyltransferase PMT2                         646   0.0     
gb|ABO93008.1|  putative methyltransferase                              645   0.0     
ref|XP_008239959.1|  PREDICTED: probable methyltransferase PMT2         649   0.0     
ref|XP_003628358.1|  hypothetical protein MTR_8g055840                  645   0.0     
ref|XP_006364604.1|  PREDICTED: probable methyltransferase PMT2-like    649   0.0     
emb|CBI31965.3|  unnamed protein product                                645   0.0     
emb|CDY50730.1|  BnaC05g50930D                                          644   0.0     
gb|EMS63414.1|  putative methyltransferase PMT2                         644   0.0     
emb|CAN60192.1|  hypothetical protein VITISV_038569                     648   0.0     
emb|CBI15236.3|  unnamed protein product                                641   0.0     
ref|XP_004299370.1|  PREDICTED: probable methyltransferase PMT2-like    645   0.0     
ref|XP_007138189.1|  hypothetical protein PHAVU_009G187900g             644   0.0     
ref|XP_009405347.1|  PREDICTED: probable methyltransferase PMT17 ...    641   0.0     
ref|XP_004499421.1|  PREDICTED: probable methyltransferase PMT2-l...    643   0.0     
ref|XP_009369302.1|  PREDICTED: probable methyltransferase PMT2         643   0.0     
gb|KEH33485.1|  methyltransferase PMT2-like protein                     643   0.0     
ref|XP_008356626.1|  PREDICTED: probable methyltransferase PMT2         643   0.0     
gb|EMS46508.1|  putative methyltransferase PMT2                         639   0.0     
ref|XP_010912141.1|  PREDICTED: probable methyltransferase PMT19        642   0.0     
ref|XP_008802371.1|  PREDICTED: probable methyltransferase PMT19        641   0.0     
ref|XP_010650488.1|  PREDICTED: probable methyltransferase PMT19        639   0.0     
gb|KHN04623.1|  Putative methyltransferase PMT15                        632   0.0     
emb|CBI39181.3|  unnamed protein product                                640   0.0     
tpg|DAA42264.1|  TPA: methyltransferase isoform 1                       637   0.0     
ref|XP_010055227.1|  PREDICTED: probable methyltransferase PMT15 ...    636   0.0     
ref|XP_009342549.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    632   0.0     
ref|XP_010055373.1|  PREDICTED: probable methyltransferase PMT19        636   0.0     



>ref|XP_004234366.1| PREDICTED: probable methyltransferase PMT16 [Solanum lycopersicum]
Length=650

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/648 (72%), Positives = 538/648 (83%), Gaps = 22/648 (3%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLY-LALLAIFCTLSYHFGTWQNgggasgtsissi  1792
             PYYTPT KP+ P  N+ + S     L Y LA +   C   Y+ G  Q+     G  +S+ 
Sbjct  10    PYYTPTSKPSPP--NYPFSSWKKLNLYYSLAAITFLCCACYYAGQLQHTTTNVGLHLSN-  66

Query  1791  ftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV  1612
                   TA TC  S NT + +SS++   SS           GDG GGAV+    +D+VK+
Sbjct  67    ------TASTCFSSQNTTSPVSSSSPVSSSSQLDFTTHHSAGDGAGGAVV---PDDTVKI  117

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YPPCDVKYSEYTPCED  RSL Y+R+RLIYRERHCP+KSE LKCRIPAP+GY+NPFKWP 
Sbjct  118   YPPCDVKYSEYTPCEDPTRSLKYNRDRLIYRERHCPEKSEFLKCRIPAPYGYKNPFKWPM  177

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+AWY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINLKD
Sbjct  178   SRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLKD  237

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH++QVQFALERGVPALIG++ASKRL
Sbjct  238   GSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVPALIGVIASKRL  297

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGGYWILSGPPI W++YW+GW+RT+
Sbjct  298   PYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGYWILSGPPIHWRKYWKGWERTK  357

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             +DL AEQT+IEKVA SLCWKKF+E DDIAIWQKPYNH+ C  LR+A   PPMCPA  DPD
Sbjct  358   QDLNAEQTKIEKVARSLCWKKFVEKDDIAIWQKPYNHLQCKELRKASKNPPMCPA-QDPD  416

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYTD++TCLT LP+VS E+     +LEKWPKRL+A+PPRI RGT++G++ + F +DS 
Sbjct  417   KAWYTDIETCLTSLPEVSSEEKVAGGQLEKWPKRLHAIPPRISRGTVNGVTSDTFNEDSQ  476

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW +R+S+Y  V + QL + GRYRN+LDMNA+LGGFAA LVD  +WVMN+VP E+K+NTL
Sbjct  477   LWKRRVSYYKTV-NNQLGQPGRYRNLLDMNAYLGGFAANLVDDPVWVMNIVPPEAKVNTL  535

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G+IYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLYKDRCEMEDILLEMDRILRPEGS
Sbjct  536   GIIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEGS  595

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD LIKVKRITDGL W+S++VDHEDGPL+REKLLFAVK+YWT
Sbjct  596   VIIRDDVDTLIKVKRITDGLNWDSQIVDHEDGPLEREKLLFAVKSYWT  643



>ref|XP_006353348.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=647

 Score =   926 bits (2394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/649 (72%), Positives = 536/649 (83%), Gaps = 25/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI--FCTLSYHFGTWQNgggasgtsiss  1795
             PYYTPT KP+ P H    +   N   LY +L AI   C   Y+ G  Q+     G  +S+
Sbjct  8     PYYTPTSKPSQPTHPFSSWKRLN---LYYSLAAITFLCCACYYAGQLQHTTTTVGLHLSN  64

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
                     A +C  S NT + + S++   SS    LDFTTHH  GDG       D D+VK
Sbjct  65    -------IASSCFSSQNTTSPVFSSSPVSSSQ---LDFTTHHSAGDGDGGAVVPD-DTVK  113

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
             +YPPCDVKYSEYTPCED  RSL Y+R+RLIYRERHCP+KSE LKCRIPAP+GY+NPFKWP
Sbjct  114   IYPPCDVKYSEYTPCEDPARSLKYNRDRLIYRERHCPEKSEFLKCRIPAPYGYKNPFKWP  173

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRD+AWY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINLK
Sbjct  174   MSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLK  233

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH++QVQFALERGVPALIG++ASKR
Sbjct  234   DGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVPALIGVIASKR  293

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGGYWILSGPPI W++YW+GW+RT
Sbjct  294   LPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGYWILSGPPIHWRKYWKGWERT  353

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDP  721
             +EDL AEQT+IEKVA SLCWKKF+E DDIAIWQKPYNH+ C  LR+    PPMCPA  DP
Sbjct  354   KEDLNAEQTKIEKVARSLCWKKFVEKDDIAIWQKPYNHLQCKELRKTSKNPPMCPA-QDP  412

Query  720   DMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT+++TCLT LP+VS E+     +LEKWPKRL+A+PPRI RGT++G++ + F KDS
Sbjct  413   DRAWYTEIETCLTSLPEVSSEEKVAGGQLEKWPKRLHAIPPRISRGTLNGVTSDTFNKDS  472

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW +R+S+Y  V + QL + GRYRN+LDMNA+LGGFAA LVD  +WVMN+VP E+ +NT
Sbjct  473   QLWKRRVSYYKTV-NNQLGQPGRYRNLLDMNAYLGGFAANLVDDPVWVMNIVPAEANVNT  531

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLYKDRCEMEDILLEMDRILRPEG
Sbjct  532   LGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEG  591

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD LIKVKRITDGL W+S++VDHEDGPL+REKLLFAVK+YWT
Sbjct  592   SVIIRDDVDTLIKVKRITDGLNWDSQIVDHEDGPLEREKLLFAVKSYWT  640



>emb|CDP05238.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   923 bits (2385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/647 (71%), Positives = 529/647 (82%), Gaps = 19/647 (3%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             PYYTP  KPA   H + +     N L  L L+ I C+LSY FG WQ+GG  +  +  S  
Sbjct  8     PYYTPISKPAANAHVNTW---KRNNLYSLVLITILCSLSYLFGVWQHGGATTSFTTPS--  62

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVY  1609
                + +   C+   NT T++++T    S+    LDF++HH   D G  +G     S KVY
Sbjct  63    --NVGSTPPCVLPENTTTSIATTASKTSNSK-ALDFSSHHSADDRG--IGKVSGGSAKVY  117

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCDVKYSEYTPCED +RSL + R RLIYRERHCP K E+LKCRIPAP+GYRNPFKWP S
Sbjct  118   PPCDVKYSEYTPCEDPKRSLKFSRSRLIYRERHCPAKHELLKCRIPAPYGYRNPFKWPLS  177

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD+AWY NVPHKELTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLINLKDG
Sbjct  178   RDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLKDG  237

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSRNIL MSFAPRDTH++QVQFALERGVPALIG+LASKRLP
Sbjct  238   SIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVPALIGVLASKRLP  297

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQYDG +L EVDRVLRPGGYWILSGPPIRW++YW+GW RT E
Sbjct  298   YPSRAFDMAHCSRCLIPWGQYDGVFLTEVDRVLRPGGYWILSGPPIRWRKYWKGWQRTRE  357

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL  EQT IE+VA SLCWKK +E DDIAIWQKP NH  C +L++    P  CP + DPD 
Sbjct  358   DLNKEQTGIEQVAKSLCWKKLIEKDDIAIWQKPANHTQCKKLKKVYNSPAFCP-NQDPDK  416

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT+++TCLTPLP+VSD +E     LEKWPKRLNA+PPRI  GT++GI+ + F+KDS L
Sbjct  417   AWYTNIETCLTPLPEVSDGEEIAGGRLEKWPKRLNAMPPRISTGTVNGITPQTFQKDSQL  476

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W +RIS+Y  V + QL +AGRYRN+LDMNAFLGGFAA+LV+  +WVMNV+PVE+K+NTLG
Sbjct  477   WERRISYYKTV-NNQLGQAGRYRNLLDMNAFLGGFAASLVEDPVWVMNVIPVEAKVNTLG  535

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VIYERGLIGTY +WCEAMSTYPRTYDLIHADS+ TLYKDRCEMEDILLEMDRILRPEGS+
Sbjct  536   VIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVLTLYKDRCEMEDILLEMDRILRPEGSL  595

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVD L+K KRI D L W+S++VDHEDGPL+REKLLFAVK+YWT
Sbjct  596   IIRDDVDTLVKAKRIADALNWDSQIVDHEDGPLEREKLLFAVKSYWT  642



>ref|XP_009610423.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=651

 Score =   922 bits (2383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/649 (71%), Positives = 532/649 (82%), Gaps = 24/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI--FCTLSYHFGTWQNgggasgtsiss  1795
             PYYTPT KP+   H    +   N    Y +L A+   C   Y+ G  Q+         +S
Sbjct  8     PYYTPTSKPSAATHPFSSWKKLN---FYYSLAAVTFLCCACYYVGYLQHSNVGLRVLTTS  64

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
                  +A+   C  S N  +T S  + S SS    LDF+THH   DGGAV     +D+VK
Sbjct  65    ----TLASTTNCFSSQNKTSTTSRVSSSSSSP---LDFSTHHAADDGGAVTA---DDAVK  114

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
             +YPPCD KYSEYTPCED +RSL + R+RLIYRERHCP+KSE+LKCRIPAP+GY+NPFKWP
Sbjct  115   IYPPCDFKYSEYTPCEDQKRSLKFKRDRLIYRERHCPEKSELLKCRIPAPYGYKNPFKWP  174

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRD+AWY NVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMF NGADAYIDDIGKLINLK
Sbjct  175   LSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFPNGADAYIDDIGKLINLK  234

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNIL MSFAPRDTH++QVQFALERGVPALIG++ASKR
Sbjct  235   DGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVPALIGVIASKR  294

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGGYWILSGPPI W++YW+GW+RT
Sbjct  295   LPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGYWILSGPPINWRKYWKGWERT  354

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDP  721
              EDL AEQT+IE+VA SLCWKKF+E DDIAIWQKPYNH+ C   R+    PPMCPA  DP
Sbjct  355   REDLNAEQTKIEQVAKSLCWKKFVEKDDIAIWQKPYNHLQCKESRKMSRNPPMCPA-QDP  413

Query  720   DMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT+++TCLTPLPQVS E+      LEKWPKRL+A+PPRI RGT++G++ + F+KDS
Sbjct  414   DKAWYTEIETCLTPLPQVSSEERVAGGHLEKWPKRLHAIPPRISRGTVNGVTADTFKKDS  473

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW +RIS+Y  V + QL + GRYRN+LDMNA LGGFAA LVD  +WVMN+VPVE+K+NT
Sbjct  474   QLWKRRISYYKTV-NNQLGQPGRYRNLLDMNANLGGFAANLVDDPVWVMNIVPVEAKVNT  532

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY  WCEAMSTYPRTYDLIHADS+FTLYKDRCEMEDILLEMDRILRPEG
Sbjct  533   LGVIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFTLYKDRCEMEDILLEMDRILRPEG  592

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD L+KVKRI DGL W+S++VDHE+GPL+REKLLFAVK+YWT
Sbjct  593   SVIIRDDVDTLVKVKRIVDGLNWDSQIVDHENGPLEREKLLFAVKSYWT  641



>ref|XP_011076214.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=658

 Score =   922 bits (2382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/650 (71%), Positives = 534/650 (82%), Gaps = 24/650 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             PYYTP  KP     +  Y   P  KL  LA++ I C+LSY FG WQ+GG  S +  S   
Sbjct  8     PYYTPLSKPTPTAPS--YLKKP--KLYSLAIITILCSLSYLFGAWQHGGATSSSPTS---  60

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAG---LDFtthhgdgdgGAVLGNHDEDSV  1618
                +     C  +    T  ++ TQS SS S+    LDF +HH   DGG    +    ++
Sbjct  61    --NLGATIPCFSTSQNNTITNTNTQSHSSSSSNAPKLDFASHHSADDGGVTTLS---PAI  115

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             K YPPCD+KYSEYTPCED ERSL +DR+RLIYRERHCP+K+E+LKCR+PAP+GY+NPF+W
Sbjct  116   KSYPPCDIKYSEYTPCEDQERSLKFDRDRLIYRERHCPEKNELLKCRVPAPYGYKNPFQW  175

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRD+AWY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINL
Sbjct  176   PLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINL  235

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
             KDGSIRTA+DTGCGVAS+GAYLLSRNIL MSFAPRDTH++QVQFALERGVPALIG++ASK
Sbjct  236   KDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVPALIGVIASK  295

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RLPYPS+AFDMAHCSRCLIPWGQYDGAYLIEVDR+LRPGGYWILSGPPI WK++W+GW+R
Sbjct  296   RLPYPSRAFDMAHCSRCLIPWGQYDGAYLIEVDRILRPGGYWILSGPPIHWKKHWKGWER  355

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASND  724
             T EDL AEQ QIE V  SLCWKK +E DDI+IWQKP NH+ C + R     PP CPA N 
Sbjct  356   TMEDLNAEQMQIENVTRSLCWKKLIEKDDISIWQKPANHLKCKKFRTVVRNPPFCPAQN-  414

Query  723   PDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWYT+L+TCLTPLP+VS+++E     LEKWP+RLN +PPRI RGT++G++ E F++D
Sbjct  415   PDQAWYTNLETCLTPLPEVSNKEEVAGGQLEKWPERLNTIPPRISRGTVNGVTAETFQQD  474

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+S+Y  V + QL +AGRYRN+LDMNAFLGGFAA L+D  LWVMNVVPVE+K+N
Sbjct  475   TQLWKKRVSYYKKV-NNQLGQAGRYRNILDMNAFLGGFAANLIDDPLWVMNVVPVEAKVN  533

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLYKDRCEMEDI+LEMDRILRPE
Sbjct  534   TLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYKDRCEMEDIMLEMDRILRPE  593

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GS+IIRDDVD+L+KVKRI D L WES++VDHEDGPL+REKLLFAVK YWT
Sbjct  594   GSLIIRDDVDILVKVKRIADALNWESQIVDHEDGPLEREKLLFAVKLYWT  643



>ref|XP_009770932.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=653

 Score =   920 bits (2379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/654 (70%), Positives = 539/654 (82%), Gaps = 32/654 (5%)
 Frame = -2

Query  1968  PYYTPTYKPA---LPLHN----HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasg  1810
             PYYTPT KP+   LP  +    + YYS        LA +   C   Y+ G  Q+      
Sbjct  8     PYYTPTSKPSSATLPFSSWKKLNPYYS--------LAAVTFLCCACYYAGYLQHSSVGLR  59

Query  1809  tsissiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHD  1630
                +S     IA+   C FS    T+++++  S +S S+ LDF THH   DGGAV     
Sbjct  60    VLTTST----IASTTNC-FSSQNNTSITTSRVSSTSSSSPLDFRTHHAADDGGAVA---P  111

Query  1629  EDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRN  1450
             +D+VK+YPPCDVK+SEYTPCED +RSL + R+RLIYRERHCP+K+E+LKCRIPAP+GY+N
Sbjct  112   DDAVKIYPPCDVKFSEYTPCEDQKRSLKFKRDRLIYRERHCPEKNELLKCRIPAPYGYKN  171

Query  1449  PFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGK  1270
             PFKWP SRD+AWY NVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMF NGADAYIDDIGK
Sbjct  172   PFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFPNGADAYIDDIGK  231

Query  1269  LINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGI  1090
             LINLKDGSIRTA+DTGCGVAS+GAYLLSRNIL MSFAPRDTH++QVQFALERGVPALIG+
Sbjct  232   LINLKDGSIRTAIDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVPALIGV  291

Query  1089  LASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQ  910
             +ASKRLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGGYWILSGPPI W+++W+
Sbjct  292   IASKRLPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGYWILSGPPINWRKHWK  351

Query  909   GWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCP  736
             GW+RT EDL AEQT+IE+VA SLCWKKF+E DDIAIWQKPYNH+ C   R+    PPMCP
Sbjct  352   GWERTREDLNAEQTKIEQVAKSLCWKKFVEKDDIAIWQKPYNHLQCKESRKMSRNPPMCP  411

Query  735   ASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEK  571
             A  DPD AWYT+++TCLTPLP+VS E      +LEKWPKRL+A+PPRI RGT++GI+ + 
Sbjct  412   A-QDPDKAWYTEIETCLTPLPEVSSEDRVAGGQLEKWPKRLHAIPPRISRGTVEGITADT  470

Query  570   FEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVE  391
             F+KDS LW +R+S+Y  V + QL + GRYRN+LDMNA LGGFAA LVD  +WVMN+VPVE
Sbjct  471   FKKDSQLWKRRMSYYKTV-NNQLGQPGRYRNLLDMNANLGGFAANLVDDPVWVMNIVPVE  529

Query  390   SKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRI  211
             +K+NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIH DS+FTLY+DRCEMEDILLEMDRI
Sbjct  530   AKVNTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHGDSVFTLYEDRCEMEDILLEMDRI  589

Query  210   LRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             LRPEGSVIIRDDVD+L+KVKRI DGL W+S++VDHEDGPL+REKLLFAVK+YWT
Sbjct  590   LRPEGSVIIRDDVDILVKVKRIADGLNWDSQIVDHEDGPLEREKLLFAVKSYWT  643



>ref|XP_009801989.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Nicotiana 
sylvestris]
Length=647

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/651 (70%), Positives = 535/651 (82%), Gaps = 29/651 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSP----NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsi  1801
             PYYTPT K     H    Y SP       L  L  +   C+  Y  G WQN G  S  + 
Sbjct  8     PYYTPTSK-----HTAATYHSPFLLKRPNLYSLVAVTFLCSAFYFTGLWQNRGSNSVITT  62

Query  1800  ssiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
             S+I    + T   C  S NT+T   ++++S       LDFTTHH   DGGAV     +DS
Sbjct  63    SNI----VHTTIPCFPSKNTSTNSPTSSKSTQK----LDFTTHHSTDDGGAVT---PDDS  111

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             +K+YPPCD+KYSEYTPCED ERSL ++R RLIYRERHCP+K+E+LKCRIPAP+GY+NPFK
Sbjct  112   IKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKNELLKCRIPAPYGYKNPFK  171

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD+AWY NVPHKELTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLIN
Sbjct  172   WPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLIN  231

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L DGSIRTA+DTGCGVAS+GAYLLSRNI+ +SFAPRD+H++QVQFALERGVPALIG++AS
Sbjct  232   LNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVPALIGVIAS  291

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPIRW++YW+GW 
Sbjct  292   KRLPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPIRWRKYWKGWA  351

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASN  727
             RT EDL AEQ +IE+VA  LCWKKF+E DDIAIWQKPYNH+ C   R R   PP+CPA  
Sbjct  352   RTREDLNAEQNKIEQVAKRLCWKKFVEKDDIAIWQKPYNHVKCTEFRRRVKNPPICPA-Q  410

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT ++TCLTPLP+VS+E+E     LEKWPKRL+A+PPRI RGT++G++ E F+K
Sbjct  411   DPDKAWYTKIETCLTPLPEVSNEQEVAGGQLEKWPKRLHAIPPRISRGTVNGVTEEDFQK  470

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             DS LW +R+S+Y +V + QL + G+YRN+LDMNAFLGGFAA LVD  +WVMN+ P E+K+
Sbjct  471   DSQLWKRRVSYYKSV-NNQLGQPGQYRNILDMNAFLGGFAANLVDDPVWVMNIAPAEAKV  529

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++RCEMEDI+LE+DRILRP
Sbjct  530   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENRCEMEDIMLELDRILRP  589

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EGSVIIRDDVD+LIKVKRI DGL W+S+++DHEDGPL+REKLLFAVK+YWT
Sbjct  590   EGSVIIRDDVDILIKVKRIADGLNWDSQIIDHEDGPLEREKLLFAVKSYWT  640



>ref|XP_009801988.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nicotiana 
sylvestris]
Length=648

 Score =   913 bits (2360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/652 (70%), Positives = 535/652 (82%), Gaps = 30/652 (5%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSP----NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsi  1801
             PYYTPT K     H    Y SP       L  L  +   C+  Y  G WQN G  S  + 
Sbjct  8     PYYTPTSK-----HTAATYHSPFLLKRPNLYSLVAVTFLCSAFYFTGLWQNRGSNSVITT  62

Query  1800  ssiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
             S+I    + T   C  S NT+T   ++++S       LDFTTHH   DGGAV     +DS
Sbjct  63    SNI----VHTTIPCFPSKNTSTNSPTSSKSTQK----LDFTTHHSTDDGGAVT---PDDS  111

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             +K+YPPCD+KYSEYTPCED ERSL ++R RLIYRERHCP+K+E+LKCRIPAP+GY+NPFK
Sbjct  112   IKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKNELLKCRIPAPYGYKNPFK  171

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD+AWY NVPHKELTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLIN
Sbjct  172   WPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLIN  231

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L DGSIRTA+DTGCGVAS+GAYLLSRNI+ +SFAPRD+H++QVQFALERGVPALIG++AS
Sbjct  232   LNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVPALIGVIAS  291

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPIRW++YW+GW 
Sbjct  292   KRLPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPIRWRKYWKGWA  351

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASN  727
             RT EDL AEQ +IE+VA  LCWKKF+E DDIAIWQKPYNH+ C   R R   PP+CPA  
Sbjct  352   RTREDLNAEQNKIEQVAKRLCWKKFVEKDDIAIWQKPYNHVKCTEFRRRVKNPPICPA-Q  410

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT ++TCLTPLP+VS+E+E     LEKWPKRL+A+PPRI RGT++G++ E F+K
Sbjct  411   DPDKAWYTKIETCLTPLPEVSNEQEVAGGQLEKWPKRLHAIPPRISRGTVNGVTEEDFQK  470

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             DS LW +R+S+Y +V + QL + G+YRN+LDMNAFLGGFAA LVD  +WVMN+ P E+K+
Sbjct  471   DSQLWKRRVSYYKSV-NNQLGQPGQYRNILDMNAFLGGFAANLVDDPVWVMNIAPAEAKV  529

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKD-RCEMEDILLEMDRILR  205
             NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++ RCEMEDI+LE+DRILR
Sbjct  530   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENSRCEMEDIMLELDRILR  589

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEGSVIIRDDVD+LIKVKRI DGL W+S+++DHEDGPL+REKLLFAVK+YWT
Sbjct  590   PEGSVIIRDDVDILIKVKRIADGLNWDSQIIDHEDGPLEREKLLFAVKSYWT  641



>ref|XP_006340522.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=654

 Score =   912 bits (2357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/649 (70%), Positives = 534/649 (82%), Gaps = 21/649 (3%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI--FCTLSYHFGTWQNgggasgtsiss  1795
             PYYTPT KP  P  +H   S P  K  + +L+AI   C+  Y  G WQ+    +G   SS
Sbjct  8     PYYTPTSKPT-PTSHHS--SLPLKKPNFYSLIAITFLCSAFYFTGLWQSSTTGTGAGSSS  64

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
             +      T+  C  S NT+T   S+  +       LDFTTHH   DGGA +   D D++K
Sbjct  65    VVI--TTTSLPCFPSKNTSTNPPSSRTTTKK----LDFTTHHSAADGGAAVTAPD-DAIK  117

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
             +YP CD+KYSEYTPCED ERSL ++R RLIYRERHCP+K+E+LKCRIPAP+GY+NPFKWP
Sbjct  118   IYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNELLKCRIPAPYGYKNPFKWP  177

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDVAWY NVPHKELTVEKAVQNWIR+EGD+F+FPGGGTMF NGADAYIDDI KLINLK
Sbjct  178   VSRDVAWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINLK  237

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNI+ MSFAPRD+H++QVQFALERGVPALIG++ASKR
Sbjct  238   DGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVPALIGVIASKR  297

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPI WKR+W+GW+RT
Sbjct  298   LPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPINWKRHWKGWERT  357

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDP  721
              EDL AEQ +IE+VA  LCWKKF+E DDIAIWQKP+NHM C   R R   PPMCPA  DP
Sbjct  358   REDLYAEQNKIEQVAKRLCWKKFVEKDDIAIWQKPFNHMKCTEFRNRNKNPPMCPA-QDP  416

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT ++TCLTPLP+V+ E+E     LEKWPKRL+ +PPRI RGT+DG++ E F+KDS
Sbjct  417   DKAWYTKIETCLTPLPKVASEEEVAGGQLEKWPKRLHVIPPRISRGTVDGVTEEVFQKDS  476

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW +R+S+Y +V + QL + GRYRN+LDMNAFLGGFAA LV+  +WVMN+VP+E+K+NT
Sbjct  477   QLWKRRVSYYKSV-NNQLDQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPLEAKVNT  535

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++RCEMEDI+LE+DRILRPEG
Sbjct  536   LGAIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENRCEMEDIMLELDRILRPEG  595

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD+LI+VKRI DGL W+S++VDHEDGPL+REKL FAVKTY T
Sbjct  596   SVIIRDDVDILIRVKRIADGLNWDSQIVDHEDGPLEREKLFFAVKTYST  644



>ref|XP_011101180.1| PREDICTED: probable methyltransferase PMT16 [Sesamum indicum]
Length=645

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 447/647 (69%), Positives = 518/647 (80%), Gaps = 24/647 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLY-LALLAIFCTLSYHFGTWQNgggasgtsissi  1792
             PYYTP  KP     +    +      LY LA+L I C+LSY FG WQ+GG          
Sbjct  7     PYYTPLSKPTPASASSSAANHLKKPKLYSLAILTILCSLSYLFGAWQHGGAT--------  58

Query  1791  ftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV  1612
                   +A    FS    T+ S T     + +  LDF THH      AV       +   
Sbjct  59    ----TPSATIPCFSVPRNTSASITQPGSPTATTKLDFATHHSA----AVDEGAATLASST  110

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YPPC +KYSEYTPCED +RSL + R+RLIYRERHCP+K E L+CR+PAP+GY+NPFKWP 
Sbjct  111   YPPCSIKYSEYTPCEDQKRSLKFPRDRLIYRERHCPEKKERLRCRVPAPYGYKNPFKWPV  170

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+ WY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINLKD
Sbjct  171   SRDLVWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLKD  230

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH++QVQFALERGVPALIG++ASKRL
Sbjct  231   GSIRTAIDTGCGVASWGAYLLSRNILPISFAPRDTHEAQVQFALERGVPALIGVIASKRL  290

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWGQYDGAYLIEVDR+LRPGGYWILSGPPIRW++YW+GW+R+ 
Sbjct  291   PYPSRAFDMAHCSRCLIPWGQYDGAYLIEVDRILRPGGYWILSGPPIRWRKYWRGWERSR  350

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDM  715
             EDL AEQ QIE V  SLCWKK +E DDIAIWQKP NH+ C + R+    P+  +S DPD 
Sbjct  351   EDLNAEQMQIENVTKSLCWKKLVEKDDIAIWQKPANHLQCKKFRKVFKRPLFCSSQDPDK  410

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT L+TCLTPLP+VS+ +E     LEKWPKRLNA+PPRI +GTI+G++ + F++D  L
Sbjct  411   AWYTSLETCLTPLPEVSNNEEVAGGKLEKWPKRLNAIPPRISKGTINGVTPDTFQQDLQL  470

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             WN+R+S+Y  V + QL +AGRYRN+LDMNAFLGGFAA LV   LWVMNVVPVE+K+NTLG
Sbjct  471   WNRRVSYYKTV-NNQLGQAGRYRNILDMNAFLGGFAANLVGDPLWVMNVVPVEAKINTLG  529

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VIYERGLIGTY +WCEAMSTYPRTYDLIHADSIFTLYKDRCEM+DI+LEMDRILRPEGS+
Sbjct  530   VIYERGLIGTYQSWCEAMSTYPRTYDLIHADSIFTLYKDRCEMDDIMLEMDRILRPEGSL  589

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVD+L+KVKRI DGL W+S++VDHEDGPL+REKLLFAVK YWT
Sbjct  590   IIRDDVDILVKVKRIADGLNWDSQIVDHEDGPLEREKLLFAVKLYWT  636



>ref|XP_009626220.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=650

 Score =   907 bits (2344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 453/651 (70%), Positives = 532/651 (82%), Gaps = 26/651 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSP----NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsi  1801
             PYYTPT K     H    Y SP       L  L  +   C+  Y  G WQN G +S  + 
Sbjct  8     PYYTPTSK-----HTAATYHSPFPLKRPNLYSLVAITFLCSAFYFTGLWQNRGSSSVITT  62

Query  1800  ssiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
             S+I    + T   C  S NT+T   +++ S  S    LDFTTHH   DGG V     +DS
Sbjct  63    SNI----VHTTIPCFPSKNTSTNSPTSSSSSKSTQK-LDFTTHHSTDDGGGVT---PDDS  114

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             +K+YPPCD+KYSEYTPCED ERSL ++R RLIYRERHCP+K E+LKCRIPAP+GY+NPFK
Sbjct  115   IKIYPPCDIKYSEYTPCEDPERSLKFNRNRLIYRERHCPEKKELLKCRIPAPYGYKNPFK  174

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD+AWY NVPHKELTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLIN
Sbjct  175   WPISRDLAWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLIN  234

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L DGSIRTA+DTGCGVAS+GAYLLSRNI+ +SFAPRD+H++QVQFALERGVPALIG++AS
Sbjct  235   LNDGSIRTAIDTGCGVASWGAYLLSRNIIAISFAPRDSHEAQVQFALERGVPALIGVIAS  294

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPIRW++YW+GW 
Sbjct  295   KRLPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPIRWRKYWKGWA  354

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASN  727
             RT EDL AEQ +IE+VA  LCWKKF+E DDIAIWQKPYNH+ C   R R   PPMCP   
Sbjct  355   RTREDLNAEQNKIEQVAKRLCWKKFVEKDDIAIWQKPYNHVKCTEFRRRVKNPPMCPV-Q  413

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT ++TCLTPLP+VS E+E     +EKWPKRL+ +PPRI RGTI+G++ E F+K
Sbjct  414   DPDKAWYTKIETCLTPLPEVSSEEEVAGGQVEKWPKRLHEIPPRISRGTINGVTEEDFQK  473

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             DS LW +R+S+Y +V + QL +  RYRN+LDMNAFLGGFAA LVD  +WVMN+VPVE+K+
Sbjct  474   DSQLWKRRVSYYKSV-NSQLDQPERYRNILDMNAFLGGFAAKLVDDPVWVMNIVPVEAKV  532

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++RCEME+I+LE+DRILRP
Sbjct  533   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENRCEMENIMLELDRILRP  592

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EGSVIIRDDVD+LIK+KRI DGL W+S+++DHEDGPL+REKLLFAVK+YWT
Sbjct  593   EGSVIIRDDVDILIKLKRIGDGLNWDSQIIDHEDGPLEREKLLFAVKSYWT  643



>ref|XP_004240739.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Solanum 
lycopersicum]
Length=651

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/649 (69%), Positives = 527/649 (81%), Gaps = 24/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI--FCTLSYHFGTWQNgggasgtsiss  1795
             PYYTPT KP  P  +H   S P  K  + +L+AI   C+  Y  G W +    +G   SS
Sbjct  8     PYYTPTSKPT-PTSHHS--SLPLKKPNFYSLIAISFLCSGFYFTGVWHSSTTGAGAGSSS  64

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
             +F   I T     F     +T  S++ + +     LDFTTHH      A  G   +D++K
Sbjct  65    VF---ITTTSLPCFPSKNTSTSPSSSTTSTKK---LDFTTHHSA----AYDGAAPDDAIK  114

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
             +YP CD+KYSEYTPCED ERSL ++R RLIYRERHCP+K+EVLKCRIPAP+GY+NPFKWP
Sbjct  115   IYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNEVLKCRIPAPYGYKNPFKWP  174

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDV WY NVPHKELTVEKAVQNWIR+EGD+F+FPGGGTMF NGADAYIDDI KLINLK
Sbjct  175   VSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINLK  234

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNI+ MSFAPRD+H++QVQFALERGVPALIG++ASKR
Sbjct  235   DGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVPALIGVIASKR  294

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPI WKR+W+GWDRT
Sbjct  295   LPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPINWKRHWKGWDRT  354

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDP  721
              EDL AEQ +IE++A  LCWKKF+E DDIAIWQKP+NHM C   R R   PPMCP + DP
Sbjct  355   REDLYAEQNKIEQLAKRLCWKKFVEKDDIAIWQKPFNHMKCTEFRNRNKNPPMCP-TQDP  413

Query  720   DMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT ++TCLTPLP+V+ E+     +LEKWPKRLNA+PPRI RGT+DG++ E F+KDS
Sbjct  414   DKAWYTKIETCLTPLPEVASEEDLAGGQLEKWPKRLNAIPPRISRGTVDGVTAEVFQKDS  473

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW +R+S+Y +V + QL + GRYRN+LDMNAFLGGFAA LV+  +WVMN+VPVE K NT
Sbjct  474   ELWKRRVSYYKSV-NNQLDQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPVEVKTNT  532

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++RCEMEDI+LE+DRILRPEG
Sbjct  533   LGAIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENRCEMEDIVLELDRILRPEG  592

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD+LI+VKRI DGL W+S +VDHEDGPL+REKL FAVKTY T
Sbjct  593   SVIIRDDVDILIRVKRIADGLNWDSLIVDHEDGPLEREKLFFAVKTYST  641



>ref|XP_010321993.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Solanum 
lycopersicum]
Length=651

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/649 (69%), Positives = 526/649 (81%), Gaps = 24/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI--FCTLSYHFGTWQNgggasgtsiss  1795
             PYYTPT KP  P  +H   S P  K  + +L+AI   C+  Y  G W +    +G   SS
Sbjct  8     PYYTPTSKPT-PTSHHS--SLPLKKPNFYSLIAISFLCSGFYFTGVWHSSTTGAGAGSSS  64

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
             +F   I T     F     +T  S++ + +     LDFTTHH      A  G   +D++K
Sbjct  65    VF---ITTTSLPCFPSKNTSTSPSSSTTSTKK---LDFTTHHSA----AYDGAAPDDAIK  114

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
             +YP CD+KYSEYTPCED ERSL ++R RLIYRERHCP+K+EVLKCRIPAP+GY+NPFKWP
Sbjct  115   IYPVCDIKYSEYTPCEDPERSLKFNRRRLIYRERHCPEKNEVLKCRIPAPYGYKNPFKWP  174

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDV WY NVPHKELTVEKAVQNWIR+EGD+F+FPGGGTMF NGADAYIDDI KLINLK
Sbjct  175   VSRDVVWYANVPHKELTVEKAVQNWIRYEGDKFRFPGGGTMFPNGADAYIDDIAKLINLK  234

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNI+ MSFAPRD+H++QVQFALERGVPALIG++ASKR
Sbjct  235   DGSIRTAIDTGCGVASWGAYLLSRNIIAMSFAPRDSHEAQVQFALERGVPALIGVIASKR  294

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGG+WILSGPPI WKR+W+GWDRT
Sbjct  295   LPYPSRAFDMAHCSRCLIPWGEYDGTYLIEVDRVLRPGGFWILSGPPINWKRHWKGWDRT  354

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDP  721
              EDL AEQ +IE++A  LCWKKF+E DDIAIWQKP+NHM C   R R   PPMCP + DP
Sbjct  355   REDLYAEQNKIEQLAKRLCWKKFVEKDDIAIWQKPFNHMKCTEFRNRNKNPPMCP-TQDP  413

Query  720   DMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT ++TCLTPLP+V+ E+     +LEKWPKRLNA+PPRI RGT+DG++ E F+KDS
Sbjct  414   DKAWYTKIETCLTPLPEVASEEDLAGGQLEKWPKRLNAIPPRISRGTVDGVTAEVFQKDS  473

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW +R+S+Y +V + QL + GRYRN+LDMNAFLGGFAA LV+  +WVMN+VPVE K NT
Sbjct  474   ELWKRRVSYYKSV-NNQLDQPGRYRNILDMNAFLGGFAANLVNDPVWVMNIVPVEVKTNT  532

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLY++RCEMEDI+LE+DRILRPEG
Sbjct  533   LGAIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYENRCEMEDIVLELDRILRPEG  592

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD+LI+VKRI DGL W+S +VDHEDGPL+REKL FAV TY T
Sbjct  593   SVIIRDDVDILIRVKRIADGLNWDSLIVDHEDGPLEREKLFFAVMTYST  641



>gb|EYU19524.1| hypothetical protein MIMGU_mgv1a002864mg [Erythranthe guttata]
Length=629

 Score =   893 bits (2307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/648 (69%), Positives = 520/648 (80%), Gaps = 39/648 (6%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             P+YTP  KPA        Y    +KL  LA++ + C+L Y  G W +GGGA+ T+     
Sbjct  7     PHYTPLSKPAAAGGGGAAYLR-KSKLYSLAIVTVLCSLFYLIGVWHHGGGAATTT-----  60

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVY  1609
                + T   C  + N  T               LDF THH   DGGA        +VK Y
Sbjct  61    --NLGTTLPCFTTTNNTTKK-------------LDFATHHSASDGGA--------AVKPY  97

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP-KKSEVLKCRIPAPFGYRNPFKWPE  1432
             PPC  KYSEYTPCED +RSL + R++LIYRERHCP KK E+LKCR+PAP GY+NPFKWP 
Sbjct  98    PPCSGKYSEYTPCEDPKRSLKFPRDKLIYRERHCPEKKKELLKCRVPAPHGYKNPFKWPA  157

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+ WY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINLKD
Sbjct  158   SRDLVWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLKD  217

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYL+SRNIL +SFAPRDTH++QVQFALERGVPAL+G++ASKRL
Sbjct  218   GSIRTAIDTGCGVASWGAYLMSRNILPISFAPRDTHEAQVQFALERGVPALLGVIASKRL  277

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWGQ DGAYLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+R+ 
Sbjct  278   PYPSRAFDMAHCSRCLIPWGQNDGAYLIEVDRVLRPGGYWILSGPPIRWKKYWKGWERSR  337

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             EDL  EQTQIE VA  LCWKK +E DDIAIWQKP NH++C +L++    PP+C   N PD
Sbjct  338   EDLNEEQTQIENVAKGLCWKKLIEKDDIAIWQKPLNHLNCNKLKKTTTNPPLCSLPN-PD  396

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT L+TCLTPLP+VS  +     ELEKWPKRLNA+PPRI +GTI+G++ E FE+D  
Sbjct  397   NAWYTKLETCLTPLPEVSRSEEVAGGELEKWPKRLNAIPPRISKGTINGVTPETFEQDLK  456

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LWN+R+S+Y  V + QL +AGRYRN+LDMNAFLGGFAA L++  LWVMNVVPVE+K+NTL
Sbjct  457   LWNRRVSYYKTV-NNQLGQAGRYRNILDMNAFLGGFAANLIEDPLWVMNVVPVEAKVNTL  515

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTY +WCEAMSTYPRTYDLIHADS+FTLYKDRCEMEDI+LEMDRILRPEGS
Sbjct  516   GVIYERGLIGTYQSWCEAMSTYPRTYDLIHADSVFTLYKDRCEMEDIMLEMDRILRPEGS  575

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD L+KVKRI DG+ W+S++VDHEDGPL+REKLLFAVK YWT
Sbjct  576   VIIRDDVDTLVKVKRIADGMNWDSQIVDHEDGPLEREKLLFAVKLYWT  623



>ref|XP_009609846.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=657

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/649 (68%), Positives = 525/649 (81%), Gaps = 25/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             PYY+PTYKP         YS   N       +   C+++Y FG           SIS+  
Sbjct  8     PYYSPTYKPNAANFPSSPYSIRINVYTLAIAITFLCSITYLFG---------RGSISTSP  58

Query  1788  tAKIATAKTCL----FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
              + +A    C+     S   A+  S  + S SS S+ LDF+T+ GD +G  V     +DS
Sbjct  59    VSNVAATIPCIPLKITSTAAASNNSKISSSSSSTSSQLDFSTNQGDDEGEGVA---PDDS  115

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             VKVYP CD+KYSEYTPCED +RSL + R+RLIYRERHCP KS++LKCRIPAP+GY+ PFK
Sbjct  116   VKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKSQLLKCRIPAPYGYKKPFK  175

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP+SRD+AWY NVPHKELTVEKAVQNWIR EGD+F+FPGGGTMF NGADAY+DDI KLIN
Sbjct  176   WPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDIDKLIN  235

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSR+IL MSFAPRDTH++QVQFALERGVPALIG+LAS
Sbjct  236   LKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVPALIGVLAS  295

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPW QYDG YL+EVDRVLRPGGYWILSGPPIRW++YW+GW+
Sbjct  296   KRLPYPSRAFDMAHCSRCLIPWDQYDGEYLMEVDRVLRPGGYWILSGPPIRWRKYWKGWE  355

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDP  721
             RT +DL  EQT+IE+VA  LCWKKF+E DDIAIWQKPYNH  C    Q    MCPA  DP
Sbjct  356   RTRDDLNGEQTRIEEVAKKLCWKKFVEKDDIAIWQKPYNHFQC--KEQKKKLMCPA-QDP  412

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT+L TC+TPLP+VS E+E     LEKWPKRL+A+PPRI  GT++G++ E FEKDS
Sbjct  413   DKAWYTELSTCVTPLPEVSSEEEVAGGQLEKWPKRLHAIPPRISSGTVNGVTAESFEKDS  472

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW KR+S+Y +V D +L + GRYRN+LDMNA+LGGFAA+ VD  +WVMNVVPVE+++NT
Sbjct  473   QLWQKRVSYYKSV-DNKLNQPGRYRNLLDMNAYLGGFAASWVDDPVWVMNVVPVEAEVNT  531

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGL+GTY  WCEAMSTYPRTYDLIHADSIFT+YKDRCEMEDILLEMDRILRPEG
Sbjct  532   LGVIYERGLVGTYQNWCEAMSTYPRTYDLIHADSIFTMYKDRCEMEDILLEMDRILRPEG  591

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIR+DVD+L++VK+I DGL+W++ +VDHEDGP++REKLLFAVK+YWT
Sbjct  592   SVIIREDVDILVEVKKIADGLKWDTLIVDHEDGPMEREKLLFAVKSYWT  640



>ref|XP_009794887.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=657

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 442/649 (68%), Positives = 524/649 (81%), Gaps = 25/649 (4%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             PYY+PTYKP         YS   N       +   C+++Y FG           SIS+  
Sbjct  8     PYYSPTYKPNAANFPSSPYSIRINVYTLAIAITFLCSITYLFG---------RGSISTSP  58

Query  1788  tAKIATAKTCL----FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
              + +A    C+     S   A+  S  + S SS S+ LDF+T+ GD +G  V     +DS
Sbjct  59    VSNVAATIPCIPLKITSTAAASNNSKISSSSSSTSSQLDFSTNQGDDEGEGVA---PDDS  115

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             VKVYP CD+KYSEYTPCED +RSL + R+RLIYRERHCP KS++LKCRIPAP+GY+ PFK
Sbjct  116   VKVYPACDIKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKSQLLKCRIPAPYGYKKPFK  175

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP+SRD+AWY NVPHKELTVEKAVQNWIR EGD+F+FPGGGTMF NGADAY+DDI KL N
Sbjct  176   WPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDIDKLFN  235

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSR+IL MSFAPRDTH++QVQFALERGVPALIG+LAS
Sbjct  236   LKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVPALIGVLAS  295

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYP +AFDMAHCSRCLIPW QYDG YL+EVDRVLRPGGYWILSGPPIRW++YW+GW+
Sbjct  296   KRLPYPCRAFDMAHCSRCLIPWDQYDGEYLMEVDRVLRPGGYWILSGPPIRWRKYWKGWE  355

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDP  721
             RT +DL  EQT+IE+VA  LCWKKF+E DDIAIWQKPYNH  C    Q    MCPA  DP
Sbjct  356   RTRDDLNWEQTRIEEVAKKLCWKKFVEKDDIAIWQKPYNHFQC--KEQKKKLMCPA-QDP  412

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT+L TC+TPLP+VS E+E     LEKWPKRL+A+PPRI RGT++G++ E FEKDS
Sbjct  413   DKAWYTELSTCVTPLPEVSSEEEVAGGQLEKWPKRLHAIPPRISRGTVNGVTAESFEKDS  472

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW KR+S+Y +V D +L + GRYRN+LDMNA+LGGFAA+ VD  +WVMNVVPVE+++NT
Sbjct  473   QLWQKRVSYYKSV-DNKLNQPGRYRNLLDMNAYLGGFAASWVDDPVWVMNVVPVEAEVNT  531

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGL+GTY +WCEAMSTYPRTYDLIHADSIFT+YKDRCEMEDILLEMDRILRPEG
Sbjct  532   LGVIYERGLVGTYQSWCEAMSTYPRTYDLIHADSIFTMYKDRCEMEDILLEMDRILRPEG  591

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIR+DVD+L++VK+I DGL+W++ +VDHEDGP++R KLLFAVK+YWT
Sbjct  592   SVIIREDVDILVEVKKIADGLKWDTLIVDHEDGPMERGKLLFAVKSYWT  640



>gb|EPS68701.1| hypothetical protein M569_06064, partial [Genlisea aurea]
Length=638

 Score =   880 bits (2273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/650 (67%), Positives = 516/650 (79%), Gaps = 36/650 (6%)
 Frame = -2

Query  1965  YYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissift  1786
             Y+ P  KP+  +           K+  L ++ + C++SY FG W++GG            
Sbjct  8     YHFPARKPSAWIPPVISLHMNPRKICSLLIVFVLCSISYLFGVWRHGGIGLT--------  59

Query  1785  AKIATAKTCL--FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV  1612
                A   +C+    GN   T              LDF++HH  GDGG  LG     + K 
Sbjct  60    --TAVRPSCVPTTEGNDQPTQQR-----------LDFSSHHSAGDGGIELGVR---ARKS  103

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YP CDVKYSEYTPCEDT RSL + RERLIYRERHCP + E +KCRIPAP GY+ PF+WP 
Sbjct  104   YPACDVKYSEYTPCEDTTRSLRFPRERLIYRERHCPAEDERVKCRIPAPSGYKTPFRWPA  163

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+AWY NVPHKELTVEKAVQNWIRFEGDRF+FPGGGTMF NGADAYIDDIGKLINL D
Sbjct  164   SRDLAWYANVPHKELTVEKAVQNWIRFEGDRFRFPGGGTMFPNGADAYIDDIGKLINLSD  223

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSR+I+ MSFAPRD+H++QVQFALERGVPALIG++ASKRL
Sbjct  224   GSIRTAIDTGCGVASWGAYLLSRDIIAMSFAPRDSHEAQVQFALERGVPALIGVIASKRL  283

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWGQ+DGAYLIEVDR+LRPGGYWILSGPPIRWK+YW GWDRT+
Sbjct  284   PYPSRAFDMAHCSRCLIPWGQHDGAYLIEVDRILRPGGYWILSGPPIRWKKYWSGWDRTK  343

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC---IRLRQAPPPMCP-ASND  724
             EDL AEQ QIE V +SLCWKK +E DDIAIWQKP NH++C    R+++  PP+C  AS++
Sbjct  344   EDLNAEQLQIENVTNSLCWKKLIERDDIAIWQKPLNHINCKKYKRVKKNGPPLCSTASHN  403

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWYT+L+TCLTPLP+V   +     E+E WPKR  AVPPRI RGT++GI+ E FE+D
Sbjct  404   PDQAWYTNLETCLTPLPEVESAEDVAGGEVENWPKRATAVPPRISRGTVNGITSETFEQD  463

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
               LW +RIS+Y  V + QL +AGRYRN+LDMNAFLGGFAA L++  LWVMNVVPV++K+N
Sbjct  464   HKLWKRRISYYKTV-NNQLGQAGRYRNILDMNAFLGGFAANLIEDPLWVMNVVPVDAKIN  522

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLG+IYERGLIGTY  WCEAMSTYPRTYDLIHADS+F+LYK+RCEMEDI+LEMDRILRPE
Sbjct  523   TLGIIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFSLYKNRCEMEDIMLEMDRILRPE  582

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GS+IIRDDVDVL++VKRI D L W++++VDHEDGPL+REKLLFAVKTYWT
Sbjct  583   GSLIIRDDVDVLVQVKRIADALNWDNQIVDHEDGPLEREKLLFAVKTYWT  632



>ref|XP_002279420.2| PREDICTED: probable methyltransferase PMT15 isoform X1 [Vitis 
vinifera]
 emb|CBI31829.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   878 bits (2269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/620 (70%), Positives = 507/620 (82%), Gaps = 23/620 (4%)
 Frame = -2

Query  1884  LALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqsls  1705
             LA++  FC+ SY  G+WQ+G G + T+       + +    C  S N+  T  +      
Sbjct  42    LAVITFFCSFSYFLGSWQHGRGTTSTTA------EFSLRGRCNPSQNSTNTALNDPFLAQ  95

Query  1704  shsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLI  1525
                  +DF+THH   DG A +    E+ VK YP C V+YSEYTPCE T+R+L ++RERLI
Sbjct  96    L---SIDFSTHHAAEDGVATV---PEEKVKSYPACGVEYSEYTPCEGTKRALKFERERLI  149

Query  1524  YRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEG  1345
             YRERHCP+K ++LKCRIPAP+GYRNP  WP SRDVAWY NVPHKELTVEKAVQNWI +EG
Sbjct  150   YRERHCPEKGDLLKCRIPAPYGYRNPPAWPASRDVAWYANVPHKELTVEKAVQNWIIYEG  209

Query  1344  DRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMS  1165
             DRF+FPGGGTMF NGADAYIDDIGKLINLKDGSIRTA+DTGCGVAS+GAYLLSRNI+TMS
Sbjct  210   DRFRFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNIITMS  269

Query  1164  FAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIE  985
             FAPRDTH++QVQFALERGVPALIG+LAS RLPYPS+AFDMAHCSRCLIPWGQYDG YLIE
Sbjct  270   FAPRDTHEAQVQFALERGVPALIGVLASIRLPYPSRAFDMAHCSRCLIPWGQYDGVYLIE  329

Query  984   VDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIA  805
             VDRVLRPGGYW+LSGPPI WK++W+GW+RTE+DL+AEQ  IE VA SLCWKK +E DDIA
Sbjct  330   VDRVLRPGGYWVLSGPPINWKKHWRGWERTEKDLKAEQQTIENVAKSLCWKKLVEKDDIA  389

Query  804   IWQKPYNHMDCI---RLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----EL  649
             IWQKP NH+ C    ++ Q PP   P   DPD AWYT ++TCLTPLP+VS  +     EL
Sbjct  390   IWQKPINHLYCKVNRKITQNPPFCLP--QDPDRAWYTKMETCLTPLPEVSYSQELAGGEL  447

Query  648   EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLD  469
              KWP+RLN +PPRI  G+I+G++ E F+ +S LW KR+S+Y AV + QL + GRYRN+LD
Sbjct  448   AKWPERLNVIPPRISSGSINGVTAEIFQLNSELWKKRMSYYKAV-NNQLRQPGRYRNLLD  506

Query  468   MNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDL  289
             MNA+LGGFAAALV+  +WVMNVVPV++K+NTLGVIYERGLIGTY  WCEAMSTYPRTYDL
Sbjct  507   MNAYLGGFAAALVEDPVWVMNVVPVDAKINTLGVIYERGLIGTYQNWCEAMSTYPRTYDL  566

Query  288   IHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVD  109
             IHADS+F+LYKDRCEMEDILLEMDRILRPEGSVI+RDDVDVL+K+KRITDGL W SR+VD
Sbjct  567   IHADSVFSLYKDRCEMEDILLEMDRILRPEGSVILRDDVDVLVKIKRITDGLNWMSRIVD  626

Query  108   HEDGPLQREKLLFAVKTYWT  49
             HEDGP QREKLLFAVK+YWT
Sbjct  627   HEDGPHQREKLLFAVKSYWT  646



>gb|KDP22318.1| hypothetical protein JCGZ_26149 [Jatropha curcas]
Length=652

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/646 (66%), Positives = 504/646 (78%), Gaps = 23/646 (4%)
 Frame = -2

Query  1962  YTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftA  1783
             Y PT KP+  L     Y+     L  L L+   C  SY FG WQ  G  +  + ++  T 
Sbjct  9     YHPTSKPSKGLTT--IYTFKKKDLFPLTLILFLCLFSYLFGLWQQTGSFTLKTTTATATT  66

Query  1782  KIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPP  1603
                    C           +   + + H   LDF  HH   D GA         VKVYPP
Sbjct  67    NSIVQIPC-------NPTKTNPTADAQHDESLDFGAHHMADDDGAATS-----PVKVYPP  114

Query  1602  CDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRD  1423
             C+V +SEYTPCED  RSL + R +LIYRERHCP+K E +KCR+PAP+GY+NPF WP+SRD
Sbjct  115   CNVNFSEYTPCEDARRSLRFSRRQLIYRERHCPEKDERIKCRVPAPYGYKNPFAWPKSRD  174

Query  1422  VAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSI  1243
             +AWY NVPHK LTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLINL DGSI
Sbjct  175   LAWYANVPHKHLTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSI  234

Query  1242  RTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYP  1063
             RTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH++QVQFALERGVPALIG+LASKRLPYP
Sbjct  235   RTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVPALIGVLASKRLPYP  294

Query  1062  SKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDL  883
             S+AFDMAHCSRCLIPW +  G YL+EVDRVLRPGGYWILSGPPI WK+YW+GWDRT+EDL
Sbjct  295   SRAFDMAHCSRCLIPWAELGGIYLMEVDRVLRPGGYWILSGPPIHWKKYWKGWDRTKEDL  354

Query  882   EAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA---PPPMCPASNDPDMA  712
              AEQT+IE VA SLCWKKF+E DDIAIWQKP+NH++C   R+     P  CP   DPD A
Sbjct  355   NAEQTKIENVAKSLCWKKFIEKDDIAIWQKPFNHLNCKANRKITPNTPTFCPVDQDPDKA  414

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT ++ CLT LP+VS+ +E     L KWP+RLNA+PPRI  G ++G++ E FE +  LW
Sbjct  415   WYTKMEACLTNLPEVSNSQEVAGGKLRKWPERLNAIPPRISTGNVEGVTPEIFENEIQLW  474

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
             NKR+ +Y AV + QL +AGRYRN+LDMNA+LGGFAAAL+D  +WVMNVVPV++K+NTLG+
Sbjct  475   NKRMEYYKAV-NNQLAQAGRYRNLLDMNAYLGGFAAALIDDPVWVMNVVPVQAKVNTLGI  533

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IY+RGLIGTY  WCEAMSTYPRTYDLIHA+S+F+LY+ RCEMEDILLEMDRILRPEGSVI
Sbjct  534   IYDRGLIGTYQDWCEAMSTYPRTYDLIHANSVFSLYQGRCEMEDILLEMDRILRPEGSVI  593

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +RDDVDVL+ +K+ITDGL WES++VDHEDGPLQREKL FAVK+YWT
Sbjct  594   LRDDVDVLVNIKKITDGLNWESQIVDHEDGPLQREKLFFAVKSYWT  639



>ref|XP_004309222.1| PREDICTED: probable methyltransferase PMT16-like [Fragaria vesca 
subsp. vesca]
Length=646

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/647 (66%), Positives = 499/647 (77%), Gaps = 30/647 (5%)
 Frame = -2

Query  1962  YTPTYKPALP--LHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             Y PT KP+ P  L N   +         L L+   C  SY FG WQ+G  +   S ++  
Sbjct  10    YNPTSKPSKPFSLSNFSTWKIKPTNSYTLPLILFLCIFSYFFGLWQHGSTSPTASTNAAH  69

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVY  1609
                   +     + N  T               LDFTTHH       +  N    + K +
Sbjct  70    NQLPCNSPDTTLTKNQQT---------------LDFTTHHNPNYAINISNN----TPKTF  110

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCDVKYSEYTPCED +RSL ++RERLIYRERHCP K E+LKCR+PAP GYRN F WP+S
Sbjct  111   PPCDVKYSEYTPCEDAKRSLKFERERLIYRERHCPAKDELLKCRVPAPHGYRNTFTWPKS  170

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD+AWY NVPHKELT+EKAVQNWI ++GDRFKFPGGGTMF NGADAYIDDIGKLINLKDG
Sbjct  171   RDLAWYANVPHKELTIEKAVQNWIIYQGDRFKFPGGGTMFPNGADAYIDDIGKLINLKDG  230

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSR+IL +SFAPRDTH++QVQFALERGVPALIG++ASKRLP
Sbjct  231   SIRTAIDTGCGVASWGAYLLSRDILPISFAPRDTHEAQVQFALERGVPALIGVIASKRLP  290

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQ DG YL EVDRVLRPGGYWILSGPPIRWK+YW+GW+RT+E
Sbjct  291   YPSRAFDMAHCSRCLIPWGQNDGVYLTEVDRVLRPGGYWILSGPPIRWKKYWKGWERTQE  350

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDPDM  715
             DL  EQT IE VA SLCW K +E DDIAIWQKP NH++C   R+       CPA  DPD 
Sbjct  351   DLNEEQTGIEAVAASLCWNKLVEKDDIAIWQKPTNHLNCKMNRKLAKNRNFCPAQ-DPDQ  409

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT+L+TCLTPLP+VS E +     L KWP+RL AVPPRI RGT+ G++   F++DS L
Sbjct  410   AWYTNLETCLTPLPEVSSEDDVAGGKLAKWPQRLTAVPPRISRGTVKGVTAANFQQDSEL  469

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR++HY  V + QL + GRYRN+LDMNA+LGGFAAALVD  +WVMN+VPV+ K+NTLG
Sbjct  470   WRKRVTHYKTV-NNQLAQPGRYRNLLDMNAYLGGFAAALVDLPVWVMNMVPVDVKVNTLG  528

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VIYERGLIG+Y  WCEAMSTYPRTYDLIHAD++F+LYKDRCE+EDILLEMDRILRPEGSV
Sbjct  529   VIYERGLIGSYQNWCEAMSTYPRTYDLIHADTVFSLYKDRCEIEDILLEMDRILRPEGSV  588

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVDVL+K+K I D + W+S++ DHEDGP +REKLLFAVK YWT
Sbjct  589   IIRDDVDVLVKIKSIIDHMDWDSQIADHEDGPHEREKLLFAVKKYWT  635



>ref|XP_007038610.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23111.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=642

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/654 (67%), Positives = 518/654 (79%), Gaps = 42/654 (6%)
 Frame = -2

Query  1971  LPYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissi  1792
             LPY+  T+KP         ++S    L  LAL+   CTLS+ FG WQ+ G A        
Sbjct  6     LPYHA-TFKPLKATTTS--FASRKGSLFSLALVLCLCTLSFLFGLWQHSGSAPTF-----  57

Query  1791  ftAKIATAKT--CLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS-  1621
                 I T K+  C+ + NT  T  +T+++       LDF+THH        + + DE+S 
Sbjct  58    ----ITTNKSLPCIPNPNTTITTRTTSET-------LDFSTHH--------VADADEESL  98

Query  1620  ---VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRN  1450
                VK YP C VKYSEYTPCED  RSL + R+RLIYRERHCP+K E+LKCR+PAP+ Y+N
Sbjct  99    LPDVKTYPSCSVKYSEYTPCEDHIRSLKFKRDRLIYRERHCPEKGELLKCRVPAPYDYKN  158

Query  1449  PFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGK  1270
             PF WP+SRD+AW+ NVPHKELTVEKA QNWIR+EG RF+FPGGGTMF +GADAYIDDIGK
Sbjct  159   PFPWPKSRDLAWFANVPHKELTVEKAGQNWIRYEGKRFRFPGGGTMFPHGADAYIDDIGK  218

Query  1269  LINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGI  1090
             LINLKDGSIRTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH++QVQFALERGVPA++G+
Sbjct  219   LINLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVPAILGV  278

Query  1089  LASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQ  910
             LASKRLPYPS+AFDMAHCSRCLIPW QYDG YLIEVDRVLRPGGYWILSGPPIRWK+YWQ
Sbjct  279   LASKRLPYPSRAFDMAHCSRCLIPWDQYDGVYLIEVDRVLRPGGYWILSGPPIRWKKYWQ  338

Query  909   GWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCP  736
             GW RT EDL  EQT+IE+VA  LCWKK +E DDIAIWQKP NH++C   R+    PP C 
Sbjct  339   GWQRTREDLNDEQTRIERVARRLCWKKLVEKDDIAIWQKPINHLNCKVNRKFNRNPPFCL  398

Query  735   ASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEK  571
             A  DPD AWYT+L+TCLT LP+VS ++     EL KWP+RLNA+PPRI+ GT++GI+ E 
Sbjct  399   A-QDPDKAWYTNLETCLTRLPEVSHDQEIAGGELAKWPQRLNAIPPRIRNGTVNGITAEI  457

Query  570   FEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVE  391
             F +DS +W +R+S+Y   ++ QL + GRYRN+LDMNA+LGGFA AL+D  +WVMNV+P E
Sbjct  458   FMQDSDVWKRRLSYYK-TLNHQLGQNGRYRNILDMNAYLGGFATALIDDPVWVMNVIPAE  516

Query  390   SKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRI  211
             +K+NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LYKDRCEMEDILLEMDRI
Sbjct  517   AKVNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKDRCEMEDILLEMDRI  576

Query  210   LRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             LRPEGSV+ RDDVD+L+K+K+ITDGL W+S++VDHEDGPL REKLLF VK YWT
Sbjct  577   LRPEGSVVFRDDVDILVKIKKITDGLNWDSQIVDHEDGPLNREKLLFGVKVYWT  630



>ref|XP_002510829.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51431.1| ATP binding protein, putative [Ricinus communis]
Length=649

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/646 (66%), Positives = 501/646 (78%), Gaps = 25/646 (4%)
 Frame = -2

Query  1962  YTPTYKPALPLHNHQY-YSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissift  1786
             Y PT KP+ P     + +S     L  L L++  C   Y FG WQ  G  + ++ ++   
Sbjct  8     YHPTSKPSKPFMAKMFPFSFKRKNLFSLLLISFLCIFCYLFGLWQRAGSFTLSTTTTNTI  67

Query  1785  AKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYP  1606
               I    T   + N                  LDF  HH   DGG  +       VK+YP
Sbjct  68    VSIPCKPTTTATNNKKQEEP------------LDFVPHHVAQDGGVTVA----PEVKIYP  111

Query  1605  PCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESR  1426
             PC+V +SEYTPCED  RSL ++R +LIYRERHCP+  E +KCRIPAP+GY+NPF WP SR
Sbjct  112   PCNVNFSEYTPCEDDNRSLRFNRRQLIYRERHCPETYEKIKCRIPAPYGYKNPFTWPASR  171

Query  1425  DVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGS  1246
             + AWY NVPHK LTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAYIDDIGKLINL DGS
Sbjct  172   NFAWYANVPHKHLTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAYIDDIGKLINLNDGS  231

Query  1245  IRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPY  1066
             IRTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH++QVQFALERGVPALIG+LASKRLPY
Sbjct  232   IRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVPALIGVLASKRLPY  291

Query  1065  PSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEED  886
             PS AFDMAHCSRCLIPW   +G +LIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RT+ED
Sbjct  292   PSTAFDMAHCSRCLIPWADLEGLFLIEVDRVLRPGGYWILSGPPIRWKKYWKGWERTKED  351

Query  885   LEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPDMA  712
             L AEQT+IE VA SLCWKK +E DDIAIWQKP NH++C   R     PP CP   DPD A
Sbjct  352   LNAEQTKIENVAKSLCWKKLVEKDDIAIWQKPLNHLNCKINRNITQNPPFCPRDQDPDKA  411

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT L+TCL+ LP+VS+ +E     L+KWP+RLNAVPPRI RG++ G++ E F+KD  LW
Sbjct  412   WYTKLETCLSNLPEVSNNQEIAGGKLKKWPERLNAVPPRISRGSVKGLTAENFQKDIKLW  471

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              KR+ +Y  V + QL +AGRYRN+LDMNA LGGFAAAL+D  +W MNV+PV++K+NTLGV
Sbjct  472   TKRVQYYKTV-NNQLGQAGRYRNLLDMNAQLGGFAAALIDLPVWAMNVIPVQAKVNTLGV  530

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERGLIGTY  WCEAMSTYPRTYDLIHAD +F+LY+ RCEMEDILLEMDRILRPEGSVI
Sbjct  531   IYERGLIGTYQDWCEAMSTYPRTYDLIHADLVFSLYQGRCEMEDILLEMDRILRPEGSVI  590

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              RDDVD+L+K+KRITDGL WES++VDHEDGPL+REKLLFAVK+YWT
Sbjct  591   FRDDVDMLVKIKRITDGLNWESQIVDHEDGPLEREKLLFAVKSYWT  636



>ref|XP_010255518.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Nelumbo 
nucifera]
Length=645

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/655 (65%), Positives = 502/655 (77%), Gaps = 46/655 (7%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             P Y+ +Y+P  P     Y   P+  L  +  +   C+ +Y FG W++ GG+         
Sbjct  7     PSYSASYRPYNP-----YLKKPS--LFKMVCVTFLCSAAYLFGVWKHSGGS---------  50

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVY  1609
                + TA    F G            L + +  LDF+TH              ED++ + 
Sbjct  51    --DVMTASPTDFLGTIRCAQMKNATQLPTATVVLDFSTHQAA-----------EDTITLP  97

Query  1608  PP--------CDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYR  1453
             PP        CDVKYSEYTPCEDT+RSL ++R+RLIYRERHCP+K+E+LKCR+PAP+GY+
Sbjct  98    PPRGPRYFPACDVKYSEYTPCEDTKRSLKFERDRLIYRERHCPQKAELLKCRVPAPYGYK  157

Query  1452  NPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIG  1273
             +PF WPESRD AWY NVPHKELTVEKA QNWIRFEGDRF+FPGGGTMF NGADAYID+IG
Sbjct  158   SPFTWPESRDFAWYANVPHKELTVEKAGQNWIRFEGDRFRFPGGGTMFPNGADAYIDEIG  217

Query  1272  KLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIG  1093
             KLINL+DGSIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH++QVQFALERGVPALIG
Sbjct  218   KLINLRDGSIRTAIDTGCGVASWGAYLLSRNILAISFAPRDTHEAQVQFALERGVPALIG  277

Query  1092  ILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYW  913
             +LASKRLPYPS+AFDMAHCSRCLIPWG YDG YLIEVDR+LRPGGYWILSGPPI WKR+W
Sbjct  278   VLASKRLPYPSRAFDMAHCSRCLIPWGVYDGLYLIEVDRILRPGGYWILSGPPINWKRHW  337

Query  912   QGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMC  739
             +GW RT+EDL AEQ+ IE VA SLCWKK +E  DIAIWQKP NH+ C + R+    P  C
Sbjct  338   KGWQRTQEDLSAEQSAIEAVAKSLCWKKLVEKGDIAIWQKPTNHIYCKKTRKVFKQPQFC  397

Query  738   PASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGE  574
              A  DPD AWY+ ++TCLTPLP+VSD KE     LEKWP RL +VPPRI  G++DG++ E
Sbjct  398   QA-QDPDRAWYSKMETCLTPLPEVSDIKEIAGGQLEKWPNRLQSVPPRISSGSLDGVTAE  456

Query  573   KFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPV  394
              F +D+ LW KR++HY AV + QL + GRYRN+LDMNA LGGFAAAL+D  +WV+NVVP 
Sbjct  457   TFREDTELWKKRVAHYKAVSN-QLAQKGRYRNLLDMNAHLGGFAAALIDDPVWVINVVPT  515

Query  393   ESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDR  214
             E+K+NTLG IYERGLIGTY  WCEAMSTYPRTYDLIHADS+ TLYKDRCE+EDILLEMDR
Sbjct  516   EAKINTLGAIYERGLIGTYQDWCEAMSTYPRTYDLIHADSVLTLYKDRCEIEDILLEMDR  575

Query  213   ILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ILRPEG+VI RDDVD+L+  K ITDG+ W+S +VDHE GP QREKLLFAVK YWT
Sbjct  576   ILRPEGTVIFRDDVDILVTTKSITDGMNWDSHIVDHEKGPHQREKLLFAVKRYWT  630



>ref|XP_006365768.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=637

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/649 (66%), Positives = 512/649 (79%), Gaps = 39/649 (6%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI----FCTLSYHFGTWQNgggasgtsi  1801
             PYY+PTYK     +   Y SSP++  + +  LAI     C+++Y  G           SI
Sbjct  8     PYYSPTYKK----NGANYPSSPHSIRINVYTLAIAFTVLCSIAYLIG---------RGSI  54

Query  1800  ssiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS  1621
             S+   + +AT+  C+         S+TT    + S+G                     D 
Sbjct  55    STSPVSNVATSVPCI----PLKITSATTAVSKNSSSGTQVDEEGEGAV---------SDD  101

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             VKVYP CD K+SEYTPCED +RSL + R+RLIYRERHCP K+++LKCR+PAP+GY+ PFK
Sbjct  102   VKVYPSCDFKFSEYTPCEDPQRSLKFKRDRLIYRERHCPDKTQLLKCRVPAPYGYKKPFK  161

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP+SRD+AWY NVPHKELTVEKAVQNWIR EGD+F+FPGGGTMF NGADAY+DDI KLIN
Sbjct  162   WPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDIDKLIN  221

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSR+IL MSFAPRDTH++QVQFALERGVPALIG+LAS
Sbjct  222   LKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVPALIGVLAS  281

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPW  YDGAYL+EVDRVLRPGGYWILSGPPIRW++Y++GW+
Sbjct  282   KRLPYPSRAFDMAHCSRCLIPWDLYDGAYLMEVDRVLRPGGYWILSGPPIRWRKYFKGWE  341

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDP  721
             RT +DL  EQT+IE+VA  LCWKKF+E DDIAIWQKPYNH  C    Q    MCPA  D 
Sbjct  342   RTRDDLNGEQTRIEEVAKKLCWKKFVEKDDIAIWQKPYNHFQC--KEQKKKLMCPA-QDY  398

Query  720   DMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT+L+TC+TPLP+VS ++     +LEKWPKRLNA+PPRI  GT+ G++   FEKDS
Sbjct  399   DKAWYTELETCITPLPEVSSDEDVAGGQLEKWPKRLNAIPPRISSGTVKGVTAGSFEKDS  458

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW KR+S+Y +V D +L + GRYRN+LDMNA LGGFAA  VD  +WVMN+VP E+++NT
Sbjct  459   QLWQKRVSYYKSV-DDKLNQPGRYRNLLDMNANLGGFAANWVDDPVWVMNIVPAEAEVNT  517

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY +WCEAMSTYPRTYDL+HADSIFT+YK+RC+MEDILLEMDRILRPEG
Sbjct  518   LGVIYERGLIGTYQSWCEAMSTYPRTYDLLHADSIFTMYKERCDMEDILLEMDRILRPEG  577

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             S+IIR+DVD+L++VKRI DGL WES +VDHEDGP++REKLLFAVKTYWT
Sbjct  578   SIIIREDVDILVEVKRIVDGLNWESLIVDHEDGPMEREKLLFAVKTYWT  626



>ref|XP_007220207.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
 gb|EMJ21406.1| hypothetical protein PRUPE_ppa002720mg [Prunus persica]
Length=640

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/649 (67%), Positives = 509/649 (78%), Gaps = 40/649 (6%)
 Frame = -2

Query  1962  YTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftA  1783
             Y PT KP+ P  +   +  PN  +  L ++   C  SY FG WQ+GG             
Sbjct  9     YHPTSKPSKP--SLFPWKKPN--VYTLPVVLFLCICSYFFGLWQHGGT------------  52

Query  1782  KIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK--VY  1609
              + T K    S N     ++T+ +       LDF++HH       +  +    SVK  VY
Sbjct  53    SMPTFKLPCKSSNQIHPATTTSTT-------LDFSSHHTPN----LTASTSSHSVKPEVY  101

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD+K+SEYTPCED +RSL +DR+RLIYRERHCP+K+E+LKCR+PAP GY+  F WP S
Sbjct  102   PPCDLKFSEYTPCEDAKRSLKFDRDRLIYRERHCPEKNELLKCRVPAPHGYKTVFSWPMS  161

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDR--FKFPGGGTMFRNGADAYIDDIGKLINLK  1255
             RD+AWY NVPHKELTVEKAVQNWI +EGDR   +FPGGGTMF NGADAYIDDIGKLINLK
Sbjct  162   RDLAWYANVPHKELTVEKAVQNWIIYEGDRNRLRFPGGGTMFPNGADAYIDDIGKLINLK  221

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH SQVQFALERGVPALIG++ASKR
Sbjct  222   DGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHVSQVQFALERGVPALIGVIASKR  281

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPWGQ+DG YL EVDRVLRPGGYWILSGPPIRW++YW+GW+RT
Sbjct  282   LPYPSRAFDMAHCSRCLIPWGQHDGVYLTEVDRVLRPGGYWILSGPPIRWQKYWKGWERT  341

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPP--MCPASNDP  721
             +EDL AEQT IE VA SLCWKK +E DDIAIWQKP NH+ C   R+       CPA NDP
Sbjct  342   KEDLNAEQTSIEDVAKSLCWKKLVEKDDIAIWQKPNNHLTCQNNRKLGKSRNFCPA-NDP  400

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYT L TCLTPLP+V+D ++     L KWP+RLNA+PPRI +GT+ G++ E F++DS
Sbjct  401   DKAWYTKLDTCLTPLPEVADNEQVAGGKLAKWPQRLNAIPPRINKGTVKGVTAEVFKQDS  460

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW KR+S+Y +V + QL   GRYRN+LDMNA+LGGFAAALVD  +WVMNVVPV+ K NT
Sbjct  461   ELWKKRVSYYKSV-NNQLGNPGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVDVKANT  519

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY  WCEAMSTYPRTYDLIHADS+FTLY DRCEM+DILLEMDRILRPEG
Sbjct  520   LGVIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFTLYADRCEMDDILLEMDRILRPEG  579

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVD+L+K+K I D ++W+S++VDHEDGP +REKLLFAVK YWT
Sbjct  580   SVIIRDDVDMLVKIKSIIDAMEWDSQIVDHEDGPQEREKLLFAVKKYWT  628



>ref|XP_008377156.1| PREDICTED: probable methyltransferase PMT16 [Malus domestica]
Length=647

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/648 (67%), Positives = 505/648 (78%), Gaps = 26/648 (4%)
 Frame = -2

Query  1971  LPYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissi  1792
             LPY+ PT KP+ P  +   +  PN  +  L ++   C  SY FG WQ+GG  +       
Sbjct  8     LPYH-PTSKPSKP--SPFIWKKPN--VYTLPVVLFLCICSYFFGLWQHGGPTAV------  56

Query  1791  ftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV  1612
                   TA T  F     +     T + ++ ++ LDFT+HH      A   +    +  V
Sbjct  57    ----TKTASTPTFKLPCKSPNEIHTTTTTTTASALDFTSHHSPNFSTATSSH--ATTTNV  110

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +P CD KYSEYTPCED +RSL +DR+RLIYRERHCP+KSE+LKCRIPAP GY+N F WP 
Sbjct  111   FPRCDAKYSEYTPCEDDKRSLKFDRDRLIYRERHCPEKSELLKCRIPAPHGYKNVFPWPR  170

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+AWY N PHKELTVEKAVQNWI +EGDRF+FPGGGTMF NGADAYIDDIGK INLKD
Sbjct  171   SRDLAWYANAPHKELTVEKAVQNWIIYEGDRFRFPGGGTMFPNGADAYIDDIGKFINLKD  230

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSR+IL MSFAPRDTH SQVQFALERGVPALIG++ASKRL
Sbjct  231   GSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHVSQVQFALERGVPALIGVIASKRL  290

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWGQ+DG YL EVDRVLRPGGYWILSGPPIRW +YW+GW+RT+
Sbjct  291   PYPSRAFDMAHCSRCLIPWGQHDGVYLTEVDRVLRPGGYWILSGPPIRWAKYWKGWERTK  350

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPD  718
             EDL  EQT IE VA SLCWKK  E DDIAIWQKP NH+ C   R+       CPA NDPD
Sbjct  351   EDLNEEQTSIENVAKSLCWKKLAEKDDIAIWQKPTNHLSCQNNRKFGKARNFCPA-NDPD  409

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT L+TCLTPLP+VSD +E     L  WP RLNA+PPRI +GT+ G++ + F++DS 
Sbjct  410   TAWYTKLETCLTPLPEVSDNEEVAGGKLANWPHRLNAIPPRISKGTVKGVTADVFKQDSE  469

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+S+Y +V + QL   GRYRN+LDMNA LGGFAAALVD  +WVMNVVPVE K NTL
Sbjct  470   LWKKRVSYYKSV-NNQLGNPGRYRNILDMNAQLGGFAAALVDLPVWVMNVVPVEVKSNTL  528

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTY  WCEAMSTYPRTYD +HADS+F+LYKDRCE EDILLEMDRILRPEGS
Sbjct  529   GVIYERGLIGTYQNWCEAMSTYPRTYDFLHADSVFSLYKDRCEAEDILLEMDRILRPEGS  588

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             V++RDDVDVL+K+K I DG++W+S++VDHEDGPL+REKLLFAVK YWT
Sbjct  589   VVMRDDVDVLVKIKSIVDGMEWDSQIVDHEDGPLEREKLLFAVKKYWT  636



>ref|XP_002318832.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
 gb|EEE97052.2| hypothetical protein POPTR_0012s13570g [Populus trichocarpa]
Length=655

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/531 (75%), Positives = 464/531 (87%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             VK YP C+V +SEYTPCED +RSL + R +LIYRERHCP+K E+LKCRIPAP GY+NPFK
Sbjct  114   VKSYPSCNVNFSEYTPCEDAKRSLRFKRHQLIYRERHCPEKHEILKCRIPAPHGYKNPFK  173

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD AWY NVPHK LTVEKA QNWIRF GDRF+FPGGGTMF NGADAYIDDIG+LIN
Sbjct  174   WPASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGGGTMFPNGADAYIDDIGRLIN  233

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH++QVQFALERGVPALIGILAS
Sbjct  234   LKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHEAQVQFALERGVPALIGILAS  293

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPW +  G YLIEVDRVLRPGGYW+LSGPPI WK++W+GW+
Sbjct  294   KRLPYPSRAFDMAHCSRCLIPWAESGGQYLIEVDRVLRPGGYWVLSGPPINWKKHWKGWE  353

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASN  727
             RT++DL  E  +IE VA SLCW+KF+E  DIAIW+KP NH++C   R+    PP CPA  
Sbjct  354   RTKDDLNDEHMKIEAVAKSLCWRKFVEKGDIAIWKKPINHLNCKVNRKITQNPPFCPA-Q  412

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DP+ AWYT+++TCLT LP+VS+++     EL KWP+RLNAVPPRI RGT+ GI+ E F+K
Sbjct  413   DPEKAWYTNMETCLTHLPEVSNKEDVAGGELPKWPERLNAVPPRISRGTLKGITAETFQK  472

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LWN+R+S+Y AV + QL +AGRYRN+LDMNA+LGGFAAAL +  LWVMNVVP+++K+
Sbjct  473   DTALWNRRVSYYKAV-NNQLEQAGRYRNILDMNAYLGGFAAALTEDPLWVMNVVPIQAKV  531

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY  WCEAMSTYPRTYDLIHADS+F+LY  RCEMEDILLEMDRILRP
Sbjct  532   NTLGVIYERGLIGTYQDWCEAMSTYPRTYDLIHADSVFSLYDGRCEMEDILLEMDRILRP  591

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EGSVI RDDVDVL+K+K+I+DGL W+S++VDHEDGP QREKLLFA+KTYWT
Sbjct  592   EGSVIFRDDVDVLVKIKKISDGLNWDSQIVDHEDGPHQREKLLFAIKTYWT  642



>ref|XP_004228448.2| PREDICTED: probable methyltransferase PMT15, partial [Solanum 
lycopersicum]
Length=637

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/651 (64%), Positives = 509/651 (78%), Gaps = 46/651 (7%)
 Frame = -2

Query  1968  PYYTPTYKPALPLHNHQYYSSPNNKLLYLALLAI----FCTLSYHFG--TWQNgggasgt  1807
             PYY+PTYK     +   Y SSP++  + +  LAI     C++SY  G  +      ++ +
Sbjct  8     PYYSPTYKK----NGANYPSSPHSIRINVYTLAIAFTILCSMSYLIGRGSISTSPVSNAS  63

Query  1806  sissiftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDE  1627
             S       KI ++ + ++  +++                                     
Sbjct  64    SSVLCIPLKITSSTSGVYKNSSSGDEEGEGAV---------------------------S  96

Query  1626  DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNP  1447
             D VK+YPPCD KYSEYTPCED +RSL + R+RLIYRERHCP K+++LKCR+PAP+GY+ P
Sbjct  97    DDVKLYPPCDFKYSEYTPCEDPQRSLKFKRDRLIYRERHCPDKTQLLKCRVPAPYGYKKP  156

Query  1446  FKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKL  1267
             FKWP+SRD+AWY NVPHKELTVEKAVQNWIR EGD+F+FPGGGTMF NGADAY+DDI KL
Sbjct  157   FKWPKSRDLAWYANVPHKELTVEKAVQNWIRKEGDKFRFPGGGTMFPNGADAYVDDIDKL  216

Query  1266  INLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGIL  1087
             INLKDGSIRTA+DTGCGVAS+GAYLLSR+IL MSFAPRDTH++QVQFALERGVPALIG+L
Sbjct  217   INLKDGSIRTAIDTGCGVASWGAYLLSRDILAMSFAPRDTHEAQVQFALERGVPALIGVL  276

Query  1086  ASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQG  907
             ASKRLPYPS+AFDMAHCSRCLIPW  YDGAYL+EVDRVLRPGGYWILSGPPIRW++Y++G
Sbjct  277   ASKRLPYPSRAFDMAHCSRCLIPWDLYDGAYLMEVDRVLRPGGYWILSGPPIRWRKYFKG  336

Query  906   WDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASN  727
             W+RT++DL  EQT+IE+VA  LCWKKF+E DDIAIWQKPYNH  C    Q    MC +  
Sbjct  337   WERTKDDLNGEQTRIEEVAKKLCWKKFVEKDDIAIWQKPYNHFQC--KEQKKQLMC-SVQ  393

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             D D AWYT+L+TC+TPLP+V+ E+     +LEKWPKRLNA+PPRI  G++ G++   FEK
Sbjct  394   DYDKAWYTELETCITPLPEVTSEEDVAGGQLEKWPKRLNAIPPRISSGSVKGVTAGSFEK  453

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             DS LW KR+S+Y ++ D +L + GR+RN+LDMNA LGGFAA+ VD  +WVMN+VP E+++
Sbjct  454   DSQLWRKRVSYYKSI-DNKLNQPGRFRNLLDMNANLGGFAASWVDDPVWVMNIVPAEAEV  512

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY +WCEAMSTYPRTYDL+HADSIFT+YK+RC+M+DILLEMDRILRP
Sbjct  513   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDLLHADSIFTMYKERCDMDDILLEMDRILRP  572

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EGS+IIR+DVD+L++VKRI DGL WES +VDHEDGP++REKLLF VKTYWT
Sbjct  573   EGSIIIREDVDILVEVKRIVDGLNWESLIVDHEDGPMEREKLLFGVKTYWT  623



>ref|XP_010693483.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=642

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/535 (75%), Positives = 460/535 (86%), Gaps = 9/535 (2%)
 Frame = -2

Query  1632  DEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYR  1453
             D    +VYPPCD+ YSEYTPCED  RS+ + R+RLIYRERHCPKK E+LKCR+PAPFGY+
Sbjct  96    DSSLNRVYPPCDITYSEYTPCEDRRRSVKFTRDRLIYRERHCPKKWELLKCRVPAPFGYK  155

Query  1452  NPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIG  1273
             +PFKWP SRD  WY NVPHK LTVEKAVQNWIRFEGDRFKFPGGGTMF NGA AYID+IG
Sbjct  156   SPFKWPVSRDYVWYDNVPHKHLTVEKAVQNWIRFEGDRFKFPGGGTMFPNGAGAYIDEIG  215

Query  1272  KLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIG  1093
             KLINL DGSIRTA+DTGCGVAS+GAYLLSRNI+ MSFAP+DTH++QVQFALERGVPALIG
Sbjct  216   KLINLNDGSIRTAIDTGCGVASWGAYLLSRNIVAMSFAPKDTHEAQVQFALERGVPALIG  275

Query  1092  ILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYW  913
             ++ASKRLPYPS+AFDMAHCSRCLIPW QYDG YL+EVDRVLRPGGYWILSGPPI WK+YW
Sbjct  276   VMASKRLPYPSRAFDMAHCSRCLIPWDQYDGVYLMEVDRVLRPGGYWILSGPPINWKKYW  335

Query  912   QGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMC  739
             +GW R+ EDL  EQT+IE VA +LCWKK ++  DIAIWQKP NHM C R ++     P C
Sbjct  336   KGWQRSREDLNGEQTRIENVAKNLCWKKVIQKGDIAIWQKPINHMHCKRNQKVHTNQPFC  395

Query  738   PASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGE  574
             P  N PD AWYT+L+TC TPLP+VS+EKE     L KWPKRL  +PPRI+ GT +G++ +
Sbjct  396   PTPN-PDQAWYTNLETCHTPLPEVSEEKEVAGGHLAKWPKRLTEIPPRIRSGTTEGVTPK  454

Query  573   KFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPV  394
              F++D  LW +R+S+Y  V + QL + GRYRN+LDMNA LGGFAA LVD  +WVMNVVPV
Sbjct  455   IFQEDMKLWKRRVSYYKTV-NNQLGQLGRYRNLLDMNAKLGGFAAGLVDDPVWVMNVVPV  513

Query  393   ESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDR  214
             E+K+NTLGVIYERGLIGTY +WCEAMSTYPRTYD IHADSIFTLYKDRCEMEDILLEMDR
Sbjct  514   EAKVNTLGVIYERGLIGTYQSWCEAMSTYPRTYDFIHADSIFTLYKDRCEMEDILLEMDR  573

Query  213   ILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ILRPEGS+I RDDVD+L+K+K+ITD LQW+S++VDHEDGPLQREKLLFAVK+YWT
Sbjct  574   ILRPEGSIIFRDDVDILVKIKKITDALQWDSQIVDHEDGPLQREKLLFAVKSYWT  628



>ref|XP_011041603.1| PREDICTED: probable methyltransferase PMT16 [Populus euphratica]
Length=631

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/531 (75%), Positives = 459/531 (86%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V+ YP C+V  SEYTPCED +RS  + R +LIY ERHCP+K E+LKCRIPAP+GYRNPF 
Sbjct  90    VRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLIYEERHCPEKDEILKCRIPAPYGYRNPFT  149

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD AWY NVPHK LTVEKAVQNWIRFE DRF+FPGGGTMF NGADAYIDDIG+LI+
Sbjct  150   WPASRDYAWYNNVPHKHLTVEKAVQNWIRFEADRFRFPGGGTMFPNGADAYIDDIGRLID  209

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRN+LTMSFAPRD H++QVQFALERGVPALIGI+AS
Sbjct  210   LKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDNHEAQVQFALERGVPALIGIMAS  269

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYPS+AFDMAHCSRCLIPW  + G YLIEVDRVLRPGGYWILSGPPI W+ +W+GWD
Sbjct  270   KRLPYPSRAFDMAHCSRCLIPWADFGGQYLIEVDRVLRPGGYWILSGPPINWESHWKGWD  329

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASN  727
             RTE+DL  EQ +IE VA+SLCWKK +E DDIAIWQKP NH++C   R+    PP CPA +
Sbjct  330   RTEDDLNDEQNKIETVANSLCWKKLVEKDDIAIWQKPINHLNCKVNRKITQNPPFCPA-H  388

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT+++TCLT LP+VS  +     EL KWP+RLNAVPPRI RGT++GI+ E F+K
Sbjct  389   DPDKAWYTNMETCLTNLPEVSTNQDVAGGELPKWPERLNAVPPRISRGTLEGITAETFQK  448

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LWN+R+S+Y AV + QL + GRYRN+LDMNA+LGGFAAAL++  LWVMNVVPV++  
Sbjct  449   DTALWNRRVSYYKAV-NNQLEKPGRYRNILDMNAYLGGFAAALINDPLWVMNVVPVQASA  507

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F LY DRCEMEDILLEMDRILRP
Sbjct  508   NTLGVIYERGLIGTYQDWCEAMSTYPRTYDFIHADSVFNLYDDRCEMEDILLEMDRILRP  567

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EG+VI+RDDVDVL+K+K+ITD L W+SR+VDHEDGP QREKLLFAVK+YWT
Sbjct  568   EGNVILRDDVDVLVKIKKITDRLNWDSRIVDHEDGPHQREKLLFAVKSYWT  618



>ref|XP_006445150.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 ref|XP_006491016.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|ESR58390.1| hypothetical protein CICLE_v10019272mg [Citrus clementina]
 gb|KDO86013.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=636

 Score =   854 bits (2206),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/629 (66%), Positives = 494/629 (79%), Gaps = 28/629 (4%)
 Frame = -2

Query  1914  YSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtat  1735
             + + +  L  + L+ I CT+ Y  G WQ+  GA           + AT+ + + +     
Sbjct  15    FKTKHANLYSITLVTILCTIFYLAGMWQHSPGAI----------RAATSPSSILTS----  60

Query  1734  tlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTER  1555
                S+T + +S +  LDF+ HH   D    L       V   PPCD KY E  PCEDT R
Sbjct  61    VPCSSTSAKASTNLNLDFSAHHQAPDPPPTLAR-----VTYIPPCDPKYVENVPCEDTHR  115

Query  1554  SLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEK  1375
             SL +DR+RLIYRERHCP+K+E+LKCR+PAP GY  PF+WPESR  AWY NVPHKELTVEK
Sbjct  116   SLKFDRDRLIYRERHCPEKTELLKCRVPAPHGYTVPFRWPESRQFAWYANVPHKELTVEK  175

Query  1374  AVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAY  1195
               QNW+RF+GDRF FPGGGTMF  GADAYIDDIGKLINLKDGSIRTA+DTGCGVAS+GAY
Sbjct  176   KNQNWVRFQGDRFSFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAY  235

Query  1194  LLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPW  1015
             L+SRNIL +SFAPRDTH++QVQFALERGVPALIG++AS RLPYPS+AFDMAHCSRCLIPW
Sbjct  236   LMSRNILAVSFAPRDTHEAQVQFALERGVPALIGVMASIRLPYPSRAFDMAHCSRCLIPW  295

Query  1014  GQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCW  835
             GQYDG YLIEVDRVLRPGGYWILSGPP+ W+ +W+GW+RT EDL++EQ  IE +A SLCW
Sbjct  296   GQYDGLYLIEVDRVLRPGGYWILSGPPVNWESHWKGWNRTTEDLKSEQNGIETIARSLCW  355

Query  834   KKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSD  661
             KK ++  D+AIWQKP NH+ CI  R+    P  C A  DPDMAWYT ++TCLTPLP+VS+
Sbjct  356   KKLIQKKDLAIWQKPTNHVHCIANRRVFKKPRFCKA-QDPDMAWYTKMETCLTPLPEVSN  414

Query  660   EKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVE  496
              KE     L KWP+RLNA+PPR+ RG +DG++ E F +D+ LW KR+++Y +V D QL +
Sbjct  415   IKEIAGGQLTKWPERLNAIPPRVNRGAVDGVTAEMFREDTALWKKRVTYYKSV-DYQLAQ  473

Query  495   AGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAM  316
              GRYRN+LDMNA+LGGFAAALVD  LWVMN VPVE+K+NTLGVIYERGLIGTY  WCEAM
Sbjct  474   PGRYRNLLDMNAYLGGFAAALVDDPLWVMNTVPVEAKINTLGVIYERGLIGTYQNWCEAM  533

Query  315   STYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDG  136
             STYPRTYDLIHADSIF+LYKDRCEMED+LLEMDRILRPEGSVIIRDDVD+L+K+K ITDG
Sbjct  534   STYPRTYDLIHADSIFSLYKDRCEMEDVLLEMDRILRPEGSVIIRDDVDILVKIKSITDG  593

Query  135   LQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++WE R+ DHE+GP QREK+LFA K YWT
Sbjct  594   MEWEGRIADHENGPRQREKILFANKKYWT  622



>ref|XP_002321888.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
 gb|EEF06015.2| hypothetical protein POPTR_0015s13580g [Populus trichocarpa]
Length=631

 Score =   852 bits (2202),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/612 (68%), Positives = 480/612 (78%), Gaps = 37/612 (6%)
 Frame = -2

Query  1863  CTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqslsshsAGLD  1684
             CT SY FG+W+N   +     S   T      K+                        LD
Sbjct  37    CTFSYLFGSWRNTIVSIPCDPSKPTTTVTEEGKS------------------------LD  72

Query  1683  FtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP  1504
             F THH  GD    L +     V+ YP C+V  SEYTPCED +RS  + R +LIY ERHCP
Sbjct  73    FATHHSAGDLDVTLTSE----VRTYPSCNVNLSEYTPCEDPKRSFKFSRHQLIYEERHCP  128

Query  1503  KKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPG  1324
             +K E+LKCRIPAP+GYRNPF WP SRD AWY NVPHK LTVEKAVQNWIRFEGDRF+FPG
Sbjct  129   EKGELLKCRIPAPYGYRNPFTWPASRDYAWYNNVPHKHLTVEKAVQNWIRFEGDRFRFPG  188

Query  1323  GGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTH  1144
             GGTMF NGADAYIDDIG+LI+L DGSIRTA+DTGCGVAS+G YLLSRN+LTMSFAPRD H
Sbjct  189   GGTMFPNGADAYIDDIGRLIDLNDGSIRTAIDTGCGVASWGGYLLSRNVLTMSFAPRDNH  248

Query  1143  QSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRP  964
             ++QVQFALERGVPALIGI+ASKRLPYPS+AFDMAHCSRCLIPW  + G YLIEVDRVLRP
Sbjct  249   EAQVQFALERGVPALIGIMASKRLPYPSRAFDMAHCSRCLIPWADFGGQYLIEVDRVLRP  308

Query  963   GGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYN  784
             GGYWILSGPPI WK +W+GWDRTE+DL  EQ +IE VA+SLCWKK +E DDIAIWQKP N
Sbjct  309   GGYWILSGPPINWKTHWKGWDRTEDDLNDEQNKIETVANSLCWKKLVEKDDIAIWQKPIN  368

Query  783   HMDCIRLRQAP--PPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLN  625
             H++C   R+    PP CPA +DPD AWYT+++TCLT LP+ S  +     EL KWP+RLN
Sbjct  369   HLNCKANRKITQNPPFCPA-HDPDKAWYTNMETCLTNLPEASSNQDVAGGELPKWPERLN  427

Query  624   AVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGF  445
             AVPPRI RGT++GI+ E F+KD+ LWN+R+S+Y AV + QL + GRYRN+LDMNA+LGGF
Sbjct  428   AVPPRISRGTLEGITAETFQKDTALWNRRVSYYKAV-NNQLEKPGRYRNILDMNAYLGGF  486

Query  444   AAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFT  265
             AAAL++  LWVMNVVPV++  NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+
Sbjct  487   AAALINDPLWVMNVVPVQASANTLGVIYERGLIGTYQDWCEAMSTYPRTYDFIHADSVFS  546

Query  264   LYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQR  85
             LY  RCEMEDILLEMDRILRPEG+VI RDDVDVL+K+K+ITD L W+SR+VDHEDGP QR
Sbjct  547   LYDGRCEMEDILLEMDRILRPEGNVIFRDDVDVLVKIKKITDILNWDSRIVDHEDGPHQR  606

Query  84    EKLLFAVKTYWT  49
             EKLLFAVK YWT
Sbjct  607   EKLLFAVKAYWT  618



>ref|XP_010278559.1| PREDICTED: probable methyltransferase PMT15 [Nelumbo nucifera]
Length=633

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/629 (66%), Positives = 489/629 (78%), Gaps = 26/629 (4%)
 Frame = -2

Query  1905  PNNK---LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtat  1735
             P+NK   L  +  + + C+++Y FG WQ+ GG+            ++T       G    
Sbjct  6     PHNKTTSLYRMVFVTLLCSVAYLFGVWQHSGGS-----------DVSTNSATELLGTIRC  54

Query  1734  tlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTER  1555
                     L +    LDF+THH                 K +P CD KYSEYTPCED  R
Sbjct  55    VQIKNITQLPAKPTVLDFSTHHTAEGEITATPAR---GPKYFPACDAKYSEYTPCEDAVR  111

Query  1554  SLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEK  1375
             SL ++R+RLIYRERHCP+K+E+LKCR+PAP+GY+NPF WP SRD AWY NVPHKELTVEK
Sbjct  112   SLKFERDRLIYRERHCPEKAELLKCRVPAPYGYKNPFTWPTSRDFAWYANVPHKELTVEK  171

Query  1374  AVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAY  1195
             AVQNWIRF+ DRF+FPGGGTMF +GA AYIDDI KLINL+DGSIRTA+DTGCGVAS+GAY
Sbjct  172   AVQNWIRFQRDRFRFPGGGTMFPHGAGAYIDDIDKLINLRDGSIRTAIDTGCGVASWGAY  231

Query  1194  LLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPW  1015
             LLSRNILTMSFAPRDTH++QVQFALERGVPALIG+LAS RLPYPS+AFDMAHCSRCLIPW
Sbjct  232   LLSRNILTMSFAPRDTHEAQVQFALERGVPALIGVLASNRLPYPSRAFDMAHCSRCLIPW  291

Query  1014  GQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCW  835
             GQYDG YLIEVDR+LRPGGYWILSGPPI WKR+W+GW+RTEEDL  EQ+ IE VA SLCW
Sbjct  292   GQYDGLYLIEVDRILRPGGYWILSGPPINWKRHWKGWERTEEDLYKEQSTIEAVAKSLCW  351

Query  834   KKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSD  661
             KK +E  DIAIWQKP NH+ C + R+    P  C    DPD AWYT ++TCLTPLP  SD
Sbjct  352   KKVVERGDIAIWQKPTNHIYCKKSRKVIKQPKFC-QGQDPDKAWYTKMETCLTPLPDASD  410

Query  660   EKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVE  496
              KE     L+KWP+RL +VPPRI  G+++GI+ E F +D+ LW +R+ +Y +V + QL +
Sbjct  411   IKEIAGGQLDKWPERLYSVPPRISSGSLEGITAESFREDTELWRRRVGYYKSV-NNQLGQ  469

Query  495   AGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAM  316
              GRYRN+LDMNA LGGFAAAL+D  +WVMNVVP E+KLNTLG IYERGLIGTY  WCEAM
Sbjct  470   KGRYRNLLDMNAHLGGFAAALIDDPVWVMNVVPTEAKLNTLGAIYERGLIGTYQNWCEAM  529

Query  315   STYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDG  136
             STYPRTYDL+HADS+F+LYK RCEMEDILLEMDRILRPEG+VI RDDVDVL+++K ITDG
Sbjct  530   STYPRTYDLLHADSVFSLYKGRCEMEDILLEMDRILRPEGTVIFRDDVDVLLEIKSITDG  589

Query  135   LQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             + WES++VDHE GPL+REKLLFAVKTYWT
Sbjct  590   MNWESKIVDHEKGPLEREKLLFAVKTYWT  618



>gb|KDO86012.1| hypothetical protein CISIN_1g006633mg [Citrus sinensis]
Length=637

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/630 (66%), Positives = 494/630 (78%), Gaps = 29/630 (5%)
 Frame = -2

Query  1914  YSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtat  1735
             + + +  L  + L+ I CT+ Y  G WQ+  GA           + AT+ + + +     
Sbjct  15    FKTKHANLYSITLVTILCTIFYLAGMWQHSPGAI----------RAATSPSSILTS----  60

Query  1734  tlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTER  1555
                S+T + +S +  LDF+ HH   D    L       V   PPCD KY E  PCEDT R
Sbjct  61    VPCSSTSAKASTNLNLDFSAHHQAPDPPPTLAR-----VTYIPPCDPKYVENVPCEDTHR  115

Query  1554  SLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEK  1375
             SL +DR+RLIYRERHCP+K+E+LKCR+PAP GY  PF+WPESR  AWY NVPHKELTVEK
Sbjct  116   SLKFDRDRLIYRERHCPEKTELLKCRVPAPHGYTVPFRWPESRQFAWYANVPHKELTVEK  175

Query  1374  AVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAY  1195
               QNW+RF+GDRF FPGGGTMF  GADAYIDDIGKLINLKDGSIRTA+DTGCGVAS+GAY
Sbjct  176   KNQNWVRFQGDRFSFPGGGTMFPRGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAY  235

Query  1194  LLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPW  1015
             L+SRNIL +SFAPRDTH++QVQFALERGVPALIG++AS RLPYPS+AFDMAHCSRCLIPW
Sbjct  236   LMSRNILAVSFAPRDTHEAQVQFALERGVPALIGVMASIRLPYPSRAFDMAHCSRCLIPW  295

Query  1014  GQY-DGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLC  838
             GQY DG YLIEVDRVLRPGGYWILSGPP+ W+ +W+GW+RT EDL++EQ  IE +A SLC
Sbjct  296   GQYADGLYLIEVDRVLRPGGYWILSGPPVNWESHWKGWNRTTEDLKSEQNGIETIARSLC  355

Query  837   WKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVS  664
             WKK ++  D+AIWQKP NH+ CI  R+    P  C A  DPDMAWYT ++TCLTPLP+VS
Sbjct  356   WKKLIQKKDLAIWQKPTNHVHCIANRRVFKKPRFCKA-QDPDMAWYTKMETCLTPLPEVS  414

Query  663   DEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             + KE     L KWP+RLNA+PPR+ RG +DG++ E F +D+ LW KR+++Y +V D QL 
Sbjct  415   NIKEIAGGQLTKWPERLNAIPPRVNRGAVDGVTAEMFREDTALWKKRVTYYKSV-DYQLA  473

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
             + GRYRN+LDMNA+LGGFAAALVD  LWVMN VPVE+K+NTLGVIYERGLIGTY  WCEA
Sbjct  474   QPGRYRNLLDMNAYLGGFAAALVDDPLWVMNTVPVEAKINTLGVIYERGLIGTYQNWCEA  533

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
             MSTYPRTYDLIHADSIF+LYKDRCEMED+LLEMDRILRPEGSVIIRDDVD+L+K+K ITD
Sbjct  534   MSTYPRTYDLIHADSIFSLYKDRCEMEDVLLEMDRILRPEGSVIIRDDVDILVKIKSITD  593

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G++WE R+ DHE+GP QREK+LFA K YWT
Sbjct  594   GMEWEGRIADHENGPRQREKILFANKKYWT  623



>ref|XP_006490342.1| PREDICTED: probable methyltransferase PMT15-like [Citrus sinensis]
 gb|KDO60066.1| hypothetical protein CISIN_1g006905mg [Citrus sinensis]
Length=626

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/541 (73%), Positives = 458/541 (85%), Gaps = 11/541 (2%)
 Frame = -2

Query  1647  VLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPA  1468
             V     E  +K YP C++ YSEYTPC+D +RSL + R RLIYRERHCP KSE+LKCR+PA
Sbjct  78    VAATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLIYRERHCPAKSELLKCRVPA  137

Query  1467  PFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAY  1288
             P+GYRNPF WP SRD+ WY NVPHKELTVEKAVQNWIR+EGDRF+FPGGGTMF NGADAY
Sbjct  138   PYGYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEGDRFRFPGGGTMFPNGADAY  197

Query  1287  IDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGV  1108
             IDDIGKLINL DGSIRTA+DTGCGVAS+GAYLLSRNI+TMSFAPRDTH++QVQFALERGV
Sbjct  198   IDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMSFAPRDTHEAQVQFALERGV  257

Query  1107  PALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIR  928
             PALIG+LA++RLPYPS+AFDMAHCSRCLIPW Q+ G YLIEVDRVLRPGGYWILSGPPI 
Sbjct  258   PALIGVLAAERLPYPSRAFDMAHCSRCLIPWNQFGGIYLIEVDRVLRPGGYWILSGPPIN  317

Query  927   WKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC---IRLRQ  757
             WK++ +GW RT+EDL  EQT IE VA SLCW+K  E  DIAIW+KP NH++C    +L Q
Sbjct  318   WKKHARGWQRTKEDLNKEQTAIENVAKSLCWEKIKEKGDIAIWRKPINHLNCKTNQKLSQ  377

Query  756   APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTI  592
               PP CP   DPD AWYT + TCLT LP+VS ++     EL KWP+RLNAVPPRI +GT+
Sbjct  378   N-PPFCPV-QDPDKAWYTQMGTCLTRLPEVSSDRETAGGELAKWPQRLNAVPPRISKGTV  435

Query  591   DGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWV  412
              GI+ E F+++S LW KR+S+Y   M+ QL ++GRYRN+LDMNA LGGFAAAL+D  +WV
Sbjct  436   KGITPEIFQQNSELWKKRLSYYK-TMNNQLGQSGRYRNILDMNAHLGGFAAALIDFPVWV  494

Query  411   MNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDI  232
             MNVVP E+K+NTLGVIYERGL+GTY  WCEAMSTYPRTYDLIHADS+F+LYKDRCE EDI
Sbjct  495   MNVVPAEAKINTLGVIYERGLVGTYTNWCEAMSTYPRTYDLIHADSVFSLYKDRCETEDI  554

Query  231   LLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYW  52
             LLEMDRILRPEG VI RDDVD L+KVKRI D L+W+S++VDHEDGPL+REKLLFAVK YW
Sbjct  555   LLEMDRILRPEGGVIFRDDVDELVKVKRIIDALKWQSQIVDHEDGPLEREKLLFAVKLYW  614

Query  51    T  49
             T
Sbjct  615   T  615



>ref|XP_006421866.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
 gb|ESR35106.1| hypothetical protein CICLE_v10004550mg [Citrus clementina]
Length=626

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/620 (68%), Positives = 486/620 (78%), Gaps = 31/620 (5%)
 Frame = -2

Query  1884  LALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqsls  1705
             L L+   C  SY FG WQ+GG  S    ++  T  +  A +   +  TA           
Sbjct  19    LTLILFLCIFSYLFGLWQHGGPTSLLPATTSTTTVVDIACSTATATATAPKT--------  70

Query  1704  shsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLI  1525
                  +DFT HH       V     E  +K YP C++ YSEYTPC+D +RSL + R RLI
Sbjct  71    -----IDFTAHH-------VAATSSEAVMKTYPLCNISYSEYTPCQDGKRSLKFSRRRLI  118

Query  1524  YRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEG  1345
             YRERHCP KSE+LKCR+PAP+GYRNPF WP SRD+ WY NVPHKELTVEKAVQNWIR+EG
Sbjct  119   YRERHCPAKSELLKCRVPAPYGYRNPFAWPTSRDLVWYANVPHKELTVEKAVQNWIRYEG  178

Query  1344  DRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMS  1165
             DRF+FPGGGTMF NGADAYIDDIGKLINL DGSIRTA+DTGCGVAS+GAYLLSRNI+TMS
Sbjct  179   DRFRFPGGGTMFPNGADAYIDDIGKLINLNDGSIRTAIDTGCGVASWGAYLLSRNIITMS  238

Query  1164  FAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIE  985
             FAPRDTH++QVQFALERGVPALIG+LA++RLPYPS+AFDMAHCSRCLIPW Q+ G YLIE
Sbjct  239   FAPRDTHEAQVQFALERGVPALIGVLAAERLPYPSRAFDMAHCSRCLIPWNQFGGIYLIE  298

Query  984   VDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIA  805
             VDRVLRP GYWILSGPPI WK++ +GW RT+EDL  EQT IE VA SLCW+K  E  DIA
Sbjct  299   VDRVLRPRGYWILSGPPINWKKHARGWQRTKEDLNKEQTAIENVAKSLCWEKIKEKGDIA  358

Query  804   IWQKPYNHMDC---IRLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----EL  649
             IW+KP NH++C    +L Q  PP CP   DPD AWYT + TCLT LP+VS  +     EL
Sbjct  359   IWRKPINHLNCKTNQKLSQN-PPFCPV-QDPDKAWYTQMGTCLTRLPEVSSNRETAGGEL  416

Query  648   EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLD  469
              KWP+RLNAVPPRI +GT+ GI+ E F+++S LW KR+S+Y A M+ QL ++GRYRN+LD
Sbjct  417   AKWPQRLNAVPPRISKGTVKGITPEIFQQNSELWKKRLSYYKA-MNNQLGQSGRYRNILD  475

Query  468   MNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDL  289
             MNA LGGFAAAL+D  +WVMNVVP E+K+NTLGVIYERGLIGTY  WCEAMSTYPRTYDL
Sbjct  476   MNAHLGGFAAALIDFPVWVMNVVPAEAKINTLGVIYERGLIGTYTNWCEAMSTYPRTYDL  535

Query  288   IHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVD  109
             IHADS+F+LYKDRCE EDILLEMDRILRPEG VI RDDVD L+KVKRI D L+W+S++VD
Sbjct  536   IHADSVFSLYKDRCETEDILLEMDRILRPEGGVIFRDDVDELVKVKRIIDALKWQSQIVD  595

Query  108   HEDGPLQREKLLFAVKTYWT  49
             HEDGPL+REKLLFAVK YWT
Sbjct  596   HEDGPLEREKLLFAVKLYWT  615



>ref|XP_011030063.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=655

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/650 (66%), Positives = 507/650 (78%), Gaps = 26/650 (4%)
 Frame = -2

Query  1965  YYTPTYKPALPLHNHQYYSSP----NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsis  1798
             Y+  T+KP    H H   +SP       L  LALL   CT SY FG W++ GG    S++
Sbjct  8     YHGATFKP----HKHFAANSPFFFKKTNLYTLALLLFLCTFSYLFGVWRHEGGGGVLSVN  63

Query  1797  siftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSV  1618
                    ATA T     +     S  T + +     LDF++HH   D    L       V
Sbjct  64    KSA----ATATTSTIV-SIPCNPSKATTAATRGGKPLDFSSHHKADDLDFTL----TSEV  114

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             K YP C+V +SEYTPCED +RSL + R +LI RERHCP+K E+LKCRIPAP GY+NPFKW
Sbjct  115   KSYPSCNVNFSEYTPCEDAKRSLRFKRHQLICRERHCPEKHEILKCRIPAPHGYKNPFKW  174

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRD AWY NVPHK LTVEKA QNWIRF GDRF+FPGGGTMF NGADAYIDDIG+LINL
Sbjct  175   PASRDFAWYNNVPHKHLTVEKAGQNWIRFAGDRFRFPGGGTMFPNGADAYIDDIGRLINL  234

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
             KDGSIRTA+DTGCGVAS+GAYLLSRN+LTMSFAPRDTH++QVQFALERGVPALIGILASK
Sbjct  235   KDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVPALIGILASK  294

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RLPYPS+AFDMAHCSRCLIPW +  G YLIEVDRVLRPGGYWILSGPPI WK+ W+GW+R
Sbjct  295   RLPYPSRAFDMAHCSRCLIPWAESGGQYLIEVDRVLRPGGYWILSGPPINWKKRWKGWER  354

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASND  724
             T+ DL  EQ +IE VA SLCW+KF+E  DIAIW+KP NH+ C   R+     P C A  D
Sbjct  355   TKGDLNDEQMKIEAVAKSLCWRKFVEKADIAIWEKPINHLKCKVNRKITQNLPFCSA-QD  413

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             P+ AWYT+++TCLT LP+V++++     EL KWP+RLNAVPPRI RGT++GI+ E F+KD
Sbjct  414   PEKAWYTNMETCLTHLPEVANKEDVAGGELPKWPERLNAVPPRISRGTLEGITAETFQKD  473

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LWN+R+S+Y AV + QL +AGRYRN+LD NA+LGGFAAAL +  +WVMNVVP+++K+N
Sbjct  474   TVLWNRRVSYYKAV-NNQLEQAGRYRNILDTNAYLGGFAAALSEDPVWVMNVVPIQAKVN  532

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIGTY  WCEAMSTYPRTYDLIHADS+F+LY  RCEMEDILLEMDRILRPE
Sbjct  533   TLGVIYERGLIGTYQDWCEAMSTYPRTYDLIHADSVFSLYDGRCEMEDILLEMDRILRPE  592

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GSVI RDDVD+L+K+K+I+DGL W+S+++DHEDGP QREKLLFA+KTYWT
Sbjct  593   GSVIFRDDVDMLVKIKKISDGLNWDSQIIDHEDGPHQREKLLFAIKTYWT  642



>ref|XP_007152322.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
 gb|ESW24316.1| hypothetical protein PHAVU_004G120000g [Phaseolus vulgaris]
Length=627

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/645 (63%), Positives = 489/645 (76%), Gaps = 43/645 (7%)
 Frame = -2

Query  1962  YTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftA  1783
             Y PT KP+ P       ++   K    +L+A+ C  SY FG ++     + T        
Sbjct  10    YHPTAKPSKP-------NTHCKKTNLYSLVALLCIFSYTFGAYRQTSKPTATL-------  55

Query  1782  KIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPP  1603
                T K C  S                 ++ LDF++HH        L      S   YPP
Sbjct  56    ---TTKPCFHS--------------PPSTSHLDFSSHHNATATSLPLST----STSRYPP  94

Query  1602  CDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRD  1423
             CDV  SEYTPCED  RSL Y R R++YRERHCP K+E LKCR+PAP GYRNPF WP SRD
Sbjct  95    CDVSLSEYTPCEDHARSLRYSRRRMVYRERHCPTKTEALKCRVPAPHGYRNPFPWPASRD  154

Query  1422  VAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSI  1243
             VAWY NVPH+ELTVEKAVQNWIR++GDRF FPGGGTMF +GAD YIDDIGKL++L+DGS+
Sbjct  155   VAWYANVPHRELTVEKAVQNWIRYQGDRFHFPGGGTMFPDGADKYIDDIGKLVSLRDGSV  214

Query  1242  RTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYP  1063
             RTA+DTGCGVAS+GAYLLSR+I+ +S APRDTH++QVQFALERGVPALIG+LASKRLP+P
Sbjct  215   RTAVDTGCGVASWGAYLLSRDIIAVSIAPRDTHEAQVQFALERGVPALIGVLASKRLPFP  274

Query  1062  SKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDL  883
             S+AFDMAHCSRCLIPW +YDG YL E+DR+LRPGGYWILSGPPIRWK++W+GW+RT++DL
Sbjct  275   SRAFDMAHCSRCLIPWAEYDGLYLNEIDRILRPGGYWILSGPPIRWKKHWKGWERTKDDL  334

Query  882   EAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDPDMAW  709
               EQT+IE VA SLCW K +E DDIAIWQK  NH++C   R+     P C A   PD AW
Sbjct  335   NEEQTKIENVAKSLCWNKLVEKDDIAIWQKAKNHLECKANRKLTHNRPFCKAQGSPDKAW  394

Query  708   YTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWN  544
             YTD+QTCL+PLP VS ++E     L+ WP RL A PPRI  GTI G++ E F  D+ LW 
Sbjct  395   YTDMQTCLSPLPDVSSKEETAGGALKNWPDRLKATPPRISMGTIKGVTPETFSNDNKLWK  454

Query  543   KRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVI  364
             KR+S+Y  V + QL +AGRYRN+LDMNA+LGGFAAAL+D  +WVMNVVPV++K++TLG I
Sbjct  455   KRVSYYKNV-NNQLGKAGRYRNLLDMNAYLGGFAAALIDSPVWVMNVVPVQAKVDTLGAI  513

Query  363   YERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVII  184
             +ERGLIGTYH WCEAMSTYPRTYDLIHADS+F+LY DRCE+EDI+LEMDRILRPEGSVII
Sbjct  514   FERGLIGTYHNWCEAMSTYPRTYDLIHADSVFSLYNDRCELEDIVLEMDRILRPEGSVII  573

Query  183   RDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RDDVD+L+KVK I +G+ W+S++VDHEDGPL+REKLLFAVK YWT
Sbjct  574   RDDVDILVKVKSIVNGMDWDSQIVDHEDGPLEREKLLFAVKNYWT  618



>ref|XP_003548213.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=632

 Score =   842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/528 (73%), Positives = 454/528 (86%), Gaps = 8/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC V  SEYTPCED  RSL Y R R++YRERHCP+ +EVLKCR+PAP GYRNPF WP 
Sbjct  97    FPPCHVSLSEYTPCEDHARSLQYSRRRMVYRERHCPRNNEVLKCRVPAPHGYRNPFPWPA  156

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAWY NVPH+ELTVEKAVQNWIR++GDRF FPGGGTMF +GAD YIDDI  L+NL+D
Sbjct  157   SRDVAWYANVPHRELTVEKAVQNWIRYDGDRFHFPGGGTMFPDGADKYIDDIADLVNLRD  216

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             G++RTA+DTGCGVAS+GAYLLSR+I+T+S APRDTH++QVQFALERGVPALIG+LASKRL
Sbjct  217   GTVRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVPALIGVLASKRL  276

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             P+PS+AFDMAHCSRCLIPW +YDG YL E+DR+LRPGGYWILSGPPIRWK++W+GW+RT+
Sbjct  277   PFPSRAFDMAHCSRCLIPWAEYDGLYLNEIDRILRPGGYWILSGPPIRWKKHWKGWERTK  336

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDPD  718
             EDL  EQT+IE  A SLCW K +E DDIAIWQK  NH+DC   R+     P C A N+PD
Sbjct  337   EDLNKEQTKIENAAKSLCWNKLVEKDDIAIWQKAKNHLDCKSNRKLTQNRPFCKAQNNPD  396

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYTD+QTCL+P+P+VS ++E     L+KWP+RL A PPRI RGTI G++ E F KD+ 
Sbjct  397   KAWYTDMQTCLSPMPEVSSKEETAGGALKKWPERLKATPPRISRGTIKGVNPETFSKDNE  456

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+++Y    + QL +AGRYRN+LDMNA+LGGFAAALVD  +WVMNVVPV++K++TL
Sbjct  457   LWKKRVAYYKKA-NNQLGKAGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVQAKVDTL  515

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G IYERGLIGTYH WCEAMSTYPRTYDLIHADS+F+LY DRCE+EDILLEMDRILRPEGS
Sbjct  516   GAIYERGLIGTYHNWCEAMSTYPRTYDLIHADSLFSLYNDRCELEDILLEMDRILRPEGS  575

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD+L+KVK I +G+ W+S++VDHEDGPL+REKLLFAVK YWT
Sbjct  576   VIIRDDVDILVKVKSIVNGMDWDSQIVDHEDGPLEREKLLFAVKNYWT  623



>ref|XP_010061323.1| PREDICTED: probable methyltransferase PMT16 [Eucalyptus grandis]
 gb|KCW90733.1| hypothetical protein EUGRSUZ_A02808 [Eucalyptus grandis]
Length=605

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/623 (65%), Positives = 483/623 (78%), Gaps = 49/623 (8%)
 Frame = -2

Query  1902  NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlss  1723
              N+L    L+ + C++SY  G+W+                 IA +K C+ S         
Sbjct  16    TNRLHAWLLVFLLCSVSYLLGSWRKAAVT------------IAASKPCVSSS--------  55

Query  1722  ttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAY  1543
                        LDF             G    ++V+ YPPCDVK+SE+TPCED +RS  +
Sbjct  56    -----------LDFRPRRAQDG-----GASSSENVRTYPPCDVKHSEHTPCEDPKRSHRF  99

Query  1542  DRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQN  1363
             DR RLI+RERHCP+++E LKCR+PAP GYRNPF+WP SRD+AWY NVPHKELTVEKAVQN
Sbjct  100   DRRRLIFRERHCPERNETLKCRVPAPPGYRNPFRWPTSRDMAWYANVPHKELTVEKAVQN  159

Query  1362  WIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSR  1183
             WI+FEGDRF+FPGGGTMF NGADAYIDDIGKLI+L++GSIRTA+DTGCGVAS+GAYLLSR
Sbjct  160   WIQFEGDRFRFPGGGTMFPNGADAYIDDIGKLIDLRNGSIRTAIDTGCGVASWGAYLLSR  219

Query  1182  NILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYD  1003
              IL MSFAPRDTH++QVQFALERGVPA IG+LASKRLPYPS+AFDMAHCSRCLIPW  +D
Sbjct  220   GILAMSFAPRDTHEAQVQFALERGVPAQIGVLASKRLPYPSRAFDMAHCSRCLIPWDLFD  279

Query  1002  GAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFM  823
             G YLIEVDRVLRPGGYWILSGPPI WK +W GW RT+EDL AEQT+IE VA SLCWKK +
Sbjct  280   GIYLIEVDRVLRPGGYWILSGPPINWKNHWSGWQRTKEDLSAEQTRIENVAKSLCWKKLV  339

Query  822   EVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK----  655
             E DDIAIWQKP NH+ C         +CP S DPD AWYT ++TCLTPLP+V D +    
Sbjct  340   EKDDIAIWQKPINHLHC------KVNLCP-SQDPDKAWYTSMETCLTPLPKVKDGQEISG  392

Query  654   -ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
              EL  WP+RLN +PPRI +GT+ GI+ E F++++ LW +R+S+Y  V + QL   GRYRN
Sbjct  393   GELANWPERLNTIPPRISKGTLPGITAEIFQRETALWERRVSYYKTV-NNQLGLPGRYRN  451

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             +LDMNA+LGGFAA LV   +WV+NVVPVE+K+NTLG IYERGLIGTYH+WC+AMSTYPR 
Sbjct  452   LLDMNAYLGGFAATLVQDPVWVLNVVPVEAKVNTLGAIYERGLIGTYHSWCKAMSTYPRA  511

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDLIHADS+F+LY+DRCE++DILLEMDR+LRPEGS I+RDDVD+L+KVKRI D + ++S+
Sbjct  512   YDLIHADSLFSLYQDRCELDDILLEMDRVLRPEGSFILRDDVDMLVKVKRIIDTMNYDSQ  571

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             +VDHEDGPL REKLLFAVK+YWT
Sbjct  572   IVDHEDGPLVREKLLFAVKSYWT  594



>gb|EYU25067.1| hypothetical protein MIMGU_mgv1a004954mg [Erythranthe guttata]
Length=503

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/498 (79%), Positives = 442/498 (89%), Gaps = 9/498 (2%)
 Frame = -2

Query  1521  RERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGD  1342
             RERHCP+K E+LKCR+PAP+GY+NPFKWP SRD+AWY NVPHKELTVEKAVQNWIRFEGD
Sbjct  3     RERHCPEKDELLKCRVPAPYGYKNPFKWPLSRDLAWYANVPHKELTVEKAVQNWIRFEGD  62

Query  1341  RFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSF  1162
             RF+FPGGGTMF NGADAYIDDIGKLINLKDGSIRTA+DTGCGVAS+GAYLLSRNIL MSF
Sbjct  63    RFRFPGGGTMFPNGADAYIDDIGKLINLKDGSIRTAIDTGCGVASWGAYLLSRNILPMSF  122

Query  1161  APRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEV  982
             APRDTH++QVQFALERGVPALIG++ASKRLPYPS+AFDMAHCSRCLIPWGQ+DGAYLIEV
Sbjct  123   APRDTHEAQVQFALERGVPALIGVIASKRLPYPSRAFDMAHCSRCLIPWGQHDGAYLIEV  182

Query  981   DRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAI  802
             DRVLRPGGYWILSGPPI WK++W+GW+RT +DL +EQ QIE V  SLCWKK +E DDI+I
Sbjct  183   DRVLRPGGYWILSGPPINWKKHWKGWERTTDDLNSEQMQIENVTKSLCWKKLIEKDDISI  242

Query  801   WQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELEK  643
             WQKP NH+ C R R+    PP CPA  DPD AWYT+L+TCLTPLP+VS+       ELEK
Sbjct  243   WQKPTNHLKCKRFRKIFKNPPFCPAQ-DPDKAWYTNLETCLTPLPEVSNNDEIAGGELEK  301

Query  642   WPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMN  463
             WP+RLN VPPRI RGTI G++ E F++D  LW KR+S+Y  V + QL +AGRYRN+LDMN
Sbjct  302   WPRRLNTVPPRIIRGTIQGVTPEIFQQDLQLWKKRVSYYKTV-NNQLGQAGRYRNILDMN  360

Query  462   AFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIH  283
             AFLGGFAA LV   LWVMN+VPVE+K+NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIH
Sbjct  361   AFLGGFAANLVKDPLWVMNIVPVEAKVNTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIH  420

Query  282   ADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHE  103
             ADS+FTLYK+RCEMEDI+LEMDRILRPEGS+IIRDDVD L+K KRI DGL WES++VDHE
Sbjct  421   ADSVFTLYKERCEMEDIMLEMDRILRPEGSLIIRDDVDELVKAKRIADGLNWESQIVDHE  480

Query  102   DGPLQREKLLFAVKTYWT  49
             DGPL+REKLLFAVK YWT
Sbjct  481   DGPLEREKLLFAVKLYWT  498



>ref|XP_003533217.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=633

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/528 (72%), Positives = 453/528 (86%), Gaps = 8/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YPPC V  SEYTPCED  RSL Y R R++YRERHCP  S++LKCR+PAP GYRNPF WP 
Sbjct  98    YPPCHVSLSEYTPCEDHARSLQYSRRRMVYRERHCPTNSDLLKCRVPAPHGYRNPFPWPA  157

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAWY NVPH+ELTVEKAVQNWIR++GDRF+FPGGGTMF NGAD YIDDI  L+NL+D
Sbjct  158   SRDVAWYANVPHRELTVEKAVQNWIRYDGDRFRFPGGGTMFPNGADKYIDDIADLVNLRD  217

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             G++RTA+DTGCGVAS+GAYLLSR+I+T+S APRDTH++QVQFALERGVPALIG+LASKRL
Sbjct  218   GTVRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVPALIGVLASKRL  277

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             P+PS+AFDMAHCSRCLIPW +YDG YL E+DR+LRPGGYWILSGPPIRWK++W+GW+RT+
Sbjct  278   PFPSRAFDMAHCSRCLIPWAEYDGLYLNEIDRILRPGGYWILSGPPIRWKKHWKGWERTK  337

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDPD  718
             EDL  EQT+IE VA SLCW K +E DDIAIWQK  NH+DC   R+     P+C A ++PD
Sbjct  338   EDLNEEQTKIENVAKSLCWNKLVEKDDIAIWQKAKNHLDCKANRKLSHNRPLCKAQSNPD  397

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT++QTCL+PLP+VS + E     L+ WP+RL A PPRI +GTI G++ E F KD+ 
Sbjct  398   KAWYTEMQTCLSPLPEVSSKDETAGGALKNWPERLKATPPRISKGTIKGVTSETFSKDNE  457

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KRI++Y  V + QL +AGRYRN+L+MNA+LGGFAA LVD  +WVMNVVPV++K++TL
Sbjct  458   LWKKRIAYYKKV-NNQLGKAGRYRNLLEMNAYLGGFAAVLVDLPVWVMNVVPVQAKVDTL  516

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G IYERGLIGTYH WCEAMSTYPRTYDLIHADS+F+LY DRCE+EDILLEMDRILRPEGS
Sbjct  517   GAIYERGLIGTYHNWCEAMSTYPRTYDLIHADSVFSLYSDRCELEDILLEMDRILRPEGS  576

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD+L+KVK I +G+ W+ ++VDHEDGPL+REKLLFAVK YWT
Sbjct  577   VIIRDDVDILVKVKSIVNGMDWDCQIVDHEDGPLEREKLLFAVKNYWT  624



>ref|XP_010693482.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=629

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/624 (65%), Positives = 487/624 (78%), Gaps = 25/624 (4%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             N +  L L+ I C+ SY FG WQ   G   +S         A   TC+         +  
Sbjct  18    NHIYTLTLITILCSTSYFFGVWQRSSGRGRSST------SSAIITTCI---------THN  62

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
                L S  + LDF+ HH   D  + +        K YP C+  YS+YTPCED  R+L   
Sbjct  63    LTGLGSSLSLLDFSAHHLAEDVPSTVSG-SSLMTKSYPGCNASYSDYTPCEDPNRALKLK  121

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             + R+++ ERHCP K+EVLKCR+PAP+GY++PFKWP SRD AWY NVP K LT  KAVQNW
Sbjct  122   QTRMMHLERHCPTKTEVLKCRVPAPYGYKSPFKWPVSRDYAWYNNVPSKMLTEHKAVQNW  181

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             IRFEGDRFKFPGGGTMFR GADAYID+I KLINL DGSIRTA+DTGCGVAS+GAYL+SRN
Sbjct  182   IRFEGDRFKFPGGGTMFRFGADAYIDNIAKLINLHDGSIRTAIDTGCGVASWGAYLMSRN  241

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             IL MSFAPRDTH++QVQFALERGVPALIG++ASKRLPYPS+AFDMAHC+RCLI W QYDG
Sbjct  242   ILPMSFAPRDTHEAQVQFALERGVPALIGVMASKRLPYPSRAFDMAHCARCLIHWDQYDG  301

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
              YLIEVDRVLRPGGYWILSGPPIRW++ W+GW  ++E L+ EQT+IE +A  LCWKK +E
Sbjct  302   VYLIEVDRVLRPGGYWILSGPPIRWEKNWKGWKMSKEVLKREQTRIENLATKLCWKKIIE  361

Query  819   VDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK---  655
              DDIAIWQKP NH++C R ++  A PP+CPA  DPDMAWYT+L+TCLTPLP+VS+     
Sbjct  362   KDDIAIWQKPINHINCKRTQEVNADPPLCPA-QDPDMAWYTNLETCLTPLPEVSENHKVA  420

Query  654   --ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYR  481
               +L KWPKRL  +PPRI  G+I G++ + F++D  +W +R+SHY AV + QL E GRYR
Sbjct  421   GGQLAKWPKRLTEIPPRISSGSIKGVTPKIFQEDMKIWKRRVSHYKAV-NNQLGEPGRYR  479

Query  480   NVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPR  301
             N+LDMNA +GGFAA LVD  +WVMNVVPVE+++NTLGVIYERGLIGTYH+WCEAMSTYPR
Sbjct  480   NLLDMNAKMGGFAAGLVDDPVWVMNVVPVEAEVNTLGVIYERGLIGTYHSWCEAMSTYPR  539

Query  300   TYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWES  121
             TYD IHADSIF+LYKDRCEMEDILLEMDRILRPEGSV+ RDDVD+L+++K+I D  QW+S
Sbjct  540   TYDFIHADSIFSLYKDRCEMEDILLEMDRILRPEGSVMFRDDVDLLVQIKKIIDAFQWDS  599

Query  120   RVVDHEDGPLQREKLLFAVKTYWT  49
              +V+HEDGPLQREKLLFAVK+YWT
Sbjct  600   HIVNHEDGPLQREKLLFAVKSYWT  623



>ref|XP_002511797.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF50466.1| ATP binding protein, putative [Ricinus communis]
Length=627

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/526 (73%), Positives = 444/526 (84%), Gaps = 7/526 (1%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD + SEYTPCED +RSL +DR+RL+YRERHCP+K E+LKCR+PAPFGYR PF+WP S
Sbjct  86    PPCDPELSEYTPCEDRQRSLQFDRDRLVYRERHCPEKKELLKCRVPAPFGYRVPFRWPVS  145

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+  W+ NVPHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GADAYIDDIGKLINLKDG
Sbjct  146   REYGWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLINLKDG  205

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVASFGAYLLSRNILTMSFAPRDTH++QVQFALERGVPALIG+ AS R P
Sbjct  206   SIRTAIDTGCGVASFGAYLLSRNILTMSFAPRDTHEAQVQFALERGVPALIGVFASMRQP  265

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPW  YDG YLIEVDR+LRPGGYW+LSGPPI W+ +W+GW RT E
Sbjct  266   YPSRAFDMAHCSRCLIPWATYDGQYLIEVDRMLRPGGYWVLSGPPINWENHWKGWSRTPE  325

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDMA  712
             DL  EQT IE VA SLCWKK ++ DD+AIWQKP NH+ C   R+    P+   S DPD A
Sbjct  326   DLNEEQTSIETVAKSLCWKKLVQKDDLAIWQKPTNHIHCKANRKVFKQPLFCESQDPDRA  385

Query  711   WYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT L+TCLTPLP+VS+ +     +L  WP+RL A+PPRI  G+++GI+ E F +++ LW
Sbjct  386   WYTKLETCLTPLPEVSNIRDIAGGQLANWPERLTAIPPRISSGSLNGITAETFTENTELW  445

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              KR+ HY AV D QL E GRYRN+LDMNA+LGGFAAALVD   WVMNVVPVE+ +NTLGV
Sbjct  446   KKRVDHYKAV-DHQLAEQGRYRNILDMNAYLGGFAAALVDDPAWVMNVVPVETDINTLGV  504

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERGLIGTY  WCEAMSTYPRTYDLIHADS+F+LYKDRC+MED+LLEMDRILRPEGSVI
Sbjct  505   IYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFSLYKDRCDMEDLLLEMDRILRPEGSVI  564

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRDDVDVL+KVK I D +QW++R+ DHE  P +REK+LFAVK YWT
Sbjct  565   IRDDVDVLLKVKSIVDVMQWDARIADHERSPHEREKILFAVKQYWT  610



>gb|KEH17379.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=636

 Score =   831 bits (2146),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/526 (72%), Positives = 452/526 (86%), Gaps = 8/526 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YPPC    ++YTPCED  RSL Y R+++IYRERHCPKK E+LKCR+PAP GY+NPF WP 
Sbjct  105   YPPCTPSLTDYTPCEDHTRSLKYTRDKMIYRERHCPKKHEILKCRVPAPNGYKNPFPWPT  164

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+AWY NVP++ LTVEKA QNWIRF+GD+F+FPGGGTMF NGAD YIDDIGKLI+L+D
Sbjct  165   SRDMAWYANVPYRHLTVEKAGQNWIRFDGDKFRFPGGGTMFPNGADKYIDDIGKLIDLED  224

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GS+RTA+DTGCGVAS+GAYLLSR+ILT+S APRDTH++QVQFALERGVPA+IG+ ASKRL
Sbjct  225   GSVRTAVDTGCGVASWGAYLLSRDILTVSIAPRDTHEAQVQFALERGVPAVIGVFASKRL  284

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             P+PS+AFDMAHCSRCLIPW +YDG YL EVDR+LRPGGYWILSGPPI WKRYW+GW+RT+
Sbjct  285   PFPSRAFDMAHCSRCLIPWPEYDGLYLNEVDRILRPGGYWILSGPPIHWKRYWKGWERTK  344

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMA  712
             EDL  EQT+IE VA SLCW K +E  DIAIWQKP NH+DC   +    P C   N+PD A
Sbjct  345   EDLNEEQTKIENVAKSLCWNKIVEKGDIAIWQKPKNHLDCKFTQNR--PFCQEQNNPDKA  402

Query  711   WYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT++QTCL PLP+VS+++     EL  WP+RL + PPRI +GTI G++ + F KD+ LW
Sbjct  403   WYTNMQTCLNPLPKVSNKEEISGGELNNWPQRLKSTPPRISKGTIKGVTPQTFSKDNQLW  462

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
             NKR+S+Y  V + QL +AGRYRN+LDMNA+LGGFAA+LV + +WVMNVVP+++K++TLG 
Sbjct  463   NKRVSYYKKV-NNQLEKAGRYRNLLDMNAYLGGFAASLVKYPIWVMNVVPIQAKVDTLGA  521

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERGLIG YH WCEAMSTYPRTYDLIHADS+F+LY DRCE+EDILLEMDRILRPEGSVI
Sbjct  522   IYERGLIGMYHNWCEAMSTYPRTYDLIHADSVFSLYNDRCELEDILLEMDRILRPEGSVI  581

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRDDVD+L+KVK I +GL+WES++VDHEDGPL+REKLLFAVK YWT
Sbjct  582   IRDDVDILVKVKSIINGLEWESQIVDHEDGPLEREKLLFAVKKYWT  627



>gb|KDP28686.1| hypothetical protein JCGZ_14457 [Jatropha curcas]
Length=628

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/530 (72%), Positives = 448/530 (85%), Gaps = 7/530 (1%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V   PPCD KYSEYTPCED ERSL +DR++L+YRERHCP+K+E+LKCR+PAPFGYR PF+
Sbjct  85    VSHLPPCDPKYSEYTPCEDRERSLKFDRKKLVYRERHCPEKNELLKCRVPAPFGYRVPFR  144

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SR+  WY +VPHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GADAYIDDIGKLIN
Sbjct  145   WPVSREYVWYADVPHKELTVEKKKQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIN  204

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVASFGAYLLSRNILT+SFAPRDTH++QVQFALERGVPALIG+ AS
Sbjct  205   LKDGSIRTAVDTGCGVASFGAYLLSRNILTVSFAPRDTHEAQVQFALERGVPALIGVFAS  264

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              R PYPS+AFDMAHCSRCLIPW + +G YLIEVDR+LRPGGYW+LSGPPI W+ +W+GWD
Sbjct  265   IRQPYPSRAFDMAHCSRCLIPWAENEGQYLIEVDRILRPGGYWVLSGPPINWENHWKGWD  324

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASND  724
             RT EDL  EQ +IE VA SLCWKK ++ DD+AIWQKP NH+ CI  R+    P    S D
Sbjct  325   RTPEDLNQEQAKIETVAKSLCWKKLIQKDDLAIWQKPTNHIHCIANRKVFKQPFFCESRD  384

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWYT ++TCLTPL +VS+ +     EL KWP+RL A+PPRI  G+++GI+ E F K+
Sbjct  385   PDKAWYTKMETCLTPLSEVSNIRDIAGGELPKWPERLTAIPPRISNGSLEGITAEIFTKN  444

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KRI+HY  + D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMNVVPVE+++N
Sbjct  445   TELWKKRIAHYRTI-DYQLAEKGRYRNLLDMNAYLGGFAAALVDDPVWVMNVVPVEAEVN  503

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLG IYERGLIGTY  WCEAMSTYPRTYD IHADSIF+LYKDRCEMEDILLEMDRILRPE
Sbjct  504   TLGAIYERGLIGTYQNWCEAMSTYPRTYDFIHADSIFSLYKDRCEMEDILLEMDRILRPE  563

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GSVIIRDDVD+L++VK+I + +QW +R+ DHE  P +REK+LFAVK YWT
Sbjct  564   GSVIIRDDVDILLQVKKIAEVMQWNARIADHERSPHEREKILFAVKEYWT  613



>ref|XP_004515722.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=649

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/526 (71%), Positives = 451/526 (86%), Gaps = 7/526 (1%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YPPC    ++YTPCED  RSL Y R+++IYRERHCP K+E+LKCR+PAP GY+NPF WP 
Sbjct  117   YPPCTPSLTDYTPCEDHARSLKYTRDKMIYRERHCPNKNEILKCRVPAPNGYKNPFPWPT  176

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD+AWY NVP++ LTVEKAVQNWIRF+GDRF+FPGGGTMF +GAD YIDDIGKLINL D
Sbjct  177   SRDMAWYANVPYRHLTVEKAVQNWIRFDGDRFRFPGGGTMFPDGADKYIDDIGKLINLSD  236

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSR+I+T+S APRDTH++QVQFALERGVPA+IG+LASKRL
Sbjct  237   GSIRTAVDTGCGVASWGAYLLSRDIITVSIAPRDTHEAQVQFALERGVPAIIGVLASKRL  296

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             P+PS+AFDMAHCSRCLIPW +YDG YL E+DR+LRPGGYWILSGPPI WK+YW+GW+RT+
Sbjct  297   PFPSRAFDMAHCSRCLIPWPEYDGLYLNEIDRILRPGGYWILSGPPIHWKKYWKGWERTK  356

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMA  712
             EDL  EQT+IEKVA SLCW K +E  DIAIWQKP NH DC +      P C   N+PD A
Sbjct  357   EDLNEEQTKIEKVATSLCWNKLIENGDIAIWQKPKNHFDC-KANTQNRPFCMVQNNPDKA  415

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT++QTCL PLP+VS+++E     L  WP+RL + PPRI +GTI G++ + F KD+ LW
Sbjct  416   WYTNMQTCLIPLPEVSNKEETAGGALSNWPQRLKSTPPRISKGTIKGVTPQTFSKDNELW  475

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
             NKR+S+Y  V + QL +AGRYRN+LDMN +LGGFAA+LV++ +WVMNVVP+++K++TLG 
Sbjct  476   NKRVSYYKKV-NNQLGKAGRYRNLLDMNGYLGGFAASLVNYPIWVMNVVPIQAKVDTLGA  534

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERGLIG YH WCEAMSTYPRTYDLIHAD +F+LY DRCE+EDILLEMDRILRPEGSVI
Sbjct  535   IYERGLIGMYHNWCEAMSTYPRTYDLIHADYVFSLYNDRCELEDILLEMDRILRPEGSVI  594

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRDDVD+L+KVK I +G+ WES++VDHEDGPL+REKLLFAVK YWT
Sbjct  595   IRDDVDILVKVKSIINGMNWESQIVDHEDGPLEREKLLFAVKKYWT  640



>ref|XP_008234471.1| PREDICTED: probable methyltransferase PMT16, partial [Prunus 
mume]
Length=601

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/532 (74%), Positives = 450/532 (85%), Gaps = 20/532 (4%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             K YPPCD K+SEYTPCED +RSL +DR+RLIYRERHCP+K+E+LKCR+PAP GY+  F W
Sbjct  69    KAYPPCDFKFSEYTPCEDAKRSLKFDRDRLIYRERHCPEKNELLKCRVPAPHGYKTVFSW  128

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDR--FKFPGGGTMFRNGADAYIDDIGKLI  1264
             P SRD+AWY NVPHKELTVEKAVQNWI +EGDR   +FPGGGTMF NGADAYIDDIGKLI
Sbjct  129   PMSRDLAWYANVPHKELTVEKAVQNWIIYEGDRNRLRFPGGGTMFPNGADAYIDDIGKLI  188

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
             NLKDGSIRTA+DTGCGVAS+GAYLLSRNILTMSFAPRDTH SQVQFALERGVPALIG++A
Sbjct  189   NLKDGSIRTAIDTGCGVASWGAYLLSRNILTMSFAPRDTHVSQVQFALERGVPALIGVIA  248

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYPS+AFDMAHCSRCLIPWGQ+DG YL EVDRVLRPGGYWILSGPPIRW++YW GW
Sbjct  249   SKRLPYPSRAFDMAHCSRCLIPWGQHDGVYLTEVDRVLRPGGYWILSGPPIRWQKYWTGW  308

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPP--MCPAS  730
              R         T    VA SLCWKK +E DDIAIWQKP NH+ C   R+       CPA 
Sbjct  309   GR---------TXXXXVAKSLCWKKLVEKDDIAIWQKPTNHLTCQNNRKLGKSRNFCPA-  358

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             NDPD AWYT L TCLTPLP+VSD ++     L KWP+RLNA+PPRI +GT+ G++ E F+
Sbjct  359   NDPDKAWYTKLDTCLTPLPEVSDNEQVAGGKLAKWPQRLNAIPPRINKGTVKGVTAEVFK  418

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +DS LW KR+S+Y +V + QL   GRYRN+LDMNA+LGGFAAALVD  +WVMNVVPV+ K
Sbjct  419   QDSELWKKRVSYYKSV-NNQLGNPGRYRNLLDMNAYLGGFAAALVDLPVWVMNVVPVDVK  477

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
              NTLGVIYERGLIGTY  WCEAMSTYPRTYDLIHADS+FTLY+DRCEM+DILLEMDRILR
Sbjct  478   ANTLGVIYERGLIGTYQNWCEAMSTYPRTYDLIHADSVFTLYEDRCEMDDILLEMDRILR  537

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEGSVIIRDDVD+L+K+K I D ++W+S++VDHEDGP +REKLLFAVK YWT
Sbjct  538   PEGSVIIRDDVDMLVKIKSIIDEMEWDSQIVDHEDGPHEREKLLFAVKKYWT  589



>ref|XP_008439398.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=603

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/532 (73%), Positives = 448/532 (84%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             + K +P C + YSEYTPCEDT RSL + R+RLIYRERHCP+K E LKCRIPAP GYRNPF
Sbjct  59    AAKPFPACGLNYSEYTPCEDTHRSLKFSRDRLIYRERHCPEKEESLKCRIPAPPGYRNPF  118

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
              WP SRD+AWY NVPHK LTVEKAVQNWIR+EG+ F+FPGGGTMF +GADAYID+IGKLI
Sbjct  119   AWPVSRDLAWYVNVPHKHLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADAYIDNIGKLI  178

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
             NLKDGSIRTA+DTGCGV S+GAYLLSR+I+TMSFAPRDTH++QVQFALERGVPALIGILA
Sbjct  179   NLKDGSIRTAIDTGCGVGSWGAYLLSRDIITMSFAPRDTHEAQVQFALERGVPALIGILA  238

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYPS AFDMAHCSRCLIPW QY+G +L+EVDRVLRPGGYWILSGPPI WK++W+GW
Sbjct  239   SKRLPYPSNAFDMAHCSRCLIPWSQYEGIFLVEVDRVLRPGGYWILSGPPINWKKHWKGW  298

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPAS  730
             +RT+EDL +EQ  IEKVA SLCW K +E  DIAIWQKP NH++C   R+    PP C  S
Sbjct  299   ERTKEDLNSEQLAIEKVAKSLCWTKLVEDGDIAIWQKPINHLNCKVNRKITKNPPFC-NS  357

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
              DPD AWYTD+Q CLT LP+VS+ KE     L +WP+RLNA+P RI RGT++G++ E F 
Sbjct  358   QDPDRAWYTDMQACLTHLPEVSNSKEIAGGKLARWPERLNAIPQRISRGTVEGVTEETFI  417

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
              DS LW KR+++Y  + + QL + GRYRN LDMNAFLGGFAAALVD  +WVMNVVPV+ K
Sbjct  418   HDSELWKKRLTYYRTI-NNQLNKPGRYRNFLDMNAFLGGFAAALVDDPVWVMNVVPVDVK  476

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             +NTLGVIY+RGLIGTY  WCEAMSTYPRTYD IHADS+F+LYK+RCEMEDILLEMDR LR
Sbjct  477   VNTLGVIYDRGLIGTYQDWCEAMSTYPRTYDFIHADSVFSLYKNRCEMEDILLEMDRTLR  536

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEGSVI R+++DVL+K+K ITD L W S++V HEDGP   EKLLFAVK YWT
Sbjct  537   PEGSVIFRENIDVLVKIKMITDNLNWSSQIVHHEDGPYHMEKLLFAVKNYWT  588



>ref|XP_004140852.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
 ref|XP_004157229.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT15-like 
[Cucumis sativus]
 gb|KGN57350.1| hypothetical protein Csa_3G180380 [Cucumis sativus]
Length=604

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/541 (72%), Positives = 450/541 (83%), Gaps = 9/541 (2%)
 Frame = -2

Query  1650  AVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIP  1471
               L N    + K +P C + YSEYTPCEDT+RSL + R+RLIYRERHCP+K E LKCRIP
Sbjct  51    TTLQNITITAAKPFPACGLVYSEYTPCEDTQRSLKFSRDRLIYRERHCPEKEEALKCRIP  110

Query  1470  APFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADA  1291
             AP GYRNPF WP SRD+AWY NVPHK+LTVEKAVQNWIR+EG+ F+FPGGGTMF +GADA
Sbjct  111   APPGYRNPFAWPVSRDLAWYVNVPHKDLTVEKAVQNWIRYEGETFRFPGGGTMFPDGADA  170

Query  1290  YIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERG  1111
             YID+IGKLINLKDGSIRTA+DTGCGV S+GAYLLSR I+TMSFAPRDTH++QVQFALERG
Sbjct  171   YIDNIGKLINLKDGSIRTAIDTGCGVGSWGAYLLSRGIITMSFAPRDTHEAQVQFALERG  230

Query  1110  VPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPI  931
             VPALIGILASKRLPYPS AFDMAHCSRCLIPW QYDG +LIEVDRVLRPGGYWILSGPPI
Sbjct  231   VPALIGILASKRLPYPSNAFDMAHCSRCLIPWSQYDGIFLIEVDRVLRPGGYWILSGPPI  290

Query  930   RWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP  751
              W ++W+GW+RT+EDL +EQ  IEKVA SLCW K +E  DIAIWQKP NH++C   R+  
Sbjct  291   NWNKHWKGWERTKEDLNSEQLAIEKVAKSLCWTKLVEDGDIAIWQKPINHLNCKVNRKIT  350

Query  750   --PPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTI  592
               PP C A  DPD AWYTD+Q CLT LP+VS+ KE     L +WP+RLNA+P RI RGT+
Sbjct  351   KNPPFCNA-QDPDRAWYTDMQACLTHLPEVSNSKEIAGGKLARWPERLNAIPQRISRGTV  409

Query  591   DGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWV  412
             +G++ E F  DS LW KR+++Y  + + QL + GRYRN LDMNAFLGGFAAALVD  +WV
Sbjct  410   EGVTEETFIHDSELWKKRLTYYRTI-NNQLNKPGRYRNFLDMNAFLGGFAAALVDDPVWV  468

Query  411   MNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDI  232
             MNVVPV++K+NTLGVIY+RGLIGTY  WCEAMSTYPRTYD IHADS+F+LY++RCEMEDI
Sbjct  469   MNVVPVDAKVNTLGVIYDRGLIGTYQDWCEAMSTYPRTYDFIHADSVFSLYENRCEMEDI  528

Query  231   LLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYW  52
             LLEMDRILRPEGSVI R+++D L K+K ITD L W S++V HEDGP   EKLLFAVK YW
Sbjct  529   LLEMDRILRPEGSVIFRENIDTLAKIKMITDNLNWSSQIVHHEDGPYHMEKLLFAVKNYW  588

Query  51    T  49
             T
Sbjct  589   T  589



>ref|XP_009400717.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=631

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/624 (65%), Positives = 482/624 (77%), Gaps = 28/624 (4%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
               LL L ++AI C+ SY+ G WQ+G GA+  + +      + TA +C          +  
Sbjct  22    TNLLRLGVVAILCSASYYLGIWQHGSGATSVTST------VVTAVSC--------DRNPA  67

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
                ++  +A LDF  HHG     A        SV+ +P CD+KYSEYTPCED +RSL +D
Sbjct  68    ASPITGRAAALDFAVHHGADQAAA-----GAPSVREFPACDIKYSEYTPCEDRDRSLRFD  122

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             R+RLIYRERHCP K E+LKC IPAP GYRNPF WP SR+ AW+ NVPHKELTVEKAVQNW
Sbjct  123   RDRLIYRERHCPTKGELLKCLIPAPPGYRNPFPWPASRETAWFANVPHKELTVEKAVQNW  182

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             I  +GD+F+FPGGGTMF NGADAYIDDI +LI+L DGSIRTA+DTGCGVAS+GAYLLSRN
Sbjct  183   IHVDGDKFRFPGGGTMFPNGADAYIDDIDRLISLSDGSIRTAVDTGCGVASWGAYLLSRN  242

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             +LTMSFAPRD+H++QVQFALERGVPA+IG+LAS RLPYPS+AFDMAHCSRCLIPW  YDG
Sbjct  243   VLTMSFAPRDSHEAQVQFALERGVPAMIGVLASIRLPYPSRAFDMAHCSRCLIPWHLYDG  302

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
              YLIEVDR+LRPGGYWILSGPP+ WK++W+GWDRT EDL  EQ+ IE VA SLCW K  E
Sbjct  303   QYLIEVDRILRPGGYWILSGPPVNWKKHWKGWDRTREDLNHEQSAIEAVARSLCWNKLKE  362

Query  819   VDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVS-----D  661
               DIAIWQKP NH+ C   R+    P  C + N PD AWYT  ++C+TPLP+V       
Sbjct  363   KGDIAIWQKPINHIGCKANRKTVRSPQFCQSQN-PDTAWYTKTESCITPLPEVVRVEEIS  421

Query  660   EKELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYR  481
               EL+KWP+RL AVPPRI RG+IDG + E F +D+ LW  R+ +Y  V++ QL + GRYR
Sbjct  422   GGELKKWPERLTAVPPRIARGSIDGATPEVFLQDTELWKNRVGYYKTVIN-QLGQKGRYR  480

Query  480   NVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPR  301
             N+LDMNA  GGFAAAL+D  LWVMN+VP  + +NTLGVIYERGLIGTY  WCEAMSTYPR
Sbjct  481   NLLDMNAKFGGFAAALIDDPLWVMNIVPTAADVNTLGVIYERGLIGTYQDWCEAMSTYPR  540

Query  300   TYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWES  121
             TYDL+HADS+FTLYKDRCEMEDILLEMDRILRPEG+VIIRDDVD L+K+K I DG++W S
Sbjct  541   TYDLLHADSVFTLYKDRCEMEDILLEMDRILRPEGTVIIRDDVDALVKIKSIADGMRWNS  600

Query  120   RVVDHEDGPLQREKLLFAVKTYWT  49
             R++DHEDGPLQREKLL  VKTYWT
Sbjct  601   RIMDHEDGPLQREKLLLVVKTYWT  624



>ref|XP_011091674.1| PREDICTED: probable methyltransferase PMT15 [Sesamum indicum]
Length=645

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/528 (73%), Positives = 447/528 (85%), Gaps = 9/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPCD K+SEYTPC+DT RSL +DR+ L+YRERHCP+KSE+LKCR+PAP GY+ PF+WPE
Sbjct  105   FPPCDRKFSEYTPCQDTARSLKFDRDMLVYRERHCPEKSELLKCRVPAPHGYKTPFRWPE  164

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDV WY NVPHK LTVEKA QNW+RFEGDRF FPGGGTMF  GADAYIDDIGKLINL D
Sbjct  165   SRDVVWYANVPHKHLTVEKAGQNWVRFEGDRFSFPGGGTMFPRGADAYIDDIGKLINLGD  224

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSR+IL MSFAP+DTH++QVQFALERGVPALIGI+AS+RL
Sbjct  225   GSIRTAIDTGCGVASWGAYLLSRDILPMSFAPKDTHEAQVQFALERGVPALIGIMASERL  284

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFD+AHCSRCLIPWGQYDG YLIEVDRVLRPGGYWILSGPP+ W+ +W+GW+RT 
Sbjct  285   PYPSRAFDIAHCSRCLIPWGQYDGLYLIEVDRVLRPGGYWILSGPPVNWQNHWKGWNRTR  344

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPD  718
             EDL++EQ  IE VA SLCWKK ++ +D+AIWQK  NH+ C   R+    PP C    DPD
Sbjct  345   EDLDSEQNGIESVARSLCWKKLVQRNDLAIWQKATNHLHCKLNRKVFRKPPFC-QGQDPD  403

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT ++ CLTPLP+VSD K     EL KWP+RL  VPPRI  G++ G++ E F K++ 
Sbjct  404   KAWYTKMEACLTPLPEVSDVKEVSGGELAKWPERLTVVPPRILAGSVKGVTEESFVKNTE  463

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             +W +R++HY ++ D QL E GRYRN+LDMNA LGGFAAALV+  +W+MNVVPVE+++NTL
Sbjct  464   IWKERVAHYKSI-DFQLAEPGRYRNLLDMNAGLGGFAAALVNDPVWIMNVVPVEAEVNTL  522

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTY +WCEAMSTYPRTYD IHADSIFTLYKDRCE+EDILLEMDRILRP+GS
Sbjct  523   GVIYERGLIGTYQSWCEAMSTYPRTYDFIHADSIFTLYKDRCEIEDILLEMDRILRPQGS  582

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVDVL+ VK I DGL WESR+ DHE GP  REKLL A K YWT
Sbjct  583   VIIRDDVDVLVNVKSIVDGLAWESRMTDHEGGPHVREKLLIATKQYWT  630



>ref|XP_009629797.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana tomentosiformis]
Length=636

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/531 (73%), Positives = 448/531 (84%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V  +P C+ + SEYTPCED++RSL +DR  LIYRERHCP+K+E+LKCRIPAPFGY+ PF+
Sbjct  97    VNHFPSCNPELSEYTPCEDSKRSLKFDRNMLIYRERHCPEKNELLKCRIPAPFGYKPPFR  156

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESRD  WY NVPHK LTVEKA QNW+RF+GDRF FPGGGTMF  GADAYIDDIGKLIN
Sbjct  157   WPESRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAYIDDIGKLIN  216

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRNIL +SFAP+DTH++QVQFALERGVPALIGILA+
Sbjct  217   LKDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPKDTHEAQVQFALERGVPALIGILAT  276

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYP++AFDMAHCSRCLIPWGQYDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+
Sbjct  277   KRLPYPARAFDMAHCSRCLIPWGQYDGLYLIEVDRILRPGGYWILSGPPINWENHWKGWN  336

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT +DL+AEQ QIE VA SLCWKK  +  ++AIWQKP NHM C   R+    PP C    
Sbjct  337   RTAKDLKAEQDQIESVARSLCWKKVTQKGELAIWQKPTNHMHCKINRKVFRKPPFC-QEQ  395

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT +  CL+PLP+VS+ ++     L  WP+RL AVPPRI  G I+G++ E F K
Sbjct  396   DPDKAWYTKIDACLSPLPEVSNIRDFAGGPLANWPERLTAVPPRIATGNIEGVTAEGFSK  455

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LW KR++HY A +D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMNV+PVE+++
Sbjct  456   DTELWKKRVAHYKA-LDFQLAECGRYRNILDMNAWLGGFAAALVDDPVWVMNVIPVEAEV  514

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY +WCEAMSTYPRTYD IHADS+F+LY+DRCEMEDILLEMDRILRP
Sbjct  515   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDFIHADSVFSLYQDRCEMEDILLEMDRILRP  574

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +GSVI RDDVDVL+ VK I DGLQW+SR+VDHE GP  REKLL A K YWT
Sbjct  575   QGSVIFRDDVDVLVNVKSIVDGLQWDSRMVDHEGGPHVREKLLIATKQYWT  625



>ref|XP_009343539.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/633 (64%), Positives = 483/633 (76%), Gaps = 33/633 (5%)
 Frame = -2

Query  1920  QYYSSPNNK--LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSG  1747
             QY+S    +  L Y+ L A+ CTL Y  G WQ+  G +  +        +++  +C    
Sbjct  8     QYFSLKPKRANLYYMTLAAVLCTLCYLVGIWQHSSGGAVITA------SVSSVASC----  57

Query  1746  NtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCE  1567
                           + +  LDF  HH   D          D +   PPC+ K SEYTPCE
Sbjct  58    ---------PPITINKTIHLDFKAHHTAEDLPLPPAAARVDHL---PPCNAKLSEYTPCE  105

Query  1566  DTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKEL  1387
             D  RSL +DR+RL+YRERHCP+K E+LKCRIPAP GY  P +WPESRD  WY NVPHKEL
Sbjct  106   DLTRSLKFDRKRLVYRERHCPEKEELLKCRIPAPHGYTVPLRWPESRDSVWYANVPHKEL  165

Query  1386  TVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVAS  1207
             TVEK  QNW+ ++GDRF+FPGGGTMF  GADAYIDDIGKLINL+DGS+RTA+DTGCGVAS
Sbjct  166   TVEKKKQNWVHYDGDRFRFPGGGTMFPRGADAYIDDIGKLINLRDGSVRTAIDTGCGVAS  225

Query  1206  FGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRC  1027
             +GAYLLSR+ILT+SFAPRDTH++QVQFALERGVPALIGILASKRLPYPS+AFDMAHCSRC
Sbjct  226   WGAYLLSRDILTVSFAPRDTHEAQVQFALERGVPALIGILASKRLPYPSRAFDMAHCSRC  285

Query  1026  LIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVAD  847
             LIPWGQYDG YLIEVDRVLRPGGYWILSGPPI W+++W+GW+RT EDL AEQT IE VA 
Sbjct  286   LIPWGQYDGLYLIEVDRVLRPGGYWILSGPPINWEKHWKGWERTAEDLRAEQTTIENVAK  345

Query  846   SLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLP  673
             SLCWKK  +  D+AIWQK  NH+ C   R+    P  C A  DPD AWYT ++ CLTPLP
Sbjct  346   SLCWKKLKQKGDLAIWQKTTNHVHCKMNRKVFKKPSFCQA-RDPDTAWYTKMEDCLTPLP  404

Query  672   QVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDG  508
              V++ K     EL KWPKRLN+VPPRI  G++ G++ + F +++ LWNKR+++Y   MD 
Sbjct  405   GVNNIKEIAGGELSKWPKRLNSVPPRISSGSLTGVTAQTFRENTELWNKRVAYYK-TMDY  463

Query  507   QLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTW  328
             QL E GRYRN+LDMNA+LGGFAAALV   +WVMN+VPVE+++NTLG IYERGLIGTY  W
Sbjct  464   QLAEPGRYRNLLDMNAYLGGFAAALVHDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNW  523

Query  327   CEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKR  148
             CEAMSTYPRTYD IH+DS+FTLYKDRCE+EDILLEMDRILRPEGS+I RDDVDVL+KVK 
Sbjct  524   CEAMSTYPRTYDFIHSDSVFTLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKS  583

Query  147   ITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I D +Q+++R+VDHEDGP++REK++ AVK YWT
Sbjct  584   IMDAMQYDARIVDHEDGPIEREKIMLAVKQYWT  616



>ref|XP_008232735.1| PREDICTED: probable methyltransferase PMT15 [Prunus mume]
Length=632

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/622 (64%), Positives = 478/622 (77%), Gaps = 30/622 (5%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttq  1714
             L Y+ L+A+ CTL Y  G WQ+                  +  T   + + +T+ SS   
Sbjct  19    LYYMTLVAVLCTLCYLVGIWQH------------------STGTTAITADISTSDSSCPP  60

Query  1713  slsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRE  1534
                + +  LDF  HH   D            V   PPCD K SEYTPC+D  RSL +DRE
Sbjct  61    ITRNTTIHLDFEAHHRAEDLPLPPA---AARVSHLPPCDAKLSEYTPCQDVTRSLKFDRE  117

Query  1533  RLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIR  1354
             RL+YRERHCP+K E+LKCRIPAP GY+ PF+WPESRD  WY NVPHKELTVEK  QNW++
Sbjct  118   RLVYRERHCPEKGELLKCRIPAPHGYKVPFQWPESRDSVWYANVPHKELTVEKKKQNWVQ  177

Query  1353  FEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNIL  1174
             +EGDRF+FPGGGTMF  GADAYID+IGKLINL+DGS+RTA+DTGCGVAS+GAYLLSR+IL
Sbjct  178   YEGDRFRFPGGGTMFPRGADAYIDEIGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDIL  237

Query  1173  TMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAY  994
              MSFAPRDTH++QVQFALERGVPALIGILAS+RLPYPS+AFDMAHCSRCLIPWGQYDG Y
Sbjct  238   PMSFAPRDTHEAQVQFALERGVPALIGILASQRLPYPSRAFDMAHCSRCLIPWGQYDGLY  297

Query  993   LIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVD  814
             LIEVDRVLRPGGYWILSGPPI W+++W+GWDRT EDL+AEQT IE VA SLCWKK  + D
Sbjct  298   LIEVDRVLRPGGYWILSGPPINWEKHWKGWDRTAEDLKAEQTMIENVAKSLCWKKLKQKD  357

Query  813   DIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----  655
             D+A+WQKP NH+ C   R+    P  C A  DPD AWYT ++ CLTPLP V++ K     
Sbjct  358   DLAVWQKPTNHVHCKVNRKVFKKPSFCQA-EDPDKAWYTTMEDCLTPLPGVNNIKEIAGG  416

Query  654   ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNV  475
             EL KWP+RL +VPPRI  G++ GI+ E F  ++ LW KR+++Y   +D QL E GRYRN+
Sbjct  417   ELAKWPERLTSVPPRISSGSVTGITAEMFRDNTELWKKRVAYYK-TLDYQLAEPGRYRNL  475

Query  474   LDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTY  295
             LDMNA+LGGFAAALV   +WVMN+VPVE+++NTLGVIYERGLIGTY  WCEAMSTYPRTY
Sbjct  476   LDMNAYLGGFAAALVQDPVWVMNIVPVEAEVNTLGVIYERGLIGTYQNWCEAMSTYPRTY  535

Query  294   DLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRV  115
             D IH+DS+F+LYKDRCE+EDILLEMDRILRPEGS+I RDDVDVL+KVK I D +Q+++ +
Sbjct  536   DFIHSDSVFSLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIMDAMQYDATI  595

Query  114   VDHEDGPLQREKLLFAVKTYWT  49
             VDHE+GP  REK+L A K YWT
Sbjct  596   VDHENGPRHREKILLAAKQYWT  617



>gb|KCW46397.1| hypothetical protein EUGRSUZ_K00230 [Eucalyptus grandis]
Length=603

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/532 (71%), Positives = 455/532 (86%), Gaps = 12/532 (2%)
 Frame = -2

Query  1629  EDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRN  1450
             +D  + Y  C   +SEYTPCED +RSL +DR RLIYRERHCP K+E +KCR+PAP+GYR 
Sbjct  65    DDRPRTYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPDKTEKVKCRVPAPYGYRI  124

Query  1449  PFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGK  1270
             PF+WP SRD+AWY NVPHKELTVEKAVQNWI+++GDRF+FPGGGTMF +GA AYIDDIG+
Sbjct  125   PFRWPASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGGGTMFPHGASAYIDDIGE  184

Query  1269  LINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGI  1090
             LINLKDGSIRTA+DTGCGVAS+GAYLLSRN+LTMSFAPRDTH++QVQFALERGVPALIG+
Sbjct  185   LINLKDGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVPALIGV  244

Query  1089  LASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQ  910
             LASKRLPYPS+AFDMAHCSRCLIPW +  G YL+EVDRVLRPGGYWILSGPPIRW++YW+
Sbjct  245   LASKRLPYPSRAFDMAHCSRCLIPWAESGGTYLMEVDRVLRPGGYWILSGPPIRWRKYWR  304

Query  909   GWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPAS  730
             GW+RT++DL +EQ  IE+VA SLCW K +E  DI++WQKP NH+ C   R      CP +
Sbjct  305   GWNRTQDDLRSEQNSIERVARSLCWTKLIEKGDISVWQKPTNHLQCKVNR-----FCP-T  358

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
              DPD AWYT++ TCLT LP+VS ++E     + KWP RLNAVPPRI  GT+ GI+ E F+
Sbjct  359   QDPDTAWYTNMDTCLTQLPEVSGDEEVAGGQVAKWPARLNAVPPRISGGTVPGITAETFQ  418

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
              D+ LW +R+S+Y  V + QL +AGRYRN+LDMNA LGGFAAALV+  +WVMNVVPVE+ 
Sbjct  419   TDAELWKRRVSYYKTV-NNQLGQAGRYRNLLDMNAHLGGFAAALVEDPVWVMNVVPVEAP  477

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             +NTLGV+YERGLIGTY +WCEAMSTYPRTYD IHADS+FTLYKDRC+ +DILLEMDRILR
Sbjct  478   VNTLGVVYERGLIGTYQSWCEAMSTYPRTYDFIHADSLFTLYKDRCDADDILLEMDRILR  537

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEGSVI+RDDVDVL+K+KR+ DG+ ++S++VDHEDGPL R+KLLFAVK+YWT
Sbjct  538   PEGSVILRDDVDVLVKLKRMLDGMNYDSQIVDHEDGPLVRQKLLFAVKSYWT  589



>ref|XP_010035103.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
Length=643

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/647 (63%), Positives = 500/647 (77%), Gaps = 28/647 (4%)
 Frame = -2

Query  1968  PY--YTPTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsiss  1795
             PY  Y PT KPA       Y +  N+ L     +   C +SY  G WQ+GG  +  S S+
Sbjct  4     PYAPYHPTAKPASA--TPSYLTIKNSSLSKGVFVLFLCFMSYLLGIWQHGGRIAPASFST  61

Query  1794  iftAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK  1615
                A ++   +     ++++  +  +         LDF +HH   D         +D  +
Sbjct  62    TTVAAVSCPSSPAKGSSSSSASAGVS---------LDFESHHRQDDTADA---ELDDRPR  109

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
              Y  C   +SEYTPCED +RSL +DR RLIYRERHCP K+E +KCR+PAP+GYR PF+WP
Sbjct  110   TYAACAGNFSEYTPCEDVQRSLRFDRTRLIYRERHCPDKTEKVKCRVPAPYGYRIPFRWP  169

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRD+AWY NVPHKELTVEKAVQNWI+++GDRF+FPGGGTMF +GA AYIDDIG+LINLK
Sbjct  170   ASRDLAWYANVPHKELTVEKAVQNWIQYQGDRFRFPGGGTMFPHGASAYIDDIGELINLK  229

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVAS+GAYLLSRN+LTMSFAPRDTH++QVQFALERGVPALIG+LASKR
Sbjct  230   DGSIRTAIDTGCGVASWGAYLLSRNVLTMSFAPRDTHEAQVQFALERGVPALIGVLASKR  289

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS+AFDMAHCSRCLIPW +  G YL+EVDRVLRPGGYWILSGPPIRW++YW+GW+RT
Sbjct  290   LPYPSRAFDMAHCSRCLIPWAESGGTYLMEVDRVLRPGGYWILSGPPIRWRKYWRGWNRT  349

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDM  715
             ++DL +EQ  IE+VA SLCW K +E  DI++WQKP NH+ C   R      CP + DPD 
Sbjct  350   QDDLRSEQNSIERVARSLCWTKLIEKGDISVWQKPTNHLQCKVNR-----FCP-TQDPDT  403

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT++ TCLT LP+VS ++E     + KWP RLNAVPPRI  GT+ GI+ E F+ D+ L
Sbjct  404   AWYTNMDTCLTQLPEVSGDEEVAGGQVAKWPARLNAVPPRISGGTVPGITAETFQTDAEL  463

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W +R+S+Y  V + QL +AGRYRN+LDMNA LGGFAAALV+  +WVMNVVPVE+ +NTLG
Sbjct  464   WKRRVSYYKTV-NNQLGQAGRYRNLLDMNAHLGGFAAALVEDPVWVMNVVPVEAPVNTLG  522

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             V+YERGLIGTY +WCEAMSTYPRTYD IHADS+FTLYKDRC+ +DILLEMDRILRPEGSV
Sbjct  523   VVYERGLIGTYQSWCEAMSTYPRTYDFIHADSLFTLYKDRCDADDILLEMDRILRPEGSV  582

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I+RDDVDVL+K+KR+ DG+ ++S++VDHEDGPL R+KLLFAVK+YWT
Sbjct  583   ILRDDVDVLVKLKRMLDGMNYDSQIVDHEDGPLVRQKLLFAVKSYWT  629



>ref|XP_008799521.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=639

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/623 (65%), Positives = 483/623 (78%), Gaps = 26/623 (4%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L+ +A++A+ C+ SY  G WQ+GGG + +  SS     I    +C  S N+ ++ + TT
Sbjct  23    NLISIAVIALLCSASYLLGMWQHGGGGATSLASSST---IVATVSCNHSNNSPSSTAVTT  79

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                      LDF THH       V       + + +P CD KYSEYTPCED +RSL + R
Sbjct  80    ---------LDFDTHHAAD----VSAVDALPARRGFPACDAKYSEYTPCEDVKRSLKFPR  126

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             +RLI+RERHCP K E L+C IPAP GYRNPF WP SR+VAW+ NVPHKELTVEKAVQNWI
Sbjct  127   DRLIFRERHCPGKGEELRCLIPAPAGYRNPFPWPASREVAWFANVPHKELTVEKAVQNWI  186

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R +GD+F+FPGGGTMF NGADAYIDDIG+LINL DGSIRTA+DTGCGVAS+G+YLLSR+I
Sbjct  187   RVDGDKFRFPGGGTMFPNGADAYIDDIGRLINLHDGSIRTAIDTGCGVASWGSYLLSRDI  246

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             LTMS APRD+H++QVQFALERGVPA+IGILASKRLPYPS+AFDMAHCSRCLIPW Q DG 
Sbjct  247   LTMSIAPRDSHEAQVQFALERGVPAMIGILASKRLPYPSRAFDMAHCSRCLIPWHQNDGL  306

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YLIE+DR+LRPGGYWILSGPPI WKR+W+GW RT EDL AEQ+ IE VA SLCWKK  EV
Sbjct  307   YLIEIDRILRPGGYWILSGPPINWKRHWKGWQRTREDLSAEQSAIEAVAKSLCWKKLKEV  366

Query  816   DDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK----  655
              DIAIWQKP NH+ C   R+    P  C A N PD AWYT+++ C+TPLP+    +    
Sbjct  367   GDIAIWQKPTNHIHCKASRKIIRSPQFCAARN-PDAAWYTEMEACITPLPEADSIRDVAG  425

Query  654   -ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
              EL+KWP RL AVP RI  G++DG++ E F +DS LW KR+ HY  +++  L + GRYRN
Sbjct  426   GELKKWPGRLMAVPQRIASGSLDGVTSEMFLQDSELWKKRVEHYKKLVN--LGQKGRYRN  483

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             +LDMNA  GGFAAAL D S+WVMNVVP  +  NTLGVIYERGLIGTY  WCEAMSTYPRT
Sbjct  484   LLDMNARFGGFAAALADESVWVMNVVPTAANANTLGVIYERGLIGTYQDWCEAMSTYPRT  543

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDLIHADS+FTLYKDRCEMEDILLEMDRILRPE +VI RDDVDVL+K+K ITDG++W+S+
Sbjct  544   YDLIHADSVFTLYKDRCEMEDILLEMDRILRPESTVIFRDDVDVLVKIKSITDGMRWKSQ  603

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             + DHEDGPL+REK+L AVK YWT
Sbjct  604   IADHEDGPLRREKILLAVKDYWT  626



>ref|XP_009804054.1| PREDICTED: probable methyltransferase PMT15 [Nicotiana sylvestris]
Length=636

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/531 (73%), Positives = 447/531 (84%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V  +P C+ + SEYTPCED++RSL +DR  LIYRERHCP+K+E+LKCRIPAPFGY+ PF+
Sbjct  97    VNHFPSCNPELSEYTPCEDSKRSLKFDRNMLIYRERHCPEKNELLKCRIPAPFGYKQPFR  156

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESRD  WY NVPHK LTVEKA QNW+RF+ DRF FPGGGTMF  GADAYIDDIGKLIN
Sbjct  157   WPESRDSVWYANVPHKHLTVEKAGQNWVRFKDDRFTFPGGGTMFPRGADAYIDDIGKLIN  216

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRNIL +SFAP+DTH++QVQFALERGVPALIGILA+
Sbjct  217   LKDGSIRTAIDTGCGVASWGAYLLSRNILPISFAPKDTHEAQVQFALERGVPALIGILAT  276

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYP++AFDMAHCSRCLIPWG+YDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+
Sbjct  277   KRLPYPARAFDMAHCSRCLIPWGRYDGLYLIEVDRILRPGGYWILSGPPINWENHWKGWN  336

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT EDL+AEQ QIE VA SLCWKK  +  ++AIWQKP NHM C   R+    PP C    
Sbjct  337   RTAEDLKAEQDQIESVARSLCWKKVTQKGELAIWQKPTNHMHCKINRKVFRKPPFC-QEQ  395

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT +  CL PLP+VS+ ++     L  WP+RL AVPPRI  G+I+G++ E F K
Sbjct  396   DPDKAWYTKIDACLNPLPEVSNVRDIAGGPLANWPERLTAVPPRIASGSIEGVTAEGFSK  455

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LW KR++HY A +D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMNVVPVE+++
Sbjct  456   DTELWKKRVAHYKA-LDFQLAERGRYRNILDMNAWLGGFAAALVDDPVWVMNVVPVEAEV  514

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY +WCEAMSTYPRTYD IHADS+F+LY+DRCEMEDILLEMDRILRP
Sbjct  515   NTLGVIYERGLIGTYQSWCEAMSTYPRTYDFIHADSVFSLYQDRCEMEDILLEMDRILRP  574

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +GSVI RDDVDVL+ VK I DGLQW+SR+VDHE GP  REKLL A K YWT
Sbjct  575   QGSVIFRDDVDVLVNVKSIIDGLQWDSRMVDHEGGPHVREKLLIATKQYWT  625



>ref|XP_010919241.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=637

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/621 (65%), Positives = 480/621 (77%), Gaps = 46/621 (7%)
 Frame = -2

Query  1863  CTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqslsshsAGLD  1684
             C+ SY  G WQ+GGG  G + S   ++ I    +C  S N+ TT              LD
Sbjct  34    CSASYLLGIWQHGGGGGGGAPSLASSSTILATVSCNHSNNSPTT--------------LD  79

Query  1683  FtthhgdgdgGAVLGNH---DEDSV------KVYPPCDVKYSEYTPCEDTERSLAYDRER  1531
             F             G H   D+ +V      + +P CD KYSEYTPCED +RS  + ++R
Sbjct  80    F-------------GTHHAADDSAVDALPAARGFPACDAKYSEYTPCEDVKRSFKFPQDR  126

Query  1530  LIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRF  1351
             LI+RERHCP+K E L+C IPAP GYRNPF WP SR+VAW+ NVPHKELTVEKAVQNWIR 
Sbjct  127   LIFRERHCPQKGEELRCMIPAPAGYRNPFPWPASREVAWFANVPHKELTVEKAVQNWIRV  186

Query  1350  EGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILT  1171
             +GD+F+FPGGGTMF NGADAYIDDIG+LINL+DGSIRTA+DTGCGVAS+G YLLSR+ILT
Sbjct  187   DGDKFRFPGGGTMFPNGADAYIDDIGRLINLRDGSIRTAIDTGCGVASWGGYLLSRDILT  246

Query  1170  MSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYL  991
             MS APRD+H++QVQFALERGVPA+IGILASKRLPYPS+AFDMAHCSRCLIPW QYDG +L
Sbjct  247   MSIAPRDSHEAQVQFALERGVPAMIGILASKRLPYPSRAFDMAHCSRCLIPWHQYDGLFL  306

Query  990   IEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDD  811
             IE+DR+LRPGGYWILSGPPI WK +W+GW RT EDL AEQ+ IE VA SLCWKK  EV D
Sbjct  307   IEIDRILRPGGYWILSGPPINWKSHWKGWQRTREDLSAEQSAIEAVAKSLCWKKLKEVRD  366

Query  810   IAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----E  652
             IAIWQKP NH+ C   R+    P  C A N PD AWY++++TC+TPLP+V   +     E
Sbjct  367   IAIWQKPTNHIHCKASRKVIQSPQFCTARN-PDAAWYSNMETCITPLPEVDSIRDVAGGE  425

Query  651   LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVL  472
             L+KWP+RL AVPPRI RG++DG++GE F +DS LW KR+ HY  +++  L + GRYRN+L
Sbjct  426   LKKWPERLMAVPPRIARGSLDGVTGEVFLQDSELWKKRVGHYKKLVN--LGQKGRYRNLL  483

Query  471   DMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYD  292
             DMNA  GGFAAAL D  +WVMN+VP  + +NTLGVIYERGLIGTY  WCEAMSTYPRTYD
Sbjct  484   DMNARFGGFAAALADIPVWVMNIVPTAANVNTLGVIYERGLIGTYQDWCEAMSTYPRTYD  543

Query  291   LIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVV  112
             LIHADS+FTLYKDRCEMEDILLEMDRILRPE +VI RDDVDVL+K+K ITDG++W+S++ 
Sbjct  544   LIHADSLFTLYKDRCEMEDILLEMDRILRPESTVIFRDDVDVLVKIKSITDGMRWKSQIA  603

Query  111   DHEDGPLQREKLLFAVKTYWT  49
             DHEDGPLQREK+L AVK YWT
Sbjct  604   DHEDGPLQREKILLAVKDYWT  624



>ref|XP_010053660.1| PREDICTED: probable methyltransferase PMT15 [Eucalyptus grandis]
 gb|KCW78011.1| hypothetical protein EUGRSUZ_D02245 [Eucalyptus grandis]
Length=650

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/528 (73%), Positives = 450/528 (85%), Gaps = 10/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPCD K+SEYTPCED +RSL +DRERL+YRERHCP+K E LKCRIPAP GYR PF WPE
Sbjct  114   FPPCDPKFSEYTPCEDVQRSLRFDRERLVYRERHCPEKRERLKCRIPAPHGYRLPFPWPE  173

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AW+ NVPHKELTVEK  QNW+RFEGDRF FPGGGTMF NGADAYIDDIGK+I+L+ 
Sbjct  174   SRDKAWFANVPHKELTVEKKKQNWVRFEGDRFIFPGGGTMFSNGADAYIDDIGKMIDLRG  233

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSR+ILT+SFAPRDTH++QVQFALERGVPALIG+LASKRL
Sbjct  234   GSIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVPALIGVLASKRL  293

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPI W+++W+GWDR E
Sbjct  294   PYPSRAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPINWEKHWKGWDRKE  353

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPD  718
             EDL+AEQ  IE +A SLCWKK  +  DIAIWQKP NH+ C + R+    PP CPA  DPD
Sbjct  354   EDLKAEQDAIESIARSLCWKKLKQKGDIAIWQKPTNHVHCKKNRKVFKFPPFCPA-QDPD  412

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT + TCLT LP+VSD K     EL KWP+RL AVPPRI  G++ G++ E F++++ 
Sbjct  413   KAWYTQMDTCLTALPEVSDIKDIAGGELAKWPQRLTAVPPRIASGSV-GVTAETFKENTD  471

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW  R+S+Y + +D QL + GRYRN+LDMNA LGGFAAALVD  +WVMNVVPVE+  NTL
Sbjct  472   LWRSRVSYYKS-LDHQLAQKGRYRNLLDMNANLGGFAAALVDDPVWVMNVVPVEATTNTL  530

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTY +WCEA+STYPRTYD IHADS+FTLY +RC+M+DILLEMDRILRPEG 
Sbjct  531   GVIYERGLIGTYQSWCEAVSTYPRTYDFIHADSVFTLYSERCDMDDILLEMDRILRPEGG  590

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +I RDDVD+L K+KR+TD +Q+ESR++DHE GP +REK+L A K YWT
Sbjct  591   IIFRDDVDILEKIKRMTDAMQYESRIIDHEKGPHEREKILLAYKQYWT  638



>ref|XP_004155808.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=635

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/628 (64%), Positives = 475/628 (76%), Gaps = 35/628 (6%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L  + L+AI C + Y  G WQ                  +  K+ +F+G      +ST 
Sbjct  14    NLYTITLVAILCAVFYLVGVWQQ-----------------SIGKSLIFAGGNYACTASTV  56

Query  1716  qslsshsAG-----LDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERS  1552
              +   +S       LDF  HH   D   V      +    +PPCD K  EYTPCED ERS
Sbjct  57    AATIENSTATTVIDLDFAAHHTAADLPVVQKARRPN----FPPCDSKLYEYTPCEDRERS  112

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L +DR+RLIYRERHCP+  E+LKCR+PAP GY+ PF+WPESRD AW++NVPHKELTVEK 
Sbjct  113   LKFDRDRLIYRERHCPEAGEILKCRVPAPAGYKVPFRWPESRDFAWFSNVPHKELTVEKK  172

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
              QNW+RFE DRF+FPGGGTMF  GADAYIDDIGKLINL DGSIRTA+DTGCGVAS+GAYL
Sbjct  173   NQNWVRFENDRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGCGVASWGAYL  232

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             LSRNI+TMSFAPRDTH++QVQFALERGVPALIG+LAS RLPYPS+AFDMAHCSRCLIPW 
Sbjct  233   LSRNIVTMSFAPRDTHEAQVQFALERGVPALIGVLASIRLPYPSRAFDMAHCSRCLIPWA  292

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             Q DG YLIEVDR+LRPGGYW+LSGPPI W+ +W+GW+RT  DL+AEQ++IE VA SLCWK
Sbjct  293   QSDGMYLIEVDRILRPGGYWVLSGPPINWENHWKGWNRTTGDLQAEQSKIEAVAKSLCWK  352

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K  + DDIAIWQKP NH+ C + R+    P  C    DPD+AWYT ++ CLTPLP+VSD 
Sbjct  353   KLKQKDDIAIWQKPTNHIHCKKNRKVFKFPNFC-QEQDPDIAWYTKMEPCLTPLPEVSDV  411

Query  657   KE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEA  493
             KE     L  WP+RL +VPPRI  G++  I+ + F +++ LW KR++HY A +DGQL E 
Sbjct  412   KETAGGQLLNWPERLTSVPPRISSGSLKQITPQNFTENTELWRKRVAHYKA-LDGQLAEP  470

Query  492   GRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMS  313
             GRYRN+LDMN+FLGGFAAA+VD  LWVMN+VPVE+  NTLGVIYERGLIGTY  WCEAMS
Sbjct  471   GRYRNLLDMNSFLGGFAAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNWCEAMS  530

Query  312   TYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGL  133
             TYPRTYD IH DS+F++YK RCEMEDILLEMDRILRP+GSVI+RDDVDVL++VK I + +
Sbjct  531   TYPRTYDFIHGDSVFSMYKGRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKSIAEAM  590

Query  132   QWESRVVDHEDGPLQREKLLFAVKTYWT  49
             QWE R+ DHE GP QREK+L A K YWT
Sbjct  591   QWECRIADHEKGPHQREKILVATKQYWT  618



>ref|XP_010559094.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=620

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/619 (64%), Positives = 476/619 (77%), Gaps = 27/619 (4%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             +K+ Y+ ++   C  SY FG WQ+       +          +A  C+            
Sbjct  15    SKIYYITIVTFLCLASYLFGIWQHSRAVIPRATVDD-----TSAVGCV------------  57

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
               + +     LDF  HH   D               +P CDVK SEYTPCED +RSL + 
Sbjct  58    GLNKTLMPRDLDFAAHHTAEDPPPTAARE-----VTFPACDVKLSEYTPCEDQKRSLKFP  112

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             RERL YRERHCP++ EVL+CRIPAP+GY+ PF+WPESRDV+W+ NVPH ELTVEK  QNW
Sbjct  113   RERLEYRERHCPERDEVLRCRIPAPYGYKMPFRWPESRDVSWFANVPHTELTVEKKDQNW  172

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             +R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYLLSRN
Sbjct  173   VRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLTDGSIRTAIDTGCGVASFGAYLLSRN  232

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             I+TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ+DG
Sbjct  233   IITMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQHDG  292

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
              YL+EVDRVLRPGGYWILSGPPI W+  W+GW+RT EDLE+EQTQIE+VA +LCWKK ++
Sbjct  293   TYLMEVDRVLRPGGYWILSGPPINWQNRWKGWERTMEDLESEQTQIERVARNLCWKKLVQ  352

Query  819   VDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKELE  646
              DD+AIWQKP+NH+ C + RQ    P  C  + DPDMAWYT L+ CLTPLP+V + K LE
Sbjct  353   KDDLAIWQKPFNHIHCKKTRQKLNKPKFC-MNPDPDMAWYTKLEICLTPLPEVRETK-LE  410

Query  645   KWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDM  466
             KWP RLNAVPPRI  G ++GI+ + F +++ LW  R+S+Y   +D QL E GRYRN+LDM
Sbjct  411   KWPARLNAVPPRISSGQVEGITKDIFLENTQLWKTRVSYYK-TLDNQLAERGRYRNLLDM  469

Query  465   NAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLI  286
             NA+LGGFAAALVD  +WVMN+VPVES +NTLGV+YERGLIGTY  WCEAMSTYPRTYD I
Sbjct  470   NAYLGGFAAALVDDPVWVMNIVPVESSVNTLGVVYERGLIGTYQNWCEAMSTYPRTYDFI  529

Query  285   HADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDH  106
             HADS+F+LY+++CE EDIL+EMDRILRP G +IIRDDVD+LI+V RIT GLQW+ R+ DH
Sbjct  530   HADSVFSLYREKCEPEDILVEMDRILRPGGGIIIRDDVDILIQVSRITKGLQWQGRIADH  589

Query  105   EDGPLQREKLLFAVKTYWT  49
             E GP QREK+L+AVK YWT
Sbjct  590   EKGPHQREKILYAVKQYWT  608



>ref|XP_008438092.1| PREDICTED: probable methyltransferase PMT15 [Cucumis melo]
Length=635

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/634 (63%), Positives = 477/634 (75%), Gaps = 35/634 (6%)
 Frame = -2

Query  1914  YSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNt--  1741
             + S    L  + L+ I C + Y  G WQ                  +  K+ +F+G    
Sbjct  8     FKSGRLNLYKITLVTILCAVFYLVGVWQQ-----------------SVGKSLIFAGGNYA  50

Query  1740  ---attlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPC  1570
                +T  ++   S ++    LDF  HH   D   V      +    +PPCD K  EYTPC
Sbjct  51    CTTSTAAATFENSTATSVIDLDFAAHHTAADLPVVQKARRPN----FPPCDSKLYEYTPC  106

Query  1569  EDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKE  1390
             ED +RSL +DR+RLIYRERHCP+  E+LKCR+PAP GY+ PF+WPESRD AW++NVPHKE
Sbjct  107   EDRDRSLKFDRDRLIYRERHCPEAGEILKCRVPAPPGYKVPFRWPESRDFAWFSNVPHKE  166

Query  1389  LTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVA  1210
             LTVEK  QNW+RFE DRF+FPGGGTMF  GADAYIDDIGKLINL DGSIRTA+DTGCGVA
Sbjct  167   LTVEKKNQNWVRFENDRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGCGVA  226

Query  1209  SFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSR  1030
             S+GAYLLSRNI+TMSFAPRDTH++QVQFALERGVPALIG+LAS RLPYPS+AFDMAHCSR
Sbjct  227   SWGAYLLSRNIVTMSFAPRDTHEAQVQFALERGVPALIGVLASIRLPYPSRAFDMAHCSR  286

Query  1029  CLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVA  850
             CLIPW Q DG YLIEVDR+LRPGGYW+LSGPPI W+ +W+GW+RT  DL+AEQ++IE VA
Sbjct  287   CLIPWAQSDGMYLIEVDRILRPGGYWVLSGPPINWENHWKGWNRTTGDLQAEQSKIEAVA  346

Query  849   DSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPL  676
              SLCWKK  + DDIAIWQKP NH+ C + R+    P  C    DPD AWYT ++ CLTPL
Sbjct  347   KSLCWKKLKQKDDIAIWQKPTNHIHCKKNRKVFKFPNFC-QEQDPDSAWYTKMEPCLTPL  405

Query  675   PQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMD  511
             P+VSD KE     L  WP+RL +VPPRI  G++  I+ + F +++ LW KR++HY A +D
Sbjct  406   PEVSDVKETAGGQLLNWPERLTSVPPRINSGSLKQITPQNFTENTELWRKRVAHYKA-LD  464

Query  510   GQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHT  331
             GQL E GRYRN+LDMN+FLGGFAAALVD  LWVMN+VPVE+  NTLGVIYERGLIGTY  
Sbjct  465   GQLAEPGRYRNLLDMNSFLGGFAAALVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQN  524

Query  330   WCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVK  151
             WCEAMSTYPRTYD IH DS+F++YKDRCEMEDILLEMDRILRP+GSVI+RDDVDVL++VK
Sbjct  525   WCEAMSTYPRTYDFIHGDSVFSMYKDRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVK  584

Query  150   RITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              I + +QWE R+ DHE GP QREK+L A K YWT
Sbjct  585   SIAEAMQWECRIADHEKGPHQREKILVATKQYWT  618



>ref|XP_007220534.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
 gb|EMJ21733.1| hypothetical protein PRUPE_ppa002801mg [Prunus persica]
Length=632

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/623 (64%), Positives = 474/623 (76%), Gaps = 30/623 (5%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L Y+ L+A+ CTL Y  G WQ+                  +  T   + + +T+ SS  
Sbjct  18    NLYYMTLVAVLCTLCYLVGIWQH------------------STGTTAITASISTSDSSCP  59

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                 + +  LDF  HH   D            V   PPCD K SEYTPC+D  RSL +DR
Sbjct  60    PIPRNTTIHLDFEAHHRAEDLPLPPA---AARVAHLPPCDAKLSEYTPCQDVTRSLKFDR  116

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             ERL+YRERHCP+K E+LKCRIPAP GY  PF+WPESRD  WY NVPHKELTVEK  QNW+
Sbjct  117   ERLVYRERHCPEKEELLKCRIPAPHGYTVPFRWPESRDSVWYANVPHKELTVEKKKQNWV  176

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
              +EGDRF+FPGGGTMF  GADAYID+IGKLINL+DGS+RTA+DTGCGVAS+GAYLLSR+I
Sbjct  177   HYEGDRFRFPGGGTMFPRGADAYIDEIGKLINLRDGSVRTAIDTGCGVASWGAYLLSRDI  236

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             L MSFAPRDTH+ QVQFALERGVPALIGILAS+RLPYPS+AFDMAHCSRCLIPWGQYDG 
Sbjct  237   LPMSFAPRDTHEGQVQFALERGVPALIGILASQRLPYPSRAFDMAHCSRCLIPWGQYDGL  296

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YLIEVDRVLRPGGYWILSGPPI W+++W+GWDRT EDL+AEQT IE VA SLCWKK  + 
Sbjct  297   YLIEVDRVLRPGGYWILSGPPINWEKHWKGWDRTAEDLKAEQTMIENVAKSLCWKKLKQK  356

Query  816   DDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK----  655
             DD+A+WQKP NH+ C   R+    P  C A  DPD AWYT ++ CLTPLP V++ K    
Sbjct  357   DDLAVWQKPTNHVHCKVNRKVFKKPSFCQA-QDPDKAWYTTMEDCLTPLPGVNNIKEIAG  415

Query  654   -ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
              EL KWP+RL +VPPRI  G++ GI+ E F  ++ LW  R+++Y   +D QL E GRYRN
Sbjct  416   GELAKWPERLTSVPPRISSGSVTGITAEMFRDNTELWKNRVAYYK-TLDYQLAEPGRYRN  474

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             +LDMNA+LGGFAAALV   +WVMN+VPVE+++NTLGVIYERGLIGTY  WCEAMSTYPRT
Sbjct  475   LLDMNAYLGGFAAALVQDPVWVMNIVPVEAEVNTLGVIYERGLIGTYQNWCEAMSTYPRT  534

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YD IH+DS+F+LYKDRCE+EDILLEMDRILRPEGS+I RDDVDVL+KVK I D +Q+++R
Sbjct  535   YDFIHSDSVFSLYKDRCEVEDILLEMDRILRPEGSIIFRDDVDVLVKVKSIMDAMQYDAR  594

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             +VDHE+GP  REK+L A K YW 
Sbjct  595   IVDHENGPRHREKILLAAKQYWA  617



>emb|CDP08881.1| unnamed protein product [Coffea canephora]
Length=640

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/638 (64%), Positives = 482/638 (76%), Gaps = 29/638 (5%)
 Frame = -2

Query  1926  NHQYYSSPNNK---LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK--T  1762
             N  YY +   K   L Y+A+  + C+LSY  G WQ+GG             KIA      
Sbjct  6     NLPYYLTLKTKKTSLFYMAVTTVLCSLSYLIGIWQHGGL------------KIAAKSPMA  53

Query  1761  CLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSE  1582
              L     +    + T    S S  LDFT  H   D   +        V+  PPC  ++SE
Sbjct  54    TLLELPCSNLNKNFTTIGGSSSVTLDFTARHNADDLVPL---SSSARVEQIPPCKPEFSE  110

Query  1581  YTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNV  1402
             YTPCED  RSL +DR+R IYRERHCP+K E+LKCRIPAP GY+  F+WP SRD+ WY NV
Sbjct  111   YTPCEDVNRSLKFDRDRNIYRERHCPEKDELLKCRIPAPHGYKTSFRWPASRDMVWYANV  170

Query  1401  PHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTG  1222
             PHK LTVEKA QNW++F+GDRFKFPGGGTMF  GAD+YI DIGK INLKDGSIRTA+DTG
Sbjct  171   PHKHLTVEKAKQNWVQFKGDRFKFPGGGTMFPRGADSYIADIGKFINLKDGSIRTAIDTG  230

Query  1221  CGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMA  1042
             CGVAS+GAYLLSRNIL++SFAPRDTH +QVQFALERGVPALIG+LAS RLPYPS+AFD+A
Sbjct  231   CGVASWGAYLLSRNILSVSFAPRDTHVAQVQFALERGVPALIGVLASIRLPYPSRAFDIA  290

Query  1041  HCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQI  862
             HCSRCLIPWG++DG YLIEVDR+LRPGGYW+LSGPPI W+ +W+GW+RT +DL+ EQ  I
Sbjct  291   HCSRCLIPWGKFDGLYLIEVDRILRPGGYWVLSGPPINWESHWKGWNRTAQDLKKEQDGI  350

Query  861   EKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTC  688
             E VA SLCWKK ++ +D+AIWQKP NH+ C   R+A   PP C A  DPD AWYT ++ C
Sbjct  351   ENVARSLCWKKLVQKNDLAIWQKPSNHIHCKIYRKAFKKPPFCQA-QDPDKAWYTKMEAC  409

Query  687   LTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYS  523
             LTPLP+VS+ KE     L KWP+RL AVPPRI  G++DGI+   ++KD+ LW KR+ HY 
Sbjct  410   LTPLPEVSETKEMAGGLLAKWPERLTAVPPRIVSGSLDGITAATYDKDTYLWKKRVEHYK  469

Query  522   AVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIG  343
              V+D QL E GRYRN+LDMNA LGGFAAALV+  LWVMNVVP E+KLNTLG IYERGLIG
Sbjct  470   -VLDSQLAEPGRYRNLLDMNAHLGGFAAALVNDPLWVMNVVPAEAKLNTLGAIYERGLIG  528

Query  342   TYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVL  163
             TY  WCEAMSTYPRTYD IHADS+F+LY+DRC+MEDILLEMDRILRP+GSVIIRDDVD+L
Sbjct  529   TYQNWCEAMSTYPRTYDFIHADSLFSLYQDRCDMEDILLEMDRILRPQGSVIIRDDVDIL  588

Query  162   IKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             + VK + D LQW+SR+VDHE GP  REKLL AVK YWT
Sbjct  589   VDVKSVIDRLQWDSRMVDHEGGPHVREKLLIAVKQYWT  626



>ref|XP_006287263.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
 gb|EOA20161.1| hypothetical protein CARUB_v10000453mg [Capsella rubella]
Length=634

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/625 (64%), Positives = 482/625 (77%), Gaps = 31/625 (5%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L  + L+AI CT SY FG WQ+ G     S  S    K   + +C F    A       
Sbjct  21    NLYRVILVAILCTASYLFGVWQHSGRGISHSSLSNHELK---SVSCTFPRQAAPV-----  72

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                      L+F   H   D          + +   PPC V++SEYTPCE   RSL++ R
Sbjct  73    ---------LNFAARHTAPDPPQT---ELTERITQIPPCGVEFSEYTPCEFVNRSLSFPR  120

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             ERLIYRERHCP+K E+L+CRIPAP+GY  P++WPESRDVAW+ NVPH ELTVEK  QNW+
Sbjct  121   ERLIYRERHCPEKHEMLRCRIPAPYGYTVPYRWPESRDVAWFANVPHTELTVEKKNQNWV  180

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R+E DRF FPGGGTMF  GADAY+D+IG+LINLKDGSIRTA+DTGCGVASFGAYL+SRNI
Sbjct  181   RYEKDRFLFPGGGTMFPRGADAYLDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSRNI  240

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             +TMSFAPRDTH++QVQFALERGVPA IG+LAS RLP+P++AFD+AHCSRCLIPWGQY+G 
Sbjct  241   VTMSFAPRDTHEAQVQFALERGVPASIGVLASIRLPFPARAFDIAHCSRCLIPWGQYNGT  300

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YLIEVDRVLRPGGYWILSGPPI W+R+W+GW+RT +DL++EQ++IE+VA SLCWKK ++ 
Sbjct  301   YLIEVDRVLRPGGYWILSGPPINWQRHWKGWERTRDDLKSEQSEIERVARSLCWKKLVQR  360

Query  816   DDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK----  655
             +D+A+WQKP NH+ C R R A   PP C     PD AWYT L+TCLTPLP+V+  +    
Sbjct  361   EDLAVWQKPTNHIHCKRNRIALGRPPFC-RRTLPDQAWYTKLETCLTPLPEVTGSEIKEE  419

Query  654   ---ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRY  484
                +L +WP+RLNAVPPRIK G+++GI+ + F  ++  W +R+S+Y    D QL E GRY
Sbjct  420   AGGKLARWPERLNAVPPRIKSGSLEGITEDDFVSNTETWQRRVSYYKR-FDQQLAETGRY  478

Query  483   RNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYP  304
             RN+LDMNA LGGFA+ALVD  +WVMNVVP+E+ +NTLGVIYERGLIGTY  WCEAMSTYP
Sbjct  479   RNLLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEAMSTYP  538

Query  303   RTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWE  124
             RTYD IHADS+FT+YKDRC+MEDILLEMDRILRP+GSV+IRDDVDVL KVK+ITD +QWE
Sbjct  539   RTYDFIHADSVFTMYKDRCDMEDILLEMDRILRPKGSVVIRDDVDVLTKVKKITDAMQWE  598

Query  123   SRVVDHEDGPLQREKLLFAVKTYWT  49
              R+ DHE+GPL+REK+LF VK YWT
Sbjct  599   GRIGDHENGPLEREKILFLVKEYWT  623



>ref|XP_009349944.1| PREDICTED: probable methyltransferase PMT15 [Pyrus x bretschneideri]
Length=632

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/527 (72%), Positives = 441/527 (84%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P CD K+SEYTPCED  RSL +DR+RL+YRERHCP K E+LKCRIPAP GY+ PF+WPES
Sbjct  92    PACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYKVPFRWPES  151

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+  WY NVPHKELTVEK +QNW+ +EGDRF+FPGGGTMF  GADAYIDDIGKLINL++G
Sbjct  152   RESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLREG  211

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSR+ILT+SFAPRDTH++QVQFALERGVPALIGILASKRLP
Sbjct  212   SIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVPALIGILASKRLP  271

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQYDG YLIEVDRVLRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  272   YPSRAFDMAHCSRCLIPWGQYDGLYLIEVDRVLRPGGYWILSGPPINWENHWKGWERTAE  331

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDM  715
             DL+AEQT IE VA SLCWKK  +  D+AIWQKP NH+ C   R+    P  C A  DPD 
Sbjct  332   DLKAEQTTIENVAKSLCWKKLKQKGDLAIWQKPTNHVHCKVTRKLFKKPSFCQA-QDPDT  390

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++ CLTPLP V++ KE     L KWP+RLN VPPRI  G + GI+ E F +++ L
Sbjct  391   AWYTKMEDCLTPLPGVNNIKEIAGGQLAKWPERLNTVPPRISSGRLTGITAESFRENTEL  450

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+ +Y  V D QL E GRYRN+LDMNA+LGGFAA LV   +WVMN+VPVE+++NTLG
Sbjct  451   WKKRVEYYKTV-DYQLAEPGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNTLG  509

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYD IH+DS+FTLYKDRCE EDILLEMDRILRPEGS+
Sbjct  510   AIYERGLIGTYQNWCEAMSTYPRTYDFIHSDSVFTLYKDRCEAEDILLEMDRILRPEGSI  569

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I RDDVDVL+KVK I D +Q+++R+VDHE+GP  REK+L AVK YWT
Sbjct  570   IFRDDVDVLVKVKSILDAMQYDARIVDHENGPKVREKILLAVKQYWT  616



>ref|XP_004496597.1| PREDICTED: probable methyltransferase PMT16-like [Cicer arietinum]
Length=623

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/528 (71%), Positives = 447/528 (85%), Gaps = 9/528 (2%)
 Frame = -2

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP-KKSEVLKCRIPAPFGYRNPFKW  1438
             V+P C V ++EYTPCED  RSL Y R R+I+RERHCP K  E LKCR+P P+GYRNPF W
Sbjct  93    VFPRCSVNFTEYTPCEDPTRSLRYKRSRMIFRERHCPIKGEEDLKCRVPPPYGYRNPFPW  152

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAWY NVPH+ELTVEKAVQNWIR++GDRF FPGGGTMF NGADAYIDDIGKLINL
Sbjct  153   PASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFFFPGGGTMFPNGADAYIDDIGKLINL  212

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
             KDGSIRTALDTGCGVAS+GAYL+SRNI+T+S APRDTH++QVQFALERGVPALI +LASK
Sbjct  213   KDGSIRTALDTGCGVASWGAYLMSRNIITLSIAPRDTHEAQVQFALERGVPALIAVLASK  272

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RLP+PS++FDM+HCSRCLIPW ++DG +L E+DRVLRPGGYWILSGPPI WK++W GW R
Sbjct  273   RLPFPSRSFDMSHCSRCLIPWAEHDGIFLNEIDRVLRPGGYWILSGPPIHWKKHWNGWQR  332

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPD  718
             T+EDL  EQ +IEKVA SLCW K +E DDIAIWQKP NH+DC  +     P C + +  D
Sbjct  333   TKEDLNEEQKKIEKVAKSLCWNKLVEKDDIAIWQKPKNHLDCKSITSR--PFCTSQDPSD  390

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYTDLQTCL+P+P VS ++E     LE WP+RLN++PPRI++ TI G+S   F KD+ 
Sbjct  391   KAWYTDLQTCLSPVPHVSSKEETAGGNLENWPQRLNSIPPRIQKATIKGVSPSAFSKDNE  450

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+S+Y  V + QL ++GRYRN+LDMNA+LGGFA++L++  +WVMNVVPV++K+N+L
Sbjct  451   LWKKRVSYYKKV-NNQLGKSGRYRNILDMNAYLGGFASSLIEDPVWVMNVVPVQAKVNSL  509

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G IYERGLIG YH WCEAMSTYPRTYDLIHA S+F+LY  RCE+E I+LEMDRILRPEG+
Sbjct  510   GAIYERGLIGIYHDWCEAMSTYPRTYDLIHAGSLFSLYNGRCELEGIMLEMDRILRPEGA  569

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +IIRDDVDVL+KVK I DGL+W+S++VDHEDGPL+REKLLF VK YWT
Sbjct  570   IIIRDDVDVLLKVKSIGDGLEWQSQIVDHEDGPLEREKLLFVVKKYWT  617



>gb|KHG14191.1| hypothetical protein F383_16741 [Gossypium arboreum]
Length=629

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/630 (63%), Positives = 485/630 (77%), Gaps = 33/630 (5%)
 Frame = -2

Query  1914  YSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtat  1735
             +++ N  L ++ L+ I CT  Y  G WQ+  G + +S S+      +   + L +     
Sbjct  17    FNTKNLTLYHITLVVILCTTFYLIGIWQHSVGTTFSSSSAAAAFLSSVPCSSLKTTQ---  73

Query  1734  tlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTER  1555
                            LDF  HH   D  +     +      +PPCD  +SEYTPCED +R
Sbjct  74    ---------------LDFLPHHLPPDPPS-----ETARAAQFPPCDHSFSEYTPCEDVQR  113

Query  1554  SLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEK  1375
             SL +DR+ LIYRERHCP+K E+LKCRIPAP+GY+ PF+WP+ R+ AW+ NVPHKELTVEK
Sbjct  114   SLKFDRDMLIYRERHCPEKDELLKCRIPAPYGYKVPFRWPQGREFAWFANVPHKELTVEK  173

Query  1374  AVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAY  1195
               QNWI+ EGDRF+FPGGGTMF +GADAYIDDI KLINL+DGSIRTA+DTGCGVAS+GAY
Sbjct  174   KNQNWIKVEGDRFRFPGGGTMFPHGADAYIDDIDKLINLRDGSIRTAIDTGCGVASWGAY  233

Query  1194  LLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPW  1015
             LLSRNIL MSFAPRDTH++QVQFALERGVPA+IG++AS RLPYPS+AFDMAHCSRCLIPW
Sbjct  234   LLSRNILAMSFAPRDTHEAQVQFALERGVPAMIGVMASIRLPYPSRAFDMAHCSRCLIPW  293

Query  1014  GQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCW  835
             G YDG YLIEVDRVLRPGGYWILSGPPI W+++W+GW+RT +DL++EQT+IE VA SLCW
Sbjct  294   GLYDGLYLIEVDRVLRPGGYWILSGPPINWQKHWKGWNRTTDDLKSEQTRIETVAKSLCW  353

Query  834   KKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSD  661
             KK ++ DD+A+WQKP NH+ C   R+    PP+C   N PDMAWYT L+TCLTPLP VS+
Sbjct  354   KKLVQKDDLAVWQKPTNHVHCKANRKDFKRPPICHTQN-PDMAWYTKLETCLTPLPHVSN  412

Query  660   EKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVE  496
              KE     L KWP+RLNA+PPRI  G++  I+   F ++S LW KR+ +Y  + D QL E
Sbjct  413   IKEIAGGQLAKWPERLNAIPPRISSGSLLRITETVFVENSELWKKRVEYYKTI-DHQLAE  471

Query  495   AGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVES-KLNTLGVIYERGLIGTYHTWCEA  319
              GRYRN+LDMNA+LGGFAAALVD  +WVMN+VPVE+ ++NTLGV+YERGLIGTY  WCEA
Sbjct  472   TGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEADQINTLGVVYERGLIGTYQNWCEA  531

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
             MSTYPRTYD IH D+IF+LYKDRCEMEDI+LEMDRILRPE SVIIRDDVDVL+K+K + D
Sbjct  532   MSTYPRTYDFIHGDAIFSLYKDRCEMEDIVLEMDRILRPESSVIIRDDVDVLMKLKNMMD  591

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G+QW+ R+VDHEDGP +R K+LFAVK YW 
Sbjct  592   GMQWDGRIVDHEDGPHERTKILFAVKQYWV  621



>ref|XP_011035186.1| PREDICTED: probable methyltransferase PMT15 isoform X3 [Populus 
euphratica]
Length=628

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/526 (72%), Positives = 447/526 (85%), Gaps = 7/526 (1%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD KYSE+TPCED ERSL +DR+RLIYRERHCP+  E+LKCR+PAP+GY+ PF+WPES
Sbjct  91    PPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPESHEILKCRVPAPYGYKVPFRWPES  150

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+ AWY NVPHKELTVEK  QNW+  EG+R +FPGGGTMF  GADAYIDDIG+LINLKDG
Sbjct  151   REFAWYANVPHKELTVEKKNQNWVHVEGERLRFPGGGTMFPRGADAYIDDIGQLINLKDG  210

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH SQVQFALERGVPALIGI+AS RLP
Sbjct  211   SIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVPALIGIIASIRLP  270

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQYDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  271   YPSRSFDMAHCSRCLIPWGQYDGQYLIEVDRILRPGGYWILSGPPINWEAHWEGWNRTRE  330

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDMA  712
             DL AEQ+QIE+VA SLCWKK ++  DIAIWQKP NH+ C   R+    P+   S +PDMA
Sbjct  331   DLGAEQSQIEEVARSLCWKKLVQRKDIAIWQKPTNHIHCKVNRKVFKRPLFCKSQNPDMA  390

Query  711   WYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT ++TCLTPLP+VS+ +     +L KWP+RLNA+PPRI RG+++GI+   F ++S LW
Sbjct  391   WYTKMETCLTPLPEVSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSELW  450

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              +R+++Y  + D QL + GRYRN+LDMNA LGGFAAALVD  +WVMNVVPV++K NTLGV
Sbjct  451   KRRVAYYKKI-DYQLAQTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKTNTLGV  509

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             I+ERGLIGTY  WCEAMSTYPRTYD IHADS+F+LY DRC+M+DILLEMDRILRPEGSVI
Sbjct  510   IFERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYNDRCDMQDILLEMDRILRPEGSVI  569

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +RDDVD+L+KVK I D +QW+ R+ DHE  P +REK+LFA K YWT
Sbjct  570   MRDDVDILMKVKSIIDVMQWDGRIADHESSPHRREKILFATKKYWT  615



>ref|XP_011035172.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Populus 
euphratica]
 ref|XP_011035179.1| PREDICTED: probable methyltransferase PMT15 isoform X2 [Populus 
euphratica]
Length=628

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/526 (72%), Positives = 447/526 (85%), Gaps = 7/526 (1%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD KYSE+TPCED ERSL +DR+RLIYRERHCP+  E+LKCR+PAP+GY+ PF+WPES
Sbjct  91    PPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPEIHEILKCRVPAPYGYKVPFRWPES  150

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+ AWY NVPHKELTVEK  QNW+  EG+R +FPGGGTMF  GADAYIDDIG+LINLKDG
Sbjct  151   REFAWYANVPHKELTVEKKNQNWVHVEGERLRFPGGGTMFPRGADAYIDDIGQLINLKDG  210

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH SQVQFALERGVPALIGI+AS RLP
Sbjct  211   SIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVPALIGIIASIRLP  270

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQYDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  271   YPSRSFDMAHCSRCLIPWGQYDGQYLIEVDRILRPGGYWILSGPPINWEAHWEGWNRTRE  330

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDMA  712
             DL AEQ+QIE+VA SLCWKK ++  DIAIWQKP NH+ C   R+    P+   S +PDMA
Sbjct  331   DLGAEQSQIEEVARSLCWKKLVQRKDIAIWQKPTNHIHCKVNRKVFKRPLFCKSQNPDMA  390

Query  711   WYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WYT ++TCLTPLP+VS+ +     +L KWP+RLNA+PPRI RG+++GI+   F ++S LW
Sbjct  391   WYTKMETCLTPLPEVSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSELW  450

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              +R+++Y  + D QL + GRYRN+LDMNA LGGFAAALVD  +WVMNVVPV++K NTLGV
Sbjct  451   KRRVAYYKKI-DYQLAQTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKTNTLGV  509

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             I+ERGLIGTY  WCEAMSTYPRTYD IHADS+F+LY DRC+M+DILLEMDRILRPEGSVI
Sbjct  510   IFERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYNDRCDMQDILLEMDRILRPEGSVI  569

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +RDDVD+L+KVK I D +QW+ R+ DHE  P +REK+LFA K YWT
Sbjct  570   MRDDVDILMKVKSIIDVMQWDGRIADHESSPHRREKILFATKKYWT  615



>ref|XP_002320758.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
 gb|EEE99073.2| hypothetical protein POPTR_0014s07180g [Populus trichocarpa]
Length=629

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/527 (72%), Positives = 447/527 (85%), Gaps = 8/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD KYSE+TPCED ERSL +DR+RLIYRERHCP+  E+LKCR+PAP+GY+ PF+WPES
Sbjct  91    PPCDPKYSEHTPCEDVERSLKFDRDRLIYRERHCPESHEILKCRVPAPYGYKVPFRWPES  150

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+ AWY NVPHKELTVEK  QNW+  EG R +FPGGGTMF  GADAYIDDIGKLINLKDG
Sbjct  151   REFAWYANVPHKELTVEKKNQNWVHVEGKRLRFPGGGTMFPRGADAYIDDIGKLINLKDG  210

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH SQVQFALERGVPALIGI+AS RLP
Sbjct  211   SIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHVSQVQFALERGVPALIGIIASIRLP  270

Query  1068  YPSKAFDMAHCSRCLIPWGQY-DGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             YPS++FDMAHCSRCLIPWGQY DG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+RT 
Sbjct  271   YPSRSFDMAHCSRCLIPWGQYADGQYLIEVDRILRPGGYWILSGPPINWEAHWEGWNRTR  330

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDM  715
             EDL AEQ+QIEKVA SLCWKK ++  DIAIWQKP NH+ C   R+    P+   S +PDM
Sbjct  331   EDLGAEQSQIEKVARSLCWKKLVQRKDIAIWQKPTNHIHCKVNRKVFKRPLFCKSQNPDM  390

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++TCLTPLP+VS+ +     +L KWP+RLNA+PPRI RG+++GI+   F ++S L
Sbjct  391   AWYTKMETCLTPLPEVSNIRDIAGGQLAKWPERLNAIPPRISRGSLEGITAGNFIENSEL  450

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W +R+++Y  + D QL + GRYRN+LDMNA LGGFAAALVD  LWVMNVVPV++K NTLG
Sbjct  451   WKRRVAYYKKI-DYQLAQTGRYRNLLDMNAHLGGFAAALVDDPLWVMNVVPVQAKTNTLG  509

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VI+ERGLIGTY  WCEAMSTYPRTYD IHADS+F+LY+DRC++EDILLEMDRILRPEGSV
Sbjct  510   VIFERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYEDRCDVEDILLEMDRILRPEGSV  569

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++RDDVD+L+KVK I D +QW+ R+ DHE  P QREK+LFA K YWT
Sbjct  570   VMRDDVDILMKVKSIIDVMQWDGRIADHESSPHQREKILFATKKYWT  616



>ref|XP_006396270.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
 gb|ESQ37723.1| hypothetical protein EUTSA_v10028512mg [Eutrema salsugineum]
Length=633

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/529 (70%), Positives = 451/529 (85%), Gaps = 11/529 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P C V++SEYTPCE  +RSL++ RERLIYRERHCPKK E+L+CRIPAP+GY+ PF+WPES
Sbjct  92    PSCGVEFSEYTPCEFVKRSLSFPRERLIYRERHCPKKEEILRCRIPAPYGYKVPFRWPES  151

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYID+IG+LINL+DG
Sbjct  152   RDKAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLINLRDG  211

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA++G+LAS RLP
Sbjct  212   SIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAILGVLASIRLP  271

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             +P++AFDMAHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPP+ W+++W+GW+RT +
Sbjct  272   FPARAFDMAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPVNWQKHWKGWERTRD  331

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL +EQTQIE+VA SLCWKK ++ +D+A+WQKP NH+ C R R A   PP C     PD 
Sbjct  332   DLNSEQTQIERVARSLCWKKLVQREDLAVWQKPTNHIHCKRNRIALRRPPFC-HRTQPDQ  390

Query  714   AWYTDLQTCLTPLPQVSDEK-------ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             AWYT L+ CLTPLP+V+  +       +L +WP+RLNAVPPRI+ G++ GI+ + F  ++
Sbjct  391   AWYTKLEECLTPLPEVTGSEIKEVAGGKLARWPERLNAVPPRIRSGSLQGITEDDFVSNT  450

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
               W +R+S+Y +  D QL E GRYRN+LDMNA LGGFA+ALVD  +WVMNVVPVE+ +NT
Sbjct  451   ETWQRRVSYYKS-FDQQLAETGRYRNLLDMNAHLGGFASALVDDPVWVMNVVPVEATVNT  509

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY  WCEAMSTYPRTYD +HADS+F++YKD+C+MEDILLEMDRILRP+G
Sbjct  510   LGVIYERGLIGTYQNWCEAMSTYPRTYDFVHADSVFSMYKDKCDMEDILLEMDRILRPKG  569

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDD+DVL KVK+ITD +QWE R+VDHE+GPL+REK+LF VK YWT
Sbjct  570   SVIIRDDIDVLTKVKKITDAMQWEGRIVDHENGPLEREKILFLVKEYWT  618



>ref|XP_010523726.1| PREDICTED: probable methyltransferase PMT16 [Tarenaya hassleriana]
Length=684

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/532 (70%), Positives = 445/532 (84%), Gaps = 12/532 (2%)
 Frame = -2

Query  1614  VYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWP  1435
              +P C VK SEYTPCED +RSL + RERL YRERHCP++ EVL+CRIPAP+GY+ PF+WP
Sbjct  143   TFPACGVKLSEYTPCEDQKRSLRFPRERLEYRERHCPERDEVLRCRIPAPYGYKTPFRWP  202

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
             ESRDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L 
Sbjct  203   ESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLS  262

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTA+DTGCGVASFGAYLLSR ++TMSFAPRDTH++QVQFALERGVPA+IGI+A+ R
Sbjct  263   DGSIRTAIDTGCGVASFGAYLLSRKVMTMSFAPRDTHEAQVQFALERGVPAMIGIMATIR  322

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LPYPS++FD+AHCSRCLIPWGQYDG YL+EVDRVLRPGGYWILSGPPI W+  W+GW RT
Sbjct  323   LPYPSRSFDLAHCSRCLIPWGQYDGIYLMEVDRVLRPGGYWILSGPPINWQNRWKGWGRT  382

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDP  721
              +DLEAEQTQIE+VA +LCWKK ++ D++A+WQKP+NH+ C R R     P  C    DP
Sbjct  383   MDDLEAEQTQIERVARNLCWKKVVQKDNLAVWQKPFNHVRCRRTRDVSKKPQFC-QKTDP  441

Query  720   DMAWYTDLQTCLTPLPQVSDEKE--------LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             DMAWYT L+TCLTPLP+V +  +        LEKWP RLNA+PPRI  GT++GI+ E F 
Sbjct  442   DMAWYTKLETCLTPLPEVPETGDIEAVAGGKLEKWPARLNAIPPRISSGTVEGITAEMFL  501

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +++ LW  R+SHY   +D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMNVVPVE+ 
Sbjct  502   ENTELWKNRVSHYK-TLDHQLAERGRYRNLLDMNAYLGGFAAALVDDPVWVMNVVPVEAS  560

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             +NTLGV+YERGLIGTY  WCEAMSTYPRTYD +HADS+F+LY+D+CE E+ILLEMDRILR
Sbjct  561   VNTLGVVYERGLIGTYQNWCEAMSTYPRTYDFVHADSVFSLYQDQCEPEEILLEMDRILR  620

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             P G V+IRDDVD+L+KVKRI  GLQWE R+ DHE GP +REK+L+AVK YWT
Sbjct  621   PGGGVMIRDDVDILVKVKRIIKGLQWEGRIFDHEKGPHEREKILYAVKQYWT  672



>ref|XP_003623835.1| hypothetical protein MTR_7g076170 [Medicago truncatula]
 gb|ABN08826.1| Generic methyltransferase [Medicago truncatula]
 gb|AES80053.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/635 (62%), Positives = 473/635 (74%), Gaps = 36/635 (6%)
 Frame = -2

Query  1911  SSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtatt  1732
             + P +++ +L      CT  Y  G WQN                  T  +   SGN   +
Sbjct  14    NKPFSRIYFLTFTIFLCTFFYFLGLWQNS----------------PTTTSAAISGNNHHS  57

Query  1731  lssttqslsshsAGLDFtthhgdgdgGAVLGNHD-------EDSVKVYPPCDVKYSEYTP  1573
              +             +FT+            +H+        + V   P CDV  SEYTP
Sbjct  58    TTIIRPDCPPA----NFTSTTTSSTTLDFSAHHNVPDPPETSERVTHAPVCDVALSEYTP  113

Query  1572  CEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHK  1393
             CEDT+RSL + RE LIYRERHCP+K EVL+CRIPAP+GYR P +WPESRD AWY NVPHK
Sbjct  114   CEDTQRSLKFPRENLIYRERHCPEKEEVLRCRIPAPYGYRVPPRWPESRDWAWYANVPHK  173

Query  1392  ELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGV  1213
             ELT+EK  QNW+ FEGDRF+FPGGGTMF  GA AYIDDIGKLINLKDGS+RTALDTGCGV
Sbjct  174   ELTIEKKNQNWVHFEGDRFRFPGGGTMFPRGAGAYIDDIGKLINLKDGSVRTALDTGCGV  233

Query  1212  ASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCS  1033
             AS+GAYLL R+IL +SFAPRDTH++QVQFALERGVPALIG++AS RLPYPS+AFDMAHCS
Sbjct  234   ASWGAYLLPRDILAVSFAPRDTHEAQVQFALERGVPALIGVIASIRLPYPSRAFDMAHCS  293

Query  1032  RCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKV  853
             RCLIPWGQ DG YL EVDRVLRPGGYWILSGPPI W+ +W+GW+RT EDL AEQT IE+V
Sbjct  294   RCLIPWGQNDGIYLTEVDRVLRPGGYWILSGPPINWESHWKGWERTREDLNAEQTSIERV  353

Query  852   ADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTP  679
             A SLCWKK ++  DIAIWQKP NH+ C   R+     P C A  DPD AWYT + TCLTP
Sbjct  354   AKSLCWKKLVQKGDIAIWQKPTNHIHCKITRKVFKNRPFCDAK-DPDSAWYTKMDTCLTP  412

Query  678   LPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVM  514
             LP+V+D KE     L  WP+RL +VPPRI  G++DGI+ E F++++ LW KR+++Y   +
Sbjct  413   LPEVTDIKEVSGRGLSNWPERLTSVPPRISSGSLDGITAEMFKENTELWKKRVAYYK-TL  471

Query  513   DGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYH  334
             D QL E GRYRN+LDMNA+LGGFAAA++D  +WVMNVVPVE+++NTLGV+YERGLIGTY 
Sbjct  472   DYQLAEPGRYRNLLDMNAYLGGFAAAMIDDPVWVMNVVPVEAEINTLGVVYERGLIGTYQ  531

Query  333   TWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKV  154
              WCEAMSTYPRTYD IHADS+FTLY+DRC +EDIL+EMDRILRP+GSVI+RDDVDVL+KV
Sbjct  532   NWCEAMSTYPRTYDFIHADSLFTLYEDRCNIEDILVEMDRILRPQGSVILRDDVDVLLKV  591

Query  153   KRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             KR  D +QW++R+ DHE GP QREK+L AVK YWT
Sbjct  592   KRFADAMQWDARIADHEKGPHQREKILVAVKQYWT  626



>ref|XP_008354467.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=628

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/633 (63%), Positives = 476/633 (75%), Gaps = 33/633 (5%)
 Frame = -2

Query  1920  QYYSSPNNK--LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSG  1747
             QY+S    +  L Y+ + A+ CT+ Y  G WQ+                 +T++  +++ 
Sbjct  4     QYFSLKPKRANLYYMTVAAVLCTICYLVGIWQH-----------------STSRAAIYTP  46

Query  1746  NtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCE  1567
              +A T      + ++ +   +      D     V        V   P CD K+SEYTPCE
Sbjct  47    VSAVTSCPPITTNTTITLDFNAHHRAEDLPLPPVAAR-----VAHLPACDAKHSEYTPCE  101

Query  1566  DTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKEL  1387
             D  RSL +DR+RL+YRERHCP K E+LKCRIPAP GY  PF+WPESR+  WY NVPHKEL
Sbjct  102   DVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYTVPFRWPESRESVWYANVPHKEL  161

Query  1386  TVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVAS  1207
             TVEK +QNW+ +EGDRF+FPGGGTMF  GADAYIDDIGKLINL+ GSIRTA+DTGCGVAS
Sbjct  162   TVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLRGGSIRTAIDTGCGVAS  221

Query  1206  FGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRC  1027
             +GAYLLSR+ILT+SFAPRDTH++QVQFALERGVPALIGILASKRLPYPS+AFDMAHCSRC
Sbjct  222   WGAYLLSRDILTVSFAPRDTHEAQVQFALERGVPALIGILASKRLPYPSRAFDMAHCSRC  281

Query  1026  LIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVAD  847
             LIPWGQYDG YLIEVDRVLRPGGYWILSGPPI W+ +W+GW+RT EDL+AEQT IE VA 
Sbjct  282   LIPWGQYDGLYLIEVDRVLRPGGYWILSGPPINWENHWKGWERTAEDLKAEQTTIENVAK  341

Query  846   SLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLP  673
              LCWKK  +  D+AIWQKP NH+ C   R+    P  C A  DPD AWYT ++ CLTPLP
Sbjct  342   RLCWKKLKQKGDLAIWQKPTNHVHCKVNRKLFKKPSFCQA-QDPDTAWYTKMEDCLTPLP  400

Query  672   QVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDG  508
              V++ KE     L KWP+RLN VPPRI  G++ GI+ E F +++ LW KR+ +Y  V D 
Sbjct  401   GVNNIKEIAGGQLAKWPERLNTVPPRISSGSLTGITAETFRENTELWKKRVEYYKTV-DY  459

Query  507   QLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTW  328
             QL EAGRYRN+LDMNA+LGGFAA LV   +WVMN+VPVE+++N LG IYERGLIGTY  W
Sbjct  460   QLAEAGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNALGAIYERGLIGTYQNW  519

Query  327   CEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKR  148
             CEAMSTYPRTYDLIH+DS+FTLYKDRCE EDILLEMDRILRP GS+I RDDVDVL+KVK 
Sbjct  520   CEAMSTYPRTYDLIHSDSVFTLYKDRCEAEDILLEMDRILRPXGSIIFRDDVDVLVKVKS  579

Query  147   ITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I D +Q+++R+VDHE+GP  REK+L AVK YWT
Sbjct  580   ILDAMQYDARIVDHENGPKVREKILLAVKQYWT  612



>ref|XP_008375906.1| PREDICTED: probable methyltransferase PMT15 [Malus domestica]
Length=632

 Score =   814 bits (2103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/622 (64%), Positives = 473/622 (76%), Gaps = 31/622 (5%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttq  1714
             L Y+ L A+ CTL Y  G WQ+  G +  +        ++   +C               
Sbjct  19    LYYMTLAAVLCTLCYLVGIWQHSSGGAVITA------SVSAVASC-------------PP  59

Query  1713  slsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRE  1534
                + +  LDF  HH   D          D +   PPC+ K SEYTPCED  RSL +DR+
Sbjct  60    ITINKTIHLDFKAHHTAEDLPLPPAAARVDHL---PPCNAKLSEYTPCEDLTRSLKFDRK  116

Query  1533  RLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIR  1354
             RL+YRERHCP+K E+LKCRIPAP GY  P +WPESRD  WY NVPHKELTVEK  QNW+ 
Sbjct  117   RLVYRERHCPEKEELLKCRIPAPHGYTVPLRWPESRDSVWYANVPHKELTVEKKKQNWVH  176

Query  1353  FEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNIL  1174
             ++GDRF+FPGGGTMF  GADAYIDDIGKLINL DGS+RTA+DTGCGVAS+GAYLLSR+IL
Sbjct  177   YDGDRFRFPGGGTMFPRGADAYIDDIGKLINLGDGSVRTAIDTGCGVASWGAYLLSRDIL  236

Query  1173  TMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAY  994
             T+SFAPRDTH++QVQFALERGVPALIGILASKRLPYPS+AFDMAHCSRCLIPWGQYDG Y
Sbjct  237   TVSFAPRDTHEAQVQFALERGVPALIGILASKRLPYPSRAFDMAHCSRCLIPWGQYDGLY  296

Query  993   LIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVD  814
             LIEVDRVLRPGGYWILSGPPI W+ +W+GW+RT EDL AEQT +E VA SLCWKK  +  
Sbjct  297   LIEVDRVLRPGGYWILSGPPINWENHWKGWERTAEDLRAEQTTMENVAKSLCWKKLKQKG  356

Query  813   DIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----  655
             D+AIWQKP NH+ C   R+    P  C A  DPD AWYT ++ C+TPLP+V++ K     
Sbjct  357   DLAIWQKPTNHVHCKMNRKVFKKPSFCQA-RDPDTAWYTKMEDCVTPLPEVNNIKEIAGG  415

Query  654   ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNV  475
             EL KWPKRLN+VPPRI  G++ G++ + F +++ LWNKR+++Y   MD QL E GRYRN+
Sbjct  416   ELTKWPKRLNSVPPRISSGSLTGVTAQTFRENTELWNKRVAYYK-TMDYQLAEPGRYRNL  474

Query  474   LDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTY  295
             LD NA+LGGFAAALV   +WVMN+VPVE+++NTLG IYERGLIGTY  WCEAMSTYPRTY
Sbjct  475   LDTNAYLGGFAAALVHDPVWVMNIVPVEAEVNTLGAIYERGLIGTYQNWCEAMSTYPRTY  534

Query  294   DLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRV  115
             D IH+DS+FTLYKDRCE+E ILLEMDRILRPEGS+I RDDVDVL+KVK I D +Q++ R+
Sbjct  535   DFIHSDSVFTLYKDRCEVEYILLEMDRILRPEGSIIFRDDVDVLVKVKSIMDAMQYDVRI  594

Query  114   VDHEDGPLQREKLLFAVKTYWT  49
             VDHE+GP +REK++ AVK YWT
Sbjct  595   VDHENGPREREKIMLAVKQYWT  616



>gb|KFK37364.1| hypothetical protein AALP_AA4G247100 [Arabis alpina]
Length=628

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/631 (63%), Positives = 470/631 (74%), Gaps = 39/631 (6%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S  + L Y+A++ + CT SY  GTWQN                 A  +    +G      
Sbjct  11    SKKSNLYYVAIVTLLCTGSYLIGTWQNTS---------------ANPRAAFNNGGNTPCE  55

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
               +T+        LDF  HH   +   ++      +   +P CD   SE+TPCED +RSL
Sbjct  56    EFSTKV-------LDFNAHHNIQEPPPLI-----KTTVNFPSCDAVLSEHTPCEDAKRSL  103

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              Y RERL YR+RHCP++ E LKCRIPAP+GY+ PFKWPESRDVAW+ NVPH ELTVEK  
Sbjct  104   KYSRERLEYRQRHCPEREEALKCRIPAPYGYKTPFKWPESRDVAWFANVPHTELTVEKKN  163

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYLL
Sbjct  164   QNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLL  223

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
             SRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ
Sbjct  224   SRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQ  283

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
              DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL  EQTQIE VA SLCWKK
Sbjct  284   NDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNTEQTQIENVARSLCWKK  343

Query  828   FMEVDDIAIWQKPYNHMDC---IRLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
               + DD+AIWQKPYNH+ C   IR     P  C    DPDMAWYT + +CLTPLP+V + 
Sbjct  344   VTQRDDLAIWQKPYNHIHCKKTIRKVLKNPEFCRHDQDPDMAWYTKMDSCLTPLPEVDET  403

Query  657   KEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
             + L        EKWP RLNAVPPR+ RG +  ++ E F +D+ LW +R+S+Y   +D QL
Sbjct  404   EGLKTVAGGNVEKWPVRLNAVPPRVSRGDLGEVTPEGFLEDTKLWKQRVSYYKR-LDYQL  462

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA+LGGFA+AL D  +WVMNVVPVE+KLNTLGVIYERGLIGTY  WCE
Sbjct  463   GEKGRYRNLLDMNAYLGGFASALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCE  522

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDR+LRP G VIIRDDVDVLIK+K +T
Sbjct  523   AMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKIKELT  582

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              GLQWE R+ DHE GP +R K+ +AVK YWT
Sbjct  583   KGLQWEGRIADHEKGPHERVKIYYAVKQYWT  613



>ref|XP_004133882.1| PREDICTED: probable methyltransferase PMT15-like [Cucumis sativus]
Length=640

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/633 (63%), Positives = 474/633 (75%), Gaps = 40/633 (6%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L  + L+AI C + Y  G WQ                  +  K+ +F+G      +ST 
Sbjct  14    NLYTITLVAILCAVFYLVGVWQQ-----------------SIGKSLIFAGGNYACTASTV  56

Query  1716  qslsshsAG-----LDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERS  1552
              +   +S       LDF  HH   D   V      +    +PPCD K  EYTPCED ERS
Sbjct  57    AATIENSTATTVIDLDFAAHHTAADLPVVQKARRPN----FPPCDSKLYEYTPCEDRERS  112

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L +DR+RLIYRERHCP+  E+LKCR+PAP GY+ PF+WPESRD AW++NVPHKELTVEK 
Sbjct  113   LKFDRDRLIYRERHCPEAGEILKCRVPAPAGYKVPFRWPESRDFAWFSNVPHKELTVEKK  172

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG-----VAS  1207
              QNW+RFE DRF+FPGGGTMF  GADAYIDDIGKLINL DGSIRTA+DTG G     VAS
Sbjct  173   NQNWVRFENDRFRFPGGGTMFPRGADAYIDDIGKLINLADGSIRTAVDTGWGGRNGYVAS  232

Query  1206  FGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRC  1027
             +GAYLLSRNI+TMSFAPRDTH++QVQFALERGVPALIG+LAS RLPYPS+AFDMAHCSRC
Sbjct  233   WGAYLLSRNIVTMSFAPRDTHEAQVQFALERGVPALIGVLASIRLPYPSRAFDMAHCSRC  292

Query  1026  LIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVAD  847
             LIPW Q DG YLIEVDR+LRPGGYW+LSGPPI W+ +W+GW+RT  DL+AEQ++IE VA 
Sbjct  293   LIPWAQSDGMYLIEVDRILRPGGYWVLSGPPINWENHWKGWNRTTGDLQAEQSKIEAVAK  352

Query  846   SLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLP  673
             SLCWKK  + DDIAIWQKP NH+ C + R+    P  C    DPD+AWYT ++ CLTPLP
Sbjct  353   SLCWKKLKQKDDIAIWQKPTNHIHCKKNRKVFKFPNFC-QEQDPDIAWYTKMEPCLTPLP  411

Query  672   QVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDG  508
             +VSD KE     L  WP+RL +VPPRI  G++  I+ + F +++ LW KR++HY A +DG
Sbjct  412   EVSDVKETAGGQLLNWPERLTSVPPRISSGSLKQITPQNFTENTELWRKRVAHYKA-LDG  470

Query  507   QLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTW  328
             QL E GRYRN+LDMN+FLGGFAAA+VD  LWVMN+VPVE+  NTLGVIYERGLIGTY  W
Sbjct  471   QLAEPGRYRNLLDMNSFLGGFAAAIVDDPLWVMNIVPVEADFNTLGVIYERGLIGTYQNW  530

Query  327   CEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKR  148
             CEAMSTYPRTYD IH DS+F++YK RCEMEDILLEMDRILRP+GSVI+RDDVDVL++VK 
Sbjct  531   CEAMSTYPRTYDFIHGDSVFSMYKGRCEMEDILLEMDRILRPQGSVILRDDVDVLVEVKS  590

Query  147   ITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I + +QWE R+ DHE GP QREK+L A K YWT
Sbjct  591   IAEAMQWECRIADHEKGPHQREKILVATKQYWT  623



>ref|XP_007143370.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
 gb|ESW15364.1| hypothetical protein PHAVU_007G066900g [Phaseolus vulgaris]
Length=598

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/528 (72%), Positives = 446/528 (84%), Gaps = 11/528 (2%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + +P C   +SEYTPC+D +RSL Y R R+IYRERHCP+  E LKCR+PAP GYRNPF W
Sbjct  68    RTFPRCSANFSEYTPCQDPQRSLGYKRHRMIYRERHCPE--EPLKCRVPAPHGYRNPFPW  125

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRD AW+ NVPH+ELTVEKAVQNWIRFEG+RF FPGGGT F NGADAYI+DIGKLINL
Sbjct  126   PASRDRAWFANVPHRELTVEKAVQNWIRFEGERFVFPGGGTTFPNGADAYIEDIGKLINL  185

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
             +DGSIRTALDTGCGVAS+GAYLLSRNILT+S APRDTH++QVQFALERGVPALIGILASK
Sbjct  186   RDGSIRTALDTGCGVASWGAYLLSRNILTLSIAPRDTHEAQVQFALERGVPALIGILASK  245

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RLP+PS+AFDM+HCSRCLIPW +YDG +L EVDRVLRPGGYWILSGPPI WK+YW+GW R
Sbjct  246   RLPFPSRAFDMSHCSRCLIPWAEYDGIFLNEVDRVLRPGGYWILSGPPINWKKYWKGWQR  305

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPD  718
             TE+DL  EQT+IE+VA SLCW K +E DDIAIWQKP NH DC +L Q     C A NDPD
Sbjct  306   TEKDLNEEQTKIEEVAKSLCWSKLVEKDDIAIWQKPKNHFDC-KLTQN-RSFCSAQNDPD  363

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYTD+QTCLTP+P+VS+++E     +E WPKRL ++PPRI R TI+G++ E F KD  
Sbjct  364   KAWYTDMQTCLTPVPEVSNKEETSGGMVEDWPKRLKSIPPRIYRSTIEGVTDEAFSKDYE  423

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+S+Y  V   +L+  GRYRN+LDMNA LGGFAAAL++  +WVMNVVPV++K++TL
Sbjct  424   LWKKRVSYYKTV--NKLLGTGRYRNLLDMNAHLGGFAAALIEDPVWVMNVVPVQAKVDTL  481

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G IYERGLIG YH WCEAMSTYPRTYDLIHADS+ +LY +RC +EDILLEMDRILRPEG 
Sbjct  482   GSIYERGLIGVYHDWCEAMSTYPRTYDLIHADSVLSLYSNRCGLEDILLEMDRILRPEGC  541

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD+L+KVK I +GL+W+S +VDHED  L+REKLLFAVK YWT
Sbjct  542   VIIRDDVDMLVKVKSIVNGLEWDSIIVDHEDEHLKREKLLFAVKKYWT  589



>ref|XP_006339462.1| PREDICTED: probable methyltransferase PMT15-like [Solanum tuberosum]
Length=636

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/532 (71%), Positives = 443/532 (83%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             SV  YP C+ + SEYTPCED++RSL +DR  L YRERHCP+K+E+LKCRIPAPFGY+ PF
Sbjct  98    SVNHYPSCNPELSEYTPCEDSKRSLKFDRNMLAYRERHCPEKNELLKCRIPAPFGYKPPF  157

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             +WP+SRD  WY NVPHK LTVEKA QNW+RF+GDRF FPGGGTMF  GADAYIDDIGKLI
Sbjct  158   RWPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAYIDDIGKLI  217

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              LKDGSIRTA+DTGCGVAS+GAYLLSR+IL +SFAP+DTH++QVQFALERGVPALIGILA
Sbjct  218   KLKDGSIRTAIDTGCGVASWGAYLLSRDILPISFAPKDTHEAQVQFALERGVPALIGILA  277

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             + RLPYP++AFDMAHCSRCLIPWG+YDG YLIEVDR+LRPGGYWILSGPP+ W+ +W+GW
Sbjct  278   TNRLPYPARAFDMAHCSRCLIPWGKYDGLYLIEVDRILRPGGYWILSGPPVNWQGHWRGW  337

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RT +DL+AEQ QIE VA SLCWKK  +  D+AIWQKP NH+ C   R+    PP C   
Sbjct  338   NRTADDLKAEQDQIENVARSLCWKKVTQRGDLAIWQKPTNHVHCKINRKVFRNPPFC-QE  396

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
              DPD AWYT +  CL+PLP+VS  K+     L  WP+RL AVPPRI   +I+G++ E F 
Sbjct  397   QDPDKAWYTKIDACLSPLPEVSSVKDVAGGPLANWPERLTAVPPRIASSSIEGVTAEGFS  456

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ LW KR++HY  V+D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMN+VP E++
Sbjct  457   EDTELWKKRVAHYK-VLDSQLAEHGRYRNILDMNAWLGGFAAALVDDPVWVMNIVPTEAE  515

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             +NTLGVI+ERGLIGTY +WCEAMSTYPRTYD IHADS+FTLY+DRCEMEDILLEMDR+LR
Sbjct  516   VNTLGVIFERGLIGTYQSWCEAMSTYPRTYDFIHADSVFTLYQDRCEMEDILLEMDRVLR  575

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             P+GS I RDDVDVL+ VK I DGLQWESR+VDHE GP  REKLL A K YWT
Sbjct  576   PQGSAIFRDDVDVLVNVKSILDGLQWESRMVDHEGGPHVREKLLIATKLYWT  627



>ref|XP_007051920.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOX96077.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=635

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/527 (72%), Positives = 445/527 (84%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD+ +SEYTPCED +RSL +DR  L+YRERHCP+K+E+LKCR+PAP+GY+ PF+WP S
Sbjct  96    PPCDLSFSEYTPCEDVKRSLKFDRGMLVYRERHCPEKNELLKCRVPAPYGYKVPFRWPRS  155

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+ AW+ NVPHKELTVEK  QNW++ EG+ F+FPGGGTMF  GADAYIDDI +LINLKDG
Sbjct  156   REFAWFANVPHKELTVEKKNQNWVKVEGELFRFPGGGTMFPRGADAYIDDIDELINLKDG  215

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSRNIL +SFAPRDTH++QVQFALERGVPALIG+LAS RLP
Sbjct  216   SIRTAIDTGCGVASWGAYLLSRNILAVSFAPRDTHEAQVQFALERGVPALIGVLASIRLP  275

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQYDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW+RT +
Sbjct  276   YPSRAFDMAHCSRCLIPWGQYDGLYLIEVDRILRPGGYWILSGPPINWENHWKGWNRTRD  335

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             +L AEQ  IE  A SLCWKK ++ DD+AIWQKP NH+ C   R+    P  C   N PDM
Sbjct  336   NLRAEQNLIETGAKSLCWKKLVQKDDLAIWQKPTNHIHCRANRKVFKQPRFCQTQN-PDM  394

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT L+TCLTPLP+VS+ KE     L KWP+RLNA+PPRI  G + GI+ + F +++ L
Sbjct  395   AWYTKLETCLTPLPEVSNIKEIAGGQLAKWPERLNAIPPRISSGRLTGITEKMFVENTEL  454

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+ +Y  V D QL E GRYRN+LDMNA LGGFAAALVD  +W MNVVP+E+++NTLG
Sbjct  455   WKKRVEYYKRV-DHQLAETGRYRNLLDMNAHLGGFAAALVDDPVWTMNVVPIEAEINTLG  513

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              +YERGLIGTY +WCEAMSTYPRTYD IHADSIF+LY+DRCEMEDILLEMDRILRPEGSV
Sbjct  514   AVYERGLIGTYQSWCEAMSTYPRTYDFIHADSIFSLYQDRCEMEDILLEMDRILRPEGSV  573

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVDVL+KVK I D +QW+ R+VDHEDGP +REK+LFAVK YWT
Sbjct  574   IIRDDVDVLVKVKNIIDVMQWDGRIVDHEDGPHEREKILFAVKQYWT  620



>ref|XP_008383220.1| PREDICTED: probable methyltransferase PMT15, partial [Malus domestica]
Length=583

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/527 (72%), Positives = 439/527 (83%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P CD K+SEYTPCED  RSL +DR+RL+YRERHCP K E+LKCRIPAP GY  PF+WPES
Sbjct  43    PACDAKHSEYTPCEDVTRSLKFDRDRLVYRERHCPDKEELLKCRIPAPHGYTVPFRWPES  102

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             R+  WY NVPHKELTVEK +QNW+ +EGDRF+FPGGGTMF  GADAYIDDIGKLINL+ G
Sbjct  103   RESVWYANVPHKELTVEKKMQNWVHYEGDRFRFPGGGTMFPRGADAYIDDIGKLINLRGG  162

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSR+ILT+SFAPRDTH++QVQFALERGVPALIGILASKRLP
Sbjct  163   SIRTAIDTGCGVASWGAYLLSRDILTVSFAPRDTHEAQVQFALERGVPALIGILASKRLP  222

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQYDG YLIEVDRVLRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  223   YPSRAFDMAHCSRCLIPWGQYDGLYLIEVDRVLRPGGYWILSGPPINWENHWKGWERTAE  282

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDM  715
             DL+AEQT IE VA  LCWKK  +  D+AIWQKP NH+ C   R+    P  C A  DPD 
Sbjct  283   DLKAEQTTIENVAKRLCWKKLKQKGDLAIWQKPTNHVHCKVNRKLFKKPSFCQA-QDPDT  341

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++ CLTPLP V++ KE     L KWP+RLN VPPRI  G++ GI+ E F +++ L
Sbjct  342   AWYTKMEDCLTPLPGVNNIKEIAGGQLAKWPERLNTVPPRISSGSLTGITAETFRENTEL  401

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+ +Y  V D QL EAGRYRN+LDMNA+LGGFAA LV   +WVMN+VPVE+++N LG
Sbjct  402   WKKRVEYYKTV-DYQLAEAGRYRNLLDMNAYLGGFAAVLVHDPVWVMNIVPVEAEVNALG  460

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYDLIH+DS+FTLYKDRCE EDILLEMDRILRP GS+
Sbjct  461   AIYERGLIGTYQNWCEAMSTYPRTYDLIHSDSVFTLYKDRCEAEDILLEMDRILRPXGSI  520

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I RDDVDVL+KVK I D +Q+++R+VDHE+GP  REK+L AVK YWT
Sbjct  521   IFRDDVDVLVKVKSILDAMQYDARIVDHENGPKVREKILLAVKQYWT  567



>ref|NP_182099.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
 sp|O80844.1|PMTG_ARATH RecName: Full=Probable methyltransferase PMT16 [Arabidopsis thaliana]
 gb|AAC28550.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10597.1| putative methyltransferase PMT16 [Arabidopsis thaliana]
Length=631

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/626 (63%), Positives = 474/626 (76%), Gaps = 34/626 (5%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
              L Y+ L+A+ C  SY  G WQN                  TA     + + +       
Sbjct  15    NLYYVTLVALLCIASYLLGIWQN------------------TAVNPRAAFDDSDGTPCEG  56

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
              +  + +  LDF  HH   D   V      ++   +P C    SE+TPCED +RSL + R
Sbjct  57    FTRPNSTKDLDFDAHHNIQDPPPVT-----ETAVSFPSCAAALSEHTPCEDAKRSLKFSR  111

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             ERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WP SRDVAW+ NVPH ELTVEK  QNW+
Sbjct  112   ERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPASRDVAWFANVPHTELTVEKKNQNWV  171

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYLLSRNI
Sbjct  172   RYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNI  231

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
              TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ DGA
Sbjct  232   TTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQNDGA  291

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL AEQTQIE+VA SLCWKK ++ 
Sbjct  292   YLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNAEQTQIEQVARSLCWKKVVQR  351

Query  816   DDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKEL--  649
             DD+AIWQKP+NH+DC + R+    P  C    DPDMAWYT + +CLTPLP+V D ++L  
Sbjct  352   DDLAIWQKPFNHIDCKKTREVLKNPEFCRHDQDPDMAWYTKMDSCLTPLPEVDDAEDLKT  411

Query  648   ------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGR  487
                   EKWP RLNA+PPR+ +G ++ I+ E F +++ LW +R+S+Y   +D QL E GR
Sbjct  412   VAGGKVEKWPARLNAIPPRVNKGALEEITPEAFLENTKLWKQRVSYYKK-LDYQLGETGR  470

Query  486   YRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTY  307
             YRN++DMNA+LGGFAAAL D  +WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEAMSTY
Sbjct  471   YRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAMSTY  530

Query  306   PRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQW  127
             PRTYD IHADS+FTLY+ +CE E+ILLEMDRILRP G VIIRDDVDVLIKVK +T GL+W
Sbjct  531   PRTYDFIHADSVFTLYQGQCEPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKGLEW  590

Query  126   ESRVVDHEDGPLQREKLLFAVKTYWT  49
             E R+ DHE GP +REK+ +AVK YWT
Sbjct  591   EGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_004229839.1| PREDICTED: probable methyltransferase PMT15 [Solanum lycopersicum]
Length=636

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/531 (71%), Positives = 443/531 (83%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V  YP C+++ SEYTPCED++RSL +DR  L YRERHCP+KSE+LKCRIPAPFGY+ PF+
Sbjct  99    VNHYPSCNLELSEYTPCEDSKRSLKFDRSMLAYRERHCPEKSELLKCRIPAPFGYKPPFR  158

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP+SRD  WY NVPHK LTVEKA QNW+RF+GDRF FPGGGTMF  GADAYIDDIGKLI 
Sbjct  159   WPQSRDSVWYANVPHKHLTVEKAGQNWVRFKGDRFTFPGGGTMFPRGADAYIDDIGKLIK  218

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSR+IL +SFAP+DTH++QVQFALERGVPALIGILA+
Sbjct  219   LKDGSIRTAIDTGCGVASWGAYLLSRDILPISFAPKDTHEAQVQFALERGVPALIGILAT  278

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLPYP++AFDMAHCSRCLIPWG+YDG YLIEVDR+LRPGGYWILSGPP+ W+ +W+GW+
Sbjct  279   NRLPYPARAFDMAHCSRCLIPWGKYDGLYLIEVDRILRPGGYWILSGPPVNWQDHWRGWN  338

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT +DL+AEQ QIE VA SLCWKK  +  D+AIWQKP NH+ C   R+    PP C    
Sbjct  339   RTADDLKAEQDQIENVARSLCWKKVTQRGDLAIWQKPTNHVHCKINRKVFRKPPFC-QEQ  397

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT +  CL+PLP+VS  K+     LE WP+RL AVPPRI   +I+G++ E F +
Sbjct  398   DPDKAWYTKIDACLSPLPEVSSVKDVAGGPLENWPERLTAVPPRIASSSIEGVTAEGFSE  457

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LW KR++HY A +D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMN++P E+++
Sbjct  458   DTELWKKRVAHYKA-LDSQLAERGRYRNILDMNAWLGGFAAALVDDPVWVMNIIPAEAEV  516

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVI+ERG IGTY +WCEAMSTYPRTYD IHADS+FTLY+DRCE+EDILLEMDR+LRP
Sbjct  517   NTLGVIFERGFIGTYQSWCEAMSTYPRTYDFIHADSVFTLYQDRCEVEDILLEMDRVLRP  576

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +GS I RDDVDVL+ VK I DGLQWESR+VDHE GP  REKLL A K YWT
Sbjct  577   QGSAIFRDDVDVLVNVKSILDGLQWESRMVDHEGGPHVREKLLIATKLYWT  627



>ref|XP_010540274.1| PREDICTED: probable methyltransferase PMT15 [Tarenaya hassleriana]
Length=630

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/529 (72%), Positives = 447/529 (84%), Gaps = 11/529 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P CD + SEYTPCED  RSL + RERLIYRERHCP+K E+L+CRIPAP+GY  PF+WPES
Sbjct  96    PACDAELSEYTPCEDVNRSLPFPRERLIYRERHCPEKGEILRCRIPAPYGYMAPFRWPES  155

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LINL+DG
Sbjct  156   RDVAWFANVPHTELTVEKKSQNWVRYEKDRFLFPGGGTMFPRGADAYIDDIGQLINLRDG  215

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYL+SRN++ MSFAPRDTH++QVQFALERGVPALIG++AS RLP
Sbjct  216   SIRTAIDTGCGVASWGAYLMSRNVVAMSFAPRDTHEAQVQFALERGVPALIGVMASIRLP  275

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPW Q++G YLIEVDRVLRPGGYWILSGPPI W+R+W+GW+RT++
Sbjct  276   YPSRAFDMAHCSRCLIPWAQHNGTYLIEVDRVLRPGGYWILSGPPINWQRHWKGWERTKD  335

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL AEQT+IE+VA SLCWKK ++ DD++IWQKP NH+ C R R A   P  C  S DPD+
Sbjct  336   DLNAEQTEIERVARSLCWKKLVQKDDLSIWQKPTNHIHCKRNRIALRRPRFC-RSQDPDL  394

Query  714   AWYTDLQTCLTPLPQV--SDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             AWYT L  CLTPLP+V  S+ KE     L KWP+RLN VPPRI  G++ GI+ + F  +S
Sbjct  395   AWYTKLDDCLTPLPEVTGSNVKEVAGGALAKWPERLNVVPPRISSGSLKGITPDDFAGNS  454

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
               W KR+S+Y    D QL E GRYRN+LDMNA LGGFAAALV+  +WVMNVVPVE+ +NT
Sbjct  455   ETWEKRVSYYKR-FDHQLAERGRYRNLLDMNAHLGGFAAALVNDPVWVMNVVPVEASVNT  513

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGL+GTY  WCEAMSTYPRTYD IHADS+F+LYK RCEM+DILLEMDR+LRP+G
Sbjct  514   LGVIYERGLVGTYQNWCEAMSTYPRTYDFIHADSVFSLYKGRCEMQDILLEMDRVLRPKG  573

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDDVDVL++VK ITDG+QWE+R+ DHE GPL+REK+L+AVK YWT
Sbjct  574   SVIIRDDVDVLVRVKEITDGMQWEARIGDHEGGPLEREKVLYAVKQYWT  622



>ref|XP_010427380.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=633

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/535 (71%), Positives = 450/535 (84%), Gaps = 11/535 (2%)
 Frame = -2

Query  1626  DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNP  1447
             + V    PC V++SEYTPCE   RSL++ RERLIYRERHCP+K E+L+CRIPAPFGY  P
Sbjct  91    ERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPFGYSVP  150

Query  1446  FKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKL  1267
             F+WPESRDVAW+ NVPH ELTVEK  QNW+R++ DRF FPGGGTMF  GADAYID+IG+L
Sbjct  151   FRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGGGTMFPRGADAYIDEIGRL  210

Query  1266  INLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGIL  1087
             INLKDGSIRTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA+IG+L
Sbjct  211   INLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAIIGVL  270

Query  1086  ASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQG  907
             AS RLP+P++AFD+AHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPPI W+R W+G
Sbjct  271   ASIRLPFPARAFDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRQWKG  330

Query  906   WDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPA  733
             W+RT++DL +EQTQIE+VA SLCWKK ++ +D+A+WQKP NH+ C R R     PP C  
Sbjct  331   WERTKDDLNSEQTQIERVARSLCWKKLVQREDLAVWQKPTNHIHCKRNRVVLRRPPFC-H  389

Query  732   SNDPDMAWYTDLQTCLTPLPQV--SDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGE  574
                PD AWYT L+TCLTPLP+V  SD KE     L +WP+RLNAVPPRIK G+++GI+ +
Sbjct  390   RTLPDQAWYTKLETCLTPLPEVTGSDIKEVAGGKLARWPERLNAVPPRIKSGSLEGINED  449

Query  573   KFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPV  394
              F  ++  W +R+++Y    D QL E GRYRN LDMNA LGGFA+ALVD  +WVMNVVP+
Sbjct  450   DFVSNTETWQRRVTYYKR-FDQQLAETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPM  508

Query  393   ESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDR  214
             E+ +NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LYKDRC+MEDILLEMDR
Sbjct  509   EASVNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDR  568

Query  213   ILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ILRP+G VIIRDD+DVL KVK+ITD +QWE R+ DHE+GPL+REK+LF VK YWT
Sbjct  569   ILRPKGGVIIRDDIDVLTKVKKITDAMQWEGRIGDHENGPLEREKILFLVKEYWT  623



>ref|XP_010419631.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=630

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/627 (63%), Positives = 479/627 (76%), Gaps = 31/627 (5%)
 Frame = -2

Query  1902  NNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlss  1723
                L ++ L+AI C   Y+ G WQ+ G     S  S       T+  C F    A     
Sbjct  16    QTNLYHVILIAILCAAFYYIGVWQHSGRGLSRSSLSNHDL---TSVPCTFPHQPAPV---  69

Query  1722  ttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAY  1543
                        L+F   H   D  +       + V    PC V++SEYTPCE   RSL++
Sbjct  70    -----------LNFAARHSAPDPPSTA---TAERVTQISPCGVEFSEYTPCEFVNRSLSF  115

Query  1542  DRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQN  1363
              RERLIYRERHCP+K E+L+CRIPAPFGY  PF+WPESRDVAW+ NVPH ELTVEK  QN
Sbjct  116   PRERLIYRERHCPEKHEMLRCRIPAPFGYSVPFRWPESRDVAWFANVPHTELTVEKKNQN  175

Query  1362  WIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSR  1183
             W+R++ DRF FPGGGTMF  GADAYID+IG+LINLKDGSIRTA+DTGCGVASFGAYL+SR
Sbjct  176   WVRYDKDRFLFPGGGTMFPRGADAYIDEIGRLINLKDGSIRTAIDTGCGVASFGAYLMSR  235

Query  1182  NILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYD  1003
             NI+TMSFAPRDTH++QVQFALERGVPA+IG+LAS RLP+P++AFD+AHCSRCLIPWGQY+
Sbjct  236   NIVTMSFAPRDTHEAQVQFALERGVPAIIGVLASIRLPFPARAFDIAHCSRCLIPWGQYN  295

Query  1002  GAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFM  823
             G YLIEVDRVLRPGGYWILSGPPI W+R+W+GW+RT++DL +EQ+QIE+VA SLCWKK +
Sbjct  296   GTYLIEVDRVLRPGGYWILSGPPINWQRHWKGWERTKDDLNSEQSQIERVARSLCWKKLV  355

Query  822   EVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQV--SDEK  655
             + +D+A+WQKP NH+ C R R     PP C     PD AWYT L+TCLTPLP+V  SD K
Sbjct  356   QREDLAVWQKPTNHIHCKRNRVVLRRPPFC-HRTLPDQAWYTKLETCLTPLPEVTGSDIK  414

Query  654   E-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
             E     L +WP+RLNAVPPRIK G+++GI+ + F  ++  W +R+++Y    D QL E G
Sbjct  415   EVAGGKLARWPERLNAVPPRIKSGSLEGINEDDFVSNTETWQRRVTYYKR-FDQQLAETG  473

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRN LDMNA LGGFA+ALVD  +WVMNVVP+E+ +NTLGVIYERGLIGTY  WCEAMST
Sbjct  474   RYRNFLDMNAHLGGFASALVDDPVWVMNVVPMEASVNTLGVIYERGLIGTYQNWCEAMST  533

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYD IHADS+F+LYKDRC+MEDILLEMDRILRP+G VIIRDD+DVL KVK+ITD +Q
Sbjct  534   YPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKGGVIIRDDIDVLTKVKKITDAMQ  593

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             WE R+ DHE+GPL+REK+LF VK YWT
Sbjct  594   WEGRIGDHENGPLEREKILFLVKEYWT  620



>ref|XP_002301329.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE80602.1| dehydration-responsive family protein [Populus trichocarpa]
Length=622

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/527 (70%), Positives = 447/527 (85%), Gaps = 7/527 (1%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPCD KYSEYTPCED +RSL +DR+RL+YRERHCP+  E+LKCR+P P+GY+ PF WPE
Sbjct  90    FPPCDPKYSEYTPCEDVDRSLRFDRDRLVYRERHCPESHEILKCRVPPPYGYKMPFSWPE  149

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SR++AWY NVPHK+LTVEK  QNW+R EG+R +FPGGGTMF  GADAYIDDIGKLINLKD
Sbjct  150   SRELAWYANVPHKDLTVEKKNQNWVRVEGERLRFPGGGTMFPRGADAYIDDIGKLINLKD  209

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSRNILT+SFAPRDTH SQVQFALERGVPALIGI+AS RL
Sbjct  210   GSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHVSQVQFALERGVPALIGIIASIRL  269

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS++FDMAHCSRCL+PWGQYDG YLIE+DR+LRPGGYWILSGPPI W+ +W+GW+RT 
Sbjct  270   PYPSRSFDMAHCSRCLVPWGQYDGQYLIEIDRILRPGGYWILSGPPINWETHWKGWNRTR  329

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDM  715
             EDL AEQ+QIE+VA SLCW+K ++ +DIAIWQKP NH+ C   R+    P+   S +PDM
Sbjct  330   EDLRAEQSQIERVAKSLCWRKLVQRNDIAIWQKPTNHVHCKVNRKVFKRPLFCKSQNPDM  389

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++TCLTPLP+V+  +     +L KWP+RLNA+PPRI  G ++G++   F ++S L
Sbjct  390   AWYTKMETCLTPLPEVASIRDIAGGQLAKWPERLNAIPPRISSGGLEGLAANSFVENSEL  449

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y  + D QL + GRYRN+LDMNA LGGFAAALVD  +WVMNVVPV++K+NTLG
Sbjct  450   WKKRVAYYKKI-DYQLAKTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKMNTLG  508

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VI++RGLIGTY  WCEAMSTYPRTYD IHADS+F+LY++RC +EDILLEMDRILRPEGSV
Sbjct  509   VIFQRGLIGTYQNWCEAMSTYPRTYDFIHADSLFSLYENRCGVEDILLEMDRILRPEGSV  568

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVD+L+ VK I D +QW+ R+ DHE  P +REK+LFA K YWT
Sbjct  569   IIRDDVDILLNVKAIMDAMQWDGRITDHESSPHEREKILFATKKYWT  615



>ref|NP_001047721.1| Os02g0675700 [Oryza sativa Japonica Group]
 dbj|BAD29526.1| dehydration-responsive family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF09635.1| Os02g0675700 [Oryza sativa Japonica Group]
 gb|EEE57564.1| hypothetical protein OsJ_07909 [Oryza sativa Japonica Group]
Length=646

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/623 (64%), Positives = 478/623 (77%), Gaps = 9/623 (1%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             +  L +A +A+ C+ SY  G WQ+GG +S ++  S  +   A A T   +  T +     
Sbjct  21    SSFLPIATVALLCSASYFLGAWQHGGFSSPSASPSSVSVATAVACTTTTTATTRSATRPR  80

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNH-DEDSVKVYPPCDVKYSEYTPCEDTERSLAY  1543
              ++ +     LDF+ HH     GAVL +  D  + + Y  C  +YSEYTPCED +RSL Y
Sbjct  81    KRTPAGQGQALDFSAHHAAAADGAVLSSSGDSAATRRYQACPARYSEYTPCEDVKRSLRY  140

Query  1542  DRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQN  1363
              RERL+YRERHCP   E L+C +PAP GYRNPF WP SRDVAW+ NVPHKELTVEKAVQN
Sbjct  141   PRERLVYRERHCPTGRERLRCLVPAPSGYRNPFPWPASRDVAWFANVPHKELTVEKAVQN  200

Query  1362  WIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSR  1183
             WIR +GD+F+FPGGGTMF +GADAYIDDIGKLI L DGS+RTALDTGCGVAS+GAYLLSR
Sbjct  201   WIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPLHDGSVRTALDTGCGVASWGAYLLSR  260

Query  1182  NILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYD  1003
             +IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL YP++AFDMAHCSRCLIPW  YD
Sbjct  261   DILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPARAFDMAHCSRCLIPWHLYD  320

Query  1002  GAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFM  823
             G YLIEVDRVLRPGGYWILSGPPI WK+YW+GW+RT+EDL AEQ  IE VA SLCWKK  
Sbjct  321   GLYLIEVDRVLRPGGYWILSGPPINWKKYWKGWERTKEDLNAEQQAIEAVARSLCWKKIK  380

Query  822   EVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE---  652
             E  DIA+WQKP NH  C   R++ PP C   N PD AWY  ++ C+TPLP+VSD  E   
Sbjct  381   EAGDIAVWQKPANHASCKASRKS-PPFCSHKN-PDAAWYDKMEACVTPLPEVSDASEVAG  438

Query  651   --LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
               L+KWP+RL AVPPRI RG+I G++ + F +D+ LW KRI HY  V++ Q  + GRYRN
Sbjct  439   GALKKWPQRLTAVPPRISRGSIKGVTSKAFVQDTELWRKRIQHYKGVIN-QFEQKGRYRN  497

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             VLDMNA LGGFAAAL    LWVMN+VP     +TLGV+YERGLIG+Y  WCE MSTYPRT
Sbjct  498   VLDMNAGLGGFAAALASDPLWVMNMVPTVGNSSTLGVVYERGLIGSYQDWCEGMSTYPRT  557

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDLIHADS+FTLYK+RCEM+ ILLEMDRILRPEG+VIIRDDVD+L+KVK   DG++W+S+
Sbjct  558   YDLIHADSVFTLYKNRCEMDIILLEMDRILRPEGTVIIRDDVDMLVKVKSAADGMRWDSQ  617

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             +VDHEDGPL REK+L  VKTYWT
Sbjct  618   IVDHEDGPLVREKILLVVKTYWT  640



>ref|XP_010456248.1| PREDICTED: probable methyltransferase PMT15 [Camelina sativa]
Length=644

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/535 (71%), Positives = 451/535 (84%), Gaps = 11/535 (2%)
 Frame = -2

Query  1626  DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNP  1447
             + V    PC V++SEYTPCE   RSL++ RERLIYRERHCP+K E+L+CRIPAPFGY  P
Sbjct  102   ERVTQISPCGVEFSEYTPCEFVNRSLSFPRERLIYRERHCPEKHEMLRCRIPAPFGYSVP  161

Query  1446  FKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKL  1267
             F+WPESRDVAW+ NVPH ELTVEK  QNW+R++ DRF FPGGGTMF  GADAYID+IG+L
Sbjct  162   FRWPESRDVAWFANVPHTELTVEKKNQNWVRYDKDRFLFPGGGTMFPRGADAYIDEIGRL  221

Query  1266  INLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGIL  1087
             INLKDGSIRTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA+IG+L
Sbjct  222   INLKDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAIIGVL  281

Query  1086  ASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQG  907
             AS RLP+P++AFD+AHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPPI W+R+W+G
Sbjct  282   ASIRLPFPARAFDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRHWKG  341

Query  906   WDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPA  733
             W+RT++DL +EQ+QIE+VA SLCWKK ++ +D+A+WQKP NH+ C R R     PP C  
Sbjct  342   WERTKDDLNSEQSQIERVARSLCWKKLVQREDLAVWQKPTNHIHCKRNRVVLRRPPFC-H  400

Query  732   SNDPDMAWYTDLQTCLTPLPQV--SDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGE  574
                PD AWYT L+TCLTPLP+V  SD KE     L +WP+RLNAVPPRIK G+++GI+ +
Sbjct  401   RTLPDQAWYTKLETCLTPLPEVTGSDIKEVAGGKLARWPERLNAVPPRIKSGSLEGINED  460

Query  573   KFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPV  394
              F  ++  W +R+++Y    D QL E GRYRN LDMNA LGGFA+ALVD  +WVMNVVP+
Sbjct  461   DFVSNTETWQRRVTYYKR-FDQQLAETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPM  519

Query  393   ESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDR  214
             E+ +NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LYKDRC+MEDILLEMDR
Sbjct  520   EASVNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDR  579

Query  213   ILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ILRP+G VIIRDD+DVL KVK+ITD +QWE R+ DHE+GPL+REK+LF VK YWT
Sbjct  580   ILRPKGGVIIRDDIDVLTKVKKITDAMQWEGRIGDHENGPLEREKILFLVKEYWT  634



>ref|NP_001053603.1| Os04g0570800 [Oryza sativa Japonica Group]
 emb|CAD41579.3| OSJNBa0088I22.11 [Oryza sativa Japonica Group]
 dbj|BAF15517.1| Os04g0570800 [Oryza sativa Japonica Group]
 gb|EAY95218.1| hypothetical protein OsI_17036 [Oryza sativa Indica Group]
 dbj|BAG91550.1| unnamed protein product [Oryza sativa Japonica Group]
Length=646

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/625 (64%), Positives = 473/625 (76%), Gaps = 16/625 (3%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIAT-AKTCLFSGNtattlsstt  1717
             L +LA +A+ CT+SY  G W +GG ++  +     +  IAT A     S           
Sbjct  22    LFHLAAVAVLCTVSYLIGIWHHGGFSASPAGGVASSVSIATTASVSCVSPTPTLLGGGGG  81

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                SS SA LDF  HH         G       + Y  C  KYSEYTPCED ERSL + R
Sbjct  82    GGDSSSSAPLDFAAHHTAEGMEVASGQVH----RTYEACPAKYSEYTPCEDVERSLRFPR  137

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             +RL+YRERHCP + E L+C +PAP GYRNPF WP SRDVAW+ NVPHKELTVEKAVQNWI
Sbjct  138   DRLVYRERHCPSEGERLRCLVPAPQGYRNPFPWPTSRDVAWFANVPHKELTVEKAVQNWI  197

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R EG++F+FPGGGTMF +GA AYIDDIGK+I L DGSIRTALDTGCGVAS+GAYLLSRNI
Sbjct  198   RVEGEKFRFPGGGTMFPHGAGAYIDDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNI  257

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             L MSFAPRD+H++QVQFALERGVPA+IG+L+S RL YP++AFDMAHCSRCLIPW  YDG 
Sbjct  258   LAMSFAPRDSHEAQVQFALERGVPAMIGVLSSNRLTYPARAFDMAHCSRCLIPWQLYDGL  317

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFM--  823
             YL EVDR+LRPGGYWILSGPPI WK++W+GW RT+EDL AEQ  IE VA SLCWKK    
Sbjct  318   YLAEVDRILRPGGYWILSGPPINWKKHWKGWQRTKEDLNAEQQAIEAVAKSLCWKKITLK  377

Query  822   EVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-  652
             EV DIAIWQKP NH+ C   R+    PP C ++ +PD AWY  ++ C+TPLP+VSD KE 
Sbjct  378   EVGDIAIWQKPTNHIHCKASRKVVKSPPFC-SNKNPDAAWYDKMEACITPLPEVSDIKEI  436

Query  651   ----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRY  484
                 L+KWP+RL AVPPRI  G+I+G++ E F +D+ LW KR+ HY +V+  Q  + GRY
Sbjct  437   AGGQLKKWPERLTAVPPRIASGSIEGVTDEMFVEDTKLWQKRVGHYKSVIS-QFGQKGRY  495

Query  483   RNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYP  304
             RN+LDMNA  GGFAAALVD  +WVMN+VP      TLGVIYERGLIG+Y  WCE MSTYP
Sbjct  496   RNLLDMNARFGGFAAALVDDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYP  555

Query  303   RTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWE  124
             RTYDLIHADS+FTLYKDRC+M++ILLEMDRILRPEG+VIIRDDVD+L+K+K ITDG++W 
Sbjct  556   RTYDLIHADSVFTLYKDRCQMDNILLEMDRILRPEGTVIIRDDVDMLVKIKSITDGMRWN  615

Query  123   SRVVDHEDGPLQREKLLFAVKTYWT  49
             S++VDHEDGPL REKLL  VKTYWT
Sbjct  616   SQIVDHEDGPLVREKLLLVVKTYWT  640



>ref|XP_002875017.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51276.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/533 (70%), Positives = 447/533 (84%), Gaps = 11/533 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V   P C V++SEYTPCE   RSL + RERLIYRERHCPKK E+L+CRIPAP+GY   F+
Sbjct  93    VAQIPSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPKKHEILRCRIPAPYGYTVSFR  152

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESRDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYID+IG+LIN
Sbjct  153   WPESRDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLIN  212

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L+DGSIRTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA+IG+LAS
Sbjct  213   LRDGSIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAIIGVLAS  272

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLP+P++AFD+AHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPPI W+R+W+GW+
Sbjct  273   IRLPFPARAFDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRHWKGWE  332

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT +DL +EQ+QIE+VA SLCWKK ++ +D+A+WQKP NH+ C R R A   PP C    
Sbjct  333   RTRDDLNSEQSQIERVARSLCWKKLVQREDLAVWQKPTNHIHCKRNRIALRRPPFC-HQT  391

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-------ELEKWPKRLNAVPPRIKRGTIDGISGEKF  568
              PD AWYT L+TCLTPLP+V+  +       +L +WP+RLNAVPPRIK G+++GI+ +  
Sbjct  392   LPDQAWYTKLETCLTPLPEVTGSEIKEVAGGQLARWPERLNAVPPRIKSGSLEGITEDDL  451

Query  567   EKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVES  388
               ++  W +R+S+Y    D QL E GRYRN+LDMNA LGGFA+ALVD  +WVMNVVPVE+
Sbjct  452   VSNTETWQRRVSYYKK-YDQQLAETGRYRNLLDMNAHLGGFASALVDDPVWVMNVVPVEA  510

Query  387   KLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRIL  208
              +NTLGVIYERGLIGTY  WCE+MSTYPRTYD IHADS+F+LYKDRC+MEDILLEMDRIL
Sbjct  511   SVNTLGVIYERGLIGTYQNWCESMSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRIL  570

Query  207   RPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RP+GSVIIRDD+DVL K K+ITD +QWE R+ DHE+GPL+REK+LF VK YWT
Sbjct  571   RPKGSVIIRDDIDVLTKAKKITDAMQWEGRIGDHENGPLEREKILFLVKEYWT  623



>ref|XP_004510859.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=644

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/638 (62%), Positives = 474/638 (74%), Gaps = 28/638 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLL---YLALLAIF-CTLSYHFGTWQNgggasgtsissiftAKIATAKTCL  1756
             H + S  +N LL   Y  + A F CT  Y  G W +    +  S +   TA +A A T  
Sbjct  15    HNFKSKKSNILLTNLYFLIFATFLCTFFYLLGLWHHYPSTTVISATGYSTASVAGATTLC  74

Query  1755  FSGNtattlssttqslsshsAGLDFtthhgdgdg--GAVLGNHDEDSVKVYPPCDVKYSE  1582
             F  N  TT  S++         +DF   H   +       G H       +PPCD    E
Sbjct  75    FHRNNTTTAESSSDK-------IDFAAGHYLHESPPTEARGPH-------FPPCDPSLYE  120

Query  1581  YTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNV  1402
             YTPCED+ RS  + R R +YRERHCP   E+L+CRIPAP GYR P +WPESRD  WY NV
Sbjct  121   YTPCEDSTRSSKFSRNRQVYRERHCPAPKEILRCRIPAPLGYRLPLRWPESRDSTWYANV  180

Query  1401  PHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTG  1222
             PHKEL+VEK  QNWIR EG+RFKFPGGGT FR GA AYIDDIGKLINLKDGSIRTA+DTG
Sbjct  181   PHKELSVEKKKQNWIRLEGNRFKFPGGGTTFRRGASAYIDDIGKLINLKDGSIRTAVDTG  240

Query  1221  CGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMA  1042
             CGVAS+G YLLSRNILT+SFAPRDTH++QVQFALERGVPALIGI+AS RLPYPS+AFDMA
Sbjct  241   CGVASWGGYLLSRNILTVSFAPRDTHEAQVQFALERGVPALIGIIASIRLPYPSRAFDMA  300

Query  1041  HCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQI  862
             HCSRCLIPW  YDG YL EVDRVLRPGGYWILSGPPI W+++W+GW+RT+E L  EQ  I
Sbjct  301   HCSRCLIPWANYDGLYLTEVDRVLRPGGYWILSGPPINWQKHWKGWERTKESLNDEQEGI  360

Query  861   EKVADSLCWKKFMEVDDIAIWQKPYNHMDC-IRLRQ-APPPMCPASNDPDMAWYTDLQTC  688
             E VA SLCWKK ++ DD+AIWQKP NH  C I+++     P C  + DPDMAWYT L TC
Sbjct  361   ENVAKSLCWKKLIQKDDLAIWQKPTNHAHCKIKIKMFKSRPFCDEAQDPDMAWYTKLDTC  420

Query  687   LTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYS  523
             LTPLP+V++ K     EL KWPKRL ++PPRI   ++ GI+ E F +++ LW KR++HY 
Sbjct  421   LTPLPEVNNIKEVAGGELSKWPKRLTSIPPRISSESLKGITAEMFIENTELWKKRVAHYK  480

Query  522   AVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIG  343
               +D QL E+GRYRN+LDMN++LGGFAAAL+D  +WVMNVVPVE+++NTLGVIYERGLIG
Sbjct  481   -TLDHQLAESGRYRNLLDMNSYLGGFAAALIDDPVWVMNVVPVEAEINTLGVIYERGLIG  539

Query  342   TYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVL  163
             TY  WCEAMSTYPRTYD +H DS+F+LY++RC ME+ILLEMDRILRP+GS+I+RDDVDVL
Sbjct  540   TYQNWCEAMSTYPRTYDFLHGDSVFSLYQNRCSMENILLEMDRILRPQGSIILRDDVDVL  599

Query  162   IKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              KVK I D +QW++R+ DHE GP QREK+L AVK YWT
Sbjct  600   TKVKSIADEMQWDARITDHEYGPYQREKILVAVKQYWT  637



>ref|NP_191984.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
 sp|Q9ZPH9.1|PMTF_ARATH RecName: Full=Probable methyltransferase PMT15 [Arabidopsis thaliana]
 gb|AAD17339.1| F15P23.1 gene product [Arabidopsis thaliana]
 emb|CAB80884.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81929.1| putative methyltransferase PMT15 [Arabidopsis thaliana]
Length=633

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/529 (70%), Positives = 448/529 (85%), Gaps = 11/529 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P C V++SEYTPCE   RSL + RERLIYRERHCP+K E+++CRIPAP+GY  PF+WPES
Sbjct  97    PSCGVEFSEYTPCEFVNRSLNFPRERLIYRERHCPEKHEIVRCRIPAPYGYSLPFRWPES  156

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYID+IG+LINLKDG
Sbjct  157   RDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIDEIGRLINLKDG  216

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA+IG+LAS RLP
Sbjct  217   SIRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAIIGVLASIRLP  276

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             +P++AFD+AHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPPI W+R+W+GW+RT +
Sbjct  277   FPARAFDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRHWKGWERTRD  336

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL +EQ+QIE+VA SLCW+K ++ +D+A+WQKP NH+ C R R A   PP C     P+ 
Sbjct  337   DLNSEQSQIERVARSLCWRKLVQREDLAVWQKPTNHVHCKRNRIALGRPPFC-HRTLPNQ  395

Query  714   AWYTDLQTCLTPLPQVSDEK-------ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
              WYT L+TCLTPLP+V+  +       +L +WP+RLNA+PPRIK G+++GI+ ++F  ++
Sbjct  396   GWYTKLETCLTPLPEVTGSEIKEVAGGQLARWPERLNALPPRIKSGSLEGITEDEFVSNT  455

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
               W +R+S+Y    D QL E GRYRN LDMNA LGGFA+ALVD  +WVMNVVPVE+ +NT
Sbjct  456   EKWQRRVSYYKK-YDQQLAETGRYRNFLDMNAHLGGFASALVDDPVWVMNVVPVEASVNT  514

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LYKDRC+MEDILLEMDRILRP+G
Sbjct  515   LGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKDRCDMEDILLEMDRILRPKG  574

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDD+DVL KVK+ITD +QWE R+ DHE+GPL+REK+LF VK YWT
Sbjct  575   SVIIRDDIDVLTKVKKITDAMQWEGRIGDHENGPLEREKILFLVKEYWT  623



>gb|EEC73773.1| hypothetical protein OsI_08448 [Oryza sativa Indica Group]
Length=646

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/623 (64%), Positives = 478/623 (77%), Gaps = 9/623 (1%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             +  L +A +A+ C+ SY  G WQ+GG +S ++  S  +   A A T   +  T +     
Sbjct  21    SSFLPIATVALLCSASYFLGAWQHGGFSSPSASPSSVSVATAVACTTTTTATTRSATRPR  80

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNH-DEDSVKVYPPCDVKYSEYTPCEDTERSLAY  1543
              ++ +     LDF+ HH     GAVL +  D  + + Y  C  +YSEYTPCED +RSL Y
Sbjct  81    KRTPAGQGQALDFSAHHAAAADGAVLSSSGDSAATRRYQACPARYSEYTPCEDVKRSLRY  140

Query  1542  DRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQN  1363
              RERL+YRERHCP   E L+C +PAP GYRNPF WP SRDVAW+ NVPHKELTVEKAVQN
Sbjct  141   PRERLVYRERHCPTGRERLRCLVPAPSGYRNPFPWPASRDVAWFANVPHKELTVEKAVQN  200

Query  1362  WIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSR  1183
             WIR +GD+F+FPGGGTMF +GADAYIDDIGKLI L DGS+RTALDTGCGVAS+GAYLLSR
Sbjct  201   WIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPLHDGSVRTALDTGCGVASWGAYLLSR  260

Query  1182  NILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYD  1003
             +IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL YP++AFDMAHCSRCLIPW  YD
Sbjct  261   DILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPARAFDMAHCSRCLIPWHLYD  320

Query  1002  GAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFM  823
             G YLIEVDRVLRPGGYWILSGPPI WK+YW+GW+RT+EDL AEQ  IE VA SLCWKK  
Sbjct  321   GLYLIEVDRVLRPGGYWILSGPPINWKKYWKGWERTKEDLNAEQQAIEAVARSLCWKKIK  380

Query  822   EVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE---  652
             E  DIA+WQKP NH  C   R++ PP C   N PD AWY  ++ C+TPLP+VSD  +   
Sbjct  381   EAGDIAVWQKPANHASCKASRKS-PPFCSHKN-PDAAWYDKMEVCVTPLPEVSDASKVAG  438

Query  651   --LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
               L+KWP+RL AVPPRI RG+I G++ + F +D+ LW KR+ HY  V++ Q  + GRYRN
Sbjct  439   GALKKWPQRLTAVPPRISRGSIKGVTSKAFVQDTELWRKRVQHYKGVIN-QFEQKGRYRN  497

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             VLDMNA LGGFAAAL    LWVMN+VP     +TLGV+YERGLIG+Y  WCE MSTYPRT
Sbjct  498   VLDMNAGLGGFAAALASDPLWVMNMVPTVGNSSTLGVVYERGLIGSYQDWCEGMSTYPRT  557

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDLIHADS+FTLYK+RCEM+ ILLEMDRILRPEG+VIIRDDVD+L+KVK   DG++W+S+
Sbjct  558   YDLIHADSVFTLYKNRCEMDIILLEMDRILRPEGTVIIRDDVDMLVKVKSAADGMRWDSQ  617

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             +VDHEDGPL REK+L  VKTYWT
Sbjct  618   IVDHEDGPLVREKILLVVKTYWT  640



>ref|XP_003555372.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=600

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/539 (70%), Positives = 445/539 (83%), Gaps = 14/539 (3%)
 Frame = -2

Query  1638  NH-DEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPF  1462
             NH   +S K +P C   +SEYTPC D +RSL Y R R IY+ERHCP+  E LKCR+PAP 
Sbjct  58    NHFSAESSKTFPRCSANFSEYTPCHDPQRSLRYKRSRKIYKERHCPE--EPLKCRVPAPH  115

Query  1461  GYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYID  1282
             GYRNPF WP SRD AW+ NVPH+ELTVEKAVQNWIR +GDRF FPGGGT F NGADAYI+
Sbjct  116   GYRNPFPWPASRDRAWFANVPHRELTVEKAVQNWIRSDGDRFVFPGGGTTFPNGADAYIE  175

Query  1281  DIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPA  1102
             DIG LINLKDGSIRTALDTGCGVAS+GAYLLSRNILT+S APRDTH++QVQFALERGVPA
Sbjct  176   DIGMLINLKDGSIRTALDTGCGVASWGAYLLSRNILTLSIAPRDTHEAQVQFALERGVPA  235

Query  1101  LIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWK  922
              IGILA+KRLP+PS+AFD++HCSRCLIPW +YDG +L EVDR LRPGGYWILSGPPI WK
Sbjct  236   FIGILATKRLPFPSRAFDISHCSRCLIPWAEYDGIFLNEVDRFLRPGGYWILSGPPINWK  295

Query  921   RYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCI---RLRQAP  751
             +YW+GW R +E+L  EQT+IEKVA SLCW K +E DDIAIWQKP NH+DC    +L Q  
Sbjct  296   KYWKGWQRKKEELNEEQTKIEKVAKSLCWNKLVEKDDIAIWQKPKNHLDCKANHKLTQN-  354

Query  750   PPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDG  586
                C A NDPD AWYT++QTCL+P+P VS ++E     ++ WPKRL ++PPRI +GTI+G
Sbjct  355   RSFCNAQNDPDKAWYTNMQTCLSPVPVVSSKEETAGGVVDNWPKRLKSIPPRIYKGTIEG  414

Query  585   ISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMN  406
             ++ E + K+  LW KR+SHY  V    L+   RYRN+LDMNA+LGGFAAAL++  +WVMN
Sbjct  415   VTAETYSKNYELWKKRVSHYKTV--NNLLGTERYRNLLDMNAYLGGFAAALIEDPVWVMN  472

Query  405   VVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILL  226
             VVPV++K+NTLG IYERGLIG YH WCEAMSTYPRTYDLIHADS+F+LY +RCE+EDILL
Sbjct  473   VVPVQAKVNTLGAIYERGLIGIYHDWCEAMSTYPRTYDLIHADSVFSLYSNRCELEDILL  532

Query  225   EMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EMDRILRPEG VIIRDD D+L+KVK I +GL+W+S +VDHEDGPLQREKLLFA+K YWT
Sbjct  533   EMDRILRPEGCVIIRDDADILVKVKSIVNGLEWDSIIVDHEDGPLQREKLLFAMKKYWT  591



>emb|CDY18904.1| BnaC04g04460D [Brassica napus]
Length=633

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/631 (62%), Positives = 469/631 (74%), Gaps = 41/631 (6%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN       +  +        A  C             
Sbjct  15    SNLYYVTLVAVLCVGSYLLGVWQNSTVNPRAAFDTS-----TDAPPC------------E  57

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV----YPPCDVKYSEYTPCEDTERS  1552
               S ++ +  LDF          A    HD     V    +P CD   SE+TPCED +RS
Sbjct  58    KFSKTTSATDLDFN---------AHHNPHDPPPSTVTAVSFPSCDAALSEHTPCEDAKRS  108

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L + RERL YR+RHCP++ E LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK 
Sbjct  109   LKFSRERLEYRQRHCPEREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKK  168

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
              QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYL
Sbjct  169   NQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYL  228

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             LSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWG
Sbjct  229   LSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWG  288

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             + DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL  EQTQIE+VA SLCWK
Sbjct  289   KNDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNEEQTQIEQVARSLCWK  348

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K ++ DD+AIWQKP+NH+ C ++RQ    P  C    DPDMAWYT +++CLTPLP+V + 
Sbjct  349   KVVQRDDLAIWQKPFNHIHCKKMRQVLKNPEFCRYDQDPDMAWYTKMESCLTPLPEVDEA  408

Query  657   KE--------LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
             ++        LEKWP RLNAVPPR+  G +  I+ E F +D+ LW +R+S+Y   +D QL
Sbjct  409   EDLKTVAGGKLEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKK-LDYQL  467

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA+LGGFAAAL D  +WVMNVVPVE+K NTLGVIYERGLIGTY  WCE
Sbjct  468   GETGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCE  527

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDR+LRP G VIIRDDVDVLIKVK ++
Sbjct  528   AMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELS  587

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G QW+ R+ DHE GP +R K+ +AVK YWT
Sbjct  588   KGFQWQGRIADHEKGPHERVKIYYAVKQYWT  618



>ref|XP_009128495.1| PREDICTED: probable methyltransferase PMT15 [Brassica rapa]
Length=665

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/529 (70%), Positives = 445/529 (84%), Gaps = 11/529 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P C V++SEYTPCE   RSL++ R+RLIYRERHCP K E+L+CRIPAP+GY  PF+WPES
Sbjct  133   PSCGVEFSEYTPCESVSRSLSFPRDRLIYRERHCPSKDEILRCRIPAPYGYSVPFRWPES  192

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYI +IG+LINLKDG
Sbjct  193   RDVAWFANVPHTELTVEKKNQNWVRYEKDRFLFPGGGTMFPRGADAYIGEIGRLINLKDG  252

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             S+RTA+DTGCGVASFGAYL+SRNI+TMSFAPRDTH++QVQFALERGVPA++G+LAS RLP
Sbjct  253   SVRTAIDTGCGVASFGAYLMSRNIVTMSFAPRDTHEAQVQFALERGVPAILGVLASIRLP  312

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             +P++AFD+AHCSRCLIPWGQY+G YLIEVDRVLRPGGYWILSGPPI W+R W+GW+RT++
Sbjct  313   FPARAFDIAHCSRCLIPWGQYNGTYLIEVDRVLRPGGYWILSGPPINWQRQWRGWERTKD  372

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL +EQ+QIE+VA SLCWKK  + +D+A+WQKP NH+ C R R A   PP C     PD 
Sbjct  373   DLNSEQSQIERVARSLCWKKLAQREDLAVWQKPTNHIHCKRNRIALRRPPFC-HRTQPDH  431

Query  714   AWYTDLQTCLTPLPQVSDEK-------ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             AWYT L+ CLTPLP+V+  +       +L +WP+RLNAVPPRIK G++ GI+ + F  ++
Sbjct  432   AWYTKLEQCLTPLPEVTGTEIKEVAGGKLARWPERLNAVPPRIKSGSLQGITVDDFVSNT  491

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
               W  R+S+Y  + D QL E GRYRN+LDMNA+LGGFA+ALVD  +WVMNVVPVE+ +NT
Sbjct  492   ETWQTRVSYYK-IFDQQLAETGRYRNLLDMNAYLGGFASALVDDPVWVMNVVPVEASVNT  550

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERGL+GTY  WCEAMSTYPRTYD IHADS+F+LYK RC+MEDILLEMDRILRP+G
Sbjct  551   LGVIYERGLVGTYQNWCEAMSTYPRTYDFIHADSVFSLYKHRCDMEDILLEMDRILRPKG  610

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             SVIIRDD+DVL KVK++TDG+QWE R+ DHE GPL+REK+LF VK YWT
Sbjct  611   SVIIRDDIDVLTKVKKVTDGMQWEGRIGDHEKGPLEREKILFLVKEYWT  659



>ref|XP_002880195.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56454.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/627 (63%), Positives = 473/627 (75%), Gaps = 34/627 (5%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN                  TA     + + +      
Sbjct  14    SNLYYVTLVALLCIGSYLLGIWQN------------------TAVNPRAAFDDSDGTPCE  55

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
               +    +  LDF  HH   D   V      ++   +P C  + SE+TPCED +RSL + 
Sbjct  56    QFTRPDSTKDLDFDAHHNIQDPPPVT-----ETAVNFPSCGAELSEHTPCEDAKRSLIFA  110

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             RERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK  QNW
Sbjct  111   RERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  170

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             +R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYLLSRN
Sbjct  171   VRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRN  230

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             I TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ DG
Sbjct  231   ITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQNDG  290

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
             AYL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL AEQTQIE+VA SLCWKK ++
Sbjct  291   AYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNAEQTQIEQVARSLCWKKVVQ  350

Query  819   VDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKEL-  649
              DD+AIWQKPYNH+ C + RQ    P  C    DPDMAWYT + +CLTPLP+V D ++L 
Sbjct  351   RDDLAIWQKPYNHIHCKKTRQVLKNPEFCRRDQDPDMAWYTKMDSCLTPLPEVDDAEDLK  410

Query  648   -------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
                    EKWP RLNAVPPR+ +G +  I+   F +++ LW +R+S+Y   +D QL E G
Sbjct  411   TVAGGKVEKWPARLNAVPPRVNKGDLKEITPAAFLENTKLWKQRVSYYKK-LDYQLGETG  469

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRN++DMNA+LGGFAAALVD  +WVMN+VPVE+KLNTL VIYERGLIGTY  WCEAMST
Sbjct  470   RYRNLVDMNAYLGGFAAALVDDPVWVMNIVPVEAKLNTLSVIYERGLIGTYQNWCEAMST  529

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYD IHADS+FTLY+ +C+ E+ILLEMDRILRP G VIIRDDVDVLIKVK +T GL+
Sbjct  530   YPRTYDFIHADSVFTLYQGKCKPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKGLE  589

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             WE R+ DHE GP +REK+ +AVK YWT
Sbjct  590   WEGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_011023413.1| PREDICTED: probable methyltransferase PMT15 [Populus euphratica]
Length=623

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/527 (70%), Positives = 444/527 (84%), Gaps = 7/527 (1%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC+ KYSEYTPCED ERS+ +DR R+IYRERHCP+  E+LKCR+P P+GY+ PF WPE
Sbjct  91    FPPCEPKYSEYTPCEDAERSVRFDRNRVIYRERHCPESHEILKCRVPPPYGYKVPFSWPE  150

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AWY NVPHK+LTVEK  QNW+R EG+R +FPGGGTMF  GADAYIDDIGKLINLKD
Sbjct  151   SRDWAWYANVPHKDLTVEKKNQNWVRVEGERLRFPGGGTMFPRGADAYIDDIGKLINLKD  210

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLLSRNILT+SFAPRDTH SQVQFALERGVPALIGI+AS RL
Sbjct  211   GSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHVSQVQFALERGVPALIGIIASIRL  270

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS++FDMAHCSRCLIPWGQYDG YLIE+DR+LRPGGYWILSGPPI W+ +W+GW+RT 
Sbjct  271   PYPSRSFDMAHCSRCLIPWGQYDGQYLIEIDRILRPGGYWILSGPPINWETHWKGWNRTR  330

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PPPMCPASNDPDM  715
             EDL AEQTQIE+VA SLCW+K ++ +DIAIWQKP NH+ C   R+    P+   S +PDM
Sbjct  331   EDLRAEQTQIERVAKSLCWRKLVQRNDIAIWQKPTNHVHCKVNRKVFKRPLFCKSKNPDM  390

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++TCLTPLP+V+  +     +L KWP+RLNA+PPRI  G+++G++   F ++S L
Sbjct  391   AWYTKMETCLTPLPEVASIRDIAGGQLAKWPERLNAIPPRISSGSLEGLTANSFVENSEL  450

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y  + D QL + GRYRN+LDMNA LGGFAAALVD  +WVMNVVPV++K+NTLG
Sbjct  451   WKKRVAYYKKI-DCQLAKTGRYRNLLDMNAHLGGFAAALVDDPVWVMNVVPVQAKMNTLG  509

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VI++RGL GTY  WCEAMSTYPRTYD IHADS+F+LY++RC +EDILLEMDRILRPEGSV
Sbjct  510   VIFQRGLTGTYQNWCEAMSTYPRTYDFIHADSLFSLYENRCGVEDILLEMDRILRPEGSV  569

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDV +L+ VK I D +QW+ R+ DHE  P +REK+LFA K YWT
Sbjct  570   IIRDDVVILLNVKAIVDAMQWDGRITDHESSPHEREKILFATKKYWT  616



>ref|XP_009143165.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/631 (62%), Positives = 467/631 (74%), Gaps = 41/631 (6%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN       +  +        A  C             
Sbjct  14    SNLYYITLVAVLCIGSYLLGVWQNTTVNPRAAFDTS-----TDAPPC------------E  56

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV----YPPCDVKYSEYTPCEDTERS  1552
               S ++ +  LDF          A    HD     V    +P CD   SE+TPCED +RS
Sbjct  57    KFSKTTSTTDLDFN---------AHHNPHDPPPSTVTAVSFPSCDAALSEHTPCEDAKRS  107

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L + RERL YR+RHCP + E LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK 
Sbjct  108   LKFSRERLEYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKK  167

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
              QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYL
Sbjct  168   NQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYL  227

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             LSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWG
Sbjct  228   LSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWG  287

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             + DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL  EQTQIE+VA SLCWK
Sbjct  288   KNDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNEEQTQIEQVARSLCWK  347

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K ++ DD+AIWQKP+NH+ C ++RQ    P  C    DPDMAWYT + +CLTPLP+V + 
Sbjct  348   KVVQRDDLAIWQKPFNHIHCKKMRQVLKNPEFCRYDQDPDMAWYTKMDSCLTPLPEVDES  407

Query  657   KEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
             ++L        EKWP RLNAVPPR+  G +  I+ E F +D+ LW +R+S+Y   +D QL
Sbjct  408   EDLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKK-LDYQL  466

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA+LGGFAAAL D  +WVMNVVPVE+K NTLGVIYERGLIGTY  WCE
Sbjct  467   GETGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCE  526

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDR+LRP G VIIRDDVDVLIKVK ++
Sbjct  527   AMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELS  586

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G QW+ R+ DHE GP +R K+ +AVK YWT
Sbjct  587   KGFQWQGRIADHEKGPHERVKIYYAVKQYWT  617



>emb|CDX74761.1| BnaA05g05070D [Brassica napus]
Length=632

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/631 (62%), Positives = 467/631 (74%), Gaps = 41/631 (6%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN       +  +        A  C             
Sbjct  14    SNLYYITLVAVLCIGSYLLGVWQNTTVNPRAAFDTS-----TDAPPC------------E  56

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV----YPPCDVKYSEYTPCEDTERS  1552
               S ++ +  LDF          A    HD     V    +P CD   SE+TPCED +RS
Sbjct  57    KFSKTTSTTDLDFN---------AHHNPHDPPPSAVTAVSFPSCDAALSEHTPCEDAKRS  107

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L + RERL YR+RHCP + E LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK 
Sbjct  108   LKFSRERLEYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKK  167

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
              QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYL
Sbjct  168   NQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYL  227

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             LSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWG
Sbjct  228   LSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWG  287

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             + DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL  EQTQIE+VA SLCWK
Sbjct  288   KNDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNEEQTQIEQVARSLCWK  347

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K ++ DD+AIWQKP+NH+ C ++RQ    P  C    DPDMAWYT + +CLTPLP+V + 
Sbjct  348   KVVQRDDLAIWQKPFNHIHCKKMRQVLKNPEFCRYDQDPDMAWYTKMDSCLTPLPEVDES  407

Query  657   KEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
             ++L        EKWP RLNAVPPR+  G +  I+ E F +D+ LW +R+S+Y   +D QL
Sbjct  408   EDLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKK-LDYQL  466

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA+LGGFAAAL D  +WVMNVVPVE+K NTLGVIYERGLIGTY  WCE
Sbjct  467   GETGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCE  526

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDR+LRP G VIIRDDVDVLIKVK ++
Sbjct  527   AMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELS  586

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G QW+ R+ DHE GP +R K+ +AVK YWT
Sbjct  587   KGFQWQGRIADHEKGPHERVKIYYAVKQYWT  617



>emb|CDY37061.1| BnaA04g26390D [Brassica napus]
Length=628

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/638 (63%), Positives = 470/638 (74%), Gaps = 45/638 (7%)
 Frame = -2

Query  1911  SSPNNK---LLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNt  1741
             +SP +K   L Y+ L+ + C  SY  G W+                 I  A     SG  
Sbjct  7     TSPRDKKSNLYYITLIGLLCIASYLLGIWRTSSV-------------IPRAAFDYSSG--  51

Query  1740  attlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV----YPPCDVKYSEYTP  1573
                      S +  +  LDF          A    HD   VK     +P C  K SE+TP
Sbjct  52    ---PPCEKFSKTISTRDLDFN---------AHHNPHDPPPVKAVAVSFPSCGAKLSEHTP  99

Query  1572  CEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHK  1393
             CED +RSL + R+RL YR+RHCP++ EVLKCRIPAP+GY+ PF+WPESRDVAW+ NVPH 
Sbjct  100   CEDAKRSLKFPRKRLEYRQRHCPEREEVLKCRIPAPYGYKTPFRWPESRDVAWFANVPHT  159

Query  1392  ELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGV  1213
             ELTVEK  QNW+R+E DRF FPGGGTMF +GADAYIDDIG+LI+L DGSIRTA+DTGCGV
Sbjct  160   ELTVEKKNQNWVRYENDRFWFPGGGTMFPSGADAYIDDIGRLIDLSDGSIRTAIDTGCGV  219

Query  1212  ASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCS  1033
             ASFGAYLLSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCS
Sbjct  220   ASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCS  279

Query  1032  RCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKV  853
             RCLIPWGQ  G YL+EVDRVLRPGGYWILSGPPI W+  W+GW+RT +DL AEQTQIE+V
Sbjct  280   RCLIPWGQNGGVYLMEVDRVLRPGGYWILSGPPINWQNRWKGWERTMDDLNAEQTQIEQV  339

Query  852   ADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTP  679
             A SLCWKK ++ DD+AIWQKP+NH+ C + RQ    P  C    DPDMAWYT + +CLTP
Sbjct  340   ARSLCWKKVVQRDDLAIWQKPFNHVHCKKTRQVLKKPKFCRHDQDPDMAWYTKMDSCLTP  399

Query  678   LPQVSDEKEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYS  523
             LP+V + ++L        EKWP RLNAVPPRI  G +  I+ E F  D+ LW +R+S+Y 
Sbjct  400   LPEVDEAEDLKTVAGGKVEKWPTRLNAVPPRINTGDLKEITPEGFLGDTKLWKQRVSYYK  459

Query  522   AVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIG  343
               +D QL E GRYRN+LDMNA++GGFAAAL D  +WVMNVVPVE+KLNTLGVIYERGLIG
Sbjct  460   -TLDYQLGETGRYRNILDMNAYVGGFAAALADEPVWVMNVVPVEAKLNTLGVIYERGLIG  518

Query  342   TYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVL  163
             TY  WCEAMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDRILRP G VIIRDDVDVL
Sbjct  519   TYQNWCEAMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRILRPGGGVIIRDDVDVL  578

Query  162   IKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IKVK +T GLQWE R+ DHE  P +R K+ +AVK YWT
Sbjct  579   IKVKELTKGLQWEGRIADHEKSPHERVKIYYAVKQYWT  616



>ref|XP_006397756.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
 gb|ESQ39209.1| hypothetical protein EUTSA_v10001358mg [Eutrema salsugineum]
Length=632

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/531 (70%), Positives = 439/531 (83%), Gaps = 11/531 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +P CD + SE TPCED +RSL + RERL YR+RHCP++ E LKCRIPAP+GY+ PF+WPE
Sbjct  88    FPSCDAELSENTPCEDAKRSLKFPRERLEYRQRHCPERDETLKCRIPAPYGYKTPFRWPE  147

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L D
Sbjct  148   SRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSD  207

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVASFGAYLLSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RL
Sbjct  208   GSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRL  267

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFD+AHCSRCLIPWGQ DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT 
Sbjct  268   PYPSRAFDLAHCSRCLIPWGQNDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTM  327

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPD  718
             +DL AEQTQIE+VA SLCWKK  + DD+AIWQKPYNH+ C + RQ    P  C    DPD
Sbjct  328   DDLNAEQTQIERVARSLCWKKVFQRDDLAIWQKPYNHIHCKKTRQVLKNPEFCRHDQDPD  387

Query  717   MAWYTDLQTCLTPLPQVSDEKEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             MAWYT + +CLTPLP+V + ++L        EKWP RLNAVPPR+  G ++ I+ E F +
Sbjct  388   MAWYTKMDSCLTPLPEVDEAEDLKTVAGGKVEKWPARLNAVPPRVNSGDLEEITPEAFLE  447

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             ++ LW +R+++Y   +D  L E GRYRN+LDMNA+LGGFAAAL D  +WVMNVVPVE+KL
Sbjct  448   NTKLWKQRVNYYKQ-LDYHLGETGRYRNLLDMNAYLGGFAAALADDPVWVMNVVPVEAKL  506

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LY+D+CE EDILLEMDRILRP
Sbjct  507   NTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYQDKCEPEDILLEMDRILRP  566

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G VIIRDDVD+LIKVK +T GLQWE R+ DHE GP +R K+ +AVK YWT
Sbjct  567   GGGVIIRDDVDILIKVKELTKGLQWEGRIADHEKGPHERVKIYYAVKQYWT  617



>ref|XP_003592303.1| hypothetical protein MTR_1g101370 [Medicago truncatula]
 gb|AES62554.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=634

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/529 (71%), Positives = 443/529 (84%), Gaps = 10/529 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEV-LKCRIPAPFGYRNPFKWP  1435
             +P C V ++EYTPCED  RSL Y R R+IYRERHCP K E  LKCR+P P GY+ PF WP
Sbjct  92    FPRCGVNFTEYTPCEDPTRSLRYKRSRMIYRERHCPVKGEEDLKCRVPPPHGYKTPFTWP  151

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDVAWY NVPH+ELTVEKAVQNWIR++GDRF FPGGGTMF NGA AYIDDIGKLINLK
Sbjct  152   ASRDVAWYANVPHRELTVEKAVQNWIRYDGDRFFFPGGGTMFPNGAGAYIDDIGKLINLK  211

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTALDTGCGVAS+GAYL SRNI+T+S APRDTH++QVQFALERGVPALIG+LASKR
Sbjct  212   DGSIRTALDTGCGVASWGAYLQSRNIITLSLAPRDTHEAQVQFALERGVPALIGVLASKR  271

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             LP+PS+AFD++HCSRCLIPW +YDG +L EVDRVLRPGGYWILSGPPI W ++ +GW RT
Sbjct  272   LPFPSRAFDISHCSRCLIPWAEYDGIFLNEVDRVLRPGGYWILSGPPINWNKHHRGWQRT  331

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDP  721
             ++DL  EQT+IEKVA SLCW K +E DDIAIWQKP NH+DC   R+     P C    +P
Sbjct  332   KKDLNQEQTKIEKVAKSLCWNKLIEKDDIAIWQKPINHLDCRSARKLATDRPFCGPQENP  391

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D AWYTDL+TCL P+PQVS+++E     L+ WP+RL +VPPRI  GTI+G++ E + KD+
Sbjct  392   DKAWYTDLKTCLMPVPQVSNKEETAGGVLKNWPQRLESVPPRIHMGTIEGVTSEGYSKDN  451

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              LW KRI HY  V + QL    RYRN++DMNA LGGFA+ALV + +WVMNVVPV++K++T
Sbjct  452   ELWKKRIPHYKKV-NNQL-GTKRYRNLVDMNANLGGFASALVKNPVWVMNVVPVQAKVDT  509

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIGTYH WCEAMSTYPRTYDLIHADS+F+LY  RCE+EDI+LEMDRILRPEG
Sbjct  510   LGAIYERGLIGTYHDWCEAMSTYPRTYDLIHADSLFSLYNGRCELEDIMLEMDRILRPEG  569

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++IIRDDVDVL+KVK I +GL+W+S +VDHEDGPL+REKLLFAVK YWT
Sbjct  570   AIIIRDDVDVLLKVKNIANGLEWDSSIVDHEDGPLEREKLLFAVKKYWT  618



>gb|ABV72578.1| dehydration-responsive family protein S51 [Brassica rapa]
Length=632

 Score =   805 bits (2079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/631 (62%), Positives = 466/631 (74%), Gaps = 41/631 (6%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN       +  +        A  C             
Sbjct  14    SNLYYITLVAVLCIGSYLLGVWQNTTVNPRAAFDTS-----TDAPPC------------E  56

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV----YPPCDVKYSEYTPCEDTERS  1552
               S ++ +  LDF          A    HD     V    +P CD   SE+TPCED +RS
Sbjct  57    KFSKTTSTTDLDFN---------AHHNPHDPPPSAVTAVSFPSCDAALSEHTPCEDAKRS  107

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
             L + RERL YR+RHCP + E LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK 
Sbjct  108   LKFSRERLEYRQRHCPDREEALKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKK  167

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
              QNW+R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DT CGVASFGAYL
Sbjct  168   NQNWVRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTSCGVASFGAYL  227

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             LSRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWG
Sbjct  228   LSRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWG  287

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             + DG YL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL  EQTQIE+VA SLCWK
Sbjct  288   KNDGVYLMEVDRVLRPGGYWILSGPPINWQKRWKGWERTMDDLNEEQTQIEQVARSLCWK  347

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K ++ DD+AIWQKP+NH+ C ++RQ    P  C    DPDMAWYT + +CLTPLP+V + 
Sbjct  348   KVVQRDDLAIWQKPFNHIHCKKMRQVLKNPEFCRYDQDPDMAWYTKMDSCLTPLPEVDES  407

Query  657   KEL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
             ++L        EKWP RLNAVPPR+  G +  I+ E F +D+ LW +R+S+Y   +D QL
Sbjct  408   EDLKTVAGGKVEKWPARLNAVPPRVNNGDLKEITPEAFLEDTELWKQRVSYYKK-LDYQL  466

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA+LGGFAAAL D  +WVMNVVPVE+K NTLGVIYERGLIGTY  WCE
Sbjct  467   GETGRYRNLLDMNAYLGGFAAALADEPVWVMNVVPVEAKHNTLGVIYERGLIGTYQNWCE  526

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYD IHADS+FTLY+D+CE EDILLEMDR+LRP G VIIRDDVDVLIKVK ++
Sbjct  527   AMSTYPRTYDFIHADSVFTLYQDKCEPEDILLEMDRVLRPGGGVIIRDDVDVLIKVKELS  586

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G QW+ R+ DHE GP +R K+ +AVK YWT
Sbjct  587   KGFQWQGRIADHEKGPHERVKIYYAVKQYWT  617



>ref|XP_009384529.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=635

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/619 (64%), Positives = 471/619 (76%), Gaps = 32/619 (5%)
 Frame = -2

Query  1884  LALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqsls  1705
             L ++A+FC+ SY  G WQ+ GGA+           + TA +C          ++    + 
Sbjct  29    LVVVAMFCSASYLLGIWQHIGGAT-----------VLTAISC-------DRKATDASFVV  70

Query  1704  shsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLI  1525
               +  LDF  HH   +  A +      + + +  CD KYSEYTPCED +RSL +DR+RLI
Sbjct  71    GGAPTLDFAAHHAADESDAAI-----PAAREFTACDAKYSEYTPCEDRDRSLRFDRDRLI  125

Query  1524  YRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEG  1345
             YRERHCP+K E+LKC +PAP GYRNPF WP SRD AW+ NVPH ELTVEKAVQNWIR + 
Sbjct  126   YRERHCPEKGELLKCLVPAPAGYRNPFPWPASRDAAWFANVPHNELTVEKAVQNWIRVDR  185

Query  1344  DRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMS  1165
             D+F FPGGGTMF +GADAYIDDI +LI L+DGSIRTA+DTGCGVAS+GAYLLSRNILTMS
Sbjct  186   DKFLFPGGGTMFPDGADAYIDDIDRLIPLRDGSIRTAIDTGCGVASWGAYLLSRNILTMS  245

Query  1164  FAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIE  985
             FAPRD+H++QVQFALERGVPA+IG+LAS RLPYPS+AFDMAHCSRCLIPW  YDG YLIE
Sbjct  246   FAPRDSHEAQVQFALERGVPAMIGVLASNRLPYPSRAFDMAHCSRCLIPWHLYDGQYLIE  305

Query  984   VDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIA  805
             VDRVLRPGGYWILSGPPI WKR W+GW RTE DL AEQ+ IE VA SLCWKK  E  DIA
Sbjct  306   VDRVLRPGGYWILSGPPINWKRQWKGWKRTEADLSAEQSAIEAVARSLCWKKLREKGDIA  365

Query  804   IWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK-----ELE  646
             +WQKP NH+ C   R+    P  C   N PD AWYT ++TC+ PLP V+  +     EL+
Sbjct  366   VWQKPTNHIHCKASRKVIKSPQFCHGQN-PDAAWYTKMETCIAPLPDVTGIRETAGGELK  424

Query  645   KWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDM  466
             KWP+RL AVPPRI  G+ DG++ E F +D+ LW KR+ +Y  V++ QL + GRYRN+LDM
Sbjct  425   KWPERLTAVPPRIASGSPDGVTPETFRQDTELWKKRLGYYRTVIN-QLGQKGRYRNLLDM  483

Query  465   NAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLI  286
             NA  GGFAAAL+D  +WVMNVVP  +  NTLGVIYERGLIGTY  WCEAMSTYPRTYDL+
Sbjct  484   NAKFGGFAAALIDDPVWVMNVVPTAANTNTLGVIYERGLIGTYQDWCEAMSTYPRTYDLL  543

Query  285   HADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDH  106
             HAD +F+LYK RCEMEDILLEMDRILRPEG+VI+RDDVDVLIK+K +TDG++W+S + DH
Sbjct  544   HADWVFSLYKGRCEMEDILLEMDRILRPEGTVIVRDDVDVLIKIKSVTDGMRWDSEIADH  603

Query  105   EDGPLQREKLLFAVKTYWT  49
             EDGP QREKLL  VKTYWT
Sbjct  604   EDGPHQREKLLVVVKTYWT  622



>ref|XP_007139952.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
 gb|AER13155.1| putative methyltransferase [Phaseolus vulgaris]
 gb|ESW11946.1| hypothetical protein PHAVU_008G072400g [Phaseolus vulgaris]
Length=634

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/527 (71%), Positives = 437/527 (83%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD   +EYTPCED  RSL + RE LIYRERHCP ++E L+CRIPAPFGYR P +WPES
Sbjct  101   PPCDATLAEYTPCEDVNRSLKFPREDLIYRERHCPVEAEALRCRIPAPFGYRVPLRWPES  160

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ NVPHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GA AYIDDIGKLINLKDG
Sbjct  161   RDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGASAYIDDIGKLINLKDG  220

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVAS+GAYLLSR+IL +SFAPRDTH++QVQFALERGVPALIG+LAS RLP
Sbjct  221   SIRTAIDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGVPALIGVLASIRLP  280

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQ +G YL EVDRVLRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  281   YPSRAFDMAHCSRCLIPWGQNEGIYLTEVDRVLRPGGYWILSGPPINWESHWKGWERTRE  340

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
              L+ EQ  IEKVA SLCWKK ++  D+AIWQKP NH+ C   R+     P C A+ DPD 
Sbjct  341   SLKEEQDTIEKVAKSLCWKKLVQKGDLAIWQKPTNHIHCKITRRVFKNRPFC-AAKDPDT  399

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT ++TCLTPLP+V+D       EL  WP+RL +VPPRI  G+++GI+ + F+++S L
Sbjct  400   AWYTKMETCLTPLPEVNDVSEVSGGELSNWPERLTSVPPRISSGSLNGITVDMFKENSEL  459

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAAL+D  +WVMN VPVE++LNTLG
Sbjct  460   WKKRVAYYK-TLDYQLAERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAELNTLG  518

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY++RC+MEDILLEMDRILRP+GSV
Sbjct  519   AIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFSLYQNRCKMEDILLEMDRILRPQGSV  578

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I+RDDVDVL+KVK   D +QW+SR+ DHE GP QREK+  AVK YWT
Sbjct  579   ILRDDVDVLLKVKNFADAMQWDSRIADHEKGPHQREKIFVAVKQYWT  625



>ref|XP_003551650.1| PREDICTED: probable methyltransferase PMT16-like [Glycine max]
Length=561

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/527 (71%), Positives = 438/527 (83%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC    SEYTPCED +RSL + RE LIYRERHCP + E+L+CR+PAPFGYR P +WPES
Sbjct  30    PPCAASLSEYTPCEDVQRSLKFPRENLIYRERHCPTEEELLRCRVPAPFGYRVPLRWPES  89

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ NVPHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GADAYIDDIGKLI+LKDG
Sbjct  90    RDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIDLKDG  149

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTALDTGCGVAS+GAYLLSR+IL +SFAPRDTH++QVQFALERGVPALIG+LAS RLP
Sbjct  150   SIRTALDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGVPALIGVLASIRLP  209

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQ +G YL EVDRVLRPGGYWILSGPPI W+ +W GW RT E
Sbjct  210   YPSRSFDMAHCSRCLIPWGQNEGIYLNEVDRVLRPGGYWILSGPPINWENHWNGWKRTRE  269

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
              L+ EQ  IEKVA SLCWKK ++  D+AIWQKP NH+ C   R+     P C A  DPD 
Sbjct  270   SLKEEQDGIEKVAKSLCWKKLVQKGDLAIWQKPTNHIHCKITRKVYKNRPFCEA-KDPDT  328

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT +  CLTPLP+V+D +     EL KWP+RL +VPPRI  G++ GI+G+ F++++ L
Sbjct  329   AWYTKMDICLTPLPEVNDIREVSGGELPKWPQRLKSVPPRISSGSLKGITGKMFKENNEL  388

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAAL+D  +WVMN VPVE+++NTLG
Sbjct  389   WKKRVAYYK-TLDYQLAERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLG  447

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY++RC++EDILLEMDRILRPEGSV
Sbjct  448   AIYERGLIGTYMNWCEAMSTYPRTYDFIHGDSVFSLYQNRCKVEDILLEMDRILRPEGSV  507

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I+RDDVDVL+KVK  TD +QWESR+ DHE GP QREK+LFAVK YWT
Sbjct  508   ILRDDVDVLLKVKSFTDAMQWESRIADHEKGPHQREKILFAVKQYWT  554



>ref|XP_010933874.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=640

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/623 (63%), Positives = 479/623 (77%), Gaps = 25/623 (4%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
               L +A +A+ C+ SY  G WQ+GGG   ++  +  +  +AT  +C  + N+ ++ + TT
Sbjct  23    NFLSIAAIAVLCSASYLLGIWQHGGGGGSSTSRAASSTILATV-SCNDNSNSPSSTTVTT  81

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                      LDF  HH      A     D  + + +P CD KYSEYTPCED  RSL + R
Sbjct  82    ---------LDFAAHHA-----ADESAFDGPARRDFPACDAKYSEYTPCEDVARSLKFPR  127

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             +RLIYRERHCP K E L+C IPAP GY+ PF WPESR VAW+ NVPHKELTVEKAVQNWI
Sbjct  128   DRLIYRERHCPAKGEELRCLIPAPAGYQKPFPWPESRGVAWFANVPHKELTVEKAVQNWI  187

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R +GD+F+FPGGGTMF NGADAYID+I +LINL+DGS+RTA+DTGCGVAS+GAYLLSR+I
Sbjct  188   RVDGDKFRFPGGGTMFPNGADAYIDEIDRLINLRDGSVRTAIDTGCGVASWGAYLLSRDI  247

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             LTMSFAPRD+H++QVQFALERG PA++GILAS RLPYPS+AFDMAHCSRCLIPW QYDG 
Sbjct  248   LTMSFAPRDSHEAQVQFALERGAPAMMGILASNRLPYPSRAFDMAHCSRCLIPWHQYDGL  307

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YLIE+DR+LRPGGYWILSGPPI WKR+W+GW RT+EDL AEQ+ IE VA SLCWKK  E 
Sbjct  308   YLIEIDRILRPGGYWILSGPPINWKRHWKGWQRTQEDLSAEQSAIEAVAKSLCWKKIKEE  367

Query  816   DDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK----  655
              DIAIWQKP NH+ C   R+    P  C   N PD AWYT ++ C+T +P+V   +    
Sbjct  368   RDIAIWQKPTNHIHCKANRKIIQSPQFCTDQN-PDAAWYTKMEACITSMPEVDSIQDIAG  426

Query  654   -ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
              EL+KWP+RL AVPPRI  G++ G++G+ F +D+ +W KR+ +Y  + +  L + GRYRN
Sbjct  427   GELKKWPERLMAVPPRISSGSLSGVTGDMFFQDTEMWKKRVGYYKKLFN--LGQKGRYRN  484

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             +LDMNA  GGFAAA++D  +WVMN VP  + +NTLGVIYERGLIGTY  WCEAMSTYPRT
Sbjct  485   LLDMNARFGGFAAAMIDEPVWVMNAVPTAANVNTLGVIYERGLIGTYQDWCEAMSTYPRT  544

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDL+HAD +FTLY DRCEMEDILLEMDRILRPEG+VIIRDD+DVL+K+K I DG++W+S+
Sbjct  545   YDLLHADLVFTLYSDRCEMEDILLEMDRILRPEGTVIIRDDIDVLVKIKSIADGMRWKSQ  604

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             + DHEDGPL+REK++ AVK YWT
Sbjct  605   IADHEDGPLKREKIMLAVKDYWT  627



>ref|XP_008668482.1| PREDICTED: uncharacterized protein LOC100384329 isoform X1 [Zea 
mays]
Length=638

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/623 (64%), Positives = 473/623 (76%), Gaps = 21/623 (3%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQNgggasg-tsissiftAKIATAKTCLFSGNtattlsstt  1717
             +L+LA +A+ C+LSY  G W +GG ++G  +  S  +  IATA +C     T  + S   
Sbjct  23    MLHLAAVAVLCSLSYLLGIWHHGGFSAGPAAGDSSSSVSIATAVSCATPAPTTASSSPPA  82

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
                      LDF  HH      A       +    Y  C  KYSEYTPCED ERSL + R
Sbjct  83    GP-------LDFAAHHTAEGVEAEGALRHRN----YEACPAKYSEYTPCEDVERSLRFPR  131

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             +RL+YRERHCP   E L+C +PAP GYRNPF WP SRDVAW+ NVPHKEL+VEKAVQNWI
Sbjct  132   DRLVYRERHCPAAGERLRCLVPAPKGYRNPFPWPASRDVAWFANVPHKELSVEKAVQNWI  191

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             R +GD+F+FPGGGTMF  GA AYIDDIGKLI L DGSIRTALDTGCGVAS+GAYLLSRNI
Sbjct  192   RVDGDKFRFPGGGTMFPRGAGAYIDDIGKLIPLHDGSIRTALDTGCGVASWGAYLLSRNI  251

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             L MSFAPRD+H++QVQFALERGVPA+IG+LAS +L YP+++FDMAHCSRCLIPW  YDG 
Sbjct  252   LAMSFAPRDSHEAQVQFALERGVPAMIGVLASNQLTYPARSFDMAHCSRCLIPWQLYDGL  311

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             YLIEVDR+LRPGGYWILSGPPI WK++W+GWDRT+EDL+AEQ  IE VA SLCWKK  E 
Sbjct  312   YLIEVDRILRPGGYWILSGPPINWKKHWKGWDRTKEDLDAEQKAIEAVARSLCWKKIKEE  371

Query  816   DDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE---  652
              DIAIWQKP NH+ C  + +    PP C ++ +PD AWY  ++ C+TPLP+VSD KE   
Sbjct  372   GDIAIWQKPTNHIHCKAIHKVIKSPPFC-SNKNPDAAWYDKMEACITPLPEVSDLKEVAG  430

Query  651   --LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
               L+KWP+RL AVPPRI  G+I+G++ E F +D+ LW KR+ HY +V+  QL + GRYRN
Sbjct  431   GSLKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSVI-AQLGQKGRYRN  489

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             +LDMNA  GGFAAALV+  LWVMN+VP      TLGVIYERGLIG+Y  WCE MSTYPRT
Sbjct  490   LLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYPRT  549

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YDLIHAD++FTLY  RCE E+ILLEMDRILRPEG+VIIRDDVD+L+K+K + DG++W S+
Sbjct  550   YDLIHADTVFTLYNGRCEAENILLEMDRILRPEGTVIIRDDVDLLVKIKSMADGMRWNSQ  609

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             +VDHEDGPL REKLL  VKTYWT
Sbjct  610   IVDHEDGPLVREKLLLVVKTYWT  632



>ref|XP_003580353.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=643

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/639 (62%), Positives = 469/639 (73%), Gaps = 15/639 (2%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK  1765
             P   LH       P   L  LA +A+ C++SY  G W +GG ++     +     +A   
Sbjct  6     PGTKLHLSSVARRPT--LHQLAAVAVLCSVSYLIGVWHHGGFSASPPGGTTSPVSVAITT  63

Query  1764  TCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
               +   +   T+          +  LDF  HH               + + Y  C  +YS
Sbjct  64    PSVPCVSPNVTVLGGGGGGGRLAPPLDFRAHHTAEGTEV----ESAPAKRTYEACPAQYS  119

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPCED ERSL + R+RL+YRERHCP + E L+C +PAP GYRNPF WP SRDVAW+ N
Sbjct  120   EYTPCEDVERSLRFPRDRLMYRERHCPSEGERLRCLVPAPQGYRNPFPWPTSRDVAWFAN  179

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             VPHKELTVEKAVQNWIR +GD+F+FPGGGTMF +GA AYIDDIGKLI L DGSIRTALDT
Sbjct  180   VPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGAGAYIDDIGKLIPLHDGSIRTALDT  239

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+L+S RL YP++AFDM
Sbjct  240   GCGVASWGAYLLSRDILVMSFAPRDSHEAQVQFALERGVPAMIGVLSSNRLTYPARAFDM  299

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++W+GW RT EDL AEQ  
Sbjct  300   AHCSRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHWKGWQRTTEDLNAEQQA  359

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQT  691
             IE VA SLCWKK  EV DIAIWQKP NH+ C   R+    PP C ++ +PD AWY  ++ 
Sbjct  360   IEAVAKSLCWKKIKEVGDIAIWQKPTNHIHCKASRRITKSPPFC-SNKNPDAAWYDKMEA  418

Query  690   CLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             C+TPLP+VSD K     EL+KWP+RL AVPPRI  G+I G++ E F +D+ LW KR+ HY
Sbjct  419   CITPLPEVSDIKKVAGGELKKWPQRLTAVPPRIASGSIAGVTDEMFLEDTKLWRKRVGHY  478

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
              +V+  Q  + GRYRN+LDMNA  GGFAAALV   +WVMN+VP      TLGVIYERGLI
Sbjct  479   KSVIS-QFGQKGRYRNLLDMNAHFGGFAAALVGDPMWVMNMVPTVGNSTTLGVIYERGLI  537

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             G Y  WCE MSTYPRTYDLIHADS+F+LYKDRCEM+ ILLEMDRILRPEG+VIIRDDVD+
Sbjct  538   GNYQDWCEGMSTYPRTYDLIHADSVFSLYKDRCEMDSILLEMDRILRPEGTVIIRDDVDI  597

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             L+K+K ITDG++W S+VVDHEDGPL REKLL  VKTYWT
Sbjct  598   LVKIKSITDGMRWNSQVVDHEDGPLVREKLLLVVKTYWT  636



>ref|XP_006293834.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
 gb|EOA26732.1| hypothetical protein CARUB_v10022818mg [Capsella rubella]
Length=631

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/627 (62%), Positives = 470/627 (75%), Gaps = 34/627 (5%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
             + L Y+ L+A+ C  SY  G WQN                +A  +      + +      
Sbjct  14    SNLYYVTLVALLCLGSYLLGIWQNT---------------VANPRAAF---DDSDGTPCE  55

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
                    +  L+F  HH   D   V      ++   +P C V+ SE+TPCED +RSL + 
Sbjct  56    AFIRPDSAKDLNFDAHHSIQDPPPV-----PETAASFPSCAVELSEHTPCEDAKRSLKFP  110

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             RERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELTVEK  QNW
Sbjct  111   RERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNW  170

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             +R+E DRF FPGGGTMF  GADAYIDDIG+LI+L DGSIRTA+DTGCGVASFGAYLLSRN
Sbjct  171   VRYENDRFWFPGGGTMFPRGADAYIDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRN  230

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             I TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ DG
Sbjct  231   ITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQNDG  290

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
             AYL+EVDRVLRPGGYWILSGPPI W+  W+GW+RT +DL  EQTQIE+VA SLCWKK ++
Sbjct  291   AYLMEVDRVLRPGGYWILSGPPINWQNRWKGWERTMDDLNTEQTQIEQVARSLCWKKVVQ  350

Query  819   VDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE--  652
              DD+AIWQKP+NH+ C +  Q    P  C    DPDMAWYT + +CLTPLP+V D ++  
Sbjct  351   RDDLAIWQKPFNHIQCKKTIQLLKNPKFCRHDQDPDMAWYTKMGSCLTPLPEVDDAEDLK  410

Query  651   ------LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
                   LEKWP RLNA+PPR+ +G +  I+ E F +++ LW +R+S+Y   +D QL E G
Sbjct  411   TVAGGKLEKWPARLNAIPPRVNKGELTEITPEAFLENTKLWEQRVSYYKK-LDYQLGETG  469

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRN++DMNA+LGGFAAAL D  +WVMN+VPVE+K NTLGVIYERGLIGTY  WCEAMST
Sbjct  470   RYRNLVDMNAYLGGFAAALADDPVWVMNIVPVEAKRNTLGVIYERGLIGTYQNWCEAMST  529

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYD IHADS+FT+Y+ +CE E+ILLEMDRILRP G VIIRDDVDVLIKVK +T GLQ
Sbjct  530   YPRTYDFIHADSVFTMYQGKCEPEEILLEMDRILRPGGGVIIRDDVDVLIKVKELTKGLQ  589

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             WE R+ DHE GP +REK+ +AVK YWT
Sbjct  590   WEGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_010508116.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/630 (62%), Positives = 474/630 (75%), Gaps = 34/630 (5%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S  + L Y+ L+A+ C  SY  G WQN                  T      + + +   
Sbjct  11    SKKSNLYYVTLVALLCLGSYLLGIWQN------------------TVPNPRAAFDDSDGT  52

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
                T +  S +  LDF  HH   D   V     +++   +P C  + SE+TPCED +RSL
Sbjct  53    PCETFTKPSSTKDLDFDAHHNIQDPPPV-----KETAVSFPSCGAELSEHTPCEDAKRSL  107

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + RERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELT+EK  
Sbjct  108   KFPRERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKN  167

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNW+R+E DRF FPGGGTMF  GADAY+DDIG+LI+L  GSIRTA+DTGCGVASFGAYLL
Sbjct  168   QNWVRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLL  227

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
             SRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ
Sbjct  228   SRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQ  287

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
              DGAYL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL AEQTQIEKVA SLCWKK
Sbjct  288   NDGAYLMEVDRVLRPGGYWILSGPPINWQQRWKGWERTMDDLNAEQTQIEKVARSLCWKK  347

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              ++ DD+AIWQKP NH+ C + RQ    P  C    DPDMAWYT + +CLTPLP+V + +
Sbjct  348   VVQRDDLAIWQKPLNHIHCKKTRQLLKNPEFCRHDQDPDMAWYTKMDSCLTPLPEVDEAE  407

Query  654   EL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             +L        EKWP RL AVPPR+ +G ++ I+ E F  ++ LW +R+S+Y   +D QL 
Sbjct  408   DLKTVAGGKVEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKK-LDYQLG  466

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
             E+GRYRN++DMNA+LGGFAAAL D  +WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEA
Sbjct  467   ESGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEA  526

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
             MSTYPRTYD IHA+S+FTLY+ +CE E ILLEMDRILRP G VIIRDDVDVLIKVK +T 
Sbjct  527   MSTYPRTYDFIHAESVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDVLIKVKELTK  586

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GLQWE R+ DHE GP +REK+ +AVK YWT
Sbjct  587   GLQWEGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_010506552.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/630 (62%), Positives = 474/630 (75%), Gaps = 34/630 (5%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S  + L Y+ L+A+ C  SY  G WQN                  T      + + +   
Sbjct  11    SKKSNLYYVTLVALLCLGSYLLGVWQN------------------TVPNPRAAFDDSDGT  52

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
                T +  S +  LDF  HH   D   V     +++   +P C  + SE+TPCED +RSL
Sbjct  53    PCETFTKPSSTKDLDFDAHHNIQDPPPV-----KETAVSFPSCGAELSEHTPCEDAKRSL  107

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + RERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELT+EK  
Sbjct  108   KFPRERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKN  167

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNW+R+E DRF FPGGGTMF  GADAY+DDIG+LI+L  GSIRTA+DTGCGVASFGAYLL
Sbjct  168   QNWVRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLL  227

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
             SRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ
Sbjct  228   SRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQ  287

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
              DGAYL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL AEQTQIEKVA +LCWKK
Sbjct  288   NDGAYLMEVDRVLRPGGYWILSGPPINWQQRWKGWERTMDDLNAEQTQIEKVARNLCWKK  347

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              ++ DD+AIWQKP NH+ C + RQ    P  C    DPDMAWYT + +CLTPLP+V + +
Sbjct  348   VVQRDDLAIWQKPLNHIHCKQTRQLLKNPEFCRHDQDPDMAWYTKMDSCLTPLPEVDEAE  407

Query  654   E--------LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             +        LEKWP RL AVPPR+ +G ++ I+ E F  ++ LW +R+S+Y   +D QL 
Sbjct  408   DLKTVAGGKLEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKK-LDYQLG  466

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
             E+GRYRN++DMNA+LGGFAAAL D  +WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEA
Sbjct  467   ESGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEA  526

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
             MSTYPRTYD IHADS+FTLY+ +CE E ILLEMDRILRP G VIIRDDVD+LIKVK +T 
Sbjct  527   MSTYPRTYDFIHADSVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDILIKVKELTK  586

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GLQWE R+ DHE GP +REK+ +AVK YWT
Sbjct  587   GLQWEGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_008663475.1| PREDICTED: probable methyltransferase PMT15 [Zea mays]
 gb|AFW59147.1| hypothetical protein ZEAMMB73_843401 [Zea mays]
Length=641

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/627 (63%), Positives = 475/627 (76%), Gaps = 27/627 (4%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQN---gggasgtsissiftAKIATAKTCLFSGNtattlss  1723
             LL+LA +A+ C+LSY FG W +     G +    +S  +  IATA +C        + + 
Sbjct  24    LLHLAAVAVLCSLSYLFGIWHHGGFSAGPAAGGATSSSSVSIATAVSC-------ASPAL  76

Query  1722  ttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVK--VYPPCDVKYSEYTPCEDTERSL  1549
             TT   S  +  LDF  HH         G   E +++   Y  C  KYSEYTPCED ERSL
Sbjct  77    TTAPSSPPAGPLDFAAHHTAE------GMESEAALRQRSYEACPAKYSEYTPCEDVERSL  130

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + R+RL+YRERHCP   E L+C +PAP GYRNPF WP SRDVAW+ NVPHKEL+VEKAV
Sbjct  131   RFPRDRLVYRERHCPADGERLRCLVPAPRGYRNPFPWPASRDVAWFANVPHKELSVEKAV  190

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNWIR +GDRF+FPGGGTMF  GA AYIDDI KLI L DGSIRTALDTGCGVAS+GAYLL
Sbjct  191   QNWIRVDGDRFRFPGGGTMFPRGAGAYIDDIAKLIPLHDGSIRTALDTGCGVASWGAYLL  250

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
             SR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL YP+++FDMAHCSRCLIPW  
Sbjct  251   SRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPARSFDMAHCSRCLIPWQL  310

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
             YDG YLIEVDR+LRPGGYWILSGPPI WK++W+GWDRT+EDL+AEQ  IE VA SLCWKK
Sbjct  311   YDGLYLIEVDRILRPGGYWILSGPPINWKKHWKGWDRTKEDLDAEQKAIEAVARSLCWKK  370

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQAPP--PMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
               E  DIAIWQKP NH+ C  + +     P C ++ +PD AWY  ++ C+T LP+VSD K
Sbjct  371   IKEAGDIAIWQKPTNHIHCKAIHKVSKSIPFC-SNQNPDAAWYDKMEACITRLPEVSDLK  429

Query  654   E-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
             E     L+KWP+RL AVPPRI  G+I+G++ E F +D+ LW KR+ HY +V+  QL + G
Sbjct  430   EVAGGALKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSVI-AQLGQKG  488

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRN+LDMNA  GGFAAALV+  LWVMN+VP      TLG IYERGLIG+Y  WCE MST
Sbjct  489   RYRNLLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGAIYERGLIGSYQDWCEGMST  548

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYDLIHADS+FTLY  RCE ++ILLEMDRILRPEG+VIIRDDVD+L+K+K ITDG++
Sbjct  549   YPRTYDLIHADSLFTLYNGRCEADNILLEMDRILRPEGTVIIRDDVDMLVKIKSITDGMR  608

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             W S++VDHEDGPL REKLL AVKTYWT
Sbjct  609   WNSQIVDHEDGPLVREKLLLAVKTYWT  635



>ref|XP_009142361.1| PREDICTED: probable methyltransferase PMT16 [Brassica rapa]
Length=632

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/543 (69%), Positives = 442/543 (81%), Gaps = 15/543 (3%)
 Frame = -2

Query  1635  HDEDSVKV----YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPA  1468
             HD   VK     +P C  + SE+TPCED +RSL + R+RL YR+RHCP++ EVLKCRIPA
Sbjct  75    HDPPPVKAAAVSFPSCGAQLSEHTPCEDAKRSLKFPRKRLEYRQRHCPEREEVLKCRIPA  134

Query  1467  PFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAY  1288
             P+GY+ PF+WPESRDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF +GADAY
Sbjct  135   PYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPSGADAY  194

Query  1287  IDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGV  1108
             IDDIG+LI+L DGSIRTA+DTGCGVASFGAYLLSRNI TMSFAPRDTH++QVQFALERGV
Sbjct  195   IDDIGRLIDLSDGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGV  254

Query  1107  PALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIR  928
             PA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ  G YL+EVDRVLRPGGYWILSGPPI 
Sbjct  255   PAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQNGGVYLMEVDRVLRPGGYWILSGPPIN  314

Query  927   WKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPP  748
             W+  W+GW+RT +DL AEQTQIE+VA SLCWKK ++ DD+AIWQKP+NH+ C + RQ   
Sbjct  315   WQNRWKGWERTMDDLNAEQTQIEQVARSLCWKKVVQRDDLAIWQKPFNHVHCKKTRQVLK  374

Query  747   PM--CPASNDPDMAWYTDLQTCLTPLPQVSDEKEL--------EKWPKRLNAVPPRIKRG  598
              +  C    DPDMAWYT + +CLTPLP+V + ++L        EKWP RLNAVPPRI  G
Sbjct  375   KLKFCRHDQDPDMAWYTKMDSCLTPLPEVDEAEDLKTVAGGKVEKWPARLNAVPPRINNG  434

Query  597   TIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSL  418
              +  I+ E F  D+ LW +R+S+Y   +D QL E GRYRN+LDMNA++GGFAAAL D  +
Sbjct  435   DLKEITPEGFLGDTKLWKQRVSYYK-TLDYQLGETGRYRNILDMNAYVGGFAAALADEPV  493

Query  417   WVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEME  238
             WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+FTLY+D+CE E
Sbjct  494   WVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFTLYQDKCEPE  553

Query  237   DILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKT  58
             DILLEMDRILRP G VIIRDDVDVLIKVK +T GLQWE R+ DHE  P +R K+ +AVK 
Sbjct  554   DILLEMDRILRPGGGVIIRDDVDVLIKVKELTKGLQWEGRIADHEKSPHERVKIYYAVKQ  613

Query  57    YWT  49
             YWT
Sbjct  614   YWT  616



>ref|XP_008795397.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=629

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/631 (62%), Positives = 478/631 (76%), Gaps = 43/631 (7%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
               L +A + + C+ SY  G WQ+GGG + +  +S     I    +C  + N+ ++ + T 
Sbjct  23    NFLSIAAIVVLCSASYLLGIWQHGGGGATSRAASST---ILATVSCDDNNNSPSSTAVT-  78

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNH---DEDSVKV-----YPPCDVKYSEYTPCEDT  1561
                      LDF              NH   DE +        +P C+ KYSEYTPCED 
Sbjct  79    --------ALDF-------------ANHHAADESAFAAPARRDFPACEAKYSEYTPCEDV  117

Query  1560  ERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTV  1381
              RSL + R+RLIYRERHCP K E L+C IPAP GYRNPF WPESR VAW+ NVPHKELTV
Sbjct  118   ARSLKFPRDRLIYRERHCPVKGEELRCLIPAPAGYRNPFPWPESRGVAWFANVPHKELTV  177

Query  1380  EKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFG  1201
             EKAVQNWIR +GD+F+FPGGGTMF NGADAYID+I +LINL+DGS+RTA+DTGCGVAS+G
Sbjct  178   EKAVQNWIRVDGDKFRFPGGGTMFPNGADAYIDEIDRLINLRDGSVRTAIDTGCGVASWG  237

Query  1200  AYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLI  1021
             AYLLSR+ILTMSFAPRD+H++QVQFALERGVPA++GILAS RLPYPS+AFDMAHCSRCLI
Sbjct  238   AYLLSRDILTMSFAPRDSHEAQVQFALERGVPAMVGILASNRLPYPSRAFDMAHCSRCLI  297

Query  1020  PWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSL  841
             PW QYDG YLIE+DR+LRPGGYWILSGPPI WKR+W+GW+R++EDL AEQ+ IE  A  L
Sbjct  298   PWHQYDGLYLIEIDRILRPGGYWILSGPPINWKRHWKGWERSQEDLSAEQSAIEATAKRL  357

Query  840   CWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQV  667
             CWKK  E  DIAIWQKP NH+ C   R+    P  C   N PD AWYT ++ C+TPLP+V
Sbjct  358   CWKKIKEEGDIAIWQKPTNHIHCKANRKIIQSPQFCTDQN-PDAAWYTKMEACITPLPEV  416

Query  666   SDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQL  502
                +     EL++WP+RL AVPPRI  G+++G++ E F +D+ LW KR+ +Y  +++  L
Sbjct  417   DSIQDMAGGELKRWPERLVAVPPRISSGSLNGVTDEMFFQDTELWKKRVGYYKKLLN--L  474

Query  501   VEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCE  322
              E GRYRN+LDMNA  GGFAAA++D  +WVMNVVP  +  +TLGVIYERGLIGTY  WCE
Sbjct  475   GEKGRYRNLLDMNAQFGGFAAAMIDEPVWVMNVVPTAANSSTLGVIYERGLIGTYQDWCE  534

Query  321   AMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRIT  142
             AMSTYPRTYDL+HADS+FTLYKDRC+MEDILLEMDRILRPEG+VI RDDVDVL+K++ IT
Sbjct  535   AMSTYPRTYDLLHADSVFTLYKDRCQMEDILLEMDRILRPEGTVIFRDDVDVLVKIRSIT  594

Query  141   DGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +G++W+S++ DHEDGP Q+EK+L AVK YWT
Sbjct  595   NGMRWKSQIADHEDGPRQKEKILLAVKDYWT  625



>ref|XP_009399379.1| PREDICTED: probable methyltransferase PMT15 [Musa acuminata subsp. 
malaccensis]
Length=644

 Score =   801 bits (2069),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/531 (70%), Positives = 440/531 (83%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V+ +P CDVKYSEYTPCED  RSL +DR+RLIYRERHCP+K E+LKC IPAP GY++PF 
Sbjct  96    VREFPACDVKYSEYTPCEDRTRSLRFDRKRLIYRERHCPEKGELLKCLIPAPPGYKSPFP  155

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP SRD AW+ NVPHKEL V KA QNWIR +GD+F+FPGGGTMF NGAD YIDDI +LI+
Sbjct  156   WPASRDTAWFANVPHKELAVGKAGQNWIRVDGDKFRFPGGGTMFPNGADTYIDDIDQLIS  215

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L DGSIRTA+DTGCGVAS+GAYLLSRN+LTMSFAP+D+H++QVQFALERGVPA+IG+LAS
Sbjct  216   LSDGSIRTAVDTGCGVASWGAYLLSRNVLTMSFAPKDSHEAQVQFALERGVPAMIGVLAS  275

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLPYPS+AFDMAHCSRCLI W  YDG YL+E+DR+LRPGGYWILSGPPI WK++W+GW+
Sbjct  276   IRLPYPSRAFDMAHCSRCLIQWHLYDGQYLMEIDRILRPGGYWILSGPPINWKQHWKGWN  335

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT+EDL   Q+ IE VA SLCW K  E  DIAIWQKP NH+ C   R+    P  C  S 
Sbjct  336   RTKEDLSEVQSAIEAVARSLCWNKLKEKGDIAIWQKPVNHISCKANRKIIRSPQFC-QSQ  394

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKEL-----EKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT ++TC+ PLP+V+  +E      ++WP+RL AVPPRI  G++ G++ E F +
Sbjct  395   DPDSAWYTKMETCIVPLPKVASPEETAGGAPKRWPERLTAVPPRIASGSVVGVTAETFLQ  454

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+ LW KR+ +Y  V+ GQL +AGRYRN+LDMNA  GGFAAAL+D  LWVMN+VP  S++
Sbjct  455   DTELWKKRVGYYKKVI-GQLGQAGRYRNLLDMNANFGGFAAALIDDPLWVMNIVPTTSQV  513

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY  WCEAMSTYPRTYDL+HADS+F LYKDRCEMEDILLEMDRILRP
Sbjct  514   NTLGVIYERGLIGTYQDWCEAMSTYPRTYDLLHADSVFNLYKDRCEMEDILLEMDRILRP  573

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EG+VIIRDDVD+L+K+K I DG++W SR+ DHEDGPLQREKLL  VKTYWT
Sbjct  574   EGTVIIRDDVDILVKIKSIADGMRWNSRIADHEDGPLQREKLLLVVKTYWT  624



>ref|XP_010518192.1| PREDICTED: probable methyltransferase PMT16 [Camelina sativa]
Length=631

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/630 (62%), Positives = 473/630 (75%), Gaps = 34/630 (5%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S  + L Y+ L+A+ C  SY  G WQN                  T      + + +   
Sbjct  11    SKKSNLYYVTLVALLCLGSYLLGIWQN------------------TVPNPRAAFDDSDGT  52

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
                T +  S +  LDF  HH   D   V     +++   +P C  + SE+TPCED +RSL
Sbjct  53    PCETFTKPSSTKDLDFDAHHNIQDPPPV-----KETAVSFPSCGAELSEHTPCEDAKRSL  107

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + RERL YR+RHCP++ E+LKCRIPAP+GY+ PF+WPESRDVAW+ NVPH ELT+EK  
Sbjct  108   KFPRERLEYRQRHCPEREEILKCRIPAPYGYKTPFRWPESRDVAWFANVPHTELTIEKKN  167

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNW+R+E DRF FPGGGTMF  GADAY+DDIG+LI+L  GSIRTA+DTGCGVASFGAYLL
Sbjct  168   QNWVRYENDRFWFPGGGTMFPRGADAYLDDIGRLIDLSGGSIRTAIDTGCGVASFGAYLL  227

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
             SRNI TMSFAPRDTH++QVQFALERGVPA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ
Sbjct  228   SRNITTMSFAPRDTHEAQVQFALERGVPAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQ  287

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
              DGAYL+EVDRVLRPGGYWILSGPPI W++ W+GW+RT +DL AEQTQIEKVA +LCWKK
Sbjct  288   NDGAYLMEVDRVLRPGGYWILSGPPINWQQRWKGWERTMDDLNAEQTQIEKVARNLCWKK  347

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              ++ DD+AIWQKP NH+ C + RQ    P  C    DPDMAWYT + +CLTPLP+V +  
Sbjct  348   VVQRDDLAIWQKPLNHIHCKQTRQLLKNPEFCRHDQDPDMAWYTKMDSCLTPLPEVDEAG  407

Query  654   EL--------EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             +L        EKWP RL AVPPR+ +G ++ I+ E F  ++ LW +R+S+Y   +D QL 
Sbjct  408   DLKTVAGGKVEKWPARLYAVPPRVNKGDLEEITPEAFLDNTKLWKQRVSYYKK-LDYQLG  466

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
             E+GRYRN++DMNA+LGGFAAAL D  +WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEA
Sbjct  467   ESGRYRNLVDMNAYLGGFAAALADDPVWVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEA  526

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
             MSTYPRTYD IHADS+FTLY+ +CE E ILLEMDRILRP G VIIRDDVD+LIKVK +T 
Sbjct  527   MSTYPRTYDFIHADSVFTLYQGKCEPEKILLEMDRILRPGGGVIIRDDVDILIKVKILTK  586

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GLQWE R+ DHE GP +REK+ +AVK YWT
Sbjct  587   GLQWEGRIADHEKGPHEREKIYYAVKQYWT  616



>ref|XP_006653692.1| PREDICTED: probable methyltransferase PMT15-like, partial [Oryza 
brachyantha]
Length=592

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/530 (71%), Positives = 434/530 (82%), Gaps = 9/530 (2%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + Y  C  KYSEYTPCED ERSL + RERL+YRERHCP + E L+C +PAP GYRNPF W
Sbjct  59    RTYEACPAKYSEYTPCEDVERSLRFPRERLVYRERHCPSEGERLRCLVPAPKGYRNPFPW  118

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAW+ NVPHKELTVEKAVQNWIR +GDRF+FPGGGTMF +GA AYIDDIGK+I L
Sbjct  119   PTSRDVAWFANVPHKELTVEKAVQNWIRVDGDRFRFPGGGTMFPHGAGAYIDDIGKIIPL  178

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
              DGSIRTA+DTG GVAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+L+S 
Sbjct  179   HDGSIRTAIDTGWGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLSSN  238

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RL YP++AFDMAHCSRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++W+GW R
Sbjct  239   RLTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHWKGWQR  298

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASND  724
             T+EDL AEQ  IE VA SLCWKK  E  DIAIWQKP NH+ C   R+    PP C   N 
Sbjct  299   TKEDLNAEQQAIEAVAKSLCWKKIKEDGDIAIWQKPTNHIHCKTSRKIIKSPPFCLDKN-  357

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWY  ++ C+TPLP+VSD K     EL+KWP+RL AVPPRI  G+I+G++ E F +D
Sbjct  358   PDAAWYDKMKACITPLPEVSDIKEIAGGELKKWPERLTAVPPRIASGSIEGVTDEIFMED  417

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+ HY +V+  Q  + GRYRN+LDMNA  GGFAAALVD  +WVMN+VP      
Sbjct  418   TELWKKRVGHYKSVIS-QFGQKGRYRNLLDMNARFGGFAAALVDDPVWVMNMVPTVGNST  476

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIG+Y  WCE MSTYPRTYDLIHADS+FTLYKDRCEM++ILLEMDRILRPE
Sbjct  477   TLGVIYERGLIGSYQDWCEGMSTYPRTYDLIHADSVFTLYKDRCEMDNILLEMDRILRPE  536

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G+VIIRDDVD+L+K+K ITDG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  537   GTVIIRDDVDMLVKIKSITDGMKWNSQIVDHEDGPLVREKLLLVVKTYWT  586



>ref|XP_004306838.1| PREDICTED: probable methyltransferase PMT15-like [Fragaria vesca 
subsp. vesca]
Length=627

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/531 (68%), Positives = 443/531 (83%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V   PPCD + +EYTPCED  RSL ++R+RL+YRERHCP+K+E+LKCRIPAP GY+ PF+
Sbjct  84    VSHVPPCDARLAEYTPCEDATRSLKFERDRLVYRERHCPEKNELLKCRIPAPHGYQVPFR  143

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESR   WY NVPHKELTVEK  QNW+ +EGDRF+FPGGGTMF NGADAYIDDIG+LIN
Sbjct  144   WPESRGSVWYANVPHKELTVEKKNQNWVHYEGDRFRFPGGGTMFPNGADAYIDDIGRLIN  203

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L+DGSIRTA+DTGCGVAS+G YLLSR+ILT+SFAPRDTH++QVQFALERG+PA+IG++AS
Sbjct  204   LRDGSIRTAIDTGCGVASWGGYLLSRDILTVSFAPRDTHEAQVQFALERGIPAVIGVMAS  263

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDRVLRPGGYWILSGPPI W+++W+GW+
Sbjct  264   IRLPYPSRAFDMAHCSRCLIPWGEYDGLYLIEVDRVLRPGGYWILSGPPINWQKHWKGWE  323

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT+ DL+AEQ +IE+VA SLCWKK  + DD+AIWQKP NH+ C   R+    P  C   N
Sbjct  324   RTQADLKAEQDKIERVAKSLCWKKLKQKDDLAIWQKPTNHIHCKANRKVFKKPSFCQVQN  383

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
              PD AWYT L+ CLTPLP V++ +     EL KWP RL  VPPRI  G+++GI+ E F +
Sbjct  384   -PDTAWYTKLEECLTPLPGVNNLRDTAGGELAKWPARLTTVPPRISSGSLEGITDEMFRE  442

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             ++ LW +R++HY   +D QL + GRYRN+LDMN++LG FAAALVD  +WVMN+VPVE+++
Sbjct  443   NTALWKQRVAHYK-TLDYQLADPGRYRNLLDMNSYLGSFAAALVDDPVWVMNIVPVEAEV  501

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLG IYERGLIGTY  WCEAMSTYPRTYD IH+DS+FTLYKDRCEM DILLEMDRILRP
Sbjct  502   NTLGAIYERGLIGTYQNWCEAMSTYPRTYDFIHSDSVFTLYKDRCEMVDILLEMDRILRP  561

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +GS+I RDDVD+++K K + D +Q+++R+VDHE+GP  REK+L A K YWT
Sbjct  562   QGSIIFRDDVDMVVKAKGLLDAMQYDARIVDHEEGPHHREKILLAAKQYWT  612



>ref|XP_002269747.2| PREDICTED: probable methyltransferase PMT15 [Vitis vinifera]
 emb|CBI38771.3| unnamed protein product [Vitis vinifera]
Length=632

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/531 (69%), Positives = 439/531 (83%), Gaps = 9/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V  +P C    SEYTPCED +RSL +DR  L+YRERHCP+ +EVLKCR+PAP GY  PF+
Sbjct  90    VNHFPACPTYLSEYTPCEDAQRSLKFDRVMLVYRERHCPEPNEVLKCRVPAPNGYTTPFR  149

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESRD  W+ NVPHKELTVEKAVQNW+RFEG RF+FPGGGTMF  GADAYID+IGKLIN
Sbjct  150   WPESRDSVWFANVPHKELTVEKAVQNWVRFEGKRFRFPGGGTMFPRGADAYIDEIGKLIN  209

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRNILT+SFAPRDTH++QVQFALERGVPALIG++AS
Sbjct  210   LKDGSIRTAIDTGCGVASWGAYLLSRNILTVSFAPRDTHEAQVQFALERGVPALIGVMAS  269

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLPYPS+AFDMAHCSRCLIPWGQY G YLIE+DR+LRPGGYWILSGPP+ WK++W+GW+
Sbjct  270   IRLPYPSRAFDMAHCSRCLIPWGQYGGLYLIEIDRILRPGGYWILSGPPVNWKKHWKGWN  329

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT EDL  EQ+ IE VA SLCWKK +E DD+A+WQKP NH  C   R+    PP C    
Sbjct  330   RTAEDLNNEQSGIEAVAKSLCWKKLVEKDDLAVWQKPTNHAHCQINRKVYKKPPFC-EGK  388

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPD AWYT L+ CLTPLP+V   K+     L+KWP+RL +VPPRI RG++ GI+ + F +
Sbjct  389   DPDQAWYTKLENCLTPLPEVGHVKDIAGGMLKKWPERLTSVPPRIMRGSVKGITAKIFRE  448

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D+  W KR+++Y    DG L   GR+RN+LDMNA+LGGFAAAL++  LWVMN+VPVE+++
Sbjct  449   DTDKWKKRVTYYKG-FDGNLAVPGRFRNILDMNAYLGGFAAALINDPLWVMNMVPVEAEI  507

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLG+IYERGLIGTY  WCEAMSTYPRTYD IH DS+FTLYKDRCEME+ILLEMDRILRP
Sbjct  508   NTLGIIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFTLYKDRCEMENILLEMDRILRP  567

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              G+VI+RDDVD+++K++ I + L W S++VDHE+GP   EK+++AVK YWT
Sbjct  568   GGTVILRDDVDMVVKIQSIIERLNWNSKIVDHEEGPHHTEKIVWAVKQYWT  618



>ref|XP_010055225.1| PREDICTED: probable methyltransferase PMT15 isoform X1 [Eucalyptus 
grandis]
 gb|KCW71693.1| hypothetical protein EUGRSUZ_E00212 [Eucalyptus grandis]
Length=637

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/533 (69%), Positives = 443/533 (83%), Gaps = 14/533 (3%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKS---EVLKCRIPAPFGYRNPFK  1441
             +PPC   +SEYTPCED  RSL ++RE L+YRERHCP+     E L+CR+PAP+GYR PF+
Sbjct  99    FPPCGANFSEYTPCEDVARSLRFEREMLVYRERHCPEGGAGGERLRCRVPAPYGYRRPFR  158

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESR  AW+ NVPHKELTVEK  QNW++FEG+RF FPGGGTMF  GAD YI+DIGK+IN
Sbjct  159   WPESRGTAWFANVPHKELTVEKRNQNWVKFEGNRFVFPGGGTMFPKGADKYIEDIGKMIN  218

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L+DGSI+TALDTGCGVAS+GAYLLSRNIL MSFAPRDTH++QVQFALERGVPALIG+LAS
Sbjct  219   LRDGSIKTALDTGCGVASWGAYLLSRNILAMSFAPRDTHEAQVQFALERGVPALIGVLAS  278

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              R+PYPS+AFDMAHCSRCLIPW QY+G YLIE+DRVLRPGGYWILSGPPI W+R+W+GW+
Sbjct  279   NRIPYPSRAFDMAHCSRCLIPWSQYNGLYLIEIDRVLRPGGYWILSGPPINWERHWKGWE  338

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASN  727
             RT EDL+AEQT IE +A SLCWKK  + +DIAIWQKP NH+ C   R+    P  C  S 
Sbjct  339   RTSEDLKAEQTSIETLARSLCWKKLKQKEDIAIWQKPTNHVHCKINRKVFKFPHFC-QSQ  397

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-------ELEKWPKRLNAVPPRIKRGTIDGISGEKF  568
             DPDMAWYT ++ CLTPLP V D          L +WP+RL +VPPRI  G+++GI+ + F
Sbjct  398   DPDMAWYTKMEACLTPLPDVPDNNIKVVAGGGLVRWPERLMSVPPRISSGSLEGITEKTF  457

Query  567   EKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVES  388
              +++  W  R+ HY + +D QL E GRYRN+LDMN++LGGFAAALVD  +WVMN+VPVE+
Sbjct  458   IENTAAWKTRVLHYKS-LDSQLAELGRYRNLLDMNSYLGGFAAALVDDPVWVMNIVPVEA  516

Query  387   KLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRIL  208
             ++NTLGVIYERGLIGTY +WCEAMSTYPRTYDLIHA+S+FTLY+DRCEMEDILLEMDRIL
Sbjct  517   RVNTLGVIYERGLIGTYQSWCEAMSTYPRTYDLIHANSVFTLYRDRCEMEDILLEMDRIL  576

Query  207   RPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RPEGS+I RDD+DVL+K+K   DG+Q++S++ DHE+GPL+REK+L AVK YWT
Sbjct  577   RPEGSIIFRDDMDVLVKIKDAIDGMQYDSKITDHENGPLEREKILLAVKQYWT  629



>ref|XP_003533625.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=622

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/527 (70%), Positives = 437/527 (83%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPCD   SEYTPCED +RSL + RE LIYRERHCP   E+L+CR+PAPFGYR P +WPES
Sbjct  84    PPCDPSLSEYTPCEDVQRSLKFPRENLIYRERHCPPAEELLRCRVPAPFGYRVPLRWPES  143

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ NVPHKELTVEK  QNW+RFEGD+F+FPGGGTMF  GA AYIDDIGKLINL+DG
Sbjct  144   RDAAWFANVPHKELTVEKKNQNWVRFEGDQFRFPGGGTMFPRGAGAYIDDIGKLINLEDG  203

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTALDTGCGVAS+GAYLLSR+I+ +SFAPRDTH++QVQFALERGVP LIG+LAS RLP
Sbjct  204   SIRTALDTGCGVASWGAYLLSRDIIAVSFAPRDTHEAQVQFALERGVPGLIGVLASIRLP  263

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQ +G YL EVDRVLRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  264   YPSRSFDMAHCSRCLIPWGQNEGIYLNEVDRVLRPGGYWILSGPPINWENHWKGWERTRE  323

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             +L+ EQ  IEKVA SLCWKK ++  D+AIWQKP NH+ C   R+     P C A  DPD 
Sbjct  324   NLKEEQDGIEKVAKSLCWKKLVQKGDLAIWQKPTNHIHCKITRKVYKNRPFCEA-KDPDT  382

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT + TCLTPLP+V+D +     EL  WP+RL +VPPRI  G++ GI+ E F++++ L
Sbjct  383   AWYTKMDTCLTPLPEVNDIREVSGGELSNWPERLTSVPPRISSGSLKGITAEMFKENNEL  442

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAAL+D  +WVMN VPVE+++NTLG
Sbjct  443   WKKRVAYYK-TLDYQLAERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLG  501

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYD +H DS+F+LY++RC+MEDILLEMDRILRP+GSV
Sbjct  502   AIYERGLIGTYMNWCEAMSTYPRTYDFMHGDSVFSLYQNRCKMEDILLEMDRILRPQGSV  561

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I+RDDVDVL+KVK  TD +QW+SR+ DHE GP QREK+L AVK YWT
Sbjct  562   ILRDDVDVLLKVKSFTDAMQWDSRIADHEKGPHQREKILVAVKQYWT  608



>gb|ACN78962.1| methyltransferase [Glycine max]
Length=759

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/523 (71%), Positives = 435/523 (83%), Gaps = 9/523 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC    SEYTPCED +RSL + RE LIYRERHCP + E+L+CR+PAPFGYR P +WPES
Sbjct  91    PPCAASLSEYTPCEDVQRSLKFPRENLIYRERHCPTEEELLRCRVPAPFGYRVPLRWPES  150

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ NVPHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GADAYIDDIGKLI+LKDG
Sbjct  151   RDAAWFANVPHKELTVEKKNQNWVRFEGDRFRFPGGGTMFPRGADAYIDDIGKLIDLKDG  210

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTALDTGCGVAS+GAYLLSR+IL +SFAPRDTH++QVQFALERGVPALIG+LAS RLP
Sbjct  211   SIRTALDTGCGVASWGAYLLSRDILAVSFAPRDTHEAQVQFALERGVPALIGVLASIRLP  270

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQ +G YL EVDRVLRPGGYWILSGPPI W+ +W GW RT E
Sbjct  271   YPSRSFDMAHCSRCLIPWGQNEGIYLNEVDRVLRPGGYWILSGPPINWENHWNGWKRTRE  330

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
              L+ EQ  IEKVA SLCWKK ++  D+AIWQKP NH+ C   R+     P C A  DPD 
Sbjct  331   SLKEEQDGIEKVAKSLCWKKLVQKGDLAIWQKPTNHIHCKITRKVYKNRPFCEA-KDPDT  389

Query  714   AWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT +  CLTPLP+V+D +     EL KWP+RL +VPPRI  G++ GI+G+ F++++ L
Sbjct  390   AWYTKMDICLTPLPEVNDIREVSGGELPKWPQRLKSVPPRISSGSLKGITGKMFKENNEL  449

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAAL+D  +WVMN VPVE+++NTLG
Sbjct  450   WKKRVAYYK-TLDYQLAERGRYRNLLDMNAYLGGFAAALIDDPVWVMNTVPVEAEVNTLG  508

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY++RC++EDILLEMDRILRPEGSV
Sbjct  509   AIYERGLIGTYMNWCEAMSTYPRTYDFIHGDSVFSLYQNRCKVEDILLEMDRILRPEGSV  568

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVK  61
             I+RDDVDVL+KVK  TD +QWESR+ DHE GP QREK+LFAVK
Sbjct  569   ILRDDVDVLLKVKSFTDAMQWESRIADHEKGPHQREKILFAVK  611



>dbj|BAJ87212.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92559.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/530 (70%), Positives = 429/530 (81%), Gaps = 9/530 (2%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + Y  C  KYSEYTPCED ERSL + R+RL+YRERHCP + E L+C +PAP GYRNPF W
Sbjct  98    RAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRNPFPW  157

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAW+ NVPHKELTVEKAVQNWI  EGD+F+FPGGGTMF +GA AYIDDIG LI L
Sbjct  158   PASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGNLIPL  217

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
              DGSIRTALDTGCGVAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+LAS 
Sbjct  218   HDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLASN  277

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RL YP++AFDMAHCSRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++ +GW R
Sbjct  278   RLTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHSKGWQR  337

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASND  724
             T EDL AEQ  IE VA SLCWKK  EV DIAIWQKP NH+ C  LR+    PP C ++ +
Sbjct  338   TREDLNAEQQAIESVAKSLCWKKIKEVGDIAIWQKPTNHIHCKALRKVAKSPPFC-SNKN  396

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWY  ++ C+TPLP+VSD K     EL+KWP+RL AVPPRI  G+ +G++ E F +D
Sbjct  397   PDAAWYEKMEACITPLPEVSDIKEVAGGELKKWPQRLTAVPPRIASGSFEGVTAEMFNED  456

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+ HY +V+  Q  + GRYRN+LDMNA  GGFAAAL    +WVMN+VP      
Sbjct  457   TKLWKKRVGHYKSVVS-QFGQKGRYRNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNST  515

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIG Y  WCE MSTYPRTYDLIHADS+F+LYKDRCEM+ ILLEMDRILRPE
Sbjct  516   TLGVIYERGLIGNYQDWCEGMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPE  575

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G+VIIRDDVD+L+K+K + DG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  576   GTVIIRDDVDLLVKIKSVADGMRWNSQIVDHEDGPLVREKLLLVVKTYWT  625



>ref|XP_004976536.1| PREDICTED: probable methyltransferase PMT15-like [Setaria italica]
Length=640

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/616 (64%), Positives = 473/616 (77%), Gaps = 26/616 (4%)
 Frame = -2

Query  1863  CTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlssttqslsshsAGLD  1684
             C+LSY FG W +GG ++  +  +     IATA +C     TA++ SST          LD
Sbjct  34    CSLSYLFGIWHHGGFSAARASGAGAAVSIATAVSCASPTPTASSSSSTPAGP------LD  87

Query  1683  FtthhgdgdgGAVLGNHDEDSV---KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRER  1513
             F  HH            +ED+    + Y  C VKYSEYTPCED ERSL + R+RL+YRER
Sbjct  88    FAAHHTAE-------GMEEDAAPRQRAYDACPVKYSEYTPCEDVERSLRFSRDRLVYRER  140

Query  1512  HCPKK-SEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRF  1336
             HCP   +E L+C +PAP GYRNPF WP SRDVAW+ NVPHKELTVEKAVQNWIR +GD+F
Sbjct  141   HCPSSDAERLRCLVPAPRGYRNPFPWPASRDVAWFANVPHKELTVEKAVQNWIRVDGDKF  200

Query  1335  KFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAP  1156
             +FPGGGTMF  GA AYIDDIGK+I L DGSIRTALDTGCGVAS+GAYLLSRNIL MSFAP
Sbjct  201   RFPGGGTMFPRGAGAYIDDIGKIIPLHDGSIRTALDTGCGVASWGAYLLSRNILAMSFAP  260

Query  1155  RDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDR  976
             RD+H++QVQFALERGVPA+IG+LAS RL YP+++FDMAHCSRCLIPW  YDG YLIE+DR
Sbjct  261   RDSHEAQVQFALERGVPAMIGVLASNRLTYPARSFDMAHCSRCLIPWQLYDGLYLIEIDR  320

Query  975   VLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQ  796
             VLRPGGYWILSGPPI WK++++GW R+++DL  EQ  IEKVA SLCWKK  E  DIAIWQ
Sbjct  321   VLRPGGYWILSGPPINWKKHYKGWARSKDDLNQEQQAIEKVAASLCWKKVKEEGDIAIWQ  380

Query  795   KPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWP  637
             KP NH+ C  +R+    PP C +S +PD AWY  ++ C+TPLP+VSD KE     L+KWP
Sbjct  381   KPTNHIHCKAIRKVIKSPPFC-SSQNPDAAWYDKMEACITPLPEVSDLKEVAGGKLKKWP  439

Query  636   KRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAF  457
             +RL AVPPRI  G+++G++ E F +D+ LW KRI HY +V+  QL + GRYRN+LDMNA 
Sbjct  440   ERLTAVPPRIASGSLEGVTEEMFVEDTELWKKRIGHYKSVIP-QLAQKGRYRNLLDMNAK  498

Query  456   LGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHAD  277
              GGFAAALV+  +WVMN+VP      TLGVIYERGLIG+Y  WCE MSTYPRTYDLIHAD
Sbjct  499   FGGFAAALVNDPVWVMNMVPTVGNSTTLGVIYERGLIGSYQDWCEGMSTYPRTYDLIHAD  558

Query  276   SIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDG  97
             S+FTLY  RCEME++LLEMDRILRPEG+VIIRDDVD+L+K+K I DG++W S++VDHEDG
Sbjct  559   SVFTLYHGRCEMENVLLEMDRILRPEGTVIIRDDVDLLVKIKSIADGMRWNSQIVDHEDG  618

Query  96    PLQREKLLFAVKTYWT  49
             PL REKLL  VKTYWT
Sbjct  619   PLVREKLLLVVKTYWT  634



>tpg|DAA36414.1| TPA: hypothetical protein ZEAMMB73_585119 [Zea mays]
Length=651

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/636 (63%), Positives = 477/636 (75%), Gaps = 34/636 (5%)
 Frame = -2

Query  1893  LLYLALLAIFCTLSYHFGTWQNgggasg-tsissiftAKIATAKTCLFSGNtattlsstt  1717
             +L+LA +A+ C+LSY  G W +GG ++G  +  S  +  IATA +C        T + TT
Sbjct  23    MLHLAAVAVLCSLSYLLGIWHHGGFSAGPAAGDSSSSVSIATAVSC-------ATPAPTT  75

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
              S S  +  LDF  HH      A       +    Y  C  KYSEYTPCED ERSL + R
Sbjct  76    ASSSPPAGPLDFAAHHTAEGVEAEGALRHRN----YEACPAKYSEYTPCEDVERSLRFPR  131

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             +RL+YRERHCP   E L+C +PAP GYRNPF WP SRDVAW+ NVPHKEL+VEKAVQNWI
Sbjct  132   DRLVYRERHCPAAGERLRCLVPAPKGYRNPFPWPASRDVAWFANVPHKELSVEKAVQNWI  191

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG-------------  1216
             R +GD+F+FPGGGTMF  GA AYIDDIGKLI L DGSIRTALDTGCG             
Sbjct  192   RVDGDKFRFPGGGTMFPRGAGAYIDDIGKLIPLHDGSIRTALDTGCGQYPMHSKSNFSEN  251

Query  1215  VASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHC  1036
             VAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+LAS +L YP+++FDMAHC
Sbjct  252   VASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNQLTYPARSFDMAHC  311

Query  1035  SRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEK  856
             SRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++W+GWDRT+EDL+AEQ  IE 
Sbjct  312   SRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHWKGWDRTKEDLDAEQKAIEA  371

Query  855   VADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLT  682
             VA SLCWKK  E  DIAIWQKP NH+ C  + +    PP C ++ +PD AWY  ++ C+T
Sbjct  372   VARSLCWKKIKEEGDIAIWQKPTNHIHCKAIHKVIKSPPFC-SNKNPDAAWYDKMEACIT  430

Query  681   PLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAV  517
             PLP+VSD KE     L+KWP+RL AVPPRI  G+I+G++ E F +D+ LW KR+ HY +V
Sbjct  431   PLPEVSDLKEVAGGSLKKWPERLTAVPPRIASGSIEGVTEEMFVEDTELWKKRVGHYKSV  490

Query  516   MDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTY  337
             +  QL + GRYRN+LDMNA  GGFAAALV+  LWVMN+VP      TLGVIYERGLIG+Y
Sbjct  491   I-AQLGQKGRYRNLLDMNAKFGGFAAALVNDPLWVMNMVPTVGNSTTLGVIYERGLIGSY  549

Query  336   HTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIK  157
               WCE MSTYPRTYDLIHAD++FTLY  RCE E+ILLEMDRILRPEG+VIIRDDVD+L+K
Sbjct  550   QDWCEGMSTYPRTYDLIHADTVFTLYNGRCEAENILLEMDRILRPEGTVIIRDDVDLLVK  609

Query  156   VKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +K + DG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  610   IKSMADGMRWNSQIVDHEDGPLVREKLLLVVKTYWT  645



>gb|KEH18956.1| methyltransferase [Medicago truncatula]
Length=638

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/531 (69%), Positives = 435/531 (82%), Gaps = 8/531 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
             V   PPC+    EYTPCED +RSL + R++LIYRERHCP   E L+CRIPAPFGYR P +
Sbjct  102   VSHLPPCEPSLYEYTPCEDQKRSLRFSRKKLIYRERHCPLPEETLRCRIPAPFGYRLPLR  161

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WPESRD AWY NVPHKELTVEK  QNW+RF G+RF+FPGGGTMF  GA+AY+DDIGKLIN
Sbjct  162   WPESRDGAWYANVPHKELTVEKKNQNWVRFNGNRFRFPGGGTMFPRGANAYVDDIGKLIN  221

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             LKDGSIRTA+DTGCGVAS+GAYLLSRNILT+S APRDTH++QVQFALERGVPALIGILAS
Sbjct  222   LKDGSIRTAIDTGCGVASWGAYLLSRNILTVSVAPRDTHEAQVQFALERGVPALIGILAS  281

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
              RLPYPS+AFDMAHCSRCLIPWGQ DG YL EVDR+LRPGGYWILSGPPI W+++W+GW+
Sbjct  282   IRLPYPSRAFDMAHCSRCLIPWGQDDGIYLTEVDRLLRPGGYWILSGPPINWQKHWKGWE  341

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASN  727
             RT E L  EQ  IE VA SLCWKK ++  D+AIWQKP NHM C   R+     P C  + 
Sbjct  342   RTRESLNDEQDAIENVAKSLCWKKLVQKGDLAIWQKPTNHMHCKVKRKIFKTRPFCEEAQ  401

Query  726   DPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             DPDMAWYT L TCLTPLP V++ K     E+ KWPKRL ++PPRI   ++ GI+ E F++
Sbjct  402   DPDMAWYTKLDTCLTPLPDVNNVKEVAGGEISKWPKRLTSIPPRISGESLKGITPEMFKE  461

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             ++ LW KR S+Y   +D QL E GRYRN+LDMN++LGGFAAALVD  +WVMN+VPVE+++
Sbjct  462   NTELWKKRESYYK-TLDSQLAETGRYRNLLDMNSYLGGFAAALVDDPVWVMNIVPVEAEI  520

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             NTLGVIYERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY+ RC ME+ILLEMDRILRP
Sbjct  521   NTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFSLYQHRCSMENILLEMDRILRP  580

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +GSVI+RD+VDVL KVK I D +QW++++ DHE+GP Q+EK+L AVK YWT
Sbjct  581   QGSVILRDNVDVLTKVKSIADEMQWDAKIRDHEEGPYQKEKILVAVKQYWT  631



>dbj|BAJ84848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/530 (70%), Positives = 429/530 (81%), Gaps = 9/530 (2%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + Y  C  KYSEYTPCED ERSL + R+RL+YRERHCP + E L+C +PAP GYRNPF W
Sbjct  98    RAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRNPFPW  157

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAW+ NVPHKELTVEKAVQNWI  EGD+F+FPGGGTMF +GA AYIDDIG LI L
Sbjct  158   PASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGNLIPL  217

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
              DGSIRTALDTGCGVAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+LAS 
Sbjct  218   HDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLASN  277

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RL YP++AFDMAHCSRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++ +GW R
Sbjct  278   RLTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHSKGWQR  337

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASND  724
             T EDL AEQ  IE VA SLCWKK  EV DIAIWQKP NH+ C  LR+    PP C ++ +
Sbjct  338   TREDLNAEQQAIESVAKSLCWKKIKEVGDIAIWQKPTNHIHCKALRKVAKSPPFC-SNKN  396

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWY  ++ C+TPLP+VSD K     EL++WP+RL AVPPRI  G+ +G++ E F +D
Sbjct  397   PDAAWYEKMEACITPLPEVSDIKEVAGGELKRWPQRLTAVPPRIASGSFEGVTAEMFNED  456

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+ HY +V+  Q  + GRYRN+LDMNA  GGFAAAL    +WVMN+VP      
Sbjct  457   TKLWKKRVGHYKSVVS-QFGQKGRYRNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNST  515

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIG Y  WCE MSTYPRTYDLIHADS+F+LYKDRCEM+ ILLEMDRILRPE
Sbjct  516   TLGVIYERGLIGNYQDWCEGMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPE  575

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G+VIIRDDVD+L+K+K + DG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  576   GTVIIRDDVDLLVKIKSVADGMRWNSQIVDHEDGPLVREKLLLVVKTYWT  625



>emb|CDM86771.1| unnamed protein product [Triticum aestivum]
Length=641

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/528 (69%), Positives = 432/528 (82%), Gaps = 9/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YP C  +YSEYTPCED +RSL Y R+RL+YRERHCP   E L+C +PAP GYRNPF WP 
Sbjct  112   YPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPWPA  171

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAW+ NVPHKELTVEKAVQNWIR +GD+ +FPGGGTMF +GADAYIDDIGKLI L D
Sbjct  172   SRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPLHD  231

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL
Sbjct  232   GSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRL  291

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
              YP++AFDMAHCSRCLIPW  YDG YLIE+DRVLRPGGYWILSGPPI WK+YW+GW+R++
Sbjct  292   TYPARAFDMAHCSRCLIPWHLYDGLYLIELDRVLRPGGYWILSGPPINWKKYWKGWERSK  351

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             EDL AEQ  IE VA SLCWKK  E  DIA+WQKP NH  C   R+A   PP C   N  D
Sbjct  352   EDLNAEQEAIEAVARSLCWKKIKEAGDIAVWQKPANHAGCKASRKAAKSPPFCSKKN-AD  410

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWY  ++ C+TPLP+VSD  E     ++KWP+RL AVPPR+ RGT+ G++ + F++D+ 
Sbjct  411   AAWYDKMEACVTPLPEVSDASEVAGGAVKKWPQRLTAVPPRVSRGTVKGVTAKAFQQDTE  470

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+ HY AV++ Q  + GRYRNVLDMNA LGGFAAAL  + LWVMN+VP  +  + L
Sbjct  471   LWKKRVRHYKAVIN-QFEQKGRYRNVLDMNARLGGFAAALASYPLWVMNMVPAVANSSAL  529

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GV+YERGLIG+Y  WCE  STYPRTYDLIHADS+FTLYK RCEM+ ILLEMDR+LRPEG+
Sbjct  530   GVVYERGLIGSYQDWCEGTSTYPRTYDLIHADSVFTLYKSRCEMDTILLEMDRVLRPEGT  589

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD+L+KVK ++D ++W+S++VDHEDGPL REK+L   KTYWT
Sbjct  590   VIIRDDVDMLVKVKSVSDRMRWDSQIVDHEDGPLVREKILLVAKTYWT  637



>dbj|BAJ95401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=631

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/530 (70%), Positives = 428/530 (81%), Gaps = 9/530 (2%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + Y  C  KYSEYTPCED ERSL + R+RL+YRERHCP + E L+C +PAP GYRNPF W
Sbjct  98    RAYGACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPAEGERLRCLVPAPKGYRNPFPW  157

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAW+ NVPHKELTVEKAVQNWI  EGD+F+FPGGGTMF +GA AYIDDIG LI L
Sbjct  158   PASRDVAWFANVPHKELTVEKAVQNWIHVEGDKFRFPGGGTMFPHGAGAYIDDIGNLIPL  217

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
              DGSIRTALDTGCGVAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+LAS 
Sbjct  218   HDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLASN  277

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RL YP++AFDMAHCSRCLIPW  YDG YLIEVDR+LRPGGYWILSGPPI WK++ +GW R
Sbjct  278   RLTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRILRPGGYWILSGPPINWKKHSKGWQR  337

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASND  724
             T EDL AEQ  IE VA SLCWKK  EV DIAIWQKP NH+ C  LR+    PP C ++ +
Sbjct  338   TREDLNAEQQAIESVAKSLCWKKIKEVGDIAIWQKPTNHIHCKALRKVAKSPPFC-SNKN  396

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWY  ++ C+TPLP+VSD K     EL+KWP+RL AVPPRI  G+ +G++ E F +D
Sbjct  397   PDAAWYEKMEACITPLPEVSDIKEVAGGELKKWPQRLTAVPPRIASGSFEGVTAEMFNED  456

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+ HY +V+  Q  + GRY N+LDMNA  GGFAAAL    +WVMN+VP      
Sbjct  457   TKLWKKRVGHYKSVVS-QFGQKGRYCNLLDMNARFGGFAAALAGDPMWVMNMVPTIGNST  515

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIG Y  WCE MSTYPRTYDLIHADS+F+LYKDRCEM+ ILLEMDRILRPE
Sbjct  516   TLGVIYERGLIGNYQDWCEGMSTYPRTYDLIHADSVFSLYKDRCEMDTILLEMDRILRPE  575

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G+VIIRDDVD+L+K+K + DG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  576   GTVIIRDDVDLLVKIKSVADGMRWNSQIVDHEDGPLVREKLLLVVKTYWT  625



>ref|XP_003570093.1| PREDICTED: probable methyltransferase PMT15 [Brachypodium distachyon]
Length=639

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/645 (61%), Positives = 483/645 (75%), Gaps = 32/645 (5%)
 Frame = -2

Query  1941  ALPLHNHQYYSSPNNKLLYL--ALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATA  1768
             A  LH    +SS   + L+L  A +A+ C+ SY  G W +GG +S  S S      IATA
Sbjct  7     ATKLHIPPSHSSAARRSLFLPLAAVALLCSASYLLGAWHHGGFSSSPSPSGAV--SIATA  64

Query  1767  KTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDE--DSVKVYPPCDV  1594
              +C  +  T +T              LDF+ HH          +        + YP C  
Sbjct  65    ISCTTTTLTPST--------------LDFSAHHASASTTTTSSSAPSTPQRRRQYPACPA  110

Query  1593  KYSEYTPCEDTERSLAYDRERLIYRERHCPKKS--EVLKCRIPAPFGYRNPFKWPESRDV  1420
             KYSEYTPCED +RSL Y R+RL+YRERHCP  +  + L+C +PAP GYRNPF WP SRDV
Sbjct  111   KYSEYTPCEDVKRSLRYPRDRLVYRERHCPSPAGRDRLRCLVPAPHGYRNPFPWPASRDV  170

Query  1419  AWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIR  1240
             AW+ NVPHKELTVEKAVQNWIR +GD+ +FPGGGTMF +GADAYIDDI KL+ L+DGS+R
Sbjct  171   AWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIAKLVPLRDGSVR  230

Query  1239  TALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPS  1060
             TALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL YP+
Sbjct  231   TALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRLTYPA  290

Query  1059  KAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLE  880
             +AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYW+LSGPPI W++YW+GW+R++EDL 
Sbjct  291   RAFDMAHCSRCLIPWHLYDGLYLIEVDRVLRPGGYWVLSGPPINWRKYWKGWERSKEDLN  350

Query  879   AEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ---APPPMCPASNDPDMAW  709
             AEQ  IE VA SLCWKK  E  DIA+WQKP NH+ C   R+     PP C ++ +PD AW
Sbjct  351   AEQEAIEAVARSLCWKKIKEAGDIAVWQKPMNHVSCKTSRRKTAKSPPFC-SNKNPDAAW  409

Query  708   YTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWN  544
             Y  ++ C+TPLP+VS+  E     ++KWP+RL AVPPRI RG+I G++ + F++D+ LW 
Sbjct  410   YDKMEACVTPLPEVSNADEVAGGAVKKWPQRLTAVPPRISRGSIKGVTAKAFQQDTELWK  469

Query  543   KRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVI  364
             +R+ HY AV++ Q  + GRYRNVLDMNA LGGFAAAL ++ LWVMN+VP     +TLGVI
Sbjct  470   RRVRHYKAVIN-QFEQKGRYRNVLDMNAGLGGFAAALANYPLWVMNMVPTVRNSSTLGVI  528

Query  363   YERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVII  184
             YERGLIG+Y  WCE  STYPRTYDL+HADS+FTLYK RCEM+ ILLEMDRILRPEG+VII
Sbjct  529   YERGLIGSYQDWCEGASTYPRTYDLVHADSVFTLYKSRCEMDSILLEMDRILRPEGTVII  588

Query  183   RDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RDDVD+L+KVK + DG++W+S++VDHEDGPL REKLL  VKTYWT
Sbjct  589   RDDVDMLVKVKSVADGMRWDSQIVDHEDGPLVREKLLLVVKTYWT  633



>ref|XP_002452759.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
 gb|EES05735.1| hypothetical protein SORBIDRAFT_04g032010 [Sorghum bicolor]
Length=666

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/533 (69%), Positives = 430/533 (81%), Gaps = 14/533 (3%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP-KKSEVLKCRIPAPFGYRNPFKWP  1435
             YP C  KYSEYTPCED ERSL + R+RL+YRERHCP  + EVL+C +PAP GYR PF WP
Sbjct  130   YPACAAKYSEYTPCEDVERSLRFPRDRLVYRERHCPASEREVLRCLVPAPAGYRTPFPWP  189

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDVAW+ NVPHKELTVEKAVQNWIR +GD+ +FPGGGTMF NGADAYIDDIGKLI L 
Sbjct  190   ASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPNGADAYIDDIGKLIPLH  249

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS R
Sbjct  250   DGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNR  309

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             L YP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK+YW+GW+RT
Sbjct  310   LTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRVLRPGGYWILSGPPINWKKYWKGWERT  369

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA----PPPMCPASN  727
             +EDL AEQ  IE VA SLCW K  E  DIA+WQKPYNH DC   R +     PP C   N
Sbjct  370   KEDLNAEQQAIEAVARSLCWTKVKEAGDIAVWQKPYNHADCKASRPSKASKSPPFCSRKN  429

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
              PD AWY  ++ C+TPLP+VS  K+     ++KWP+RL AVPPR+ RG + G++ + F +
Sbjct  430   -PDAAWYDKMEACITPLPEVSSAKDVAGGAVKKWPQRLTAVPPRVSRGAVKGVTAKSFAQ  488

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHS--LWVMNVVPVES  388
             D+ LW KR+ HY +V+  +  + GRYRNVLDMNA LGGFAAAL      LWVMN+VP   
Sbjct  489   DTELWRKRVRHYKSVIS-EFEQKGRYRNVLDMNARLGGFAAALATAGDPLWVMNMVPTVG  547

Query  387   KLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRIL  208
                TLG IYERGLIG+Y  WCE MSTYPRTYDLIHADS+FTLYK+RCEM+ ILLEMDR+L
Sbjct  548   NTTTLGAIYERGLIGSYQDWCEGMSTYPRTYDLIHADSVFTLYKNRCEMDRILLEMDRVL  607

Query  207   RPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RP G+VIIR+DVD+L+KVK + DG++WES++VDHEDGPL REK+L  VKTYWT
Sbjct  608   RPRGTVIIREDVDMLVKVKSVADGMRWESQIVDHEDGPLVREKILLVVKTYWT  660



>dbj|BAJ98046.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=645

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/528 (69%), Positives = 431/528 (82%), Gaps = 9/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             YP C  +YSEYTPCED +RSL Y R+RL+YRERHCP   E L+C +PAP GYRNPF WP 
Sbjct  114   YPACPAEYSEYTPCEDVKRSLRYPRDRLVYRERHCPSGRERLRCLVPAPAGYRNPFPWPA  173

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAW+ NVPHKELTVEKAVQNWIR +GD+ +FPGGGTMF +GADAYIDDIGKLI L D
Sbjct  174   SRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPHGADAYIDDIGKLIPLHD  233

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS RL
Sbjct  234   GSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNRL  293

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
              YP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK+YW+GW+R++
Sbjct  294   TYPARAFDMAHCSRCLIPWHLYDGLYLIEVDRVLRPGGYWILSGPPINWKKYWKGWERSK  353

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             EDL AEQ  IE VA SLCWKK  E  DIA+WQKP NH  C    +A   PP C   N  D
Sbjct  354   EDLNAEQEAIEAVARSLCWKKIKEAGDIAVWQKPDNHAGCKAFWKAAKSPPFCSKKN-AD  412

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWY  ++ C+TPLP+VSD  E     ++KWP+RL AVPPR+ RGT+ G++ + F +D+ 
Sbjct  413   AAWYDKMEACVTPLPEVSDASEVAGGAVKKWPQRLTAVPPRVSRGTVKGVTAKAFLQDTE  472

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+ HY AV++ Q  + GRYRNVLDMNA LGGFAAAL  + LWVMN+VP  +  + L
Sbjct  473   LWRKRVRHYKAVIN-QFEQKGRYRNVLDMNARLGGFAAALASYPLWVMNMVPTVANSSAL  531

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GV+YERGLIG+Y  WCE  STYPRTYDLIHADS+FTLY++RCEM+ ILLEMDRILRPEG+
Sbjct  532   GVVYERGLIGSYQDWCEGTSTYPRTYDLIHADSVFTLYRNRCEMDTILLEMDRILRPEGT  591

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VIIRDDVD+L+KVK + DG++W+S++VDHEDGPL REK+L   KTYWT
Sbjct  592   VIIRDDVDILVKVKSVADGMRWDSQIVDHEDGPLVREKILLVAKTYWT  639



>ref|XP_007134966.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
 gb|ESW06960.1| hypothetical protein PHAVU_010G090800g [Phaseolus vulgaris]
Length=640

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/528 (69%), Positives = 435/528 (82%), Gaps = 9/528 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC   +SEYTPCED  RSL + R RL YRERHCP   +VL+CRIPAP+GY+ P +WP S
Sbjct  102   PPCGWSFSEYTPCEDQNRSLQFPRARLAYRERHCPAAEDVLRCRIPAPYGYKQPLRWPAS  161

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AW+ N PHKELTVEK  QNW+RFEGDRF+FPGGGTMF  GAD YID++GKLINL+DG
Sbjct  162   RDAAWFANAPHKELTVEKKGQNWVRFEGDRFRFPGGGTMFPRGADRYIDELGKLINLRDG  221

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTA+DTGCGVASFGAYLLSR+ILT+SFAPRDTH SQVQFALERGVPALIGILAS RLP
Sbjct  222   SIRTAIDTGCGVASFGAYLLSRDILTVSFAPRDTHISQVQFALERGVPALIGILASIRLP  281

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWG+YDG YL EVDRVLRPGGYWILSGPPI ++++W+GW+RT E
Sbjct  282   YPSRAFDMAHCSRCLIPWGKYDGEYLTEVDRVLRPGGYWILSGPPINYEKHWRGWERTRE  341

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCI---RLRQAPPPMCPASNDPD  718
              L+ EQ +IE VA SLCWKK ++ DD+AIWQKP NH  C    ++ +   P C  + DPD
Sbjct  342   SLKDEQDEIEDVAKSLCWKKLVQKDDLAIWQKPTNHAHCKLKRKIFKTGRPFCNEAQDPD  401

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT L TCL PLP+V D KE     L  WP RL ++PPRI+  +++GI+ + F +++ 
Sbjct  402   TAWYTKLDTCLIPLPEVKDIKEISGGGLSNWPDRLTSIPPRIRSESLEGITAKMFTENTQ  461

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW KR+++Y   +D QL E GRYRNVLDMNA+LGGFAAALVD+ LWVMN+VPVE+++NTL
Sbjct  462   LWEKRVAYYKK-LDHQLAERGRYRNVLDMNAYLGGFAAALVDYPLWVMNIVPVEAEINTL  520

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GV+YERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY++RC+M DILLEMDRILRP+G+
Sbjct  521   GVVYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFSLYQNRCDMVDILLEMDRILRPQGT  580

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VI+RDDVDVL KVK I D +QW++++ DHE+GP +R+K+L AVK YWT
Sbjct  581   VILRDDVDVLTKVKSIADEMQWDAKITDHEEGPYERQKILIAVKEYWT  628



>ref|XP_003528883.1| PREDICTED: probable methyltransferase PMT15-like [Glycine max]
Length=641

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/530 (68%), Positives = 435/530 (82%), Gaps = 11/530 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC   +SE+TPCED +RSL++ R RL YRERHCP   E L+CRIPAP+GYR P +WP S
Sbjct  103   PPCASPFSEHTPCEDQQRSLSFPRHRLAYRERHCPAPEERLRCRIPAPYGYRQPLRWPAS  162

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AWY N PHKELTVEK  QNW+RF+G+RF+FPGGGTMF  GAD YI+DIGKLINL+DG
Sbjct  163   RDAAWYANAPHKELTVEKKGQNWVRFDGNRFRFPGGGTMFPRGADQYINDIGKLINLRDG  222

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             S+RTA+DTGCGVASFGAYLLSR+ILTMSFAPRDTH SQVQFALERG+PALIGILA+ RLP
Sbjct  223   SVRTAIDTGCGVASFGAYLLSRDILTMSFAPRDTHISQVQFALERGIPALIGILATIRLP  282

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS+AFDMAHCSRCLIPWGQYDG Y+ E+DRVLRPGGYWILSGPPI ++++W+GW+RT E
Sbjct  283   YPSRAFDMAHCSRCLIPWGQYDGVYMTEIDRVLRPGGYWILSGPPINYEKHWRGWERTHE  342

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ----APPPMCPASNDP  721
              L+ EQ  IE VA SLCWKK ++ DD+A+WQKP NH  C   R+       P+C  + DP
Sbjct  343   SLKEEQDGIEDVAKSLCWKKLVQKDDLAVWQKPTNHAHCKLKRKIFKSGSRPLCGEAQDP  402

Query  720   DMAWYTDLQTCLTPLPQVSDEKE------LEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             D AWYT L TCLTPLP+V + KE      L  WP RL ++PPRI+  +++GI+ E F ++
Sbjct  403   DTAWYTKLDTCLTPLPEVKNIKEVSGGGGLANWPNRLTSIPPRIRSESLEGITAEMFTEN  462

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + LW KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAALVD  +WVMN+VPVE+++N
Sbjct  463   TKLWKKRLAYYKK-LDHQLAERGRYRNLLDMNAYLGGFAAALVDDPVWVMNIVPVEAEIN  521

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGV+YERGLIGTY  WCEAMSTYPRTYD IH DS+F+LY++RC+M DILLEMDRILRP+
Sbjct  522   TLGVVYERGLIGTYQNWCEAMSTYPRTYDFIHGDSVFSLYQNRCDMVDILLEMDRILRPQ  581

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GSVI+RDDVDVL KVK I D +QW++R+ DHE+GP +R+K+L AVK YWT
Sbjct  582   GSVILRDDVDVLTKVKIIADEMQWDARITDHEEGPYERQKILVAVKEYWT  631



>ref|XP_006648932.1| PREDICTED: probable methyltransferase PMT15-like [Oryza brachyantha]
Length=603

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/526 (69%), Positives = 429/526 (82%), Gaps = 8/526 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             Y  C  KYSEYTPCED +RSL Y R+RL+YRERHCP + E L+C +PAP GY NPF WP 
Sbjct  75    YQACPAKYSEYTPCEDVKRSLRYPRDRLVYRERHCPTERERLRCLVPAPAGYHNPFPWPA  134

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRDVAW+ NVPHKELTVEKAVQNWIR +GD+F+FPGGGTMF +GADAYIDDIGKLI L D
Sbjct  135   SRDVAWFANVPHKELTVEKAVQNWIRVDGDKFRFPGGGTMFPHGADAYIDDIGKLIPLHD  194

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTALDTGCGVAS+GAYLLSR+I+ MSFAPRD+H++QVQFALERGVPA+I      RL
Sbjct  195   GSIRTALDTGCGVASWGAYLLSRDIVAMSFAPRDSHEAQVQFALERGVPAMIAPPPPPRL  254

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
              YP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI W++YW+GW+RT+
Sbjct  255   TYPARAFDMAHCSRCLIPWHLYDGLYLIEVDRVLRPGGYWILSGPPINWRKYWKGWERTK  314

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDMA  712
             EDL AEQ  IE VA SLCWKK  E  DIA+WQKP NH +C   R++ PP C ++ +PD A
Sbjct  315   EDLNAEQEAIEAVARSLCWKKIKEAGDIAVWQKPANHANCKASRKS-PPFC-SNRNPDAA  372

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WY  ++ C+TPLP+VS   E     L+KWP+RL AVPPRI RGT+ G++ + F +D+ LW
Sbjct  373   WYDKMEACVTPLPEVSGAGEVAGGALKKWPQRLTAVPPRISRGTVKGVTAKAFAQDTELW  432

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              KR+ HY  V++ Q  + GRYRNVLDMNA LGGFAAAL D  +WVMN+VP      TLGV
Sbjct  433   RKRVRHYKGVIN-QFEQKGRYRNVLDMNAGLGGFAAALADDPVWVMNMVPTVGNSTTLGV  491

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             +YERGLIG+Y  WCE MSTYPRTYDLIH+DS+FTLYK+RCEM+ ILLEMDRILRPEG+VI
Sbjct  492   VYERGLIGSYQDWCEGMSTYPRTYDLIHSDSVFTLYKNRCEMDAILLEMDRILRPEGTVI  551

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRDDVD+L+KVK   DG++W+S+++DHEDGPL REK+L  VKTYWT
Sbjct  552   IRDDVDMLVKVKNAADGMRWDSQIIDHEDGPLVREKILLVVKTYWT  597



>ref|XP_010692380.1| PREDICTED: probable methyltransferase PMT15 [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/532 (67%), Positives = 443/532 (83%), Gaps = 10/532 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKK-SEVLKCRIPAPFGYRNPF  1444
             V  +PPC + +SEYTPC D +RSL + R+RL+YRERHCP +  E + CR+PAP GY  PF
Sbjct  88    VNHFPPCSLNFSEYTPCHDVDRSLRFPRDRLVYRERHCPMELGEFVTCRVPAPNGYTTPF  147

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             +WPESRD+ WY NVPHK LTVEKA QNW+RFE DRF FPGGGTMF  GADAYID+IG++I
Sbjct  148   RWPESRDMVWYANVPHKWLTVEKAGQNWVRFEEDRFTFPGGGTMFPRGADAYIDEIGRII  207

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
             NLKDGS+RTA+DTGCGVASFGAYLLSRNILT+SFAP+DTH++QVQFALERGVPALIGI+A
Sbjct  208   NLKDGSVRTAIDTGCGVASFGAYLLSRNILTVSFAPKDTHEAQVQFALERGVPALIGIMA  267

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             + RLPYPS++FDMAHCSRCLIPWGQYDG YLIEVDR+LRPGGYWILSGPPI W+ +W+GW
Sbjct  268   TTRLPYPSRSFDMAHCSRCLIPWGQYDGLYLIEVDRILRPGGYWILSGPPINWEAHWKGW  327

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +R+++DL +EQ+ IE VA SLCWKK  ++ DIA+WQKP NH+ C + R+    P  C A 
Sbjct  328   ERSKKDLNSEQSTIEAVAKSLCWKKLRQIGDIAVWQKPTNHVHCKKNRRLFKKPRFCEA-  386

Query  729   NDPDMAWYTDLQTCLTPLPQVSD-----EKELEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
              DPD+AWYT+++ CLTPLP VS+       E+ KWP +L AVPPR+  G+++GI+ + F 
Sbjct  387   QDPDLAWYTNMEACLTPLPPVSNITQMAGGEVSKWPHKLTAVPPRVYSGSLEGITPDVFT  446

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             KD+ +W +R+++Y + ++ +L +AGRYRNVLDMNA LGGFAAALVD  +WVMN+VPVE+K
Sbjct  447   KDTIIWKERLAYYKS-LNNELNDAGRYRNVLDMNANLGGFAAALVDDPVWVMNIVPVEAK  505

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             +NTLGV++ERGLIGTY +WCEAMSTYPRTYDL+HA S+F+LY  RC+MEDILLEMDRILR
Sbjct  506   VNTLGVVFERGLIGTYQSWCEAMSTYPRTYDLLHAHSVFSLYDGRCKMEDILLEMDRILR  565

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG VI RDD+DVL+KVK   + +QW S + DHE+GP+QREK++ AVK YWT
Sbjct  566   PEGCVIFRDDIDVLVKVKNNIEEMQWNSVIFDHEEGPMQREKVMVAVKQYWT  617



>emb|CDY27362.1| BnaC04g50430D [Brassica napus]
Length=1009

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/543 (69%), Positives = 439/543 (81%), Gaps = 15/543 (3%)
 Frame = -2

Query  1635  HDEDSVKV----YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPA  1468
             HD   VK     +P C  K SE+TPCED +RSL + R RL YR+RHCP++ E LKCRIPA
Sbjct  75    HDPPPVKAATVSFPSCGAKLSEHTPCEDAKRSLKFPRGRLEYRQRHCPEREEALKCRIPA  134

Query  1467  PFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAY  1288
             P+GY+ PF+WPESRDVAW+ NVPH ELTVEK  QNW+R+E DRF FPGGGTMF  GAD+Y
Sbjct  135   PYGYKTPFRWPESRDVAWFANVPHTELTVEKKNQNWVRYENDRFWFPGGGTMFPRGADSY  194

Query  1287  IDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGV  1108
             IDDIG+LI+L  GSIRTA+DTGCGVASFGAYLLSRNI TMSFAPRDTH++QVQFALERGV
Sbjct  195   IDDIGQLIDLSHGSIRTAIDTGCGVASFGAYLLSRNITTMSFAPRDTHEAQVQFALERGV  254

Query  1107  PALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIR  928
             PA+IGI+A+ RLPYPS+AFD+AHCSRCLIPWGQ  G YL+EVDRVLRPGGYWILSGPPI 
Sbjct  255   PAMIGIMATIRLPYPSRAFDLAHCSRCLIPWGQNGGVYLMEVDRVLRPGGYWILSGPPIN  314

Query  927   WKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--  754
             W+  W+GW+RT +DL  EQTQIE+VA SLCWKK ++ DD+AIWQKP+NH+ C + +Q   
Sbjct  315   WQNRWKGWERTMDDLNTEQTQIEQVARSLCWKKVVQRDDLAIWQKPFNHIHCKKNKQVLK  374

Query  753   PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKEL--------EKWPKRLNAVPPRIKRG  598
              P  C    DPDMAWY  + +CLTPLP+V ++++L        EKWP RLNAVPPRI +G
Sbjct  375   KPKFCRHDQDPDMAWYMKMDSCLTPLPEVDEDEDLKTVAGGKVEKWPARLNAVPPRINKG  434

Query  597   TIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSL  418
              +  I+ E F +D+ LW +R+S+Y   +D QL E GRYRN+LDMNA++GGFAAAL D  +
Sbjct  435   DLKEITPEGFLEDTKLWKQRVSYYKK-LDYQLGETGRYRNLLDMNAYVGGFAAALADEPV  493

Query  417   WVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEME  238
             WVMNVVPVE+KLNTLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+FTLY+D+CE E
Sbjct  494   WVMNVVPVEAKLNTLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFTLYQDKCEPE  553

Query  237   DILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKT  58
             DILLEMDRILRP G VIIRDDVDVLIKVK +T GLQWE R+ DHE  P +R K+ +AVK 
Sbjct  554   DILLEMDRILRPGGGVIIRDDVDVLIKVKELTKGLQWEGRIADHEKSPHERVKIYYAVKQ  613

Query  57    YWT  49
             YWT
Sbjct  614   YWT  616



>ref|XP_010250929.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250938.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250946.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250956.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250965.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250972.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
 ref|XP_010250980.1| PREDICTED: probable methyltransferase PMT18 [Nelumbo nucifera]
Length=633

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/627 (60%), Positives = 474/627 (76%), Gaps = 26/627 (4%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S   +L ++  ++  C LSY  G WQN       S        + T   C    NTA  +
Sbjct  16    SKRKRLTWILCVSGLCVLSYVLGAWQNTTSPPLKSS------DVYTKVGCDGESNTAGKV  69

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
              S++   +     LDF  HH        +G ++ D ++ +PPCD+ YSEYTPC+D  R  
Sbjct  70    RSSSSLSTVS---LDFEAHHQ-------VGINETDGIEKFPPCDMTYSEYTPCQDPVRGR  119

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              +DR  L YRERHCP K E+L+C IPAP  Y+NPFKWP+SRD AWY N+PHKEL++EKAV
Sbjct  120   KFDRNMLKYRERHCPTKEELLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHKELSIEKAV  179

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNWI+ EG+RF+FPGGGTMF  GADAYIDDI KLI L  G+IRTALDTGCGVAS+GAYLL
Sbjct  180   QNWIQVEGNRFRFPGGGTMFPRGADAYIDDINKLIPLTSGTIRTALDTGCGVASWGAYLL  239

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
              RNIL MSFAPRDTH++QVQFALERGVPA+IG++AS+R+PYP++AFDMAHCSRCLIPW Q
Sbjct  240   KRNILAMSFAPRDTHEAQVQFALERGVPAMIGVMASQRMPYPARAFDMAHCSRCLIPWQQ  299

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
             YDG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RT+EDL+ EQ  IEK+A S+CWKK
Sbjct  300   YDGLYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTQEDLKQEQDAIEKIAKSICWKK  359

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              +E DD+AIWQKP NH+DC++ R+    P +C  S+ PD AWY +++ C+TPLP++S   
Sbjct  360   VIEKDDLAIWQKPLNHIDCVKSRRVFKTPHIC-KSDAPDTAWYRNMEPCITPLPEISSSD  418

Query  654   E-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
             E     LEKWP+R  +VPPRIK G+I  I+ +KF++D+ LW  R++ Y  ++    +  G
Sbjct  419   EVAGGALEKWPERAFSVPPRIKSGSIPSITAKKFQEDNELWKDRLTRYKRIIPP--LTQG  476

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             R+RN++DMNA++GGFAAALV + +WVMNVVP  +  +TLGVIYERG IGTYH WCEA ST
Sbjct  477   RFRNIMDMNAYMGGFAAALVKYPVWVMNVVPANTNQDTLGVIYERGFIGTYHDWCEAFST  536

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD VDVL+K++ ITDG++
Sbjct  537   YPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKIQSITDGMR  596

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             W+S+++DHE GP   EK+L AVKTYWT
Sbjct  597   WKSQIMDHESGPFNPEKILVAVKTYWT  623



>ref|XP_004492680.1| PREDICTED: probable methyltransferase PMT15-like [Cicer arietinum]
Length=1073

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/527 (69%), Positives = 431/527 (82%), Gaps = 9/527 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             P CDV  SEYTPCED +RSL + RE L+YRERHCP+K E+L+CRIPAPFGYR P +WPES
Sbjct  113   PVCDVSLSEYTPCEDVQRSLKFPRENLMYRERHCPEKKEILRCRIPAPFGYRVPPRWPES  172

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AWY NVPHKELT+EK  QNW+      F+FPGGGTMF  GA AYIDDIGKLINLKDG
Sbjct  173   RDWAWYANVPHKELTIEKMKQNWVXXXXXXFRFPGGGTMFPRGAGAYIDDIGKLINLKDG  232

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             SIRTALDTGCGVAS+GAYLL R+I+ +SFAPRDTH++QVQFALERGVPALIG++AS RLP
Sbjct  233   SIRTALDTGCGVASWGAYLLPRDIIAVSFAPRDTHEAQVQFALERGVPALIGVIASIRLP  292

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YPS++FDMAHCSRCLIPWGQ DG YL EVDRVLRPGGYWILSGPPI W+ +W+GW+RT E
Sbjct  293   YPSRSFDMAHCSRCLIPWGQNDGIYLAEVDRVLRPGGYWILSGPPINWETHWKGWERTRE  352

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDM  715
              L  EQ  IE V  SLCWKK ++  DIAIWQKP NH+ C   R+     P C A  DPD 
Sbjct  353   SLNEEQDSIESVTKSLCWKKLVQKGDIAIWQKPTNHVHCKITRKIFKHRPFCDA-KDPDS  411

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT + TCLTPLP+V+D K+     L  WP+RL ++PPRI  G+++GI+ EKF ++S L
Sbjct  412   AWYTKMDTCLTPLPEVNDIKDVSGGGLSNWPERLTSIPPRISSGSLEGITAEKFNENSEL  471

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+++Y   +D QL E GRYRN+LDMNA+LGGFAAAL+D+ +WVMNVVPVE+++NTLG
Sbjct  472   WKKRVAYYK-TLDYQLAERGRYRNLLDMNAYLGGFAAALIDYPVWVMNVVPVEAEINTLG  530

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              ++ERGLIGTY  WCEAMSTYPRTYD IH DSIF+LY+DRC +EDILLEMDRILRP+GSV
Sbjct  531   AVFERGLIGTYQNWCEAMSTYPRTYDFIHGDSIFSLYQDRCNIEDILLEMDRILRPQGSV  590

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             I+RDDVDVL+KVK+  D +QW++R+ DHE GP QREK+L AVK YWT
Sbjct  591   ILRDDVDVLLKVKKFVDSMQWDARIADHEKGPHQREKILIAVKQYWT  637



>ref|XP_006857883.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
 gb|ERN19350.1| hypothetical protein AMTR_s00069p00110310 [Amborella trichopoda]
Length=639

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/532 (67%), Positives = 442/532 (83%), Gaps = 9/532 (2%)
 Frame = -2

Query  1620  VKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFK  1441
              +++PPC+ + SEYTPCED +RSL ++R+RLIYRERHCP+K E+LKCRIPAPFGY+ PF 
Sbjct  89    ARLFPPCEPRLSEYTPCEDRDRSLKFERQRLIYRERHCPEKGELLKCRIPAPFGYKRPFP  148

Query  1440  WPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLIN  1261
             WP+SRD AW+ NVPH+EL+VEKAVQNWIR EG+RF+FPGGGTMF  GADAYIDDI KL+ 
Sbjct  149   WPQSRDFAWFNNVPHRELSVEKAVQNWIRVEGERFRFPGGGTMFPRGADAYIDDIEKLVP  208

Query  1260  LKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILAS  1081
             L++GSIRTA+DTGCGVAS+GAYL+SR+IL MSFAPRDTH++QVQFALERGVPA+IG+LAS
Sbjct  209   LRNGSIRTAIDTGCGVASWGAYLMSRDILAMSFAPRDTHEAQVQFALERGVPAMIGVLAS  268

Query  1080  KRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWD  901
             KRLPYP +AFDMAHCSRCLIPW  +DG  LIEVDR+LRPGGYWILSGPPI WK +W+GW 
Sbjct  269   KRLPYPCRAFDMAHCSRCLIPWHLHDGQNLIEVDRILRPGGYWILSGPPINWKTHWKGWQ  328

Query  900   RTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPA-S  730
             RT +DL AEQ  IE VA SLCWKK  E  DIA+WQKP NH+ C   R+    P  C A  
Sbjct  329   RTTKDLMAEQNAIEAVARSLCWKKIKERGDIAVWQKPSNHVHCKINRKVFKNPQFCKALD  388

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D AWY D+ TC+TPLP+V+D K     EL++WP+RL AVPPR+  G+++GI+GE F 
Sbjct  389   SESDSAWYRDMDTCMTPLPEVNDIKEVAGGELKRWPERLMAVPPRVLGGSVEGINGEAFI  448

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             KD+  W KR+S+Y  V+  QL + G YRN+LDMNA LGGFAAAL++  +WVMNVVP ++K
Sbjct  449   KDTEDWKKRVSYYKMVV-YQLGQKGLYRNILDMNAHLGGFAAALIEDPVWVMNVVPPQAK  507

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
             ++TLGV+YERG IGTYH WCEAMSTYPRTYDL+HA+ +FT+ ++RC+MEDILLEMDRILR
Sbjct  508   VDTLGVVYERGFIGTYHDWCEAMSTYPRTYDLLHANGVFTINQNRCDMEDILLEMDRILR  567

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+VI+RDDVD+L K+K I D LQW+++++DHE+GP  REK+L  VK YWT
Sbjct  568   PEGTVILRDDVDLLFKIKEIADALQWDTQMIDHEEGPHIREKILVGVKLYWT  619



>ref|XP_010091548.1| putative methyltransferase PMT15 [Morus notabilis]
 gb|EXB44733.1| putative methyltransferase PMT15 [Morus notabilis]
Length=647

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/530 (67%), Positives = 436/530 (82%), Gaps = 11/530 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC  + +EYTPCED +RSL +DR+RLIYRERHCP   EV++CRIPAP GYR PF+WPE
Sbjct  103   FPPCAAELAEYTPCEDVKRSLRFDRDRLIYRERHCPTPEEVMRCRIPAPSGYRIPFRWPE  162

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGD--RFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             SR VAWY NVPHKELTVEK  QNW+ ++ +  R  FPGGGTMF +GADAYIDDIGK I+L
Sbjct  163   SRGVAWYANVPHKELTVEKKNQNWVHYDKNTGRLTFPGGGTMFPHGADAYIDDIGKFIDL  222

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
             + GSIRTA+DTGCGVAS+GAYL+SR+IL MSFAPRD+H++QVQFALERGVP+LIGILAS 
Sbjct  223   QGGSIRTAIDTGCGVASWGAYLMSRDILAMSFAPRDSHEAQVQFALERGVPSLIGILASI  282

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RLPYPS+AFDMAHCSRCLIPWG+YDG YLIEVDR+LRPGGYWILSGPP+ W+++W+GW+R
Sbjct  283   RLPYPSRAFDMAHCSRCLIPWGKYDGLYLIEVDRILRPGGYWILSGPPVNWEKHWKGWER  342

Query  897   TEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASND  724
             TEEDL+ EQ++IE VA SLCWKK  + DD+AIWQK  NH+ C + R+    P  C    D
Sbjct  343   TEEDLQVEQSEIEAVARSLCWKKLTQKDDLAIWQKSTNHVHCEKTRKVFMKPQFC-QGQD  401

Query  723   PDMAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKD  559
             PD AWYT ++ CLTPLP V+D +     EL KWP+RL +VPPRI  G++ GI+ + F ++
Sbjct  402   PDRAWYTKMENCLTPLPNVTDLREVAGGELAKWPERLTSVPPRISSGSLSGITAKIFLEN  461

Query  558   STLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLN  379
             + +W KR+ +Y +  D QL E GRY N+LDMN++LGGFAAAL+D  +WVMN +PVE++ N
Sbjct  462   TQIWKKRVEYYKS-YDSQLAERGRYWNLLDMNSYLGGFAAALIDDPVWVMNAIPVEAQSN  520

Query  378   TLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPE  199
             TLGVIYERGLIGTY  WCEAMSTYPRTYD IHADS+F+LYK RCEMEDI+LEMDRILRPE
Sbjct  521   TLGVIYERGLIGTYQNWCEAMSTYPRTYDFIHADSVFSLYKHRCEMEDIVLEMDRILRPE  580

Query  198   GSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             GSVIIRDDVD+++K++ I + +Q+ + +VDHEDGP  REK+L A K YWT
Sbjct  581   GSVIIRDDVDLIVKIRPIIEAMQYSTSIVDHEDGPKWREKILLARKQYWT  630



>gb|KHG13750.1| hypothetical protein F383_08462 [Gossypium arboreum]
Length=633

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/636 (58%), Positives = 480/636 (75%), Gaps = 26/636 (4%)
 Frame = -2

Query  1935  PLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCL  1756
             P H+H+      N+L ++  ++  C L Y  G WQ     + T  S+       +  T  
Sbjct  9     PKHHHRL-EVQRNRLTWILGVSFLCILFYMLGAWQRSSTPTTTQFSAYNKGGCDSHVTTS  67

Query  1755  FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYT  1576
              +GN A    S+T         LDF +HH       VL +    +V  +P CD+ +SEYT
Sbjct  68    DNGNAAVGHPSST--------NLDFASHHQ-----VVLNS--SKTVNQFPSCDMSFSEYT  112

Query  1575  PCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPH  1396
             PC+D  R   +DR  L YRERHCP K E+L+C IPAP  Y+ PFKWP+SRD AWY+N+PH
Sbjct  113   PCQDKVRGRKFDRNMLKYRERHCPAKEELLRCLIPAPPQYKTPFKWPQSRDYAWYSNIPH  172

Query  1395  KELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG  1216
             +EL++EKA+QNWI+ EG+RF+FPGGGTMF  GADAYIDDIG+LI L DG+IRTA+DTGCG
Sbjct  173   RELSIEKAIQNWIQLEGNRFRFPGGGTMFPRGADAYIDDIGRLIPLTDGTIRTAIDTGCG  232

Query  1215  VASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHC  1036
             VASFGAYLL+RNILTMSFAPRDTH++QVQFALERGVPA+IGI+ S+RLPYP++AFD+AHC
Sbjct  233   VASFGAYLLNRNILTMSFAPRDTHEAQVQFALERGVPAMIGIMGSQRLPYPARAFDLAHC  292

Query  1035  SRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEK  856
             SRCLIPW +YDG YL EVDR+LRPGGYW+LSGPPI WK++W+GW+RT EDL+ EQ  IE 
Sbjct  293   SRCLIPWQKYDGLYLAEVDRILRPGGYWVLSGPPIHWKKFWRGWERTREDLKQEQDAIED  352

Query  855   VADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLT  682
             VA SLCWKK +E +D+++WQKP NH++C+R ++    P MC  S+DPD AWY +L+ C+T
Sbjct  353   VAKSLCWKKVIEKNDLSVWQKPINHVECLRSKKLLKAPHMC-ESDDPDTAWYRNLEACVT  411

Query  681   PLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAV  517
             PLP+VS   +     +EKWP+R +AVPPRI+ G+  GI+ E+FE+D+ LW +R++HY  +
Sbjct  412   PLPEVSSSDDVAGGAMEKWPERASAVPPRIRSGSTPGITAERFEEDNKLWKERVAHYKRI  471

Query  516   MDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTY  337
             +    +  GRYRN++DMNA++GGFA A++++ +WVMNVVP+ S  +TLGVIYERGLIGTY
Sbjct  472   ISP--LPTGRYRNIMDMNAYIGGFATAMLNYPVWVMNVVPINSNHDTLGVIYERGLIGTY  529

Query  336   HTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIK  157
               WCEA STYPRTYDLIHA  +FTLY++RC++  ILL+MDRILRPEG+VI RD V++L+K
Sbjct  530   QDWCEAFSTYPRTYDLIHASGLFTLYQNRCDITYILLDMDRILRPEGTVIFRDTVELLVK  589

Query  156   VKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++ ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  590   IQSITDGMRWKSQIIDHESGPFNPEKILVAVKTYWT  625



>ref|XP_007039271.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY23772.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=630

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/632 (58%), Positives = 468/632 (74%), Gaps = 27/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H    +   +L ++  ++  C L Y  G WQN    +  S           A T   SG+
Sbjct  11    HHQLEAKRKRLTWILGVSGLCILFYVLGAWQNSTTPTTGSDVYSRVGCDGNATT---SGD  67

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
               + ++ ++         LDF +HH      +        +V  +PPCD+ +SEYTPC+D
Sbjct  68    GNSPVNPSST-------NLDFASHHQVEVDSS-------KTVSQFPPCDMSFSEYTPCQD  113

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R   +DR+ L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  114   KVRGRKFDRDMLKYRERHCPTKEELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHRELS  173

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDIG+LI L DG+IRTA+DTGCGVASF
Sbjct  174   IEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIGQLIPLTDGTIRTAVDTGCGVASF  233

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL RN+LTMS APRDTH++QVQFALERGVPA+IGI+ S+RLPYP++AFD+AHCSRCL
Sbjct  234   GAYLLKRNVLTMSIAPRDTHEAQVQFALERGVPAMIGIMGSQRLPYPARAFDLAHCSRCL  293

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW +YDG YL EVDR+LRPGGYW+LSGPPI WK+YW+GW+RT+EDL+ EQ  IE VA  
Sbjct  294   IPWQKYDGLYLTEVDRILRPGGYWVLSGPPIHWKKYWRGWERTQEDLKQEQDAIEDVAKR  353

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+++WQKP NH++CI+ ++    P +C  S++PD AWY DL+ C+TPLP+
Sbjct  354   LCWKKVIENNDLSVWQKPINHIECIKSKKVIKTPHIC-KSDNPDTAWYRDLEACITPLPE  412

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             VS   +     +EKWP+R  AVPPRI  G+I GI+ EKF +D+ LWN R+ HY  ++   
Sbjct  413   VSSSDDVAGGAVEKWPERAFAVPPRISSGSIPGITAEKFREDNELWNDRVEHYKRII--S  470

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
             L+  GRYRN++DMNA+LGGFAAAL+ + +WVMNVVP  S  NTLG IYERGLIGTY  WC
Sbjct  471   LLPTGRYRNIMDMNAYLGGFAAALLKYPVWVMNVVPANSDHNTLGAIYERGLIGTYQDWC  530

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD V++L+K+K I
Sbjct  531   EAFSTYPRTYDLIHASGLFSIYQDRCDITYILLEMDRILRPEGTVIFRDSVELLVKIKSI  590

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             TDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  591   TDGMRWKSQIMDHESGPFNPEKILVAVKTYWT  622



>ref|XP_004145886.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
 gb|KGN49950.1| hypothetical protein Csa_5G146240 [Cucumis sativus]
Length=636

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/632 (59%), Positives = 473/632 (75%), Gaps = 24/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   ++ ++  ++  C LSY FG WQ+       S +     K+        S N
Sbjct  11    HHHIESRRKRVTWILAVSGLCILSYMFGAWQSTTTPINQSEAYS---KVGCPDQTFPSTN  67

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
             T +   S+T +       LDF +HHG       + N  E   K   PCD+ +SEYTPC+D
Sbjct  68    TQSKAQSSTPTR-----SLDFDSHHGVE-----INNTIEAVTKTIFPCDMSFSEYTPCQD  117

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R+  +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  118   PTRARKFDRTMLKYRERHCPAKEELLHCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELS  177

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G IRTA+DTGCGVAS+
Sbjct  178   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASW  237

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDMAHCSRCL
Sbjct  238   GAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDMAHCSRCL  297

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPWG+ DG YLIE+DRVLRPGGYWILSGPPIRWK+YW+GW+RT+EDL+ EQ  IE+VA  
Sbjct  298   IPWGKNDGLYLIELDRVLRPGGYWILSGPPIRWKKYWRGWERTQEDLKEEQDTIEEVARR  357

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH+ CI+ ++    P +C  S++PD  WY +++TC+TPLP+
Sbjct  358   LCWKKVIEKNDLAIWQKPLNHIQCIKNKKVYKTPHIC-KSDNPDAGWYRNMETCITPLPE  416

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             V+D +E     +E WP+R  AVPPRI RGTI GI+ E FE+D+ LW +RI++Y  ++   
Sbjct  417   VNDSEEVAGGAVENWPERALAVPPRISRGTIPGITAENFEEDNKLWKERITYYKKMIP--  474

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRN++DMNA LGGFAAALV   +WVMNVVP  S  +TLGVIYERGLIGTY  WC
Sbjct  475   -LAQGRYRNIMDMNANLGGFAAALVKFPVWVMNVVPANSDRDTLGVIYERGLIGTYQDWC  533

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA+ IF++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL+K++ I
Sbjct  534   EAFSTYPRTYDLIHANGIFSIYQDRCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTI  593

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +DG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  594   SDGMKWKSQIMDHETGPFNPEKILVAVKTYWT  625



>ref|XP_004169220.1| PREDICTED: probable methyltransferase PMT18-like [Cucumis sativus]
Length=636

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/632 (59%), Positives = 473/632 (75%), Gaps = 24/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   ++ ++  ++  C LSY FG WQ+       S +     K+        S N
Sbjct  11    HHHLESRRKRVTWILAVSGLCILSYMFGAWQSTTTPINQSEAYS---KVGCPDQTFPSTN  67

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
             T +   S+T +       LDF +HHG       + N  E   K   PCD+ +SEYTPC+D
Sbjct  68    TQSKAQSSTPTR-----SLDFDSHHGVE-----INNTIEAVTKTIFPCDMSFSEYTPCQD  117

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R+  +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  118   PTRARKFDRTMLKYRERHCPAKEELLHCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELS  177

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G IRTA+DTGCGVAS+
Sbjct  178   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASW  237

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDMAHCSRCL
Sbjct  238   GAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDMAHCSRCL  297

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPWG+ DG YLIE+DRVLRPGGYWILSGPPIRWK+YW+GW+RT+EDL+ EQ  IE+VA  
Sbjct  298   IPWGKNDGLYLIELDRVLRPGGYWILSGPPIRWKKYWRGWERTQEDLKEEQDTIEEVARR  357

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH+ CI+ ++    P +C  S++PD  WY +++TC+TPLP+
Sbjct  358   LCWKKVIEKNDLAIWQKPLNHIQCIKNKKVYKTPHIC-KSDNPDAGWYRNMETCITPLPE  416

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             V+D +E     +E WP+R  AVPPRI RGTI GI+ E FE+D+ LW +RI++Y  ++   
Sbjct  417   VNDSEEVAGGAVENWPERALAVPPRISRGTIPGITAENFEEDNKLWKERITYYKKMIP--  474

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRN++DMNA LGGFAAALV   +WVMNVVP  S  +TLGVIYERGLIGTY  WC
Sbjct  475   -LAQGRYRNIMDMNANLGGFAAALVKFPVWVMNVVPANSDRDTLGVIYERGLIGTYQDWC  533

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA+ IF++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL+K++ I
Sbjct  534   EAFSTYPRTYDLIHANGIFSIYQDRCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTI  593

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +DG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  594   SDGMKWKSQIMDHETGPFNPEKILVAVKTYWT  625



>gb|ABR16934.1| unknown [Picea sitchensis]
Length=626

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/541 (66%), Positives = 435/541 (80%), Gaps = 10/541 (2%)
 Frame = -2

Query  1650  AVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIP  1471
             AV GN        +  CD+KYSEYTPC+D +R+  +DR +LIYRERHCP K E LKC IP
Sbjct  81    AVGGNETSKDSINFESCDIKYSEYTPCQDPDRARKFDRTKLIYRERHCPDKKEALKCLIP  140

Query  1470  APFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADA  1291
             AP GY+NPF+WP+SRD AW+ NVPH+ELT+EKAVQNWI+ E D+F+FPGGGTMF  GADA
Sbjct  141   APPGYKNPFRWPKSRDYAWFANVPHRELTIEKAVQNWIQVEDDKFRFPGGGTMFTRGADA  200

Query  1290  YIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERG  1111
             YIDDI KLI L DGSIRTA+DTGCGVAS+GAYLL RNILTMSFAPRDTH++QVQFALERG
Sbjct  201   YIDDIDKLIPLTDGSIRTAIDTGCGVASWGAYLLKRNILTMSFAPRDTHEAQVQFALERG  260

Query  1110  VPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPI  931
             VPA+IGI+AS+R+PYP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPP+
Sbjct  261   VPAMIGIMASQRIPYPARAFDMAHCSRCLIPWKDYDGVYLIEVDRVLRPGGYWILSGPPV  320

Query  930   RWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--  757
              WK+Y +GW+RT EDL+ EQ  IE VA  LCWKK +E  D+AIWQKP NH+DC++ R   
Sbjct  321   NWKKYHRGWERTPEDLKQEQDAIEDVAKRLCWKKVVEKGDLAIWQKPMNHIDCVKSRNIY  380

Query  756   APPPMCPASNDPDMAWYTDLQTCLTPLPQVSD-----EKELEKWPKRLNAVPPRIKRGTI  592
               P +C   N PD AWY  ++TC+TPLP+V+D        LEKWPKR+ AVPPRI+ G+I
Sbjct  381   KVPHICKNDN-PDAAWYRKMETCITPLPEVNDINAVAGGALEKWPKRVTAVPPRIRSGSI  439

Query  591   DGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWV  412
              GI+ E F +DS LW  R+++Y  ++ GQL + GRYRN++DMNA LGGFAAAL +  +WV
Sbjct  440   PGITAENFNEDSKLWTDRVANYKRLI-GQLGQ-GRYRNIMDMNAGLGGFAAALANDPVWV  497

Query  411   MNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDI  232
             MNVVP ++K NTLGVIYERG IGTY  WCEA STYPRTYDLIHA  + ++Y+DRCE+ DI
Sbjct  498   MNVVPSDAKHNTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHASGLLSMYQDRCEISDI  557

Query  231   LLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYW  52
             LLEMDRILRPEG+VI RD VDVL+KV+ +  G++W+S+++DHE GP  +EK+L AVK YW
Sbjct  558   LLEMDRILRPEGTVIFRDTVDVLVKVENLIGGMRWQSQMMDHESGPFNQEKILIAVKQYW  617

Query  51    T  49
             T
Sbjct  618   T  618



>ref|XP_010056104.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056105.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 ref|XP_010056106.1| PREDICTED: probable methyltransferase PMT18 [Eucalyptus grandis]
 gb|KCW72678.1| hypothetical protein EUGRSUZ_E01134 [Eucalyptus grandis]
Length=633

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/632 (59%), Positives = 469/632 (74%), Gaps = 24/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   +L Y+  ++  C L Y  G WQ+    +  S       +  T   C     
Sbjct  11    HHHIESKKKRLTYVFCVSGLCVLFYVLGAWQSTPVPNNQS-------EAYTRIKCDAVNP  63

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
              A    ST  S SS S  LDF +HH        +  +D D+V+  P CD+ +SEYTPC+D
Sbjct  64    NAGDGQSTKLSSSSESVSLDFQSHHQ-------VAINDSDTVETIPACDMAHSEYTPCQD  116

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
              +R   +DR  L YRERHCPKK E+LKC IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  117   PQRGRKFDRNMLKYRERHCPKKDELLKCLIPAPPRYKTPFKWPQSRDYAWYDNIPHRELS  176

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G IRTA+DTGCGVAS+
Sbjct  177   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGKIRTAIDTGCGVASW  236

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+I+TMSFAPRDTH++QVQFALERGVPA+IGI+AS+R+PYP++AFDMAHCSRCL
Sbjct  237   GAYLLKRDIVTMSFAPRDTHEAQVQFALERGVPAMIGIMASQRIPYPARAFDMAHCSRCL  296

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW +YDG YLIEVDRVLRPGGYWILSGPPIRW++YW+GW+RT+EDL+ EQ  IE VA  
Sbjct  297   IPWNKYDGLYLIEVDRVLRPGGYWILSGPPIRWRKYWRGWERTQEDLKQEQDSIEDVAKR  356

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH +CI+ R     P +C A N PD AW  D++TC+TPLP+
Sbjct  357   LCWKKVVEKNDLAIWQKPINHFECIKSRSVYKTPHICKADN-PDTAWNRDMETCITPLPE  415

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             VS   E     +E WP+R  AVPPR+  G+I GI+ +K+++D+ +W  R+SHY  ++   
Sbjct  416   VSSSDEVAGGAVETWPERAFAVPPRVSSGSIPGITAQKYKEDNEIWKDRVSHYKRIISP-  474

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA LGGFAAALV + +WVMNVVPV +  +TLG IYERG IGTY  WC
Sbjct  475   -LTQGRYRNVMDMNANLGGFAAALVKYPVWVMNVVPVNTNHDTLGAIYERGFIGTYQDWC  533

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             E+ STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL+K+K I
Sbjct  534   ESFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVEVLVKIKSI  593

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             TDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  594   TDGMRWKSQIMDHESGPFNPEKILVAVKTYWT  625



>gb|EEE61530.1| hypothetical protein OsJ_15834 [Oryza sativa Japonica Group]
Length=529

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/527 (68%), Positives = 423/527 (80%), Gaps = 17/527 (3%)
 Frame = -2

Query  1617  KVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKW  1438
             + Y  C  KYSEYTPCED ERSL + R+RL+YRERHCP + E L+C +PAP GYRNPF W
Sbjct  10    RTYEACPAKYSEYTPCEDVERSLRFPRDRLVYRERHCPSEGERLRCLVPAPQGYRNPFPW  69

Query  1437  PESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINL  1258
             P SRDVAW+ NVPHKELTVEKAVQNWIR EG++F+FPGGGTMF +GA AYIDDIGK+I L
Sbjct  70    PTSRDVAWFANVPHKELTVEKAVQNWIRVEGEKFRFPGGGTMFPHGAGAYIDDIGKIIPL  129

Query  1257  KDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASK  1078
              DGSIRTALDTGCGVAS+GAYLLSRNIL MSFAPRD+H++QVQFALERGVPA+IG+L+S 
Sbjct  130   HDGSIRTALDTGCGVASWGAYLLSRNILAMSFAPRDSHEAQVQFALERGVPAMIGVLSSN  189

Query  1077  RLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDR  898
             RL YP++AFDMAHCSRCLIPW  YDG YL EVDR+LRPGGYWILSGPPI WK++W+GW R
Sbjct  190   RLTYPARAFDMAHCSRCLIPWQLYDGLYLAEVDRILRPGGYWILSGPPINWKKHWKGWQR  249

Query  897   TEEDLEAEQTQIEKVADSLCWKKFM--EVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             T+EDL AEQ  IE VA SLCWKK    EV DIAIWQKP NH+ C   R+    PP C ++
Sbjct  250   TKEDLNAEQQAIEAVAKSLCWKKITLKEVGDIAIWQKPTNHIHCKASRKVVKSPPFC-SN  308

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
              +PD AWY  ++ C+TPLP+    +           + PRI  G+I+G++ E F +D+ L
Sbjct  309   KNPDAAWYDKMEACITPLPERGSLQ-----------LQPRIASGSIEGVTDEMFVEDTKL  357

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W KR+ HY +V+  Q  + GRYRN+LDMNA  GGFAAALVD  +WVMN+VP      TLG
Sbjct  358   WQKRVGHYKSVIS-QFGQKGRYRNLLDMNARFGGFAAALVDDPVWVMNMVPTVGNSTTLG  416

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
             VIYERGLIG+Y  WCE MSTYPRTYDLIHADS+FTLYKDRC+M++ILLEMDRILRPEG+V
Sbjct  417   VIYERGLIGSYQDWCEGMSTYPRTYDLIHADSVFTLYKDRCQMDNILLEMDRILRPEGTV  476

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IIRDDVD+L+K+K ITDG++W S++VDHEDGPL REKLL  VKTYWT
Sbjct  477   IIRDDVDMLVKIKSITDGMRWNSQIVDHEDGPLVREKLLLVVKTYWT  523



>ref|XP_008437487.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
 ref|XP_008437488.1| PREDICTED: probable methyltransferase PMT18 [Cucumis melo]
Length=636

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/632 (59%), Positives = 468/632 (74%), Gaps = 24/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   ++ ++  ++  C LSY  G WQ+       S         A AK       
Sbjct  11    HHHLESRRKRVTWILAVSGLCILSYMLGAWQSTTTPINQSE--------AYAKVGCPDQT  62

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
               +T + +    S+ +  LDF +HHG       + N  E   K   PCD+ +SEYTPC+D
Sbjct  63    FPSTNTQSKAQSSTPTRSLDFQSHHGVE-----INNTIEAVTKTISPCDMSFSEYTPCQD  117

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R+  +DR  L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  118   PTRARKFDRTMLKYRERHCPAKEEQLLCMIPAPPKYKTPFKWPQSRDYAWYDNIPHRELS  177

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G IRTA+DTGCGVAS+
Sbjct  178   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTTGKIRTAIDTGCGVASW  237

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDMAHCSRCL
Sbjct  238   GAYLLKRDILAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDMAHCSRCL  297

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW + DG YLIE+DRVLRPGGYWILSGPPIRWK+YW+GW+RT+EDL+ EQ  IE+VA  
Sbjct  298   IPWAKNDGLYLIELDRVLRPGGYWILSGPPIRWKKYWRGWERTQEDLKEEQDSIEEVARR  357

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH+ CI+ ++    P +C  S++PD  WY +++TC+TPLP+
Sbjct  358   LCWKKVIEKNDLAIWQKPLNHIQCIKNKKVYKTPHIC-KSDNPDAGWYRNMETCITPLPE  416

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             V+D +E     +E WP+R  AVPPRI RGTI GI+ E FE+D+ LW +RI++Y  ++   
Sbjct  417   VNDSEEVAGGAVENWPERALAVPPRISRGTIPGITVENFEEDNKLWRERITYYKKMIP--  474

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRN++DMNA LGGFAAALV   +WVMNVVP  S  +TLGVIYERG IGTY  WC
Sbjct  475   -LAQGRYRNIMDMNANLGGFAAALVKFPVWVMNVVPANSDRDTLGVIYERGFIGTYQDWC  533

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA+ IF++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL+K++ I
Sbjct  534   EAFSTYPRTYDLIHANGIFSIYQDRCDITQILLEMDRILRPEGTVIFRDTVEVLVKIQTI  593

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +DG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  594   SDGMRWKSQIMDHETGPFNPEKILVAVKTYWT  625



>ref|XP_010660482.1| PREDICTED: probable methyltransferase PMT18 isoform X1 [Vitis 
vinifera]
Length=652

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/536 (65%), Positives = 433/536 (81%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++    + +PPCD+ YSEYTPC+D  R+  +DR  L YRERHCP K E+L C IPAP  Y
Sbjct  112   NNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTKDELLLCLIPAPPKY  171

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             +NPFKWP+SRD AWY N+PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  172   KNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  231

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +LI L  G+IRTA+DTGCGVAS+GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+I
Sbjct  232   NELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVPAMI  291

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             GILAS+R+PYP++AFDMAHCSRCLIPW  YDG YL+EVDRVLRPGGYWILSGPPIRWK+Y
Sbjct  292   GILASQRMPYPARAFDMAHCSRCLIPWNAYDGLYLLEVDRVLRPGGYWILSGPPIRWKKY  351

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPM  742
             W+GW+RT+EDL+ EQ  IE VA  LCWKK  E  D+A+WQKP NH+ C+  R+    P +
Sbjct  352   WRGWERTQEDLKQEQDAIEDVAMRLCWKKVFEKGDLAVWQKPINHIRCVESRKLIKTPHI  411

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PD AWY D++TC+TPLP V D +E     LEKWPKR  ++PPRI  G++ GI+ 
Sbjct  412   C-KSDNPDTAWYRDMETCITPLPDVRDSEEVAGGALEKWPKRAFSIPPRINSGSLPGITA  470

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             + F++D+ LW  R++HY  ++ G  +  GRYRNV+DMNA+LGGFAAAL+ + +WVMNV+P
Sbjct  471   QNFQEDNELWKDRVAHYKQIIRG--LHQGRYRNVMDMNAYLGGFAAALLKYHVWVMNVIP  528

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  +TLGVIYERG IGTYH WCEA STYPRTYDLIHA ++F++Y+DRC++  ILLE+D
Sbjct  529   ANSNQDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHASNVFSIYQDRCDITHILLEID  588

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+ I RD V+VL+K++ ITDG++W S+++DHE GP   EK+L AVK+YWT
Sbjct  589   RILRPEGTAIFRDTVEVLVKIQSITDGMRWNSQIMDHESGPFNPEKILVAVKSYWT  644



>ref|XP_002270920.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660487.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
 ref|XP_010660490.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Vitis 
vinifera]
Length=632

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/536 (65%), Positives = 433/536 (81%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++    + +PPCD+ YSEYTPC+D  R+  +DR  L YRERHCP K E+L C IPAP  Y
Sbjct  92    NNSGGTQSFPPCDMSYSEYTPCQDPVRARKFDRNMLKYRERHCPTKDELLLCLIPAPPKY  151

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             +NPFKWP+SRD AWY N+PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  152   KNPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  211

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +LI L  G+IRTA+DTGCGVAS+GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+I
Sbjct  212   NELIPLTGGTIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVPAMI  271

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             GILAS+R+PYP++AFDMAHCSRCLIPW  YDG YL+EVDRVLRPGGYWILSGPPIRWK+Y
Sbjct  272   GILASQRMPYPARAFDMAHCSRCLIPWNAYDGLYLLEVDRVLRPGGYWILSGPPIRWKKY  331

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPM  742
             W+GW+RT+EDL+ EQ  IE VA  LCWKK  E  D+A+WQKP NH+ C+  R+    P +
Sbjct  332   WRGWERTQEDLKQEQDAIEDVAMRLCWKKVFEKGDLAVWQKPINHIRCVESRKLIKTPHI  391

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PD AWY D++TC+TPLP V D +E     LEKWPKR  ++PPRI  G++ GI+ 
Sbjct  392   C-KSDNPDTAWYRDMETCITPLPDVRDSEEVAGGALEKWPKRAFSIPPRINSGSLPGITA  450

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             + F++D+ LW  R++HY  ++ G  +  GRYRNV+DMNA+LGGFAAAL+ + +WVMNV+P
Sbjct  451   QNFQEDNELWKDRVAHYKQIIRG--LHQGRYRNVMDMNAYLGGFAAALLKYHVWVMNVIP  508

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  +TLGVIYERG IGTYH WCEA STYPRTYDLIHA ++F++Y+DRC++  ILLE+D
Sbjct  509   ANSNQDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHASNVFSIYQDRCDITHILLEID  568

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+ I RD V+VL+K++ ITDG++W S+++DHE GP   EK+L AVK+YWT
Sbjct  569   RILRPEGTAIFRDTVEVLVKIQSITDGMRWNSQIMDHESGPFNPEKILVAVKSYWT  624



>gb|KDP25187.1| hypothetical protein JCGZ_20343 [Jatropha curcas]
Length=626

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/632 (58%), Positives = 464/632 (73%), Gaps = 31/632 (5%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H    S   +L ++  ++  C L Y  G WQN                  T ++ +F+  
Sbjct  11    HHQLESKRKRLTWILGVSGLCILFYVLGAWQNTSP--------------PTNRSEVFNRV  56

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
                       + +  S  LDF +HH        +  ++ D+V  +P CD+ +SEYTPC+ 
Sbjct  57    GCDVAPPAAANSNPSSILLDFDSHHQ-------IEINNTDTVANFPSCDMSFSEYTPCQH  109

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
              +R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  110   PQRGRKFDRNMLKYRERHCPTKEELLFCLIPAPPKYKTPFKWPQSRDYAWYDNIPHRELS  169

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRTA+DTGCGVAS+
Sbjct  170   IEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYIDDINELIPLTGGTIRTAIDTGCGVASW  229

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R IL MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDMAHCSRCL
Sbjct  230   GAYLLKREILAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDMAHCSRCL  289

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW QYDG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+R +EDL+ EQ  IE VA  
Sbjct  290   IPWHQYDGLYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERKQEDLKQEQDAIEDVAKR  349

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E  D+A+WQKP NH++C+R R+    P +C  S++PD AWY D++ C+TPLP+
Sbjct  350   LCWKKVVEKKDLAVWQKPVNHIECVRSRKMYKTPHIC-KSDNPDAAWYKDMEACITPLPE  408

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             VS   E     LEKWP+R  A+PPRI+ G++ GIS EKF +D+ LW  R++ Y  ++  +
Sbjct  409   VSSSDEVAGGALEKWPERAFAIPPRIRSGSLPGISAEKFMEDNELWKDRVTRYKHII--R  466

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA+LGGFAAAL+ H LWVMNVVP  S  +TLGVI+ERGLIGTY  WC
Sbjct  467   PLTQGRYRNVMDMNAYLGGFAAALIKHPLWVMNVVPANSDHDTLGVIFERGLIGTYQDWC  526

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA+ +F++Y+DRC++  ILLEMDRILRPEG+ I RD V+VL+K++ I
Sbjct  527   EAFSTYPRTYDLIHANGVFSIYQDRCDITYILLEMDRILRPEGTAIFRDTVEVLVKIQSI  586

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             T+G++W S+++DHE GP   EK+L AVK+YWT
Sbjct  587   TNGMRWTSQIMDHESGPFNPEKILVAVKSYWT  618



>ref|XP_008378063.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378064.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008378065.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/634 (57%), Positives = 463/634 (73%), Gaps = 27/634 (4%)
 Frame = -2

Query  1929  HNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFS  1750
               H +  S   +L ++  +   C   Y  G WQ        S       ++   +T   S
Sbjct  10    QKHHHVESKKKRLTWIFGIFALCIACYMLGAWQTTSAPVNRSELYQ---RVGCDETSSQS  66

Query  1749  GNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPC  1570
             GN  ++  S++         LDF +HH        +  +  ++V+ +PPCD+ YSEYTPC
Sbjct  67    GNKTSSPVSSSPLR------LDFESHHQ-------VDVNKTEAVQKFPPCDMSYSEYTPC  113

Query  1569  EDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKE  1390
             +D  R   +DR+ L +RERHCP K E L C IPAP  Y+ PFKWP+SRD AWY N+PH+E
Sbjct  114   QDPRRGRKFDRKMLKHRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRE  173

Query  1389  LTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVA  1210
             L++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI  LI L  G+IRTA+DTGCGVA
Sbjct  174   LSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINXLIPLTKGNIRTAIDTGCGVA  233

Query  1209  SFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSR  1030
             S+GAYLL RNI+TMSFAPRD+H +QVQFALERGVPA+IG++ASKRLPYP++AFDMAHCSR
Sbjct  234   SWGAYLLKRNIVTMSFAPRDSHAAQVQFALERGVPAMIGVMASKRLPYPARAFDMAHCSR  293

Query  1029  CLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVA  850
             CLIPW  YDG YLIEVDRVLRPGGYW+LSGPPI WK++W+GW+RTEEDL+ EQ  IE VA
Sbjct  294   CLIPWMNYDGMYLIEVDRVLRPGGYWVLSGPPINWKKHWRGWERTEEDLKQEQDSIESVA  353

Query  849   DSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPL  676
               LCWKK +E +D+AIWQKP NH++CI+ R+    P +C  S++PDMAW  D+++C+TPL
Sbjct  354   KRLCWKKVIEKNDLAIWQKPINHVECIKSRKVYKTPHIC-KSDNPDMAWERDMESCITPL  412

Query  675   PQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMD  511
             P+ SD  +     LEKWP+R  AVPPRI  G+I GI+ EK  +D+ LW +R+ HY  ++ 
Sbjct  413   PETSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVEHYKRIVP  472

Query  510   GQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHT  331
                +  GRYRNV+DMNA+LGGFAAAL  + +WVM  VP  S  +TLGVIYERG IGTY  
Sbjct  473   ---ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMXTVPANSNQDTLGVIYERGFIGTYQD  529

Query  330   WCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVK  151
             WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V++L+K+K
Sbjct  530   WCEAFSTYPRTYDLIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIK  589

Query  150   RITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  590   AITDGMRWKSQIMDHESGPFNPEKILLAVKTYWT  623



>ref|XP_008348991.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348992.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008348993.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=630

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/634 (57%), Positives = 462/634 (73%), Gaps = 27/634 (4%)
 Frame = -2

Query  1929  HNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFS  1750
               H +  S   +L ++  +   C   Y  G WQ        S       ++   +T   S
Sbjct  10    QKHHHVESKKKRLTWIFGIFALCIACYMLGAWQTTSAPVNRSELYQ---RVGCDETSSQS  66

Query  1749  GNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPC  1570
             GN  ++  S++         LDF +HH        +  +  ++V+ +PPCD+ YSEYTPC
Sbjct  67    GNKTSSPVSSSPLR------LDFESHHQ-------VDVNKTEAVQKFPPCDMSYSEYTPC  113

Query  1569  EDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKE  1390
             +D  R   +DR+ L  RERHCP K E L C IPAP  Y+ PFKWP+SRD AWY N+PH+E
Sbjct  114   QDPRRGRKFDRKMLKXRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRE  173

Query  1389  LTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVA  1210
             L++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI  LI L  G+IRTA+DTGCGVA
Sbjct  174   LSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINXLIPLTKGNIRTAIDTGCGVA  233

Query  1209  SFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSR  1030
             S+GAYLL RNI+TMSFAPRD+H +QVQFALERGVPA+IG++ASKRLPYP++AFDMAHCSR
Sbjct  234   SWGAYLLKRNIVTMSFAPRDSHAAQVQFALERGVPAMIGVMASKRLPYPARAFDMAHCSR  293

Query  1029  CLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVA  850
             CLIPW  YDG YLIEVDRVLRPGGYW+LSGPPI WK++W+GW+RTEEDL+ EQ  IE VA
Sbjct  294   CLIPWMNYDGMYLIEVDRVLRPGGYWVLSGPPINWKKHWRGWERTEEDLKQEQDSIESVA  353

Query  849   DSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPL  676
               LCWKK +E +D+AIWQKP NH++CI+ R+    P +C  S++PDMAW  D+++C+TPL
Sbjct  354   KRLCWKKVIEKNDLAIWQKPINHVECIKSRKVYKTPHIC-KSDNPDMAWERDMESCITPL  412

Query  675   PQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMD  511
             P+ SD  +     LEKWP+R  AVPPRI  G+I GI+ EK  +D+ LW +R+ HY  ++ 
Sbjct  413   PETSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVEHYKRIVP  472

Query  510   GQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHT  331
                +  GRYRNV+DMNA+LGGFAAAL  + +WVM  VP  S  +TLGVIYERG IGTY  
Sbjct  473   ---ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMXTVPANSNQDTLGVIYERGFIGTYQD  529

Query  330   WCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVK  151
             WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V++L+K+K
Sbjct  530   WCEAFSTYPRTYDLIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIK  589

Query  150   RITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  590   AITDGMRWKSQIMDHESGPFNPEKILLAVKTYWT  623



>ref|XP_004503565.1| PREDICTED: probable methyltransferase PMT18-like [Cicer arietinum]
Length=624

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/636 (58%), Positives = 467/636 (73%), Gaps = 35/636 (6%)
 Frame = -2

Query  1935  PLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCL  1756
             P H  Q   S  N+L ++  ++  C LSY  G W+N       S         A +K   
Sbjct  9     PKHYSQL-ESKRNRLTWILGVSGLCILSYVMGAWKNTPTPINQSE--------AYSKVDC  59

Query  1755  FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYT  1576
               G+T +   S++         LDF +HH        L  +++  ++ +PPCD+ YSEYT
Sbjct  60    NIGSTQSNKGSSS--------NLDFASHHS-------LEINNQGGLQEFPPCDMTYSEYT  104

Query  1575  PCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPH  1396
             PC+D  R   +DR  L YRERHCP K E+L C +PAP  Y+ PFKWP+SRD AWY N+PH
Sbjct  105   PCQDPARGRKFDRNMLKYRERHCPTKEELLFCLVPAPPKYKTPFKWPQSRDYAWYDNIPH  164

Query  1395  KELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG  1216
             KEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRTA+DTGCG
Sbjct  165   KELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGNIRTAIDTGCG  224

Query  1215  VASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHC  1036
             VAS+GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDMAHC
Sbjct  225   VASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDMAHC  284

Query  1035  SRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEK  856
             SRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RT+EDL+ EQ  IE+
Sbjct  285   SRCLIPWNKYDGMYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTQEDLKQEQDSIEE  344

Query  855   VADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLT  682
             VA S+CWKK +E DD++IWQKP NH++C + +Q    P +C  S++PDMAWY +++ C+T
Sbjct  345   VAKSICWKKVVEKDDLSIWQKPKNHIECAQTKQVYKTPHIC-QSDNPDMAWYQNMEKCIT  403

Query  681   PLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAV  517
             PLP+V         ELEKWPKR   VPPRI  G+I  I+ EKF+KD+ LW  R++HY  +
Sbjct  404   PLPEVGSSSKVAGGELEKWPKRAFTVPPRISSGSIPNINAEKFQKDNELWKDRMAHYKHI  463

Query  516   MDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTY  337
                  +  GRYRN++DMNA+LGGFAAAL+ + +WVMNVVP  S  +TLG IYERG IGTY
Sbjct  464   TP---IGQGRYRNIIDMNAYLGGFAAALLKYPVWVMNVVPSNSAHDTLGAIYERGFIGTY  520

Query  336   HTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIK  157
             H WCEA STYPRTYDLIHA  +F +Y+DRC +  ILLEMDRILRPEG+V+ R+ V++L K
Sbjct  521   HDWCEAFSTYPRTYDLIHAGGVFGMYQDRCNITVILLEMDRILRPEGTVVFREGVELLTK  580

Query  156   VKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +K +TD ++W+S ++DHE+GP   EK+L A KTYWT
Sbjct  581   IKSVTDAMKWKSNIMDHENGPFNPEKILVAEKTYWT  616



>ref|XP_010933740.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=632

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/630 (58%), Positives = 471/630 (75%), Gaps = 23/630 (4%)
 Frame = -2

Query  1917  YYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNta  1738
             +  S   +L ++  ++  C L Y  G WQN      +         ++    C  +   +
Sbjct  12    HLDSRRQRLTWVLGVSGLCVLFYVLGAWQNPAVPKSSG-------NVSNKIECDAANPLS  64

Query  1737  ttlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTE  1558
              + S+     SS +AGLDF   H          N    +V+ + PC + +SEYTPC+D  
Sbjct  65    NSRSTAVPLFSSSNAGLDFEARHQLDL------NETLATVEKFQPCALNFSEYTPCQDRT  118

Query  1557  RSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVE  1378
             R   ++RE LIYRERHCP+K E+++C IPAP  Y+ PFKWP+SRD AW+ N+PHKEL++E
Sbjct  119   RGRRFEREMLIYRERHCPEKDELIRCLIPAPPNYKTPFKWPQSRDYAWFDNIPHKELSIE  178

Query  1377  KAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGA  1198
             KAVQNW+  EGDRF+FPGGGTMF  GADAYIDDI  LI+L DGSIRTA+DTGCGVASFGA
Sbjct  179   KAVQNWVIVEGDRFRFPGGGTMFPRGADAYIDDINALISLTDGSIRTAIDTGCGVASFGA  238

Query  1197  YLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIP  1018
             YLL R+++TMSFAPRDTH++QVQFALERGVPA+IG++ S+R+PYP++AFDMAHCSRCLIP
Sbjct  239   YLLKRDVITMSFAPRDTHEAQVQFALERGVPAMIGVIGSQRMPYPARAFDMAHCSRCLIP  298

Query  1017  WGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLC  838
             W + DG YLIEVDRVLRPGGYWILSGPPI WK+Y++GW+RT+EDL+ EQ  IE VA  LC
Sbjct  299   WFKNDGLYLIEVDRVLRPGGYWILSGPPIHWKKYYKGWERTQEDLKQEQDSIEDVAKHLC  358

Query  837   WKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVS  664
             WKK +E DD+AIWQKP NH++CI+ R+    P +C  +++ D AWY  L+ C+TPLP+V+
Sbjct  359   WKKVIENDDLAIWQKPINHIECIQSRKIHKTPHIC-KNDNADAAWYKKLEVCITPLPEVN  417

Query  663   DEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             +E+     ELEKWP R  AVPPRI RG+I G++ E FE+D+ +W +R++HY  ++    +
Sbjct  418   NEEEVAGGELEKWPYRAFAVPPRISRGSIPGVTAENFEEDNQMWKERVTHYKRIVPP--L  475

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
               GRYRNV+DMNA LGGFAAAL+ + +WVMNVVPV S  +TLGVIYERG IGTY  WCEA
Sbjct  476   PQGRYRNVMDMNANLGGFAAALIKYPVWVMNVVPVNSDRDTLGVIYERGFIGTYQDWCEA  535

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
              STYPRTYDL+HA+ +F+ Y+DRC++  ILLEMDRILRP+G+VIIRD V+VL KVK ITD
Sbjct  536   FSTYPRTYDLLHANGVFSTYQDRCDITYILLEMDRILRPQGTVIIRDIVEVLTKVKAITD  595

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G++W+S+++DHE GP + EK+L AVKTYWT
Sbjct  596   GMRWKSQIMDHESGPFKPEKILVAVKTYWT  625



>ref|XP_001778231.1| predicted protein [Physcomitrella patens]
 gb|EDQ56898.1| predicted protein [Physcomitrella patens]
Length=602

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/555 (63%), Positives = 436/555 (79%), Gaps = 14/555 (3%)
 Frame = -2

Query  1692  GLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRER  1513
             GLDF+ HH      + L +    +   + PCD+KYSEYTPCEDTERSL + R++LIYRER
Sbjct  44    GLDFSAHH------SSLNSESGSNYTTFEPCDMKYSEYTPCEDTERSLKFPRDKLIYRER  97

Query  1512  HCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFK  1333
             HCPK+ E+L+C IPAP GYRNP  WP+SRD  W+ N PHKELTVEKA+Q W++F+G++  
Sbjct  98    HCPKEDELLQCLIPAPAGYRNPLPWPQSRDYTWFANTPHKELTVEKAIQKWVQFQGEKLY  157

Query  1332  FPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPR  1153
             FPGGGT    GAD YIDDI  LI L DGSIRTA+DTGCGVAS+GAYLL +N+LTMSFAPR
Sbjct  158   FPGGGTFSAGGADKYIDDIAALIPLNDGSIRTAIDTGCGVASWGAYLLKKNVLTMSFAPR  217

Query  1152  DTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRV  973
             DTH SQVQFALERGVPA++G++A  R+PYP+++FDMAHCSRCLIPW +YD  YLIEVDRV
Sbjct  218   DTHISQVQFALERGVPAILGVMAENRMPYPARSFDMAHCSRCLIPWAKYDSLYLIEVDRV  277

Query  972   LRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQK  793
             LRPGG+WILSGPPI W+ + +GW R+EEDL+ EQ  IE  A +LCWKK+ E D++AIWQK
Sbjct  278   LRPGGFWILSGPPINWETHHKGWQRSEEDLKDEQDSIENAARNLCWKKYAERDNLAIWQK  337

Query  792   PYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPK  634
             P NH  C + R+  + P +C  + +PDMAWY  ++TC+TPLP+V D KE     L KWP 
Sbjct  338   PLNHAKCEKQRKLDSSPHICSRAENPDMAWYWKMETCITPLPEVKDTKEVAGGALAKWPV  397

Query  633   RLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFL  454
             RL  VPPRI   +I G++ E F  D+ LW KR+++Y+A +   LV +GRYRN++DMNA L
Sbjct  398   RLTDVPPRISSESIPGLTAESFRNDNLLWTKRVNYYTAHLITPLV-SGRYRNIMDMNAGL  456

Query  453   GGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADS  274
             GGFAAALV + +WVMNV+P ++KLNTLGVIYERGLIGTY  WCEA STYPRTYDLIHA  
Sbjct  457   GGFAAALVKYPVWVMNVMPFDAKLNTLGVIYERGLIGTYQNWCEAFSTYPRTYDLIHASG  516

Query  273   IFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGP  94
             +F++Y+DRC +EDILLEMDRILRPEG++IIRD+VDVL  V  I++G++WE+R+ DHEDGP
Sbjct  517   VFSMYQDRCNIEDILLEMDRILRPEGAIIIRDEVDVLNNVMMISNGMRWETRIADHEDGP  576

Query  93    LQREKLLFAVKTYWT  49
             L  EK+L  VKTYW 
Sbjct  577   LVSEKILIGVKTYWV  591



>ref|XP_006846537.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
 gb|ERN08212.1| hypothetical protein AMTR_s00018p00198280 [Amborella trichopoda]
Length=634

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/623 (59%), Positives = 469/623 (75%), Gaps = 22/623 (4%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsstt  1717
             +L ++  ++  C + Y  G WQN   ++           I+  + C    +T    SS  
Sbjct  20    RLTWVLGVSGLCIIFYILGAWQNTTPSASDRS------SISNKEGCDGISSTTYQSSSLR  73

Query  1716  qslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDR  1537
              S SS S+ LDF +HH       V  N      + +P C++K+SEYTPC+D +R+  +++
Sbjct  74    TSSSSPSSSLDFESHHQ------VSSNDTSAGFQKFPACEMKFSEYTPCQDPKRARKFEK  127

Query  1536  ERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWI  1357
             + LIYRERHCP K E+L+C IPAP GY+NPF WP SRD AWY NVPHKELT+EKAVQNWI
Sbjct  128   KMLIYRERHCPAKDELLRCLIPAPPGYKNPFPWPRSRDWAWYANVPHKELTIEKAVQNWI  187

Query  1356  RFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNI  1177
             + EG++F+FPGGGTMF  GADAYIDDI +LI L  G IRTALDTGCGVAS+GAYLLSRNI
Sbjct  188   QVEGEKFRFPGGGTMFPRGADAYIDDINELIPLTSGKIRTALDTGCGVASWGAYLLSRNI  247

Query  1176  LTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGA  997
             L MSFAPRDTH++QVQFALERGVPA+IG+LAS+R+PYP+++FDMAHCSRCLIPW  +DG 
Sbjct  248   LAMSFAPRDTHEAQVQFALERGVPAMIGVLASERMPYPARSFDMAHCSRCLIPWYDFDGL  307

Query  996   YLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEV  817
             +LIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RT++DL  EQ  IE VA  +CWKK +E 
Sbjct  308   FLIEVDRVLRPGGYWILSGPPIRWKKYWKGWERTQKDLNQEQDAIEDVARRVCWKKLIEK  367

Query  816   DDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE---  652
             DD+A+WQKP NH++C   R+    P +C   N PD AWY  ++TC+TPLP+VSD  E   
Sbjct  368   DDLAVWQKPINHIECQNNRKLYKTPHICKGDN-PDTAWYKKMETCITPLPEVSDSSEVAG  426

Query  651   --LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRN  478
               L+KWP+R  AVPPRI  G+I GI+ EKF+ D+ LW KR+ HY  ++  + +  GRYRN
Sbjct  427   GSLDKWPERAMAVPPRITSGSIPGITAEKFQVDNDLWKKRVRHYKRII--ETLAHGRYRN  484

Query  477   VLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRT  298
             ++DMNA LGGFAAA+ +  +WVMNVVP  S+ +TLG+IYERG IGTY  WCEA STYPRT
Sbjct  485   IMDMNANLGGFAAAMAEDPVWVMNVVPANSEHDTLGMIYERGFIGTYQDWCEAFSTYPRT  544

Query  297   YDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESR  118
             YD+IHA  +F++Y+DRC++ +ILLEMDRILRPEG+VI RD V+VL+K++ IT+G++W+S+
Sbjct  545   YDMIHAVGVFSIYQDRCDISNILLEMDRILRPEGTVIFRDTVEVLVKIQGITEGMRWKSQ  604

Query  117   VVDHEDGPLQREKLLFAVKTYWT  49
             ++DHE GP   EK+L AVKTYWT
Sbjct  605   IMDHESGPFNPEKILLAVKTYWT  627



>ref|XP_002518966.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43499.1| ATP binding protein, putative [Ricinus communis]
Length=630

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/533 (65%), Positives = 432/533 (81%), Gaps = 10/533 (2%)
 Frame = -2

Query  1626  DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNP  1447
             D+V  +PPCD+ YSEYTPC+  ER   +DR  L YRERHCP K E+L C IPAP  Y+ P
Sbjct  93    DAVAEFPPCDMSYSEYTPCQHPERGRKFDRNMLKYRERHCPTKEELLLCLIPAPPKYKTP  152

Query  1446  FKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKL  1267
             FKWP+SRD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +L
Sbjct  153   FKWPQSRDYAWYDNIPHRELSIEKAVQNWIQLEGDRFRFPGGGTMFPRGADAYIDDINEL  212

Query  1266  INLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGIL  1087
             + L  G+IRTA+DTGCGVAS+GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+IGI+
Sbjct  213   VPLTGGAIRTAIDTGCGVASWGAYLLKRDILAMSFAPRDTHEAQVQFALERGVPAMIGIM  272

Query  1086  ASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQG  907
             AS+RLPYP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK+YW+G
Sbjct  273   ASQRLPYPARAFDMAHCSRCLIPWNNYDGLYLIEVDRVLRPGGYWILSGPPINWKKYWRG  332

Query  906   WDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPA  733
             W+RT+EDL+ EQ  IE VA  LCWKK +E +D+++WQKP NHM+C+R R+    P +C  
Sbjct  333   WERTQEDLKQEQDSIEDVAKRLCWKKVVEKNDLSVWQKPINHMECVRSRKIYKTPHIC-K  391

Query  732   SNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKF  568
             S++PD +WY D++ C+TPLP+VS   E     +EKWP+R  A+PPR+  G+I GI+ +KF
Sbjct  392   SDNPDASWYKDMEACITPLPEVSSSDEVAGGAVEKWPERAFAIPPRVLSGSIPGINAKKF  451

Query  567   EKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVES  388
             ++D+ LW  R+SHY  ++    +  GRYRNV+DMNA+LGGFAAAL+ + +WVMNVVP  S
Sbjct  452   KEDTELWKDRVSHYKHIISP--LTQGRYRNVMDMNAYLGGFAAALLKYPVWVMNVVPANS  509

Query  387   KLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRIL  208
               +TLGVI+ERG IG Y  WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRIL
Sbjct  510   DHDTLGVIFERGFIGAYQDWCEAFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRIL  569

Query  207   RPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RPEG+VI RD V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  570   RPEGTVIFRDTVEVLVKIQSITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  622



>gb|KEH21299.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=629

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/639 (58%), Positives = 469/639 (73%), Gaps = 36/639 (6%)
 Frame = -2

Query  1935  PLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCL  1756
             P H +Q   S  N+L ++  ++  C LSY  G W+N                  T ++  
Sbjct  9     PKHYNQL-ESKRNRLTWILGVSGLCILSYVMGAWKNTA--------------TPTNQSEA  53

Query  1755  FSG---NtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
             +S    N  +T SS++ S SS S+ LDF +HH        L       +K +PPCD+ YS
Sbjct  54    YSKVDCNVGSTASSSSISSSSSSSKLDFASHHS-------LEISTSGGIKEFPPCDMTYS  106

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPC+D  R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N
Sbjct  107   EYTPCQDPARGRKFDRNMLKYRERHCPTKEELLYCLIPAPPKYKTPFKWPQSRDYAWYDN  166

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             +PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRTA+DT
Sbjct  167   IPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTTGNIRTAIDT  226

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVAS+GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+RLPYP++AFDM
Sbjct  227   GCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRLPYPARAFDM  286

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RTEEDL+ EQ  
Sbjct  287   AHCSRCLIPWNKNDGMYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTEEDLKQEQDS  346

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQT  691
             IE+VA  +CWKK +E DD++IWQKP NH++C++ +Q    P +C  S++PDMAWY +++ 
Sbjct  347   IEEVAKRICWKKVVEKDDLSIWQKPKNHLECVQTKQVFKTPHIC-QSDNPDMAWYQNMEK  405

Query  690   CLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             C+TPLP+V+        ELEKWP+R  AVPPRI  G I  I+ EKF+KD+ LW  R+SHY
Sbjct  406   CITPLPEVTSPSKVAGGELEKWPRRAFAVPPRISSGLIPSITAEKFQKDNELWKDRMSHY  465

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
               +     +  GRYRN++DMNA+LGGFAAAL+   +WVMNVVP  S  +TLG I+ERG I
Sbjct  466   KHITP---IAQGRYRNIIDMNAYLGGFAAALLKFPVWVMNVVPSNSAHDTLGAIFERGFI  522

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             GTYH WCEA STYPRTYDLIHA  +F +Y+DRC +  ILLEMDRILRPEG+V+ R+ V++
Sbjct  523   GTYHDWCEAFSTYPRTYDLIHAAGVFGIYQDRCNITVILLEMDRILRPEGTVVFREGVEL  582

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             L K+K +TD ++W+S ++DHE GP   EK+L A KTYWT
Sbjct  583   LTKIKSVTDAMKWKSNIMDHESGPFNPEKILVAEKTYWT  621



>ref|XP_011038052.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
 ref|XP_011038053.1| PREDICTED: probable methyltransferase PMT17 [Populus euphratica]
Length=628

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/636 (58%), Positives = 470/636 (74%), Gaps = 28/636 (4%)
 Frame = -2

Query  1935  PLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCL  1756
             P H+HQ   +   +L ++  ++  C L Y  G WQ+    +  +       +  T   C 
Sbjct  6     PKHHHQL-EAKRRRLTWIVGVSGLCVLFYVLGAWQHSAPLTNLT-------QSITKADCD  57

Query  1755  FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYT  1576
              S   A + + +T S S     LDF +HH           ++  SV  +PPC + +SEYT
Sbjct  58    VSNRAAVSSNPSTSSSSV---ALDFDSHHRSQI-------NNTTSVNEFPPCAMSFSEYT  107

Query  1575  PCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPH  1396
             PC+DT+R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY N+PH
Sbjct  108   PCQDTQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPH  167

Query  1395  KELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG  1216
             KEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L DGSIRTA+DTGCG
Sbjct  168   KELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDISELIPLTDGSIRTAIDTGCG  227

Query  1215  VASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHC  1036
             VAS+GAYLL R+I++MSFAPRDTH++QV FALERGVP +IGI+AS+RLPYP++AFDMAHC
Sbjct  228   VASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVPGMIGIMASQRLPYPARAFDMAHC  287

Query  1035  SRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEK  856
             SRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPIRWK++W+GW+RT+EDL+ EQ  IE 
Sbjct  288   SRCLIPWHKYDGMYLIEVDRVLRPGGYWILSGPPIRWKKHWRGWERTQEDLKQEQDAIED  347

Query  855   VADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLT  682
             VA  LCWKK +E DD++IWQKP NH+DCI  R+    P +C  S++PD  WY +++ C+T
Sbjct  348   VAKRLCWKKVVEKDDLSIWQKPLNHIDCIASRKTYKTPHIC-KSDNPDAGWYKEMEVCIT  406

Query  681   PLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAV  517
             PLP+VS   E     +EKWP R  ++PPRI+ G+I GI+ EKF++D+ LW  R++ Y  +
Sbjct  407   PLPEVSSSDEVAGGAVEKWPARAFSIPPRIRSGSIPGITAEKFKEDNNLWKDRVTKYKHI  466

Query  516   MDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTY  337
             +    +  GRYRN++DMNA LGGFAAAL  + +WVMNVVP  S  +TLGVIYERG IGTY
Sbjct  467   ISP--LTKGRYRNIMDMNAQLGGFAAALAKYPVWVMNVVPANSNPDTLGVIYERGFIGTY  524

Query  336   HTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIK  157
               WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL++
Sbjct  525   QDWCEAFSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMDRILRPEGTVIFRDTVEVLVR  584

Query  156   VKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  585   IQTITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  620



>ref|XP_003525323.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Glycine 
max]
 ref|XP_006580503.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Glycine 
max]
Length=623

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/640 (57%), Positives = 462/640 (72%), Gaps = 34/640 (5%)
 Frame = -2

Query  1947  KPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATA  1768
             K   P H  Q+  S  N+L ++  ++  C LSY  G W+N    +  S       +I + 
Sbjct  3     KDGSPKHYGQF-DSKRNRLTWILGVSGLCILSYIMGAWKNTPSPNSQS-------EILSK  54

Query  1767  KTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKY  1588
               C     T+   SS T         +D                +D    + +PPCD+ +
Sbjct  55    VDCNVGSTTSGMSSSATNLNFESHHQIDV---------------NDSGGAQEFPPCDMSF  99

Query  1587  SEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYT  1408
             SEYTPC+D  R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD AWY 
Sbjct  100   SEYTPCQDPVRGRKFDRNMLKYRERHCPAKEELLNCLIPAPPKYKTPFKWPQSRDYAWYD  159

Query  1407  NVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALD  1228
             N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRTA+D
Sbjct  160   NIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGTIRTAID  219

Query  1227  TGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFD  1048
             TGCGVAS+GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+R+PYP++AFD
Sbjct  220   TGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRIPYPARAFD  279

Query  1047  MAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQT  868
             MAHCSRCLIPW ++DG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RTEEDL+ EQ 
Sbjct  280   MAHCSRCLIPWHKFDGLYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTEEDLKQEQD  339

Query  867   QIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQ  694
              IE+VA  +CW K +E DD++IWQKP NH+ C + +Q    P MC  S++PDMAWY +++
Sbjct  340   AIEEVAKRICWTKVVEKDDLSIWQKPKNHVGCAQTKQIYKTPHMC-QSDNPDMAWYQNME  398

Query  693   TCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISH  529
              C+TPLP+V+   +     LEKWPKR  AVPPRI  G+I  I  EKF+KD+ +W +RI+H
Sbjct  399   KCITPLPEVNSADKMAGGALEKWPKRAFAVPPRISSGSIPSIDTEKFQKDNEVWRERIAH  458

Query  528   YSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGL  349
             Y  ++    +  GRYRNV+DMNA+LGGFAAAL+   +WVMNVVP  S  +TLG IYERG 
Sbjct  459   YKHLVP---LSQGRYRNVMDMNAYLGGFAAALIKFPVWVMNVVPPNSDHDTLGAIYERGF  515

Query  348   IGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVD  169
             IGTYH WCEA STYPRTYDLIHA ++F +Y+DRC +  ILLEMDRILRPEG+VI R+ V+
Sbjct  516   IGTYHDWCEAFSTYPRTYDLIHASNVFGIYQDRCNITQILLEMDRILRPEGTVIFRETVE  575

Query  168   VLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +L+K+K ITDG++W+S ++DHE GP   EK+L A K YWT
Sbjct  576   LLVKIKSITDGMKWKSNIIDHESGPFNPEKILVAEKAYWT  615



>ref|XP_004953430.1| PREDICTED: probable methyltransferase PMT16-like [Setaria italica]
Length=648

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/529 (68%), Positives = 419/529 (79%), Gaps = 15/529 (3%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP-KKSEVLKCRIPAPFGYRNPFKWP  1435
             YP C VKYSEYTPCED ERSL Y R+RL+YRERHCP  + E L+C +PAP GYR PF WP
Sbjct  121   YPACPVKYSEYTPCEDVERSLRYPRDRLVYRERHCPASERERLRCLVPAPRGYRTPFPWP  180

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDVAW+ NVPHKELTVEKAVQNWIR +GD+ +FPGGGTMF NGADAYIDDIGKLI L 
Sbjct  181   ASRDVAWFANVPHKELTVEKAVQNWIRVDGDKLRFPGGGTMFPNGADAYIDDIGKLIPLH  240

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS R
Sbjct  241   DGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNR  300

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             L YP++AFDMAHCSRCLIPW  YDG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW+RT
Sbjct  301   LTYPARAFDMAHCSRCLIPWQLYDGLYLMEVDRVLRPGGYWILSGPPINWKKYWKGWERT  360

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDM  715
             +EDL AEQ  IE VA +LCW K  E  DIA+WQKPYNH +C        P C  + +PD 
Sbjct  361   KEDLNAEQQAIEAVARTLCWTKVKEAGDIAVWQKPYNHANC------KAPFCSRNKNPDA  414

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWY  ++ C+TPLP+VS   +     ++KWP+RL AVPPR+ RG + G++ + F +D+ L
Sbjct  415   AWYDKMEACVTPLPEVSGASDVAGGAVKKWPQRLTAVPPRVSRGGVRGVTAKSFAQDTEL  474

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNA--FLGGFAAALVDHSLWVMNVVPVESKLNT  376
             W KR+ HY  V+  Q  + GRYRNVLDMNA       A A     LWVMN+VP      T
Sbjct  475   WRKRVRHYKLVIR-QFEQKGRYRNVLDMNARLGGFAAALAAAGDPLWVMNMVPTLRNTTT  533

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIG+Y  WCE MSTYPRTYDLIHADS+FTLY +RCEM+ ILLEMDRILRPEG
Sbjct  534   LGAIYERGLIGSYQDWCEGMSTYPRTYDLIHADSVFTLYNNRCEMDRILLEMDRILRPEG  593

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +VIIRDDVD+L+KVK + DG++W+S++VDHEDGPL REK+L  VK YWT
Sbjct  594   TVIIRDDVDMLVKVKSVADGIRWDSQIVDHEDGPLVREKILLVVKRYWT  642



>ref|XP_004309496.1| PREDICTED: probable methyltransferase PMT18-like [Fragaria vesca 
subsp. vesca]
Length=629

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/536 (64%), Positives = 432/536 (81%), Gaps = 11/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             +  ++V+ +PPC + YSEYTPC+DT R   +DR+ L YRERHCP K E L C IPAP  Y
Sbjct  91    NKSEAVQTFPPCSMVYSEYTPCQDTNRGRKFDRQMLKYRERHCPTKEEQLLCLIPAPPKY  150

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  151   KTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  210

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              KLI L +G IRTA+DTGCGVAS+GAYLL R+ILTMSFAPRDTH +QVQFALERGVPA+I
Sbjct  211   NKLIPLTNGHIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVPAMI  270

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             G+L SKRLPYP+++FDMAHCSRCLIPW  YDG YLIEVDRVLRPG YWILSGPPI WK++
Sbjct  271   GVLGSKRLPYPARSFDMAHCSRCLIPWQNYDGLYLIEVDRVLRPGAYWILSGPPINWKKH  330

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPM  742
             W+GW+RT+EDL+ EQ  IE VA+SLCWKK ++ +D+AIWQKP NH++CIR R+    P +
Sbjct  331   WRGWERTQEDLKQEQDAIEAVANSLCWKKVIQKNDLAIWQKPLNHVECIRSRKVIKTPHI  390

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PDMAW  +++TC+TPLP+  +  +     LEKWP+R  AVPPRI  G+I GI+ 
Sbjct  391   C-KSDNPDMAWDRNMETCITPLPEPGNPNDIAGGALEKWPERAFAVPPRISSGSIPGITP  449

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EK ++D+ LW +R+ HY   +    +  GRYRNV+DMNA+LGGFAAAL  + +W+MN VP
Sbjct  450   EKLKEDNALWKERVEHYKNKIP---ISKGRYRNVMDMNAYLGGFAAALSKYPVWIMNTVP  506

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               +  +TLGVIYERG IGTY  WCEA STYPRTYDLIHA ++F++Y+DRC++  ILLEMD
Sbjct  507   ANTNQDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHAANVFSIYQDRCDITYILLEMD  566

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V++L+K+K ITDG++W S+++DHE GP   EK+L+AVKTYWT
Sbjct  567   RILRPEGAVIFRDTVEILVKIKAITDGMRWTSQIMDHETGPFNPEKILYAVKTYWT  622



>ref|XP_008677769.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|AFW63363.1| hypothetical protein ZEAMMB73_276336 [Zea mays]
Length=647

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/529 (67%), Positives = 420/529 (79%), Gaps = 11/529 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCP-KKSEVLKCRIPAPFGYRNPFKWP  1435
             YP C  +YSEYTPCED ERSL + R+RL+YRERHCP  + E L+C +PAP GYR PF WP
Sbjct  116   YPACPARYSEYTPCEDVERSLRFPRDRLVYRERHCPASERERLRCLVPAPPGYRTPFPWP  175

Query  1434  ESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLK  1255
              SRDVAW+ N PHKELTVEKAVQNWIR +GDR +FPGGGTMF NGADAYIDDI KL+ L 
Sbjct  176   ASRDVAWFANAPHKELTVEKAVQNWIRVDGDRLRFPGGGTMFPNGADAYIDDIAKLVPLH  235

Query  1254  DGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKR  1075
             DGSIRTALDTGCGVAS+GAYLLSR+IL MSFAPRD+H++QVQFALERGVPA+IG+LAS R
Sbjct  236   DGSIRTALDTGCGVASWGAYLLSRDILAMSFAPRDSHEAQVQFALERGVPAMIGVLASNR  295

Query  1074  LPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRT  895
             L YP++AFDMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI W +YW+GW+RT
Sbjct  296   LTYPARAFDMAHCSRCLIPWQLYDGLYLIEVDRVLRPGGYWILSGPPINWNKYWKGWERT  355

Query  894   EEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMCPASNDPDM  715
             +EDL AEQ  IE VA SLCW K  E  DIA+WQKPYNH  C +  ++  P C   N PD 
Sbjct  356   KEDLNAEQQAIEAVARSLCWTKVKEAGDIAVWQKPYNHAGC-KASKSSRPFCSRKN-PDA  413

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWY  ++ C+TPLP++S   +     +++WP+RL AVPPR+ RGT+ G++   F +D+ L
Sbjct  414   AWYDKMEACITPLPEISKASDVAGGAVKRWPQRLTAVPPRVSRGTVRGVTARSFAQDTEL  473

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNA--FLGGFAAALVDHSLWVMNVVPVESKLNT  376
             W +R+ HY +V   QL + GRYRNVLDMNA       A AL    LWVMN+VP  +   T
Sbjct  474   WRRRVRHYKSVA-SQLEQKGRYRNVLDMNARLGGFAAALALAGDPLWVMNMVPTVANATT  532

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LG IYERGLIG+Y  WCE MSTYPRTYDLIHADS+FTLYKDRCEM+ ILLEMDRILRP G
Sbjct  533   LGAIYERGLIGSYQDWCEGMSTYPRTYDLIHADSVFTLYKDRCEMDRILLEMDRILRPRG  592

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +VI+R+DVD+L+KVK + DG++WES++VDHEDGPL REK+L  VKTYWT
Sbjct  593   TVIVREDVDMLVKVKSLADGMRWESQIVDHEDGPLVREKILLVVKTYWT  641



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/632 (57%), Positives = 460/632 (73%), Gaps = 27/632 (4%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   +L ++  +   C   Y  G WQ        S       ++   +T   SGN
Sbjct  12    HHHVESKKKRLPWIFGIFALCIACYMLGAWQTTSAPVNRSELYQ---RVGCDETSSQSGN  68

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
               ++  S++         LDF +HH        +  +  ++V+ + PCD+ YSEYTPC+D
Sbjct  69    KTSSPVSSSPLR------LDFESHHQ-------VDVNKTEAVQRFSPCDMSYSEYTPCQD  115

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R   +DR+ L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  116   PRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELS  175

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI  LI L  G+IRTA+DTGCGVAS+
Sbjct  176   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINALIPLTKGNIRTAIDTGCGVASW  235

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+I+TMSFAPRD+H +QVQFALERGVPA+IG++ASKRLPYP++AFDMAHCSRCL
Sbjct  236   GAYLLKRDIVTMSFAPRDSHAAQVQFALERGVPAMIGVMASKRLPYPARAFDMAHCSRCL  295

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW  YDG YLIEVDRVLRPGGYWILSGPPI W ++W+GW+RT+EDL  EQ  IE VA  
Sbjct  296   IPWMNYDGMYLIEVDRVLRPGGYWILSGPPINWAKHWRGWERTQEDLNQEQDSIESVAKR  355

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH++C++ R     P +C  S++PDMAW  D+++C+TPLP+
Sbjct  356   LCWKKVIEKNDLAIWQKPINHVECVKSRNVYKTPHIC-KSDNPDMAWERDMESCITPLPE  414

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
              SD  +     LEKWP+R  AVPPRI  G+I GI+ EK  +D+ LW +R+ HY  ++   
Sbjct  415   TSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVVHYKRIVP--  472

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA+LGGFAAAL  + +WVMN VP  S  +TLGVIYERG IGTY  WC
Sbjct  473   -ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFIGTYQDWC  531

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA  IF++Y+DRC++  ILLEMDRILRPEG+V+ RD V++L+K+K I
Sbjct  532   EAFSTYPRTYDLIHAGGIFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAI  591

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             TDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  592   TDGMRWKSQIMDHESGPFNPEKILLAVKTYWT  623



>ref|XP_009389104.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389112.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389120.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
Length=629

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/529 (65%), Positives = 428/529 (81%), Gaps = 11/529 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPCD+ +SEYTPC D  R   ++R  L+YRERHCP   E+++C IPAP  Y+ PFKWP+
Sbjct  97    FPPCDLNFSEYTPCHDRTRGRRFERAMLVYRERHCPGNDELIRCLIPAPPKYKTPFKWPQ  156

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AWY N+PHKEL++EKAVQNWI+ +GDRF+FPGGGTMF  GADAYIDDI  LI+L D
Sbjct  157   SRDYAWYDNIPHKELSIEKAVQNWIQVDGDRFRFPGGGTMFPRGADAYIDDINALISLTD  216

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTA+DTGCGVAS+GAYLL R+I+TMSFAPRDTH++QVQFALERGVPA+IG++A++RL
Sbjct  217   GSIRTAIDTGCGVASWGAYLLRRDIVTMSFAPRDTHEAQVQFALERGVPAMIGVMATQRL  276

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYP++AFDMAHCSRCLIPW  +DG YLIEVDRVLRPGG+WILSGPPI WK+Y+QGW+RT+
Sbjct  277   PYPARAFDMAHCSRCLIPWHAFDGLYLIEVDRVLRPGGFWILSGPPIHWKKYYQGWERTQ  336

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLR---QAPPPMCPASNDP  721
             EDL+ EQ  IE+VA  LCWKK++E +D+AIWQKP+NHM+CI  R   +  P +C   N  
Sbjct  337   EDLKNEQDSIEEVAKRLCWKKYIEKEDLAIWQKPFNHMECIESRKIYETTPQICKKDN-A  395

Query  720   DMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDS  556
             D  WY  ++ C+TPLP+VS   E     LEKWP+R  AVPPRI RGTI G+   KFE+D+
Sbjct  396   DAGWYKKMEACITPLPEVSSPDEVAGEVLEKWPERAFAVPPRISRGTIPGLDSRKFEEDN  455

Query  555   TLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNT  376
              +W +R++HY  ++    +  GRYRNV+DMNA LGGFAAALV + +WVMNVVP  S  +T
Sbjct  456   AMWKERVTHYKKII--LPLPKGRYRNVMDMNANLGGFAAALVKYPVWVMNVVPASSNQDT  513

Query  375   LGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEG  196
             LGVIYERG IGTY  WCEA STYPRTYDLIHAD +F++Y+DRC++  ILLEMDRILRPEG
Sbjct  514   LGVIYERGFIGTYQDWCEAFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEG  573

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +VI+RD V+VL KV+ ITDG++W ++++DHE GP   EK+L AVKTYWT
Sbjct  574   TVIVRDTVEVLTKVQAITDGMRWNNQIIDHESGPFNPEKILVAVKTYWT  622



>ref|NP_001065036.1| Os10g0510400 [Oryza sativa Japonica Group]
 gb|AAK84446.1|AC087192_7 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54570.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47874.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26950.1| Os10g0510400 [Oryza sativa Japonica Group]
 dbj|BAG93354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51256.1| hypothetical protein OsJ_32126 [Oryza sativa Japonica Group]
Length=634

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/639 (57%), Positives = 461/639 (72%), Gaps = 24/639 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK  1765
             PA P    Q   S   +L Y+ +++  C   Y  G WQN       + S+I       A 
Sbjct  6     PASP-KAQQLQESKKQRLTYILVVSALCVAFYVLGAWQNTTVPKPAASSAITKVGCDPAA  64

Query  1764  TCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
                 S              S+    LDF  HH      ++     E +V+ +P C + +S
Sbjct  65    AGQSSA--------VPSFGSASQESLDFEAHHQL----SLDDTGAEAAVQPFPACPLNFS  112

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPCED +R   ++R  L+YRERHCP K E ++C IPAP  YR PFKWP+SRD AW+ N
Sbjct  113   EYTPCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAPPKYRTPFKWPQSRDFAWFNN  172

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             +PHKEL++EKAVQNWI+ +G RF+FPGGGTMF  GADAYIDDIGKLI+L DG IRTA+DT
Sbjct  173   IPHKELSIEKAVQNWIQVDGQRFRFPGGGTMFPRGADAYIDDIGKLISLTDGKIRTAIDT  232

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVAS+GAYLL RNIL MSFAPRDTH++QVQFALERGVPA+IG++  +RLPYPS++FDM
Sbjct  233   GCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVPAIIGVMGKQRLPYPSRSFDM  292

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPW ++DG YL EVDR+LRPGGYWILSGPPI WK +++GW+RT+EDL+ EQ  
Sbjct  293   AHCSRCLIPWHEFDGIYLAEVDRILRPGGYWILSGPPINWKTHYKGWERTKEDLKEEQDN  352

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYTDLQT  691
             IE VA SLCW K +E  D++IWQKP NH++C  I+ +   P +C  S++PD AWY  ++ 
Sbjct  353   IEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKKYKTPHIC-KSDNPDAAWYKQMEA  411

Query  690   CLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             C+TPLP+VS++ E     LE+WP+R  AVPPR+KRG I GI   KFE+D  LW KR+++Y
Sbjct  412   CVTPLPEVSNQGEIAGGALERWPQRAFAVPPRVKRGMIPGIDASKFEEDKKLWEKRVAYY  471

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
                +    +  GRYRNV+DMNA LGGFAA+LV + +WVMNVVPV S  +TLG IYERG I
Sbjct  472   KRTLP---IADGRYRNVMDMNANLGGFAASLVKYPVWVMNVVPVNSDRDTLGAIYERGFI  528

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             GTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ +ILLEMDRILRPEG+ IIRD VDV
Sbjct  529   GTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITNILLEMDRILRPEGTAIIRDTVDV  588

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             L KV+ I   ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  589   LTKVQAIAKRMRWESRILDHEDGPFNPEKVLVAVKTYWT  627



>ref|XP_011070323.1| PREDICTED: probable methyltransferase PMT18 [Sesamum indicum]
Length=626

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/624 (58%), Positives = 458/624 (73%), Gaps = 24/624 (4%)
 Frame = -2

Query  1899  NKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattlsst  1720
              +L ++  ++  C L Y FG WQ       +        K+         GN     SS 
Sbjct  19    KRLTWILAVSGLCVLFYVFGAWQGRSPTPSSQSDLSS--KVGCDVRTGGQGNRDLPSSSA  76

Query  1719  tqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYD  1540
                       LDF +HH        L  +    ++ +PPCD+ YSEYTPCED +RS  +D
Sbjct  77    MSQD-----ALDFESHHE-------LSVNSSQDIEKFPPCDISYSEYTPCEDQQRSKKFD  124

Query  1539  RERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNW  1360
             R+R  YRERHCP K E+L+C +PAP  Y+ PFKWP+SRD AWY N+PHKEL++EKAVQNW
Sbjct  125   RDRFKYRERHCPTKQELLRCLVPAPPNYKRPFKWPQSRDYAWYANIPHKELSIEKAVQNW  184

Query  1359  IRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRN  1180
             I+ EG+RF+FPGGGTMF NGAD YIDDI  LI + DGSIRTALDTGCGVAS+GAYLL R+
Sbjct  185   IQVEGERFRFPGGGTMFANGADVYIDDINALIPITDGSIRTALDTGCGVASWGAYLLKRD  244

Query  1179  ILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDG  1000
             I+ MSFAPRDTH++QV FALERGVPA+I IL+SKRLPYPS++FDMAHCSRCLIPW  YDG
Sbjct  245   IVAMSFAPRDTHEAQVWFALERGVPAMIAILSSKRLPYPSRSFDMAHCSRCLIPWPDYDG  304

Query  999   AYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFME  820
              YLIEVDRVLRPG YWILSGPPIRW++YW+GWDR++EDL+ EQ  IE +A  LCW+K +E
Sbjct  305   LYLIEVDRVLRPGAYWILSGPPIRWQKYWKGWDRSKEDLKQEQDSIEDLAKRLCWRKVIE  364

Query  819   VDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE--  652
               D+AIWQKP NH++C++ ++  A P MC  S+ PD AWY D++ C+TPLP+VS+  E  
Sbjct  365   KGDLAIWQKPINHVECLKNKEMYAQPEMC-KSDSPDAAWYKDMEACITPLPEVSNPNEVA  423

Query  651   ---LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYR  481
                L+KWP+R  AVPPRI  G+I GI+ +KF++D+ +W +RI +Y +++    +  GRYR
Sbjct  424   GGALQKWPERAFAVPPRISSGSIPGINAQKFQEDTEMWKERIVYYKSLVTD--LPQGRYR  481

Query  480   NVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPR  301
             NV+DMNA LGGFAAA++   +W+MNVVP  ++ +TLG IYERG IG Y  WCEA STYPR
Sbjct  482   NVMDMNANLGGFAAAMMRFPVWIMNVVPANTQPDTLGAIYERGFIGAYQDWCEAFSTYPR  541

Query  300   TYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWES  121
             TYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD V+VL+K+K ITDG++W S
Sbjct  542   TYDLIHAAGVFSMYQDRCDITYILLEMDRILRPEGTVIFRDMVEVLVKIKGITDGMRWNS  601

Query  120   RVVDHEDGPLQREKLLFAVKTYWT  49
             +++DHE GP   EK+L A KTYWT
Sbjct  602   KIIDHESGPFNPEKILLASKTYWT  625



>gb|EEC67295.1| hypothetical protein OsI_34283 [Oryza sativa Indica Group]
Length=634

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/640 (58%), Positives = 461/640 (72%), Gaps = 26/640 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK  1765
             PA P    Q   S   +L Y+ +++  C   Y  G WQN       + S+I       A 
Sbjct  6     PASP-KAQQLQESKKQRLTYILVVSALCVAFYVLGAWQNTTVPKPAASSAITKVGCDPAA  64

Query  1764  TCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHD-EDSVKVYPPCDVKY  1588
                 S              S+    LDF  HH        L + D E +V+ +P C + +
Sbjct  65    AGQSSA--------VPSFGSASQESLDFEAHHQLS-----LDDTDAEAAVQPFPACPLNF  111

Query  1587  SEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYT  1408
             SEYTPCED +R   ++R  L+YRERHCP K E ++C IPAP  YR PFKWP+SRD AW+ 
Sbjct  112   SEYTPCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAPPKYRTPFKWPQSRDFAWFN  171

Query  1407  NVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALD  1228
             N+PHKEL++EKAVQNWI+ +G RF+FPGGGTMF  GADAYIDDIGKLI+L DG IRTA+D
Sbjct  172   NIPHKELSIEKAVQNWIQVDGQRFRFPGGGTMFPRGADAYIDDIGKLISLTDGKIRTAID  231

Query  1227  TGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFD  1048
             TGCGVAS+GAYLL RNIL MSFAPRDTH++QVQFALERGVPA+IG++  +RLPYPS++FD
Sbjct  232   TGCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVPAIIGVMGKQRLPYPSRSFD  291

Query  1047  MAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQT  868
             MAHCSRCLIPW ++DG YL EVDR+LRPGGYWILSGPPI WK +++GW+RT+EDL+ EQ 
Sbjct  292   MAHCSRCLIPWHEFDGIYLAEVDRILRPGGYWILSGPPINWKTHYKGWERTKEDLKEEQE  351

Query  867   QIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYTDLQ  694
              IE VA SLCW K +E  D++IWQKP NH++C  I+ +   P +C  S++PD AWY  ++
Sbjct  352   NIEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKKYKTPHIC-KSDNPDAAWYKQME  410

Query  693   TCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISH  529
              C+TPLP+VS++ E     LE+WP+R  AVPPR+KRG I GI   KFE D  LW KR+++
Sbjct  411   ACVTPLPEVSNQGEIAGGALERWPQRAFAVPPRVKRGMIPGIDASKFEDDKKLWEKRVAY  470

Query  528   YSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGL  349
             Y   +    +  GRYRNV+DMNA LGGFAA+LV + +WVMNVVPV S  +TLG IYERG 
Sbjct  471   YKRTLP---IADGRYRNVMDMNANLGGFAASLVKYPVWVMNVVPVNSDRDTLGAIYERGF  527

Query  348   IGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVD  169
             IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ +ILLEMDRILRPEG+ IIRD VD
Sbjct  528   IGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITNILLEMDRILRPEGTAIIRDTVD  587

Query  168   VLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VL KV+ I   ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  588   VLTKVQAIAKRMRWESRILDHEDGPFNPEKVLVAVKTYWT  627



>emb|CDP12267.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/537 (65%), Positives = 432/537 (80%), Gaps = 11/537 (2%)
 Frame = -2

Query  1638  NHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFG  1459
             N  E+S + +PPCD  Y+EYTPC+D  R   +DR+ L YRERHCP K E+L+C IPAP  
Sbjct  106   NSSEES-QAFPPCDKSYTEYTPCQDPSRGRKFDRKFLKYRERHCPDKEELLRCLIPAPPN  164

Query  1458  YRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDD  1279
             Y+ PFKWP+SRD AWY N+PHK L+VEKA QNWI+ EGDRFKFPGGGTMF NGADAYIDD
Sbjct  165   YKTPFKWPQSRDYAWYANIPHKHLSVEKANQNWIQLEGDRFKFPGGGTMFPNGADAYIDD  224

Query  1278  IGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPAL  1099
             I +LI L +G IRTALDTGCGVAS+GAYLL RNI+ MSFAPRDTH++QV FALERGVPA+
Sbjct  225   INELIPLSNGDIRTALDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVWFALERGVPAM  284

Query  1098  IGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKR  919
             IG++ S+RLPYP++AFDMAHCSRCLIPW  Y G YLIEVDRVLRPGGYWILSGPPIRWK+
Sbjct  285   IGVMGSQRLPYPARAFDMAHCSRCLIPWYDYGGLYLIEVDRVLRPGGYWILSGPPIRWKK  344

Query  918   YWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPP  745
             YW GW+R++EDL+ EQ  IE VA  LCWKK +E +D+A+WQKP NH++CI+ R     PP
Sbjct  345   YWSGWERSQEDLKQEQDSIEDVAKHLCWKKVIEKEDLAVWQKPINHVECIKSRAIYHTPP  404

Query  744   MCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGIS  580
             MC  S++ + AWY D++ C++PLP+VS++ E     LEKWP+R  A PPRI  G++ GI+
Sbjct  405   MC-KSDNVEAAWYKDMEACISPLPEVSNKDEVAGGALEKWPERAFATPPRISVGSVPGIT  463

Query  579   GEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVV  400
              EKF +D+ +W  R+++Y  V+    +  G+YRNV+DMNAFLGGFAAAL  + +WVMNVV
Sbjct  464   SEKFREDNEVWKVRVANYRQVV--APLGQGQYRNVMDMNAFLGGFAAALAKYPVWVMNVV  521

Query  399   PVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEM  220
             P +   +TLG++YERG IGTYH WCEA STYPRTYDLIHAD +F++Y+DRC++ DILLEM
Sbjct  522   PAKLDPDTLGIVYERGFIGTYHDWCEAFSTYPRTYDLIHADGVFSIYQDRCDITDILLEM  581

Query  219   DRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             DRILRPEG+VI RD V+VL+K+K I+DG++WESR++DHE GP   +K+L AVK YWT
Sbjct  582   DRILRPEGTVIFRDAVEVLVKIKSISDGMRWESRILDHESGPFNPQKILVAVKNYWT  638



>ref|XP_008796868.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
 ref|XP_008796869.1| PREDICTED: probable methyltransferase PMT17 [Phoenix dactylifera]
Length=632

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/630 (58%), Positives = 465/630 (74%), Gaps = 23/630 (4%)
 Frame = -2

Query  1917  YYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNta  1738
             +  S   +L Y+  ++  C L Y  G WQN      +         ++    C      +
Sbjct  12    HLDSRRKRLTYILGVSGLCVLFYILGAWQNSAVPKSSG-------DVSNKIECGSVNPLS  64

Query  1737  ttlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTE  1558
                S+   S SS +A LDF   H          +    +V+ + PC + +SEYTPC+D  
Sbjct  65    DPHSTAVPSFSSSNAALDFEARHRPDL------DETAATVEKFHPCPLNFSEYTPCQDRT  118

Query  1557  RSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVE  1378
             R   ++RE LIYRERHCP K E+++C IPAP  Y+ PFKWP+SRD AW+ N+PHKEL++E
Sbjct  119   RGRRFEREMLIYRERHCPGKEELIRCLIPAPPNYKTPFKWPQSRDYAWFDNIPHKELSIE  178

Query  1377  KAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGA  1198
             KAVQNW+  EGDRF+FPGGGTMF  GADAYIDDI  L++L DGSIRTA+DTGCGVASFGA
Sbjct  179   KAVQNWVIVEGDRFRFPGGGTMFPRGADAYIDDINALLSLTDGSIRTAIDTGCGVASFGA  238

Query  1197  YLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIP  1018
             YLL R+++TMSFAPRDTH++QVQFALERGVPA+IG++ S+R+PYP++AFDMAHCSRCLIP
Sbjct  239   YLLKRDVITMSFAPRDTHEAQVQFALERGVPAMIGVIGSQRMPYPARAFDMAHCSRCLIP  298

Query  1017  WGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLC  838
             W + DG YLIEVDRVLRPGGYWILSGPPI WK+Y++GW+RT++DL+ EQ  IE VA  LC
Sbjct  299   WFKNDGLYLIEVDRVLRPGGYWILSGPPIHWKKYYKGWERTQDDLKHEQDSIEDVAKRLC  358

Query  837   WKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVS  664
             WKK +E DD+AIWQKP NH++CI+ R+    P +C   N  D AWY  L+ C+TPLP+V+
Sbjct  359   WKKIIEKDDLAIWQKPINHIECIQSREIHKTPHICKNDNS-DAAWYKKLEVCITPLPEVN  417

Query  663   DEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLV  499
             +E+     ELEKWP R  AVPPRI RG+I G++ + FE+D+ +W +R++HY  ++   L 
Sbjct  418   NEEEVAGGELEKWPYRAFAVPPRISRGSIPGVAAKNFEEDNQMWKERVTHYKRIVPPLL-  476

Query  498   EAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEA  319
               GRYRNV+DMNA LGGFAAAL+ + +WVMNVVP+ S  +TLGVIYERG IGTY  WCEA
Sbjct  477   -QGRYRNVMDMNANLGGFAAALIKYPVWVMNVVPISSDRDTLGVIYERGFIGTYQDWCEA  535

Query  318   MSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITD  139
              STYPR+YDL+HAD +F+ Y+DRC++  ILLEMDRILRPEG+VIIRD V+VL KVK ITD
Sbjct  536   FSTYPRSYDLLHADGVFSAYQDRCDITYILLEMDRILRPEGTVIIRDIVEVLTKVKAITD  595

Query  138   GLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  596   GMRWKSQILDHESGPFNPEKILVAVKTYWT  625



>ref|XP_002317647.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE98259.1| dehydration-responsive family protein [Populus trichocarpa]
Length=625

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/536 (65%), Positives = 431/536 (80%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++ DSV   PPCD+ YSEYTPC+D +R   +DR  L YRERHCP K E+L C IPAP  Y
Sbjct  85    NNTDSVNEIPPCDMSYSEYTPCQDPQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKY  144

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AWY N+PH EL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  145   KTPFKWPQSRDYAWYDNIPHNELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  204

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +LI L DGSIRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVPA+I
Sbjct  205   SELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVWFALERGVPAMI  264

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             GI+AS+RLPYP++AFDMAHCSRCLIPW Q DG YLIEVDRVLRPGGYWILSGPPI WK+Y
Sbjct  265   GIMASQRLPYPARAFDMAHCSRCLIPWHQNDGLYLIEVDRVLRPGGYWILSGPPIHWKKY  324

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPM  742
             W+GW+RT +DL+ EQ  IE VA  LCWKK +E  D+++WQKP NH++C+  R+    P +
Sbjct  325   WRGWERTAKDLKQEQDAIEDVAKRLCWKKVVEKGDLSVWQKPLNHIECVASRKIYKTPHI  384

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PD AWY D++TC+TPLP+VS   E     +EKWP R  AVPPRI+ G+I GI+ 
Sbjct  385   C-KSDNPDAAWYKDMETCITPLPEVSGSDEVAGGVVEKWPARAFAVPPRIRSGSIPGINA  443

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ LW  R++HY  ++    +  GR+RN++DMNA LGG AAALV + +WVMNVVP
Sbjct  444   EKFKEDNDLWKDRVAHYKNIISP--LTQGRFRNIMDMNAQLGGLAAALVKYPVWVMNVVP  501

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  +TLGVIYERG IG+Y  WCEA+STYPRTYDLIHA  +F++Y+DRC++  ILLEMD
Sbjct  502   ANSNPDTLGVIYERGFIGSYQDWCEAVSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMD  561

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  562   RILRPEGTVIFRDTVEVLVKIQTITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  617



>ref|XP_003530522.1| PREDICTED: probable methyltransferase PMT18-like [Glycine max]
Length=629

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/640 (57%), Positives = 465/640 (73%), Gaps = 28/640 (4%)
 Frame = -2

Query  1947  KPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATA  1768
             K   P H  Q+  S  N++ ++  ++  C LSY  G W+N    +  S       +I + 
Sbjct  3     KDGSPKHYSQF-DSKRNRMTWILGVSGLCILSYIMGAWKNTPSPNSQS-------EIFSK  54

Query  1767  KTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKY  1588
               C     +A   SS+    SS +   D             +  ++    + +P CD+ +
Sbjct  55    VDCNIGSTSAGMSSSSATESSSTNLNFDSHHQ---------IDINNSGGAQEFPSCDMSF  105

Query  1587  SEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYT  1408
             SEYTPC+D  R   +DR  L YRERHCP K+E+L C IPAP  Y+ PFKWP+SRD AWY 
Sbjct  106   SEYTPCQDPVRGRKFDRNMLKYRERHCPAKNELLNCLIPAPPKYKTPFKWPQSRDYAWYD  165

Query  1407  NVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALD  1228
             N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRTA+D
Sbjct  166   NIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGTIRTAID  225

Query  1227  TGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFD  1048
             TGCGVAS+GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+IGI+AS+R+PYP++AFD
Sbjct  226   TGCGVASWGAYLLRRDILAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRIPYPARAFD  285

Query  1047  MAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQT  868
             MAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RTEEDL+ EQ 
Sbjct  286   MAHCSRCLIPWHKLDGLYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTEEDLKQEQD  345

Query  867   QIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQ  694
              IE+VA  +CW K +E DD++IWQKP NH+ C + +Q    P MC  S++PDMAWY +++
Sbjct  346   AIEEVAKRICWTKVVEKDDLSIWQKPKNHVGCAQTKQIYKTPHMC-QSDNPDMAWYQNME  404

Query  693   TCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISH  529
              C+TPLP+VS   +     LEKWPKR  AVPPRI  G+I  I  EKFEKD+ +W +RI+H
Sbjct  405   KCITPLPEVSSADKVAGGALEKWPKRAFAVPPRISSGSIPNIDAEKFEKDNEVWRERIAH  464

Query  528   YSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGL  349
             Y  ++    +  GRYRNV+DMNA+LGGFAAAL+ + +WVMNVVP  S  +TLG IYERG 
Sbjct  465   YKHLIP---LSQGRYRNVMDMNAYLGGFAAALIKYPVWVMNVVPPNSDHDTLGAIYERGF  521

Query  348   IGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVD  169
             IGTYH WCEA STYPRTYDLIHA ++F +Y+DRC +  ILLEMDRILRPEG+V+ R+ V+
Sbjct  522   IGTYHDWCEAFSTYPRTYDLIHASNVFGIYQDRCNITHILLEMDRILRPEGTVVFRETVE  581

Query  168   VLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +L+K+K ITDG++W+S ++DHE GP   EK+L A K YWT
Sbjct  582   LLVKIKSITDGMKWKSNIMDHESGPFNPEKILVAQKAYWT  621



>ref|XP_010934594.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010934595.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=624

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/628 (58%), Positives = 470/628 (75%), Gaps = 32/628 (5%)
 Frame = -2

Query  1911  SSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtatt  1732
              S   +L ++  ++  C L Y  G WQN    S ++  S   +K     T L S  +   
Sbjct  15    GSRRERLTWILGVSGLCILFYMIGAWQNTTTPSTSNPISSIASKCNGPTTRLSSSGS---  71

Query  1731  lssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERS  1552
                           LDF  HH       V  N    S + +P CD+K+SEYTPC+D  R+
Sbjct  72    -------------SLDFQAHHQ------VGFNESSLSTEKFPSCDLKFSEYTPCQDPRRA  112

Query  1551  LAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKA  1372
               + +  L YRERHCP+K E+L+C IPAP  Y+NPFKWP+SRD AWY N+PH+EL++EKA
Sbjct  113   RKFVKVMLRYRERHCPQKKELLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHRELSIEKA  172

Query  1371  VQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYL  1192
             VQNWI+ EG+RF+FPGGGTMF  GAD+YIDDI  LI L +G+IRTA+D+GCGVAS+GAYL
Sbjct  173   VQNWIQVEGNRFRFPGGGTMFPRGADSYIDDINALIPLTNGNIRTAIDSGCGVASWGAYL  232

Query  1191  LSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWG  1012
             L+RNILTMSFAPRD+H++QVQFALERGVPA+IG++A++R+PYP++AFDMAHCSRCLIPW 
Sbjct  233   LNRNILTMSFAPRDSHEAQVQFALERGVPAMIGVMATERMPYPARAFDMAHCSRCLIPWE  292

Query  1011  QYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWK  832
             QYDG YLIEVDRVLRPGGYWILSGPPI WK++++GW+RT+EDL+ EQ  IE +A  LCWK
Sbjct  293   QYDGLYLIEVDRVLRPGGYWILSGPPINWKKHYRGWERTQEDLKHEQDAIEDLAKHLCWK  352

Query  831   KFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDE  658
             K +E  D+AIWQKP NH++CI+ R+    P +C  +++ D AWY  ++TC+TPLP+VS  
Sbjct  353   KVIEKGDLAIWQKPINHIECIQNRKVYKTPHIC-KNDNLDAAWYKKMETCITPLPEVSSS  411

Query  657   KE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEA  493
             +E     LEKWP+R  A+PPRI RG+I GI+ EKF++D+ +W +R++ Y  ++    +  
Sbjct  412   EEVAGGALEKWPERAFAIPPRISRGSILGITAEKFQEDNNMWKERLAGYKKIIPP--LTQ  469

Query  492   GRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMS  313
             GRYRNV+DMNA LGGFAAALV + +WVMNVVP +++ +TLGVIYERG IGTY  WCEA S
Sbjct  470   GRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQKDTLGVIYERGFIGTYQDWCEAFS  529

Query  312   TYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGL  133
             TYPRTYDLIHAD +F+ Y+DRC++  ILLEMDRILRPEG+VI RD VDVL+KV+ IT+G+
Sbjct  530   TYPRTYDLIHADGVFSTYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVETITNGM  589

Query  132   QWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +W+S+++DHE GP   EK+L AVK+YWT
Sbjct  590   RWKSQIMDHESGPFNPEKILVAVKSYWT  617



>ref|XP_007210288.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
 gb|EMJ11487.1| hypothetical protein PRUPE_ppa002760mg [Prunus persica]
Length=636

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/641 (57%), Positives = 461/641 (72%), Gaps = 23/641 (4%)
 Frame = -2

Query  1950  YKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIAT  1771
             Y    P H+H    S   +L ++  ++  C + Y  G WQ        S       ++  
Sbjct  5     YTGGSPKHHH--LESKKKRLTWIFGVSALCVVCYMLGAWQTTSSPVNRSELYQ---RVGC  59

Query  1770  AKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVK  1591
              +T    G    + S +  S SS S  LDF +HH           +  D+V+ +P CD+ 
Sbjct  60    DETSQNQGGNNVSSSPSATSASSSSLHLDFESHHQVEI-------NKSDAVQKFPACDMA  112

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             YSEYTPC+DT+R   +DR+ L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY
Sbjct  113   YSEYTPCQDTQRGRKFDRKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWY  172

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF  GA AYIDDI  LI L  G+IRTA+
Sbjct  173   DNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGAGAYIDDIDALIPLSKGNIRTAI  232

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL  +IL MSFAPRDTH +QVQFALERGVPA+IG+LASKRLPYP++AF
Sbjct  233   DTGCGVASWGAYLLRNDILAMSFAPRDTHAAQVQFALERGVPAMIGVLASKRLPYPARAF  292

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK++W+GW+RT+EDL+ EQ
Sbjct  293   DMAHCSRCLIPWQNYDGLYLIEVDRVLRPGGYWILSGPPIHWKKHWRGWERTQEDLKQEQ  352

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
               IE VA  LCWKK +E +D+AIWQKP NH++CI+ R+    P +C  S++PDMAW  D+
Sbjct  353   DSIEAVAKRLCWKKVIEKNDLAIWQKPINHIECIKSRRVYKTPHIC-KSDNPDMAWERDM  411

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             + C+TPLP+ S+  +     LEKWP R  AVPPRI  G+I G++ E    D  LW +R+ 
Sbjct  412   ENCITPLPETSNPDDVAGGALEKWPDRAFAVPPRISSGSIPGVTAEILRADDQLWKERVE  471

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             HY  ++    +  GRYRNV+DMNA+LGGFAAA+  + +WVMN VP  S  +TLGVIYERG
Sbjct  472   HYKRIIP---ISKGRYRNVMDMNAYLGGFAAAISKYPVWVMNTVPANSNQDTLGVIYERG  528

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IGTY  WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V
Sbjct  529   FIGTYQDWCEAFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVVFRDTV  588

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++L+K+K ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  589   ELLVKIKGITDGMKWKSQIMDHESGPFNPEKILVAVKTYWT  629



>gb|KHN16709.1| Putative methyltransferase PMT18 [Glycine soja]
Length=594

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/536 (64%), Positives = 428/536 (80%), Gaps = 11/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++    + +P CD+ +SEYTPC+D  R   +DR  L YRERHCP K+E+L C IPAP  Y
Sbjct  55    NNSGGAQEFPSCDMSFSEYTPCQDPVRGRKFDRNMLKYRERHCPAKNELLNCLIPAPPKY  114

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  115   KTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  174

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +LI L  G+IRTA+DTGCGVAS+GAYLL R+IL MSFAPRDTH++QVQFALERGVPA+I
Sbjct  175   NELIPLTSGTIRTAIDTGCGVASWGAYLLRRDILAMSFAPRDTHEAQVQFALERGVPAMI  234

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             GI+AS+R+PYP++AFDMAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPIRWK+Y
Sbjct  235   GIMASQRIPYPARAFDMAHCSRCLIPWHKLDGLYLIEVDRVLRPGGYWILSGPPIRWKKY  294

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPM  742
             W+GW+RTEEDL+ EQ  IE+VA  +CW K +E DD++IWQKP NH+ C + +Q    P M
Sbjct  295   WRGWERTEEDLKQEQDAIEEVAKRICWTKVVEKDDLSIWQKPKNHVGCAQTKQIYKTPHM  354

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PDMAWY +++ C+TPLP+VS   +     LEKWPKR  AVPPRI  G+I  I  
Sbjct  355   C-QSDNPDMAWYQNMEKCITPLPEVSSADKVAGGALEKWPKRAFAVPPRISSGSIPNIDA  413

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKFEKD+ +W +RI+HY  ++    +  GRYRNV+DMNA+LGGFAAAL+ + +WVMNVVP
Sbjct  414   EKFEKDNEVWRERIAHYKHLIP---LSQGRYRNVMDMNAYLGGFAAALIKYPVWVMNVVP  470

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  +TLG IYERG IGTYH WCEA STYPRTYDLIHA ++F +Y+DRC +  ILLEMD
Sbjct  471   PNSDHDTLGAIYERGFIGTYHDWCEAFSTYPRTYDLIHASNVFGIYQDRCNITHILLEMD  530

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+V+ R+ V++L+K+K ITDG++W+S ++DHE GP   EK+L A K YWT
Sbjct  531   RILRPEGTVVFRETVELLVKIKSITDGMKWKSNIMDHESGPFNPEKILVAQKAYWT  586



>ref|XP_008813543.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008813544.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Phoenix 
dactylifera]
Length=624

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/632 (58%), Positives = 470/632 (74%), Gaps = 33/632 (5%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             HQ   S   +L ++  L+  C L Y  G WQN    S ++  S   +K     T      
Sbjct  12    HQL-GSRRERLTWILGLSGLCVLFYMLGAWQNTITPSTSNPISSIVSKCNGPTT------  64

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
                         SS  + LDF  HH       V  N    S + +P CD+KYSE+TPC+D
Sbjct  65    ----------QSSSSGSSLDFQAHHQ------VGFNESSLSTEKFPSCDLKYSEFTPCQD  108

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R+  + +  L YRERHCP+K E L+C IPAP  Y+NPFKWP+SRD AWY N+PH+EL+
Sbjct  109   PRRARKFVKAMLKYRERHCPQKEEFLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHRELS  168

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EG RF+FPGGGTMF  GAD+YIDDI  LI L +G+IRTA+DTGCGVAS+
Sbjct  169   IEKAVQNWIQVEGSRFRFPGGGTMFPRGADSYIDDINALIPLTNGNIRTAIDTGCGVASW  228

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL+RNIL MSFAPRD+H++QVQFALERGVPA+IG++A++R+PYP++AFDMAHCSRCL
Sbjct  229   GAYLLNRNILAMSFAPRDSHEAQVQFALERGVPAMIGVMATERIPYPARAFDMAHCSRCL  288

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW +YDG YLIEVDRVLRPGGYWILSGPPI WK++++GW+RT+EDL+ EQ  IE +A  
Sbjct  289   IPWEKYDGLYLIEVDRVLRPGGYWILSGPPINWKKHYRGWERTQEDLKHEQDAIEDLAKR  348

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E  D+AIWQKP NH+ CI+ R+    P +C  +++PD AWY  ++TC+TPLP+
Sbjct  349   LCWKKVIEKGDLAIWQKPINHIQCIQNRKVYKTPHIC-RNDNPDAAWYKKMETCITPLPE  407

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             VS  +E     LEKWP+R  A+PPRI RG+I GI+ EKF++D+ +W +R++ Y  ++   
Sbjct  408   VSSSEEVAGGMLEKWPERAFAIPPRISRGSIPGITAEKFQEDNNMWKERLARYKKIIPP-  466

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA LGGFAAALV + +WVMNVVP +++ +TLGVIYERG IGTY  WC
Sbjct  467   -LTEGRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQQDTLGVIYERGFIGTYQDWC  525

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHAD +F++Y+DRC++  ILLEMDRILRPEG+VI RD VDVL+KV+ I
Sbjct  526   EAFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVQAI  585

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             T+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  586   TNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  617



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/538 (63%), Positives = 430/538 (80%), Gaps = 8/538 (1%)
 Frame = -2

Query  1644  LGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAP  1465
             +   DE +VK +PPCD+ YSEYTPC+D  R   +DR  L YRERHCP K E+++C IP P
Sbjct  115   MNETDEIAVKEFPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPSKEEMMQCLIPPP  174

Query  1464  FGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYI  1285
               Y+ PFKWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYI
Sbjct  175   PKYKTPFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYI  234

Query  1284  DDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVP  1105
             DDI  LI L DG+IRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QVQFALERGVP
Sbjct  235   DDINALIPLTDGNIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVP  294

Query  1104  ALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRW  925
             A+IGI+AS+RLPYP++AFDMAHCSRCLIPW +YDG YL+EVDR+LRPGGYWILSGPPIRW
Sbjct  295   AMIGIMASQRLPYPARAFDMAHCSRCLIPWQKYDGLYLMEVDRILRPGGYWILSGPPIRW  354

Query  924   KRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA-PP  748
             K+YW+GW+RT+EDL  EQ  IE V   LCWKK +E  D++IWQKP NH++CI+ ++  P 
Sbjct  355   KKYWRGWERTQEDLNQEQDSIEDVVKRLCWKKIIEQGDLSIWQKPINHIECIKSKKTYPT  414

Query  747   PMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGI  583
             P    S++ D AWY D++ C+ PLP+VS+  E     LEKWP+R  +VPPRI   ++ GI
Sbjct  415   PHICKSDNSDAAWYKDIEACIAPLPEVSNSDEVAGGALEKWPERALSVPPRISSNSVPGI  474

Query  582   SGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNV  403
             S EKF +D+ LW  RI++Y  ++    +  GRYRNV+DMNA+LGGFAAA++ + +WVMNV
Sbjct  475   STEKFREDNDLWKDRIAYYKKIVPP--LPKGRYRNVMDMNAYLGGFAAAMIKYPVWVMNV  532

Query  402   VPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLE  223
             VP  S  +TLGV+YERG IG YH WCEA S+YPRTYDLIHA  +F++Y+DRC++ +ILLE
Sbjct  533   VPANSNPDTLGVVYERGFIGVYHDWCEAFSSYPRTYDLIHAGGVFSIYQDRCDITNILLE  592

Query  222   MDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             MDR+LRPEG+VI RD V+VL+K++ IT+ ++W+S + DHE+GP   EK+L AVKTYWT
Sbjct  593   MDRLLRPEGTVIFRDTVEVLVKIQAITNRMKWKSHISDHENGPFNPEKILVAVKTYWT  650



>ref|XP_011004387.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
 ref|XP_011004388.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
Length=625

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/536 (65%), Positives = 430/536 (80%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++ DSV   PPCD+ YSEYTPC+D  R   +DR  L YRERHCP K E+L C IPAP  Y
Sbjct  85    NNTDSVNEIPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKY  144

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AWY N+PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI
Sbjct  145   KTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDI  204

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +LI L DGSIRTA+DTGCGVAS+GAYLL R+I++MSFAPRDTH++QV FALERGVP +I
Sbjct  205   SELIPLTDGSIRTAIDTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVPGMI  264

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             GI+AS+RLPYP++AFDMAHCSRCLIPW Q DG YLIEVDRVLRPGGYWILSGPPIRWK++
Sbjct  265   GIMASQRLPYPARAFDMAHCSRCLIPWHQNDGLYLIEVDRVLRPGGYWILSGPPIRWKKH  324

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPM  742
             W+GW+RT+EDL+ EQ  IE VA  LCWKK +E  D+++WQKP NH++CI  R+    P +
Sbjct  325   WRGWERTQEDLKQEQDAIEDVAKRLCWKKVVEKGDLSVWQKPLNHIECIASRKIYKTPHI  384

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C  S++PD AWY D++ C+TPLP+VS   E     +EKWP R  AVPPRI  G+I GI+ 
Sbjct  385   C-KSDNPDAAWYKDMEDCITPLPEVSSSDEVAGGVVEKWPARAFAVPPRIHSGSIPGINA  443

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ LW  R++HY   +    +  GR+RN++DMNA LGGFAAALV + +WVMNVVP
Sbjct  444   EKFKEDNDLWKDRVAHYKNFISP--LTQGRFRNIMDMNAQLGGFAAALVKYPVWVMNVVP  501

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  +TL VIYERG IG+Y  WCEA+STYPRTYDLIHA  +F++Y+DRC++  ILLEMD
Sbjct  502   ANSNPDTLCVIYERGFIGSYQDWCEAVSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMD  561

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  562   RILRPEGTVIFRDTVEVLVKIQTITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  617



>ref|XP_008813541.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Phoenix 
dactylifera]
Length=657

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/632 (58%), Positives = 470/632 (74%), Gaps = 33/632 (5%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             HQ   S   +L ++  L+  C L Y  G WQN    S ++  S   +K     T      
Sbjct  45    HQL-GSRRERLTWILGLSGLCVLFYMLGAWQNTITPSTSNPISSIVSKCNGPTT------  97

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
                         SS  + LDF  HH       V  N    S + +P CD+KYSE+TPC+D
Sbjct  98    ----------QSSSSGSSLDFQAHHQ------VGFNESSLSTEKFPSCDLKYSEFTPCQD  141

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R+  + +  L YRERHCP+K E L+C IPAP  Y+NPFKWP+SRD AWY N+PH+EL+
Sbjct  142   PRRARKFVKAMLKYRERHCPQKEEFLRCLIPAPPKYKNPFKWPQSRDYAWYDNIPHRELS  201

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EG RF+FPGGGTMF  GAD+YIDDI  LI L +G+IRTA+DTGCGVAS+
Sbjct  202   IEKAVQNWIQVEGSRFRFPGGGTMFPRGADSYIDDINALIPLTNGNIRTAIDTGCGVASW  261

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL+RNIL MSFAPRD+H++QVQFALERGVPA+IG++A++R+PYP++AFDMAHCSRCL
Sbjct  262   GAYLLNRNILAMSFAPRDSHEAQVQFALERGVPAMIGVMATERIPYPARAFDMAHCSRCL  321

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW +YDG YLIEVDRVLRPGGYWILSGPPI WK++++GW+RT+EDL+ EQ  IE +A  
Sbjct  322   IPWEKYDGLYLIEVDRVLRPGGYWILSGPPINWKKHYRGWERTQEDLKHEQDAIEDLAKR  381

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E  D+AIWQKP NH+ CI+ R+    P +C  +++PD AWY  ++TC+TPLP+
Sbjct  382   LCWKKVIEKGDLAIWQKPINHIQCIQNRKVYKTPHIC-RNDNPDAAWYKKMETCITPLPE  440

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
             VS  +E     LEKWP+R  A+PPRI RG+I GI+ EKF++D+ +W +R++ Y  ++   
Sbjct  441   VSSSEEVAGGMLEKWPERAFAIPPRISRGSIPGITAEKFQEDNNMWKERLARYKKIIPP-  499

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA LGGFAAALV + +WVMNVVP +++ +TLGVIYERG IGTY  WC
Sbjct  500   -LTEGRYRNVMDMNANLGGFAAALVKYPVWVMNVVPADTQQDTLGVIYERGFIGTYQDWC  558

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHAD +F++Y+DRC++  ILLEMDRILRPEG+VI RD VDVL+KV+ I
Sbjct  559   EAFSTYPRTYDLIHADGVFSIYQDRCDITYILLEMDRILRPEGTVIFRDTVDVLVKVQAI  618

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             T+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  619   TNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  650



>ref|XP_010934554.1| PREDICTED: probable methyltransferase PMT15 [Elaeis guineensis]
Length=608

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/528 (65%), Positives = 421/528 (80%), Gaps = 9/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +P CD  Y++YTPC D  RSL + R R  + ERHCP K+E+L+C +P P GYR P  WPE
Sbjct  77    FPVCDAMYTDYTPCHDHSRSLRFPRARHAHMERHCPAKNELLRCLVPPPAGYRRPLPWPE  136

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AW+ NVP+K+L  EK  Q+W+R EGDRF+FPGGGT F  GAD+YI +IG+LI L D
Sbjct  137   SRDAAWFANVPYKKLVAEKGNQSWVRVEGDRFRFPGGGTTFPRGADSYIKEIGRLIPLHD  196

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTALDTGCGVAS+GAYLLS+NILTMSFAPRD+H++QVQ ALERG+PA++GI A+ RL
Sbjct  197   GSIRTALDTGCGVASWGAYLLSQNILTMSFAPRDSHKAQVQLALERGLPAMLGIFAADRL  256

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPW  YDG YL+E+DR+LRPGGYWILSGPPI WK++W+GW   +
Sbjct  257   PYPSRAFDMAHCSRCLIPWHLYDGLYLMEIDRILRPGGYWILSGPPINWKQHWKGWHMKQ  316

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             +DL A Q+ IE +A SLCWKK  E +DIAIWQKP NH+ C   R+A   P  C A  +PD
Sbjct  317   KDLSALQSTIEAIARSLCWKKLKEKEDIAIWQKPANHIGCNASRKASLMPGFCSA-QEPD  375

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT +  C+TPLP+V+  +     ELEKWPKRL AVPPRI  G+I G++ + F +D+ 
Sbjct  376   AAWYTKMGACITPLPKVAGMQEKAGGELEKWPKRLMAVPPRISSGSISGVTPQMFLQDTE  435

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW +R+  Y      +L + G +RN+LDMN+ LGGFAAA++D  +WVMN+VP  +K++TL
Sbjct  436   LWKRRV-RYCKAASTELTQKGTHRNLLDMNSGLGGFAAAMIDDPVWVMNIVPTVAKIDTL  494

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTYH WCEAMSTYPRTYDL+HADS+FTLYKDRCEMEDILLEMDRILRPEG+
Sbjct  495   GVIYERGLIGTYHDWCEAMSTYPRTYDLLHADSVFTLYKDRCEMEDILLEMDRILRPEGT  554

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VI RDDVD+L+++K ITDG+ W SR+VDHEDGPLQREKLL AVK  W+
Sbjct  555   VIFRDDVDILVRIKSITDGMSWNSRIVDHEDGPLQREKLLIAVKANWS  602



>ref|XP_009360254.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009360255.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=632

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/641 (56%), Positives = 468/641 (73%), Gaps = 27/641 (4%)
 Frame = -2

Query  1950  YKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIAT  1771
             Y    P H+H    S   +L ++  ++  C + Y  G WQ        S       ++  
Sbjct  5     YSGGSPKHHH--IESKKKRLTWIFGVSALCIVCYMLGAWQTTSAPVNQSELYQ---RVGC  59

Query  1770  AKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVK  1591
              +T   SGN  ++  S++ S       LDF +HH        +  +  ++V+ +PPCD+ 
Sbjct  60    DETPSQSGNKTSSSVSSSSSSLH----LDFESHHQ-------VDINKTEAVQKFPPCDMS  108

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             YSEYTPC+D  R   +DR  L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY
Sbjct  109   YSEYTPCQDATRGRKFDRSMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWY  168

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PH+EL++EKAVQNWI+ EG+RF+FPGGGT F  GADAYID++  LI L  G+IRTA+
Sbjct  169   DNIPHRELSIEKAVQNWIQVEGERFRFPGGGTGFPRGADAYIDEMNALIPLTKGNIRTAI  228

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL R+ILTMSFAPRDTH +QVQFALERGVPA+IG++ASKRLPYP++AF
Sbjct  229   DTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVPAMIGVMASKRLPYPARAF  288

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK++W+GW+RT++DL+ EQ
Sbjct  289   DMAHCSRCLIPWTNYDGMYLIEVDRVLRPGGYWILSGPPIHWKKHWRGWERTQQDLKQEQ  348

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
               IE +A SLCWKK +E +D+AIWQKP NH++CI+ R+    P +C  S++PDMAW  ++
Sbjct  349   DSIESLAKSLCWKKVIEKNDLAIWQKPINHVECIKSRKVYKTPHIC-KSDNPDMAWEREM  407

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             ++C+TPLP+ S+  +     LEKWP+R  A+PPRI  G+I GI+ +K  +D+ LW +R+ 
Sbjct  408   ESCITPLPETSNPNDVAGGALEKWPQRAFAIPPRISSGSIPGITADKLREDNQLWKERVD  467

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             HY  ++    +  GRYRNV+DMNA+LGGFAAAL  + +WVMN VP  S  +TLGVIYERG
Sbjct  468   HYKRIVP---ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERG  524

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IG Y  WCEA+STYPRTYD IHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V
Sbjct  525   FIGHYQDWCEALSTYPRTYDFIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTV  584

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++L+K+K ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  585   EILVKIKAITDGMRWKSQILDHESGPFNPEKILLAVKTYWT  625



>gb|AAX94055.2| dehydration-induced protein [Triticum aestivum]
Length=631

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/639 (57%), Positives = 460/639 (72%), Gaps = 27/639 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK  1765
             PA P   H    S   +L Y+ +++  C   Y  G WQN    +  +          +A 
Sbjct  6     PASPKAQH-LQESKKQRLTYVLVVSALCVAFYVLGAWQNSTMPNPVAD---------SAI  55

Query  1764  TCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
             + +     A    S      +    LDF  HH          +  E  V+ +P C +  S
Sbjct  56    SRVDCDTVAQRDGSVPSFAPASENVLDFDAHHQLNL------SETESVVQQFPACPLNQS  109

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPCED +R   +DR+ LIYRERHCP K E ++C IPAP  Y+NPF+WPESRDVAW+ N
Sbjct  110   EYTPCEDRKRGRLFDRDMLIYRERHCPGKDEQIRCLIPAPPKYKNPFRWPESRDVAWFDN  169

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             +PHKEL++EKAVQNWIR EG++F+FPGGGTMF +GADAYID+I KLI+L DG IRTA+DT
Sbjct  170   IPHKELSIEKAVQNWIRVEGNKFRFPGGGTMFPHGADAYIDEISKLISLSDGRIRTAIDT  229

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVASFGAYLL RNI+T+SFAPRDTH++QVQFALERGVPA++G++ S RLPYPS+AFD+
Sbjct  230   GCGVASFGAYLLKRNIITVSFAPRDTHEAQVQFALERGVPAILGVMGSIRLPYPSRAFDL  289

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPWG +DG YL E+DR+LRPGGYWI SGPPI WK +  GW R EEDL+ EQ +
Sbjct  290   AHCSRCLIPWGGHDGLYLAEIDRILRPGGYWIHSGPPINWKTHHNGWKRAEEDLKREQDK  349

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYTDLQT  691
             IE VA SLCW K  E +D++IWQKP NH++C  I+ +   P +C  S++PD AWY  +++
Sbjct  350   IEDVARSLCWNKVAEKEDLSIWQKPKNHLECADIKKKHKIPHIC-KSDNPDAAWYKKMES  408

Query  690   CLTPLPQVSDE-----KELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             CLTPLP+VS++      E+ +WPKR   VPPR+KRGTI GI  +KFE D  LW KR+++Y
Sbjct  409   CLTPLPEVSNQGSIAGGEVARWPKRAFTVPPRVKRGTIPGIDEKKFEDDMKLWEKRLAYY  468

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
                     +  GRYRNV+DMNA LGGFAA+LV + +WVMNVVPV S  +TLG IYERG I
Sbjct  469   KRTTP---IAQGRYRNVMDMNANLGGFAASLVKYPVWVMNVVPVNSDKDTLGAIYERGFI  525

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             GTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ DILLEMDRILRPEG+ IIRD VDV
Sbjct  526   GTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITDILLEMDRILRPEGTAIIRDTVDV  585

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             L KV+ I   ++W+SR++DHEDGP  +EK+L AVKTYWT
Sbjct  586   LTKVQAIAQRMRWDSRILDHEDGPFNQEKVLVAVKTYWT  624



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/632 (58%), Positives = 459/632 (73%), Gaps = 29/632 (5%)
 Frame = -2

Query  1923  HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGN  1744
             H +  S   +L ++  +   C   Y  G WQ        S       ++   +T   SGN
Sbjct  12    HHHVESKKKRLPWIFGIFALCIACYLLGAWQTTSAPVNRSELYQ---RVGCDETSSQSGN  68

Query  1743  tattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCED  1564
               ++  S++         LDF +HH        +  +  ++V+ + PCD+ YSEYTPC+D
Sbjct  69    KTSSPVSSSPLR------LDFESHHQ-------VDVNKTEAVQRFSPCDMSYSEYTPCQD  115

Query  1563  TERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELT  1384
               R   +DR+ L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY N+PH+EL+
Sbjct  116   PRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWYDNIPHRELS  175

Query  1383  VEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASF  1204
             +EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI  LI L  G+IRTA+DTGCGVAS+
Sbjct  176   IEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINALIPLTKGNIRTAIDTGCGVASW  235

Query  1203  GAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCL  1024
             GAYLL R+I+TMSFAPRD+H +QVQFALERGVPA+IG++ASKRLPYP++AFDMAHCSRCL
Sbjct  236   GAYLLKRDIVTMSFAPRDSHAAQVQFALERGVPAMIGVMASKRLPYPARAFDMAHCSRCL  295

Query  1023  IPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADS  844
             IPW  YDG YLIEVDRVLRPGGYWILSGPPI WK +W+GW+RT+EDL+ EQ  IE VA  
Sbjct  296   IPWMNYDGMYLIEVDRVLRPGGYWILSGPPINWKTHWRGWERTQEDLKQEQDSIESVAKR  355

Query  843   LCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLTPLPQ  670
             LCWKK +E +D+AIWQKP NH++C++ R     P +C  S++PDMAWY  L  C+TPLP+
Sbjct  356   LCWKKVIEKNDLAIWQKPINHVECVKSRNVYKTPHIC-KSDNPDMAWYYSL--CITPLPE  412

Query  669   VSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQ  505
              SD  +     LEKWP+R  AVPPRI  G+I GI+ EK  +D+ LW +R+ HY  ++   
Sbjct  413   TSDPNDVAGGALEKWPERAFAVPPRISSGSIPGITAEKLREDNQLWKERVVHYKRIVP--  470

Query  504   LVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWC  325
              +  GRYRNV+DMNA+LGGFAAAL  + +WVMN VP  S  +TLGVIYERG +GTY  WC
Sbjct  471   -ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERGFLGTYQDWC  529

Query  324   EAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRI  145
             EA STYPRTYDLIHA  IF++Y+DRC++  ILLEMDRILRPEG+V+ RD V++L+K+K I
Sbjct  530   EAFSTYPRTYDLIHAGGIFSIYQDRCDITLILLEMDRILRPEGTVVFRDTVEILVKIKAI  589

Query  144   TDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             TDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  590   TDGMRWKSQIMDHESGPFNPEKILLAVKTYWT  621



>ref|XP_008375441.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
 ref|XP_008375442.1| PREDICTED: probable methyltransferase PMT18 [Malus domestica]
Length=632

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/641 (56%), Positives = 467/641 (73%), Gaps = 27/641 (4%)
 Frame = -2

Query  1950  YKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIAT  1771
             Y    P H+H    S   +L ++  ++  C + Y  G WQ        S       ++  
Sbjct  5     YSGGSPKHHH--IESKKKRLTWIFGVSALCIVCYMLGAWQTTSAPVNQSELYQ---RVGC  59

Query  1770  AKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVK  1591
              +T   SGN  ++  S++ S       LDF +HH        +  +  ++V+ +PPCD+ 
Sbjct  60    DETPSQSGNKTSSSVSSSSSSLH----LDFESHHQ-------VDINKTEAVQKFPPCDMS  108

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             YSEYTPC+D  R   +DR  L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY
Sbjct  109   YSEYTPCQDATRGRKFDRSMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWY  168

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PH+EL++EKAVQNWI+ EGDRF+FPGGGT F  GADAYID++  LI L  G+IRTA+
Sbjct  169   DNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTGFPRGADAYIDEMNALIPLTKGNIRTAI  228

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL R+ILTMSFAPRDTH +QVQFALERGVPA+IG++ASKRLPYP++AF
Sbjct  229   DTGCGVASWGAYLLKRDILTMSFAPRDTHAAQVQFALERGVPAMIGVMASKRLPYPARAF  288

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK++W+GW+RT++DL+ EQ
Sbjct  289   DMAHCSRCLIPWTNYDGMYLIEVDRVLRPGGYWILSGPPIHWKKHWRGWERTQQDLKQEQ  348

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
               IE +A  LCWKK +E +D+AIWQKP NH++CI+ R+    P +C  S++PDMAW  ++
Sbjct  349   DSIESLAKRLCWKKVIEKNDLAIWQKPINHVECIKSRKVYKTPHIC-KSDNPDMAWEREM  407

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             ++C++PLP+ S+  +     LEKWP+R  A+PPRI  G+I GI+ +K  +D+ LW +R+ 
Sbjct  408   ESCISPLPETSNPNDVAGGALEKWPQRAFAIPPRISSGSIPGITADKLREDNQLWKERVD  467

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             HY  ++    +  GRYRNV+DMNA+LGGFAAAL  + +WVMN VP  S  +TLGVIYERG
Sbjct  468   HYKRIVP---ISKGRYRNVMDMNAYLGGFAAALSKYPVWVMNTVPANSNQDTLGVIYERG  524

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IG Y  WCEA+STYPRTYD IHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V
Sbjct  525   FIGHYQDWCEALSTYPRTYDFIHAGGVFSIYQDRCDITLILLEMDRILRPEGTVVFRDTV  584

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++L+KVK ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  585   EILVKVKAITDGMRWKSQILDHESGPFNPEKILLAVKTYWT  625



>ref|XP_006661944.1| PREDICTED: probable methyltransferase PMT18-like [Oryza brachyantha]
Length=633

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/638 (57%), Positives = 463/638 (73%), Gaps = 25/638 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAK  1765
             PA P    Q   S   +L Y+ +++  C   Y  G WQN       +         ++A 
Sbjct  6     PASP-KAQQLQESRKQRLTYILVVSALCVAFYVLGAWQNTTLPKPAA---------SSAI  55

Query  1764  TCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
             T +     A++ S+     S+    LDF  HH      +  G     +V+ +P C + +S
Sbjct  56    TKVGCDPAASSSSAVPSFGSASQESLDFEAHHQLSLDDSDAGA----AVQPFPACPMNFS  111

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPCED  R   ++R  L+YRERHCP K E ++C +PAP  YR PFKWP+SRD AW+ N
Sbjct  112   EYTPCEDRTRGRRFERAMLVYRERHCPGKDEEIRCLVPAPPKYRTPFKWPQSRDYAWFNN  171

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             +PHKEL++EKAVQNWI+ +G+RF+FPGGGTMF  GADAYIDDIGKLI+L DG IRTA+DT
Sbjct  172   IPHKELSIEKAVQNWIQVDGERFRFPGGGTMFPRGADAYIDDIGKLISLSDGRIRTAIDT  231

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVAS+GAYLL RNIL MSFAPRDTH++QVQFALERGVPA+IG++  +RLPYPS+AFDM
Sbjct  232   GCGVASWGAYLLKRNILAMSFAPRDTHEAQVQFALERGVPAIIGVMGKQRLPYPSRAFDM  291

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPW ++DG YL EVDR+LRPGGYWI SGPPI WK +++GW+RT+EDL+ EQ Q
Sbjct  292   AHCSRCLIPWQEFDGLYLAEVDRILRPGGYWIHSGPPINWKTHYKGWERTKEDLKQEQDQ  351

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYTDLQT  691
             IE VA SLCW K +E  D++IWQKP NH++C  I+ +   P +C  S++PD AWY  ++ 
Sbjct  352   IEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKKYKTPHIC-KSDNPDAAWYKKMEA  410

Query  690   CLTPLPQVSDEKEL-----EKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             C+TPLP+VS++ E+     ++WP+R  AVPPR++RG I GI  +KFE+D  LW KR+++Y
Sbjct  411   CVTPLPEVSNQGEIAGGAVDRWPQRAFAVPPRVRRGMIPGIDAKKFEEDKKLWEKRVAYY  470

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
                +    +  GRYRNV+DMNA LGGFAA LV + +WVMNVVPV S  +TLG IYERG I
Sbjct  471   KRTLP---IAEGRYRNVMDMNANLGGFAATLVKYPVWVMNVVPVNSDRDTLGAIYERGFI  527

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             GTY  WCEA STYPRTYDL+HAD++F++Y+DRC++  ILLEMDRILRPEG+ IIRD VDV
Sbjct  528   GTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITSILLEMDRILRPEGTAIIRDTVDV  587

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYW  52
             L KV+ I   ++WESR++DHEDGP   EK+L AVKTYW
Sbjct  588   LTKVQAIAKRMRWESRIMDHEDGPFNPEKVLMAVKTYW  625



>gb|KFK31838.1| hypothetical protein AALP_AA6G165000 [Arabis alpina]
Length=625

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/532 (64%), Positives = 432/532 (81%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  86    TIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPTKDELLYCLIPPPPNYKIPF  145

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  146   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  205

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L +G IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  206   PLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  265

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  266   SRRLPYPARAFDLAHCSRCLIPWFKNDGLYLIEVDRVLRPGGYWILSGPPINWKQYWRGW  325

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTE+DL+ EQ  IE VA SLCWKK  E  D++IWQKP NH++C +++Q    PP+C +S
Sbjct  326   ERTEDDLKQEQDSIEDVAKSLCWKKVTEKGDLSIWQKPLNHIECKKMKQNKKSPPIC-SS  384

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             + PD AWY DL+TC+TPLP  ++  E     LE WP R  AVPPRI RGTI+GI+ EKF 
Sbjct  385   DTPDFAWYKDLETCITPLPDTNNPDESAGGALEDWPDRAFAVPPRIIRGTIEGINAEKFR  444

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNVVPV+++
Sbjct  445   EDNEVWKERIAHYKKIIPE--LSHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVVPVDAE  502

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG+IYERGLIGTY  WCE  STYPRTYD+IHA ++F+LY++RC++  ILLEMDRILR
Sbjct  503   KQTLGLIYERGLIGTYQDWCEGFSTYPRTYDMIHAGALFSLYENRCDLALILLEMDRILR  562

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V++L KV+RI  G++W+S++VDHE GP   EK+L AVKTYWT
Sbjct  563   PEGTVVLRDNVEILTKVERIVKGMKWKSQIVDHEKGPYNPEKILVAVKTYWT  614



>gb|EEC79826.1| hypothetical protein OsI_21282 [Oryza sativa Indica Group]
Length=631

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/528 (64%), Positives = 431/528 (82%), Gaps = 10/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC +KYSEYTPC+D  R+  + +  + YRERHCP+K E+ +C IPAP  Y+NPFKWP+
Sbjct  100   FPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPKYKNPFKWPQ  159

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
              RD AWY N+PH+EL++EKAVQNWI+ EG RF+FPGGGTMF +GADAYIDDI  LI+L D
Sbjct  160   CRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDDINALISLTD  219

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             G+IRTALDTGCGVAS+GAYL+ RNI+TMSFAPRD+H++QVQFALERGVPA+IG+++++R+
Sbjct  220   GNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHEAQVQFALERGVPAMIGVISTERI  279

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYP+++FDMAHCSRCLIPW ++DG YLIEVDRVLRPGGYWILSGPPI WK+Y++GW+RTE
Sbjct  280   PYPARSFDMAHCSRCLIPWNKFDGIYLIEVDRVLRPGGYWILSGPPIHWKKYFKGWERTE  339

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPD  718
             EDL+ EQ +IE +A  LCWKK +E DD+AIWQKP NH++C+  R+    P +C  SND D
Sbjct  340   EDLKQEQDEIEDLAKRLCWKKVVEKDDLAIWQKPINHIECVNSRKIYETPQIC-KSNDVD  398

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWY  ++TC++PLP V+ E E     LEKWPKR  AVPPRI RG++ G++ EKF++D+ 
Sbjct  399   SAWYKKMETCISPLPDVNSEDEVAGGALEKWPKRAFAVPPRISRGSVSGLTTEKFQEDNK  458

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             +W +R  +Y  ++    +  GRYRNV+DMNA +GGFAAAL+ + LWVMNVVP  S  +TL
Sbjct  459   VWAERADYYKKLIPP--LTKGRYRNVMDMNAGMGGFAAALMKYPLWVMNVVPSGSAHDTL  516

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G+IYERG IGTY  WCEA STYPRTYD IHAD IF+ Y+DRC++  ILLEMDRILRPEG+
Sbjct  517   GIIYERGFIGTYQDWCEAFSTYPRTYDFIHADKIFSFYQDRCDVTYILLEMDRILRPEGT  576

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VI RD V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  577   VIFRDTVEVLVKIQSITEGMRWKSQIMDHESGPFNPEKILVAVKTYWT  624



>ref|XP_008239284.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
 ref|XP_008239285.1| PREDICTED: probable methyltransferase PMT18 [Prunus mume]
Length=637

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/641 (57%), Positives = 463/641 (72%), Gaps = 22/641 (3%)
 Frame = -2

Query  1950  YKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIAT  1771
             Y    P H+H    S   +L ++  ++  C + Y  G WQ        S          T
Sbjct  5     YTGGSPKHHH--LESKKKRLTWIFGVSALCVVCYMLGAWQTTSSPVNRSELYQRVGCDET  62

Query  1770  AKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVK  1591
             ++     GN A++ S +  S SS S  LDF +HH        +  +  D+V+ +P CD+ 
Sbjct  63    SQN--QGGNNASSSSPSAASASSSSLHLDFESHHQ-------VDINKSDAVQKFPACDMA  113

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             YSEYTPC+D +R   +DR+ L YRERHCP K E L C IPAP  Y+ PFKWP+SRD AWY
Sbjct  114   YSEYTPCQDPQRGRKFDRKMLKYRERHCPTKEEQLLCLIPAPPKYKTPFKWPQSRDFAWY  173

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF  GA AYIDDI  LI L  G+IRTA+
Sbjct  174   DNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGAGAYIDDIDALIPLSKGNIRTAI  233

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL  +IL MSFAPRDTH +QVQFALERGVPA+IG+LASKRLPYP++AF
Sbjct  234   DTGCGVASWGAYLLRNDILAMSFAPRDTHAAQVQFALERGVPAMIGVLASKRLPYPARAF  293

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW  YDG YLIEVDRVLRPGGYWILSGPPI WK++W+GW+RT+EDL+ EQ
Sbjct  294   DMAHCSRCLIPWQNYDGLYLIEVDRVLRPGGYWILSGPPIHWKKHWRGWERTQEDLKQEQ  353

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
               IE VA  LCWKK +E +D+A+WQKP NH++CI+ R+    P +C  S++PDMAW  D+
Sbjct  354   DSIEAVAKRLCWKKVIEKNDLAVWQKPINHIECIKSRRVYKTPHIC-KSDNPDMAWEKDM  412

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             + C+TPLP+ ++  +     LEKWP R  AVPPRI  G+I G++ E    D  LW +R+ 
Sbjct  413   ENCITPLPETTNPDDVAGGALEKWPDRAFAVPPRISSGSIPGVTAEILRADDQLWKERVE  472

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             HY  ++    +  GRYRNV+DMNA+LGGFAAA+  + +WVMN +P  S  +TLGVIYERG
Sbjct  473   HYKRIIP---ISKGRYRNVMDMNAYLGGFAAAISKYPVWVMNTIPANSNQDTLGVIYERG  529

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IGTY  WCEA STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+V+ RD V
Sbjct  530   FIGTYQDWCEAFSTYPRTYDLIHAGGVFSIYQDRCDITYILLEMDRILRPEGTVVFRDTV  589

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++L+K+K ITDG++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  590   ELLVKIKGITDGMKWKSQIMDHESGPFNPEKILVAVKTYWT  630



>ref|NP_001056546.2| Os06g0103900 [Oryza sativa Japonica Group]
 dbj|BAD67956.1| dehydration-responsive protein-like [Oryza sativa Japonica Group]
 gb|EEE64943.1| hypothetical protein OsJ_19817 [Oryza sativa Japonica Group]
 dbj|BAF18460.2| Os06g0103900 [Oryza sativa Japonica Group]
Length=631

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/528 (64%), Positives = 431/528 (82%), Gaps = 10/528 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC +KYSEYTPC+D  R+  + +  + YRERHCP+K E+ +C IPAP  Y+NPFKWP+
Sbjct  100   FPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPKYKNPFKWPQ  159

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
              RD AWY N+PH+EL++EKAVQNWI+ EG RF+FPGGGTMF +GADAYIDDI  LI+L D
Sbjct  160   CRDFAWYDNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDDINALISLTD  219

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             G+IRTALDTGCGVAS+GAYL+ RNI+TMSFAPRD+H++QVQFALERGVPA+IG+++++R+
Sbjct  220   GNIRTALDTGCGVASWGAYLIKRNIITMSFAPRDSHEAQVQFALERGVPAMIGVISTERI  279

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYP+++FDMAHCSRCLIPW ++DG YLIEVDRV+RPGGYWILSGPPI WK+Y++GW+RTE
Sbjct  280   PYPARSFDMAHCSRCLIPWNKFDGIYLIEVDRVIRPGGYWILSGPPIHWKKYFKGWERTE  339

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPD  718
             EDL+ EQ +IE +A  LCWKK +E DD+AIWQKP NH++C+  R+    P +C  SND D
Sbjct  340   EDLKQEQDEIEDLAKRLCWKKVVEKDDLAIWQKPINHIECVNSRKIYETPQIC-KSNDVD  398

Query  717   MAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWY  ++TC++PLP V+ E E     LEKWPKR  AVPPRI RG++ G++ EKF++D+ 
Sbjct  399   SAWYKKMETCISPLPDVNSEDEVAGGALEKWPKRAFAVPPRISRGSVSGLTTEKFQEDNK  458

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             +W +R  +Y  ++    +  GRYRNV+DMNA +GGFAAAL+ + LWVMNVVP  S  +TL
Sbjct  459   VWAERADYYKKLIPP--LTKGRYRNVMDMNAGMGGFAAALMKYPLWVMNVVPSGSAHDTL  516

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             G+IYERG IGTY  WCEA STYPRTYD IHAD IF+ Y+DRC++  ILLEMDRILRPEG+
Sbjct  517   GIIYERGFIGTYQDWCEAFSTYPRTYDFIHADKIFSFYQDRCDVTYILLEMDRILRPEGT  576

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VI RD V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  577   VIFRDTVEVLVKIQSITEGMRWKSQIMDHESGPFNPEKILVAVKTYWT  624



>ref|XP_003574187.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234900.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234901.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010234902.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/643 (57%), Positives = 459/643 (71%), Gaps = 27/643 (4%)
 Frame = -2

Query  1956  PTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI  1777
             P   PA P   H    S  ++L Y+ +++  C   Y  G WQN         S       
Sbjct  2     PKDYPASPKAQH-LQESKKHRLTYILVVSSLCVAFYVLGAWQNTTMPKPVGNS-------  53

Query  1776  ATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCD  1597
             A A+          +   +  S S      D        D  AV        V+ +P C 
Sbjct  54    AIARVDCDPTAQRDSSVPSFGSASETVLDFDAHHQLNLTDTEAV--------VQQFPACS  105

Query  1596  VKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVA  1417
             + +SEYTPCED +R   ++RE L YRERHCP K E ++C IPAP  Y+NPFKWP+SRD A
Sbjct  106   LNFSEYTPCEDRKRGRRFEREMLAYRERHCPGKDEEIQCLIPAPPKYKNPFKWPQSRDFA  165

Query  1416  WYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRT  1237
             W+ N+PHKEL++EKAVQNWI+ EG++F+FPGGGTMF +GADAYIDDI KLI+L DG IRT
Sbjct  166   WFDNIPHKELSIEKAVQNWIQVEGNKFRFPGGGTMFPHGADAYIDDIAKLISLSDGKIRT  225

Query  1236  ALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSK  1057
             A+DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++ ++RLPYPS+
Sbjct  226   AIDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMGTQRLPYPSR  285

Query  1056  AFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEA  877
             AFDMAHCSRCLIPWG YDG YL EVDR+LRPGGYWILSGPPI WK + QGW RT+EDL+ 
Sbjct  286   AFDMAHCSRCLIPWGAYDGLYLAEVDRILRPGGYWILSGPPINWKTHQQGWQRTKEDLKQ  345

Query  876   EQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYT  703
             EQ +IE VA SLCW K +E  D++IWQKP NH++C  I+ +   P +C  S++PD AWY 
Sbjct  346   EQDKIENVARSLCWSKVVEKRDLSIWQKPKNHLECANIKKKYKIPHIC-KSDNPDAAWYK  404

Query  702   DLQTCLTPLPQVSDE-----KELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKR  538
              ++ C+TPLP+VS++      E+E+WP+R   VPPR+KRGTI GI  +KF +D  L  KR
Sbjct  405   KMEACVTPLPEVSNQGSIAGGEVERWPERAFTVPPRVKRGTIPGIDVKKFVEDKKLSEKR  464

Query  537   ISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYE  358
             +++Y        +  GRYRNV+DMNA LGGFAA+LV + +WVMNV+PV S  +TLG IYE
Sbjct  465   LAYYKRTTP---IAEGRYRNVMDMNANLGGFAASLVKYPVWVMNVIPVNSDKDTLGAIYE  521

Query  357   RGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRD  178
             RG IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ +ILLEMDRILRPEG+ IIRD
Sbjct  522   RGFIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITNILLEMDRILRPEGTAIIRD  581

Query  177   DVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              VDVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  582   TVDVLTKVQAITKRMRWESRILDHEDGPFNPEKVLVAVKTYWT  624



>ref|XP_002466953.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
 gb|EER93951.1| hypothetical protein SORBIDRAFT_01g017340 [Sorghum bicolor]
Length=637

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/642 (57%), Positives = 462/642 (72%), Gaps = 27/642 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI--AT  1771
             PA P    Q   S   +L Y+ +++  C   Y  G WQN         S I        T
Sbjct  6     PASP-KAQQLQESKKQRLTYILVVSALCIAFYVLGAWQNTTLPKPIGNSGITRVGCDPTT  64

Query  1770  AKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS-VKVYPPCDV  1594
             A T   SG+  +    + +        LDF  HH        + N D D  ++ +P C +
Sbjct  65    ASTTQSSGSVPSFGPGSGEV-------LDFDAHHRL-----TINNTDGDGELQQFPACPL  112

Query  1593  KYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAW  1414
              +SEYTPCED +R   +DR  L+YRERHCP K E ++C IPAP GYR PFKWP SRD A+
Sbjct  113   NFSEYTPCEDRKRGRRFDRAMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPHSRDYAY  172

Query  1413  YTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTA  1234
             + N+PHKEL++EKAVQNWI+ EGD+FKFPGGGTMF  GADAYIDDI KLI+L DG IRTA
Sbjct  173   FNNIPHKELSIEKAVQNWIQVEGDKFKFPGGGTMFPRGADAYIDDIDKLISLSDGKIRTA  232

Query  1233  LDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKA  1054
             +DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++   RLPYPS+A
Sbjct  233   VDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMGKHRLPYPSRA  292

Query  1053  FDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAE  874
             FDMAHCSRCLIPW ++DG YL EVDR+LRPGGYWILSGPPI WK +  GW+RT++DL+ E
Sbjct  293   FDMAHCSRCLIPWYEHDGLYLAEVDRILRPGGYWILSGPPINWKTHHVGWERTKDDLKQE  352

Query  873   QTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTD  700
             Q  IE +A SLCW K +E  D++IWQKP NH++C  +++    P +C  S++PD AWY  
Sbjct  353   QDNIEDIARSLCWNKVVEKRDLSIWQKPKNHLECANIKKTYKTPHIC-KSDNPDAAWYRQ  411

Query  699   LQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRI  535
             ++ C+TPLP+VS++ E     +EKWP+R   VPPRI+RG I G+  +KF++D  LW KR+
Sbjct  412   MEACVTPLPEVSNQGEVAGGAVEKWPERAFLVPPRIRRGMIPGLDAKKFDEDKKLWEKRV  471

Query  534   SHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYER  355
             ++Y  ++    +   RYRNV+DMNA +GGFAA+LV + +WVMNVVPV S  +TLG IYER
Sbjct  472   AYYKRIIP---IAENRYRNVMDMNANMGGFAASLVKYPVWVMNVVPVNSDRDTLGAIYER  528

Query  354   GLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDD  175
             G IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ DILLEMDRILRPEG+ IIRD 
Sbjct  529   GFIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITDILLEMDRILRPEGTAIIRDT  588

Query  174   VDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             VDVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  589   VDVLTKVQAITKRMRWESRIMDHEDGPFNPEKVLMAVKTYWT  630



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/532 (64%), Positives = 429/532 (81%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S+  +PPCD+ YS+YTPC+D  RS  +DRE   YRERHCPK  E+L+C IPAP  Y+ PF
Sbjct  97    SLHEFPPCDMSYSDYTPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPF  156

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA QNWI+ EG RF+FPGGGT F NGADAYID+I +LI
Sbjct  157   KWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELI  216

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L  G+IRTA+DTGCGVAS+GAYLL R+ILTMSFAPRDTH++QVQFALERGVPA+IG+++
Sbjct  217   PLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFAPRDTHEAQVQFALERGVPAMIGVIS  276

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFDMAHCSRCLIPW  YDG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  277   SKRLPYPARAFDMAHCSRCLIPWYMYDGLYLLEVDRVLRPGGYWILSGPPIHWKKYWRGW  336

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RT+EDL+ EQ  IE +A  LCWKK +E +D+AIWQKP NH+DC + +     P +C   
Sbjct  337   ERTKEDLKQEQDTIEDIAKRLCWKKLIEKNDLAIWQKPINHIDCNKSKVVYKTPQIC-GP  395

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++PD AWY D++ C+TPLP+VS   E     LEKWP+R  +VPPRI  G++ GI+ EK  
Sbjct  396   DNPDTAWYKDMEACITPLPEVSSSDEVAGGALEKWPERAFSVPPRISSGSLSGITAEKLR  455

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ LW  R+++Y  + DG L   GRYRNV+DMNA+LGGFAAA+  + +WVMNVVP  S 
Sbjct  456   EDNELWKDRMTYYKKI-DG-LFHKGRYRNVMDMNAYLGGFAAAMSKYPVWVMNVVPFHSN  513

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
              +TLG IYERGLIGTY  WCEA STYPRTYDLIHA  +F++Y+DRC++ +ILLE+DRILR
Sbjct  514   PDTLGAIYERGLIGTYQDWCEAFSTYPRTYDLIHASGVFSIYQDRCDITNILLEIDRILR  573

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+VI RD V++L+K++ IT+G++W+S+++DHE GP   EK+LFA KTYWT
Sbjct  574   PEGTVIFRDTVEMLLKIRSITEGMRWKSQIMDHESGPFNPEKILFAAKTYWT  625



>gb|EYU33422.1| hypothetical protein MIMGU_mgv1a002913mg [Erythranthe guttata]
Length=626

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/539 (64%), Positives = 426/539 (79%), Gaps = 10/539 (2%)
 Frame = -2

Query  1644  LGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAP  1465
             L  +  + ++ +PPCD+ YSEYTPC+D  R   + R+ L YRERHCP K E+L+C +PAP
Sbjct  84    LSVNSSEEIEKFPPCDMAYSEYTPCQDNLRGRKFPRDMLKYRERHCPSKEELLRCLVPAP  143

Query  1464  FGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYI  1285
               Y++PFKWP+SRD AWY N+PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYI
Sbjct  144   PNYKSPFKWPQSRDYAWYANIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYI  203

Query  1284  DDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVP  1105
             DDI  LI + DG++RTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVP
Sbjct  204   DDINALIPITDGTVRTAVDTGCGVASWGAYLLKRDIMAMSFAPRDTHEAQVWFALERGVP  263

Query  1104  ALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRW  925
             A+IG+L S RLPYP++AFDMAHCSRCLIPW  +DG YLIEVDR+LRPGGYWILSGPPIRW
Sbjct  264   AMIGLLGSMRLPYPARAFDMAHCSRCLIPWFSFDGLYLIEVDRILRPGGYWILSGPPIRW  323

Query  924   KRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLR--QAP  751
             K YW+GW+RTEEDL+ EQ  IE+VA+ LCWKK +E  D+AIWQKP NHM+C+  +  Q  
Sbjct  324   KTYWRGWERTEEDLKQEQDSIEEVANRLCWKKVVEKGDLAIWQKPINHMECLERKSNQEK  383

Query  750   PPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDG  586
             P MC  S+  D AWY D++ C+TPLP+VS+  E     L+KWP+R   VPPRI  G+I G
Sbjct  384   PHMC-KSDSADAAWYKDMEACITPLPEVSNPNEVAGGALKKWPERAFTVPPRITSGSIQG  442

Query  585   ISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMN  406
             I+ +KF +D+ +W +RIS+Y  ++    +  G  RNV+DMNA LGGFAAAL  + +WVMN
Sbjct  443   ITAKKFLEDNAMWKERISYYKNLV--SQLSRGLIRNVMDMNANLGGFAAALSKYPVWVMN  500

Query  405   VVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILL  226
             VVP  S  +TLGVIYERG IG Y  WCEA STYPRTYDLIHA  +F++Y+DRC++  ILL
Sbjct  501   VVPANSDPDTLGVIYERGFIGAYQDWCEAFSTYPRTYDLIHAGGVFSIYQDRCDITYILL  560

Query  225   EMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EMDRILRPEG+VI RD V+VL+K+K ITDG++WES++VDHE GP   EK+L A KTYWT
Sbjct  561   EMDRILRPEGTVIFRDVVEVLVKIKSITDGMRWESKIVDHESGPFNVEKILLATKTYWT  619



>ref|XP_010234899.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Brachypodium 
distachyon]
Length=662

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/643 (57%), Positives = 459/643 (71%), Gaps = 27/643 (4%)
 Frame = -2

Query  1956  PTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI  1777
             P   PA P   H    S  ++L Y+ +++  C   Y  G WQN         S       
Sbjct  33    PKDYPASPKAQH-LQESKKHRLTYILVVSSLCVAFYVLGAWQNTTMPKPVGNS-------  84

Query  1776  ATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCD  1597
             A A+          +   +  S S      D        D  AV        V+ +P C 
Sbjct  85    AIARVDCDPTAQRDSSVPSFGSASETVLDFDAHHQLNLTDTEAV--------VQQFPACS  136

Query  1596  VKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVA  1417
             + +SEYTPCED +R   ++RE L YRERHCP K E ++C IPAP  Y+NPFKWP+SRD A
Sbjct  137   LNFSEYTPCEDRKRGRRFEREMLAYRERHCPGKDEEIQCLIPAPPKYKNPFKWPQSRDFA  196

Query  1416  WYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRT  1237
             W+ N+PHKEL++EKAVQNWI+ EG++F+FPGGGTMF +GADAYIDDI KLI+L DG IRT
Sbjct  197   WFDNIPHKELSIEKAVQNWIQVEGNKFRFPGGGTMFPHGADAYIDDIAKLISLSDGKIRT  256

Query  1236  ALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSK  1057
             A+DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++ ++RLPYPS+
Sbjct  257   AIDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMGTQRLPYPSR  316

Query  1056  AFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEA  877
             AFDMAHCSRCLIPWG YDG YL EVDR+LRPGGYWILSGPPI WK + QGW RT+EDL+ 
Sbjct  317   AFDMAHCSRCLIPWGAYDGLYLAEVDRILRPGGYWILSGPPINWKTHQQGWQRTKEDLKQ  376

Query  876   EQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDC--IRLRQAPPPMCPASNDPDMAWYT  703
             EQ +IE VA SLCW K +E  D++IWQKP NH++C  I+ +   P +C  S++PD AWY 
Sbjct  377   EQDKIENVARSLCWSKVVEKRDLSIWQKPKNHLECANIKKKYKIPHIC-KSDNPDAAWYK  435

Query  702   DLQTCLTPLPQVSDE-----KELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKR  538
              ++ C+TPLP+VS++      E+E+WP+R   VPPR+KRGTI GI  +KF +D  L  KR
Sbjct  436   KMEACVTPLPEVSNQGSIAGGEVERWPERAFTVPPRVKRGTIPGIDVKKFVEDKKLSEKR  495

Query  537   ISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYE  358
             +++Y        +  GRYRNV+DMNA LGGFAA+LV + +WVMNV+PV S  +TLG IYE
Sbjct  496   LAYYKRTTP---IAEGRYRNVMDMNANLGGFAASLVKYPVWVMNVIPVNSDKDTLGAIYE  552

Query  357   RGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRD  178
             RG IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ +ILLEMDRILRPEG+ IIRD
Sbjct  553   RGFIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITNILLEMDRILRPEGTAIIRD  612

Query  177   DVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              VDVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  613   TVDVLTKVQAITKRMRWESRILDHEDGPFNPEKVLVAVKTYWT  655



>ref|XP_010478718.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=638

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/636 (56%), Positives = 463/636 (73%), Gaps = 18/636 (3%)
 Frame = -2

Query  1926  NHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissift---AKIATAKTCL  1756
             +H    +   +L ++  ++  C LSY  G+WQN    + +S             TA+   
Sbjct  7     SHHLAEAKRKRLTWILCVSGLCILSYVLGSWQNNTVPTSSSEVYSRMGCDETTTTARAQT  66

Query  1755  FSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYT  1576
                 +++    +  S SS   GLDF +HH               +VK + PCD+  SEYT
Sbjct  67    QRNPSSSDDDESLSSSSSEPVGLDFESHHKLELKVT------NQTVKYFEPCDMSLSEYT  120

Query  1575  PCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPH  1396
             PCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PFKWP+SRD AWY N+PH
Sbjct  121   PCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIPH  180

Query  1395  KELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCG  1216
             KEL++EKA+QNWI+ EG+RF+FPGGGTMF  GADAYIDDI +LI L DG+IRTA+DTGCG
Sbjct  181   KELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDTGCG  240

Query  1215  VASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHC  1036
             VASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ S+RLPYP++AFD+AHC
Sbjct  241   VASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMGSRRLPYPARAFDLAHC  300

Query  1035  SRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEK  856
             SRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW+R++EDL+ EQ  IE 
Sbjct  301   SRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKYWKGWERSQEDLKQEQDSIEN  360

Query  855   VADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCLT  682
              A SLCWKK  E  D++IWQKP NH++C +L++    PP+C  S+ PD AWY DL++C+T
Sbjct  361   AARSLCWKKVTEKGDLSIWQKPINHVECNKLKRVHKSPPLCSKSDQPDFAWYKDLESCVT  420

Query  681   PLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAV  517
             PLP+ ++  E     LE WP R  AVPPRI RGTI   + EKF +D+ +W +RI++Y  +
Sbjct  421   PLPEANNPNEFAGGALEDWPDRAFAVPPRIIRGTIPDTNAEKFREDNEVWKERIAYYKQI  480

Query  516   MDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTY  337
             M    +  GR+RN++DMNA+LGGFAAA++ +  WVMNVVPV+++  TLGVIYERG IGTY
Sbjct  481   MPE--LSRGRFRNIMDMNAYLGGFAAAIMKYPSWVMNVVPVDAEKQTLGVIYERGFIGTY  538

Query  336   HTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIK  157
               WCE  STYPRTYDLIHA  +F++Y++RC++  ILLEMDRILRPEG+V+ RD+V+ L K
Sbjct  539   QDWCEGFSTYPRTYDLIHAGGLFSIYENRCDVALILLEMDRILRPEGTVVFRDNVETLTK  598

Query  156   VKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             ++ IT+G++W+SR++DHE GP   EK+L AVK+YWT
Sbjct  599   IQSITNGMKWKSRILDHEKGPFNPEKILLAVKSYWT  634



>ref|XP_010461135.1| PREDICTED: probable methyltransferase PMT18 [Camelina sativa]
Length=641

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/639 (57%), Positives = 465/639 (73%), Gaps = 21/639 (3%)
 Frame = -2

Query  1926  NHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSG  1747
             +H    +   +L ++  ++  C LSY  G+WQN    + +S          T  T     
Sbjct  7     SHHLAEAKRKRLTWILCVSGLCILSYVLGSWQNNTVPTSSSEVYSRMGCDETTTTTRAQT  66

Query  1746  Ntattlssttqslsshs------AGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYS  1585
             N +++ S  + S SS S       GLDF +HH               +VK + PCD+  S
Sbjct  67    NPSSSSSDESLSSSSSSLSSSEPVGLDFESHHKLELKVT------NQTVKYFEPCDMSLS  120

Query  1584  EYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTN  1405
             EYTPCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PFKWP+SRD AWY N
Sbjct  121   EYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDN  180

Query  1404  VPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDT  1225
             +PHKEL++EKA+QNWI+ EG+RF+FPGGGTMF  GADAYIDDI +LI L DG+IRTA+DT
Sbjct  181   IPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLIPLTDGAIRTAIDT  240

Query  1224  GCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDM  1045
             GCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ S+RLPYP++AFD+
Sbjct  241   GCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMGSRRLPYPARAFDL  300

Query  1044  AHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQ  865
             AHCSRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW+R++EDL+ EQ  
Sbjct  301   AHCSRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKYWKGWERSQEDLKQEQDS  360

Query  864   IEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQT  691
             IE  A SLCWKK  E  D++IWQKP NH++C +L++    PP+C  S+ PD AWY DL++
Sbjct  361   IENAARSLCWKKVTEKGDLSIWQKPINHVECNKLKRVHKSPPLCSKSDQPDFAWYKDLES  420

Query  690   CLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHY  526
             C+TPLP+ ++  E     LE WP R  AVPPRI RGTI   + EKF +D+  W +RI++Y
Sbjct  421   CVTPLPEANNPNEFAGGALEDWPDRAFAVPPRIIRGTIPDTNAEKFREDNEEWKERIAYY  480

Query  525   SAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLI  346
               +M    +  GR+RN++DMNA+LGGFAAA++ +  WVMNVVPV+++  TLGVIYERG I
Sbjct  481   KQIMPE--LSRGRFRNIMDMNAYLGGFAAAIMKYPSWVMNVVPVDAEKQTLGVIYERGFI  538

Query  345   GTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDV  166
             GTY  WCE  STYPRTYDLIHAD +F++Y++RC++  ILLEMDRILRPEG+V+ RD+V+ 
Sbjct  539   GTYQDWCEGFSTYPRTYDLIHADGLFSIYENRCDVTLILLEMDRILRPEGTVVFRDNVET  598

Query  165   LIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             L K++ IT+G++W+SR++DHE GP   EK+L AVK+YWT
Sbjct  599   LTKIQSITNGMKWKSRILDHEKGPFSPEKILLAVKSYWT  637



>ref|XP_002874627.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50886.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score =   744 bits (1922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 428/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PC++  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  92    TIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  151

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  152   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  211

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  212   PLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  271

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  272   SRRLPYPARAFDLAHCSRCLIPWFKNDGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  331

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D++IWQKP NH++C +L+Q    PP+C +S
Sbjct  332   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKGDLSIWQKPLNHIECKKLKQNNKSPPLC-SS  390

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D AWY DL+TC+TPLP+ ++  E     LE WP R  AVPPRI RGTI  ++ EKF 
Sbjct  391   DNADFAWYKDLETCITPLPETNNPDESAGGALEDWPNRAFAVPPRIIRGTIPDMNAEKFR  450

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNAFLGGFAA+++ +  WVMNVVPV+++
Sbjct  451   EDNEVWKERITHYKKIVPE--LSHGRFRNIMDMNAFLGGFAASMLKYPSWVMNVVPVDAE  508

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY+ RC++  ILLEMDRILR
Sbjct  509   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYEHRCDLTLILLEMDRILR  568

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V+ L KV++I  G++W+S++VDHE GP   EK+L AVKTYWT
Sbjct  569   PEGTVVLRDNVETLNKVEKIVKGMKWKSQIVDHEKGPFNPEKILVAVKTYWT  620



>dbj|BAK03905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=701

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/540 (63%), Positives = 432/540 (80%), Gaps = 10/540 (2%)
 Frame = -2

Query  1647  VLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPA  1468
             V  N    + ++ PPC +KYSEYTPC D  R+  + +  + YRERHCP K  +L+C IPA
Sbjct  157   VAFNESSRATEMIPPCQLKYSEYTPCHDPRRARKFPKAMMQYRERHCPTKENLLRCLIPA  216

Query  1467  PFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAY  1288
             P  Y+NPF WP+SRD AWY N+PH+EL++EKAVQNWI+ EGD+F+FPGGGTMF +GADAY
Sbjct  217   PPNYKNPFTWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGDKFRFPGGGTMFPHGADAY  276

Query  1287  IDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGV  1108
             IDDI  LI L DG+IRTALDTGCGVAS+GA+LL R I+TMSFAPRD+H++QVQFALERGV
Sbjct  277   IDDIDALIPLTDGNIRTALDTGCGVASWGAFLLKRGIITMSFAPRDSHEAQVQFALERGV  336

Query  1107  PALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIR  928
             PA+IG++ ++R+PYP++AFDMAHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPPIR
Sbjct  337   PAMIGVIGTERIPYPARAFDMAHCSRCLIPWNKLDGLYLLEVDRVLRPGGYWILSGPPIR  396

Query  927   WKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--  754
             WK++++GW RTEEDL+ EQ +IE +A  LCWKK +E DD+A+WQKP NHM+C   R+A  
Sbjct  397   WKKHYKGWQRTEEDLKQEQDEIEDLAKRLCWKKVVEKDDLAVWQKPINHMECANNRKADE  456

Query  753   PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTID  589
              P  C  S+D D AWY  ++TC++PLP+V  E+E     LE WP+R  AVPPRI +G + 
Sbjct  457   TPQFC-NSSDVDSAWYKKMETCISPLPEVQTEEEVAGGALENWPQRALAVPPRITKGLVS  515

Query  588   GISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVM  409
             G++ EKFE+D+ LW +R+ HY  ++    +  GRYRNV+DMNA +GGFA+AL+++ LWVM
Sbjct  516   GLTPEKFEEDNKLWAERVDHYKKLIPP--LAKGRYRNVMDMNAGMGGFASALMEYPLWVM  573

Query  408   NVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDIL  229
             NVVP  S  +TLGVIYERG IGTYH WCEA STYPRTYDLIHAD +F+ Y+DRC++  IL
Sbjct  574   NVVPSGSAPDTLGVIYERGFIGTYHDWCEAFSTYPRTYDLIHADKVFSFYQDRCDITYIL  633

Query  228   LEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             LEMDRILRPEG++I RD V++L+K++ ITDG++W+SR++DHE GP   EK+L AVKTYWT
Sbjct  634   LEMDRILRPEGTMIFRDTVEMLLKIQAITDGMRWKSRIMDHESGPFNPEKILVAVKTYWT  693



>gb|KHM99867.1| Putative methyltransferase PMT18 [Glycine soja]
Length=527

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/523 (65%), Positives = 420/523 (80%), Gaps = 11/523 (2%)
 Frame = -2

Query  1596  VKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVA  1417
             + +SEYTPC+D  R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD A
Sbjct  1     MSFSEYTPCQDPVRGRKFDRNMLKYRERHCPAKEELLNCLIPAPPKYKTPFKWPQSRDYA  60

Query  1416  WYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRT  1237
             WY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L  G+IRT
Sbjct  61    WYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTSGTIRT  120

Query  1236  ALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSK  1057
             A+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+AS+R+PYP++
Sbjct  121   AIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAMIGIMASQRIPYPAR  180

Query  1056  AFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEA  877
             AFDMAHCSRCLIPW ++DG YLIEVDRVLRPGGYWILSGPPIRWK+YW+GW+RTEEDL+ 
Sbjct  181   AFDMAHCSRCLIPWHKFDGLYLIEVDRVLRPGGYWILSGPPIRWKKYWRGWERTEEDLKQ  240

Query  876   EQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYT  703
             EQ  IE+VA  +CW K +E DD++IWQKP NH+ C + +Q    P MC  S++PDMAWY 
Sbjct  241   EQDAIEEVAKRICWTKVVEKDDLSIWQKPKNHVGCAQTKQIYKTPHMC-QSDNPDMAWYQ  299

Query  702   DLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKR  538
             +++ C+TPLP+V+   +     LEKWPKR  AVPPRI  G+I  I  EKF+KD+ +W +R
Sbjct  300   NMEKCITPLPEVNSADKMAGGALEKWPKRAFAVPPRISSGSIPSIDTEKFQKDNEVWRER  359

Query  537   ISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYE  358
             I+HY  ++    +  GRYRNV+DMNA+LGGFAAAL+   +WVMNVVP  S  +TLG IYE
Sbjct  360   IAHYKHLVP---LSQGRYRNVMDMNAYLGGFAAALIKFPVWVMNVVPPNSDHDTLGAIYE  416

Query  357   RGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRD  178
             RG IGTYH WCEA STYPRTYDLIHA ++F +Y+DRC +  ILLEMDRILRPEG+VI R+
Sbjct  417   RGFIGTYHDWCEAFSTYPRTYDLIHASNVFGIYQDRCNITQILLEMDRILRPEGTVIFRE  476

Query  177   DVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              V++L+K+K ITDG++W+S ++DHE GP   EK+L A K YWT
Sbjct  477   TVELLVKIKSITDGMKWKSNIIDHESGPFNPEKILVAEKAYWT  519



>emb|CDX99539.1| BnaC09g24530D [Brassica napus]
Length=625

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/542 (63%), Positives = 429/542 (79%), Gaps = 14/542 (3%)
 Frame = -2

Query  1638  NHDE-----DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRI  1474
             N DE      ++K + PCD+  SEYTPCED +R   +DR  L YRERHCP K E+L C I
Sbjct  76    NQDEFKETNQTIKYFEPCDLSLSEYTPCEDRQRGRKFDRNMLKYRERHCPSKDELLYCLI  135

Query  1473  PAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGAD  1294
             P P  Y+ PFKWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GAD
Sbjct  136   PPPPNYKIPFKWPQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGAD  195

Query  1293  AYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALER  1114
             AYIDDI +LI L +G IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALER
Sbjct  196   AYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALER  255

Query  1113  GVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPP  934
             GVPA+IGI+ S+RLPYP++AFD+AHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPP
Sbjct  256   GVPAIIGIMGSRRLPYPARAFDLAHCSRCLIPWFKNDGLYLMEVDRVLRPGGYWILSGPP  315

Query  933   IRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ-  757
             I WK+YW+GW+RTEEDL+ EQ  IE VA SLCWKK +E  D++IWQKP NH++C +L+Q 
Sbjct  316   INWKQYWRGWERTEEDLKQEQDSIEDVAKSLCWKKVIEKGDLSIWQKPINHIECKKLKQN  375

Query  756   -APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGT  595
                PP+C +S++ D AWY DL+ C+TPLP  ++ +E     LE WP R  AVPPRI RGT
Sbjct  376   NKSPPICSSSDNADSAWYKDLEPCVTPLPNTNNPEESAGGALEDWPDRAFAVPPRIIRGT  435

Query  594   IDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLW  415
             I  I+ E F +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  W
Sbjct  436   IQDINTEMFREDNEVWKERIAHYKKIVPE--LSRGRFRNIMDMNAYLGGFAASMLKYPSW  493

Query  414   VMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMED  235
             VMNVVPV ++  TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +FTLY +RC++  
Sbjct  494   VMNVVPVHAEKQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFTLYDNRCDLTL  553

Query  234   ILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTY  55
             ILLEMDRILRPEG+V++RD+V++L KV++I  G++W +++VDHE GP   EK+L AVKTY
Sbjct  554   ILLEMDRILRPEGTVVLRDNVEMLTKVEKIAKGIKWNTQIVDHEKGPYNPEKILVAVKTY  613

Query  54    WT  49
             WT
Sbjct  614   WT  615



>ref|XP_002298987.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE83792.1| dehydration-responsive family protein [Populus trichocarpa]
Length=529

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/523 (65%), Positives = 424/523 (81%), Gaps = 10/523 (2%)
 Frame = -2

Query  1596  VKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVA  1417
             + +SEY PC+DT+R   +DR  L YRERHCP K E+L C IPAP  Y+ PFKWP+SRD A
Sbjct  1     MSFSEYAPCQDTQRGRKFDRNMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYA  60

Query  1416  WYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRT  1237
             WY N+PHKEL++EKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI L DGSIRT
Sbjct  61    WYDNIPHKELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDINELIPLTDGSIRT  120

Query  1236  ALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSK  1057
             A+DTGCGVAS+GAYLL R+I++MSFAPRDTH++QV FALERGVP +IGI+AS+RLPYP++
Sbjct  121   AIDTGCGVASWGAYLLKRDIISMSFAPRDTHEAQVWFALERGVPGMIGIMASQRLPYPAR  180

Query  1056  AFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEA  877
             AFDMAHCSRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPI WK++W+GW+RT+EDL+ 
Sbjct  181   AFDMAHCSRCLIPWHKYDGMYLIEVDRVLRPGGYWILSGPPIHWKKHWKGWERTQEDLKQ  240

Query  876   EQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYT  703
             EQ  IE VA  LCWKK +E DD+++WQKP NH+DCI  R+    P +C  S++PD  WY 
Sbjct  241   EQDAIEDVAKRLCWKKVVEKDDLSVWQKPLNHIDCIASRKTYKTPHIC-KSDNPDAGWYK  299

Query  702   DLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKR  538
             +++ C+TPLP+VS   E     +EKWP R  A+PPRI+ G+I GI+ EKF++D+ LW  R
Sbjct  300   EMEVCITPLPEVSSSDEVAGGAVEKWPARAFAIPPRIRSGSIPGITAEKFKEDNNLWKDR  359

Query  537   ISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYE  358
             +++Y  ++    +  GRYRN++DMNA LGGFAAAL  + +WVMNVVP  S  +TLGVIYE
Sbjct  360   VTNYKHIISP--LTKGRYRNIMDMNAQLGGFAAALAKYPVWVMNVVPANSNPDTLGVIYE  417

Query  357   RGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRD  178
             RG IGTY  WCEA+STYPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VI RD
Sbjct  418   RGFIGTYQDWCEAVSTYPRTYDLIHAGGVFSIYQDRCDITHILLEMDRILRPEGTVIFRD  477

Query  177   DVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              V+VL+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  478   TVEVLVKIQTITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  520



>ref|XP_006655679.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Oryza 
brachyantha]
Length=626

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/537 (63%), Positives = 429/537 (80%), Gaps = 10/537 (2%)
 Frame = -2

Query  1638  NHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFG  1459
             N     V+  PPC +KYSEYTPC+D  R+  + +  + YRERHCP+K E+ +C IPAP  
Sbjct  86    NESSLVVEKIPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPK  145

Query  1458  YRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDD  1279
             YRNPFKWP SRD AWY N+PH+EL++EKAVQNWI+ EG RF+FPGGGTMF +GADAYIDD
Sbjct  146   YRNPFKWPLSRDYAWYNNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDD  205

Query  1278  IGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPAL  1099
             I  LI L DG+IRTALDTGCGVAS+GAYL+ R+I+TMSFAPRD+H++QVQFALERGVPA+
Sbjct  206   INALIPLTDGNIRTALDTGCGVASWGAYLIKRDIITMSFAPRDSHEAQVQFALERGVPAM  265

Query  1098  IGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKR  919
             IG++A++R+PYP++AFDMAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPI WKR
Sbjct  266   IGVMATQRIPYPARAFDMAHCSRCLIPWNKLDGIYLIEVDRVLRPGGYWILSGPPIHWKR  325

Query  918   YWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPP  745
             +++GW+RTEEDL+ EQ +IE +A  LCWKK +E DD+AIWQKP NH++C+  R+    P 
Sbjct  326   HFKGWERTEEDLKQEQDEIEDLAKRLCWKKVVEKDDLAIWQKPVNHIECVNSRKVYETPQ  385

Query  744   MCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGIS  580
             +C  S D D AWY  ++TC++PLP V+ + E     LEKWPKR   VPPRI RG++ G++
Sbjct  386   IC-KSIDVDSAWYKKMETCISPLPDVNSDDEVAGGALEKWPKRAFTVPPRISRGSVSGLT  444

Query  579   GEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVV  400
              EKF++D+ LW +R+ +Y  ++    +  GRYRNV+DMNA +GGFAAAL+ + LWVMNVV
Sbjct  445   TEKFQEDNKLWAERVDYYKKLIPP--LTKGRYRNVMDMNAGMGGFAAALMKYPLWVMNVV  502

Query  399   PVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEM  220
             P  S  +TLG+IYERG IGTY  WCEA STYPRTYDLIHAD +F+ Y++RC++  ILLEM
Sbjct  503   PSGSAHDTLGIIYERGFIGTYQDWCEAFSTYPRTYDLIHADKVFSFYQERCDVTYILLEM  562

Query  219   DRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             DRILRPEG+VI RD V+ L+K++ ITDG+ W+S+++DHE GP   EK+L AVKTYWT
Sbjct  563   DRILRPEGTVIFRDTVEALVKIQSITDGMSWKSQIMDHESGPFNPEKILMAVKTYWT  619



>emb|CDX94256.1| BnaC02g29160D [Brassica napus]
Length=619

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/532 (63%), Positives = 428/532 (80%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  81    TIKNFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  140

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PH+EL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  141   KWPQSRDYAWYDNIPHRELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  200

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L  G IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  201   PLTAGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  260

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW + +G YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  261   SKRLPYPARAFDLAHCSRCLIPWFKNEGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  320

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK +E  D+AIW+KP NH++C +L+Q    PP+C + 
Sbjct  321   ERTEEDLKKEQDSIEDVAKSLCWKKVIEKGDLAIWRKPINHIECKKLKQNNKSPPLCTSD  380

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N+ D AWY DL++C+TPLP+ ++ +E     LE WP R  AVPPRI RGTI  I+ EKF 
Sbjct  381   NNADFAWYKDLESCITPLPETNNPEESSDGALEDWPDRAFAVPPRIIRGTIQDINAEKFR  440

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI++Y  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNVVPV+++
Sbjct  441   EDNEVWKERIAYYKKIVPE--ISHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVVPVDAE  498

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY+++C++  ILLEMDRILR
Sbjct  499   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYENKCDLTFILLEMDRILR  558

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V+ L KV+RI  G++W +++VDHE GP   EK+L AVKTYWT
Sbjct  559   PEGTVVMRDNVETLTKVERIAKGMKWNTQIVDHEKGPYNPEKILVAVKTYWT  610



>ref|XP_006655678.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Oryza 
brachyantha]
Length=640

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/537 (63%), Positives = 429/537 (80%), Gaps = 10/537 (2%)
 Frame = -2

Query  1638  NHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFG  1459
             N     V+  PPC +KYSEYTPC+D  R+  + +  + YRERHCP+K E+ +C IPAP  
Sbjct  100   NESSLVVEKIPPCQLKYSEYTPCQDPRRARKFPKTMMQYRERHCPRKEELFRCLIPAPPK  159

Query  1458  YRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDD  1279
             YRNPFKWP SRD AWY N+PH+EL++EKAVQNWI+ EG RF+FPGGGTMF +GADAYIDD
Sbjct  160   YRNPFKWPLSRDYAWYNNIPHRELSIEKAVQNWIQVEGKRFRFPGGGTMFPHGADAYIDD  219

Query  1278  IGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPAL  1099
             I  LI L DG+IRTALDTGCGVAS+GAYL+ R+I+TMSFAPRD+H++QVQFALERGVPA+
Sbjct  220   INALIPLTDGNIRTALDTGCGVASWGAYLIKRDIITMSFAPRDSHEAQVQFALERGVPAM  279

Query  1098  IGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKR  919
             IG++A++R+PYP++AFDMAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPI WKR
Sbjct  280   IGVMATQRIPYPARAFDMAHCSRCLIPWNKLDGIYLIEVDRVLRPGGYWILSGPPIHWKR  339

Query  918   YWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPP  745
             +++GW+RTEEDL+ EQ +IE +A  LCWKK +E DD+AIWQKP NH++C+  R+    P 
Sbjct  340   HFKGWERTEEDLKQEQDEIEDLAKRLCWKKVVEKDDLAIWQKPVNHIECVNSRKVYETPQ  399

Query  744   MCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGIS  580
             +C  S D D AWY  ++TC++PLP V+ + E     LEKWPKR   VPPRI RG++ G++
Sbjct  400   IC-KSIDVDSAWYKKMETCISPLPDVNSDDEVAGGALEKWPKRAFTVPPRISRGSVSGLT  458

Query  579   GEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVV  400
              EKF++D+ LW +R+ +Y  ++    +  GRYRNV+DMNA +GGFAAAL+ + LWVMNVV
Sbjct  459   TEKFQEDNKLWAERVDYYKKLIPP--LTKGRYRNVMDMNAGMGGFAAALMKYPLWVMNVV  516

Query  399   PVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEM  220
             P  S  +TLG+IYERG IGTY  WCEA STYPRTYDLIHAD +F+ Y++RC++  ILLEM
Sbjct  517   PSGSAHDTLGIIYERGFIGTYQDWCEAFSTYPRTYDLIHADKVFSFYQERCDVTYILLEM  576

Query  219   DRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             DRILRPEG+VI RD V+ L+K++ ITDG+ W+S+++DHE GP   EK+L AVKTYWT
Sbjct  577   DRILRPEGTVIFRDTVEALVKIQSITDGMSWKSQIMDHESGPFNPEKILMAVKTYWT  633



>ref|XP_009596889.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596890.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596891.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596893.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596894.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
 ref|XP_009596895.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana tomentosiformis]
Length=634

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/536 (63%), Positives = 428/536 (80%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++  S + +PPCD+ YSEYTPC++ +R   +DR  L YRERHCP K E+L+C IPAP  Y
Sbjct  96    NNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHCPSKDELLRCLIPAPPNY  155

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AW+ N+PHKEL++EKAVQNW++ EGDR +FPGGGTMF +GADAYIDDI
Sbjct  156   KIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYIDDI  215

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +L+ L  G+IRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVP +I
Sbjct  216   SELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVWFALERGVPTMI  275

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             G++ S+RLPYP++AFDMAHCSRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPIRWK Y
Sbjct  276   GVMGSQRLPYPARAFDMAHCSRCLIPWNKYDGLYLIEVDRVLRPGGYWILSGPPIRWKTY  335

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPM  742
             W+GW+RT+EDL+ EQ  IE  A  LCWKK +E  D+A+WQKP NH++C + R +   P +
Sbjct  336   WRGWERTQEDLKQEQDAIEDTARRLCWKKVIEKGDLAVWQKPLNHIECTKSRSSYHKPHI  395

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C + N  D AWY D++ C+TPLP+V++  E     LEKWP+R  A PPRI  G+I  I+ 
Sbjct  396   CKSGNG-DAAWYQDMEACITPLPEVTNSDEVAGGALEKWPERAFATPPRISSGSIPSITI  454

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ +WN+R+S+Y  ++   L+  GRYRNV+D NA+LGGFAAAL  + +WVMNVVP
Sbjct  455   EKFQEDNQVWNERVSYYKRLIG--LLPQGRYRNVMDANAYLGGFAAALSKYPVWVMNVVP  512

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               +   TLGVIYERG IGTY+ WCEA STYPRTYDLIHA  + +LY+DRC++  ILLEMD
Sbjct  513   ANNDPGTLGVIYERGFIGTYNDWCEAFSTYPRTYDLIHAGGLISLYQDRCDITYILLEMD  572

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+VL+K+K ITDG++W+SR+VDHE GP   EK+L AVKTYWT
Sbjct  573   RILRPEGTVIFRDVVEVLVKIKSITDGMRWQSRIVDHESGPFNPEKILIAVKTYWT  628



>ref|XP_009768341.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768342.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768343.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768344.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
 ref|XP_009768345.1| PREDICTED: probable methyltransferase PMT18 [Nicotiana sylvestris]
Length=636

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/536 (63%), Positives = 429/536 (80%), Gaps = 10/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGY  1456
             ++  S + +PPCD+ YSEYTPC++ +R   +DR  L YRERHCP K E+++C IPAP  Y
Sbjct  98    NNSKSSENFPPCDMSYSEYTPCQEPQRGRKFDRNMLKYRERHCPSKEELIRCLIPAPPNY  157

Query  1455  RNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDI  1276
             + PFKWP+SRD AW+ N+PHKEL++EKAVQNW++ EGDR +FPGGGTMF +GADAYIDDI
Sbjct  158   KIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYIDDI  217

Query  1275  GKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALI  1096
              +L+ L  G+IRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVPA+I
Sbjct  218   SELVPLTSGAIRTAIDTGCGVASWGAYLLKRDIVAMSFAPRDTHEAQVWFALERGVPAMI  277

Query  1095  GILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRY  916
             G++ S+RLPYP++AFDMAHCSRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPIRWK Y
Sbjct  278   GVMGSQRLPYPARAFDMAHCSRCLIPWNKYDGLYLIEVDRVLRPGGYWILSGPPIRWKTY  337

Query  915   WQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPM  742
             W+GW+RT+EDL+ EQ  IE  A  LCWKK +E  D+A+WQKP NH++C + R +   P +
Sbjct  338   WRGWERTQEDLKQEQDSIEDTARRLCWKKVIEKGDLAVWQKPLNHIECTKSRSSNHKPHI  397

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C + N  D AWY D++ C+TPLP+V++  E     LEKWP+R  A PPRI  G+I  I+ 
Sbjct  398   CKSGNG-DAAWYQDMEACITPLPEVTNSDEVAGGALEKWPERAFATPPRISSGSIPSITI  456

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ +WN+R+S+Y  ++   L+  GRYRNV+D NA+LGGFAAAL  + +WVMNVVP
Sbjct  457   EKFQEDNQVWNERVSYYKRLIG--LLPQGRYRNVMDANAYLGGFAAALSKYPVWVMNVVP  514

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               +  +TLGVIYERG IGTY+ WCEA STYPRTYDLIHA  + +LY+DRC++  ILLEMD
Sbjct  515   ANNDPDTLGVIYERGFIGTYNDWCEAFSTYPRTYDLIHAGGLISLYQDRCDITYILLEMD  574

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+VL+K+K I DG++W+SR+VDHE GP   EK+L AVKTYWT
Sbjct  575   RILRPEGTVIFRDVVEVLVKIKSIADGMRWQSRIVDHESGPFNPEKILIAVKTYWT  630



>ref|XP_004964271.1| PREDICTED: probable methyltransferase PMT17-like isoform X1 [Setaria 
italica]
 ref|XP_004964272.1| PREDICTED: probable methyltransferase PMT17-like isoform X2 [Setaria 
italica]
Length=620

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/540 (63%), Positives = 435/540 (81%), Gaps = 10/540 (2%)
 Frame = -2

Query  1647  VLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPA  1468
             V+ N     ++ +P C +KYSEYTPC+D  R+  + ++ + YRERHCPKK ++L+C IPA
Sbjct  77    VVFNESSLVLEKFPSCQLKYSEYTPCQDPRRARKFPKKMMQYRERHCPKKEDLLRCLIPA  136

Query  1467  PFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAY  1288
             P GY+NPF+WP+SRD AWY N+PH+EL++EKAVQNWI+ EGD  +FPGGGTMF +GADAY
Sbjct  137   PQGYKNPFEWPKSRDYAWYNNIPHRELSIEKAVQNWIQVEGDLLRFPGGGTMFPHGADAY  196

Query  1287  IDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGV  1108
             IDDI  LI L DG+IRTALDTGCGVAS+GAYL+ RNI+TMSFAPRD+H++QVQFALERGV
Sbjct  197   IDDINALIPLNDGNIRTALDTGCGVASWGAYLMKRNIITMSFAPRDSHEAQVQFALERGV  256

Query  1107  PALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIR  928
             P++IG++ ++R+PYP++AFDMAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPI 
Sbjct  257   PSMIGVMGTERIPYPARAFDMAHCSRCLIPWNKLDGVYLIEVDRVLRPGGYWILSGPPIH  316

Query  927   WKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--  754
             WKR+++GW+RTEEDL+ EQ +IE +A  LCWKK +E  D++IWQKP NH++C+  R+   
Sbjct  317   WKRHFKGWERTEEDLKQEQDEIEDLAKRLCWKKVVEKGDLSIWQKPTNHIECVDSRKVYD  376

Query  753   PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTID  589
              P +C   ND D AWY  ++TC++PLP V  E E     LE+WPKR +AVPPRI RGT+ 
Sbjct  377   TPKIC-KGNDVDSAWYKKMETCISPLPDVKSEDEVAGGALEQWPKRASAVPPRISRGTVP  435

Query  588   GISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVM  409
             G++ EKF++DS LW++R+ HY  ++    +   RYRNV+DMNA +GGFAAAL+ + LWVM
Sbjct  436   GLTPEKFQEDSKLWSERVDHYKKLIPP--LGKRRYRNVMDMNAGMGGFAAALMKYPLWVM  493

Query  408   NVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDIL  229
             NVVP  S  +TLGVIYERG IGTY  WCEA STYPRTYDLIHAD++F+ Y+DRC++  IL
Sbjct  494   NVVPSGSPRDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLIHADNVFSSYQDRCDITYIL  553

Query  228   LEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             LEMDRILRPEG+VIIRD V+VL KV+ I +G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  554   LEMDRILRPEGTVIIRDTVEVLGKVQAIAEGMRWKSQIMDHESGPFNPEKILVAVKTYWT  613



>ref|XP_006397065.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
 gb|ESQ38518.1| hypothetical protein EUTSA_v10028495mg [Eutrema salsugineum]
Length=665

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/532 (64%), Positives = 429/532 (81%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  126   TIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  185

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  186   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  245

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  246   PLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  305

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW + +G YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  306   SKRLPYPARAFDLAHCSRCLIPWFKNEGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  365

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK +E  D+AIWQKP NH++C +L+Q    PP+C +S
Sbjct  366   ERTEEDLKQEQDSIEDVAKSLCWKKVIEKGDLAIWQKPLNHIECKKLKQNSKSPPIC-SS  424

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D+AWY DL++C+TPLP  ++ +E     LE WP R  AVPPRI RGTI  I+ EKF 
Sbjct  425   DNADLAWYKDLESCITPLPNTNNPEESAGGALEDWPDRAFAVPPRIIRGTIQDINAEKFR  484

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNV+PV ++
Sbjct  485   EDNEVWKERIAHYKKIVPE--LSHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVIPVNAE  542

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IH   +F+LY++RC++  ILLEMDRILR
Sbjct  543   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHVGGLFSLYENRCDLTLILLEMDRILR  602

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V+ L KV+RI  G++W++++VDHE GP   EK+L AVKTYWT
Sbjct  603   PEGTVVLRDNVETLTKVERILKGMKWKTQIVDHEKGPYNPEKILVAVKTYWT  654



>ref|XP_006306983.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
 gb|EOA39881.1| hypothetical protein CARUB_v10008557mg [Capsella rubella]
Length=640

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/532 (63%), Positives = 425/532 (80%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             +VK + PCD+  SEYTPCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  108   TVKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  167

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EG+RFKFPGGGTMF  GADAYIDDI +LI
Sbjct  168   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFKFPGGGTMFPRGADAYIDDIARLI  227

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG+IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  228   PLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMG  287

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  288   SRRLPYPARAFDLAHCSRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKYWKGW  347

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +R++EDL+ EQ  IE  A SLCWKK  E  D++IWQKP NH++C +L++    PP+C  S
Sbjct  348   ERSQEDLKQEQDSIEDAARSLCWKKVTEKGDLSIWQKPINHIECKKLKRVHKSPPLCSKS  407

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             + PD AWY DL++C+TPLP+ +  +E     LE WP R  AVPPRI RGTI   + EKF 
Sbjct  408   DQPDFAWYKDLESCVTPLPEANGPEEFAGGALEDWPDRAFAVPPRIIRGTIQDTNAEKFR  467

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI++Y  +M    +  GR+RN++DMNA+LGGFAAA++ +  WVMNVVP++++
Sbjct  468   QDNEVWKERIAYYKQIMPE--LTRGRFRNIMDMNAYLGGFAAAIMKYPSWVMNVVPMDAE  525

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVI+ERG IGTY  WCE  STYPRTYDLIHA  +F++Y++RC++  ILLEMDRILR
Sbjct  526   KQTLGVIFERGFIGTYQDWCEGFSTYPRTYDLIHAGGLFSIYENRCDVTLILLEMDRILR  585

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V+ RD+V+ L K++ IT+G++W+SR++DHE GP   EK+L AVK+YWT
Sbjct  586   PEGTVVFRDNVETLTKIQSITNGMKWKSRILDHEKGPFNPEKILLAVKSYWT  637



>ref|XP_009128712.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 emb|CDY25257.1| BnaA02g21990D [Brassica napus]
Length=620

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/532 (63%), Positives = 426/532 (80%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K   PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  81    TIKNLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  140

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  141   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  200

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L  G IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  201   PLTAGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  260

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW + +G YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  261   SKRLPYPARAFDLAHCSRCLIPWFKNEGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  320

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D+AIW+KP NH++C +L+Q    PP+C + 
Sbjct  321   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKGDLAIWRKPINHIECKKLKQNNKSPPLCTSD  380

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N+ D AWY DL++C+TPLP+ ++ +E     LE WP R  AVPPRI RGTI  I+ EKF 
Sbjct  381   NNADFAWYKDLESCITPLPETNNPEESSDGALEDWPDRAFAVPPRIIRGTIQDINAEKFR  440

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI++Y  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNVVPV+++
Sbjct  441   EDNEVWKERIAYYKKIVPE--ISHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVVPVDAE  498

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY+++C++  ILLEMDRILR
Sbjct  499   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYENKCDLTLILLEMDRILR  558

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V+ L KV+RI  G++W +++VDHE GP   EK+L AVKTYWT
Sbjct  559   PEGTVVMRDNVETLTKVERIAKGMKWNTQIVDHEKGPYNPEKILVAVKTYWT  610



>ref|XP_006476235.1| PREDICTED: probable methyltransferase PMT18-like [Citrus sinensis]
Length=629

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 428/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S+  +PPCD+ YS+ TPC+D  RS  +DRE   YRERHCPK  E+L+C IPAP  Y+ PF
Sbjct  97    SLHEFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPF  156

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA QNWI+ EG RF+FPGGGT F NGADAYID+I +LI
Sbjct  157   KWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELI  216

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L  G+IRTA+DTGCGVAS+GAYLL R+ILTMSFA RDTH++QVQFALERGVPA+IG+++
Sbjct  217   PLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEAQVQFALERGVPAMIGVIS  276

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFDMAHCS CLIPW  YDG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  277   SKRLPYPARAFDMAHCSGCLIPWYMYDGLYLLEVDRVLRPGGYWILSGPPIHWKKYWRGW  336

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RT+EDL+ EQ  IE +A  LCWKK +E +D+AIWQKP NH+DC + +     P +C   
Sbjct  337   ERTKEDLKQEQDTIEDIAKRLCWKKLIEKNDLAIWQKPINHIDCNKSKVVYKTPQIC-GP  395

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++PD AWY D++ C+TPLP+VS   E     LEKWP+R  +VPPRI  G++ GI+ EK  
Sbjct  396   DNPDTAWYKDMEACITPLPEVSSSDEVAGGALEKWPERAFSVPPRISSGSLSGITAEKLR  455

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ LW  R+++Y  + DG L+  GRYRNV+DMNA+LGGFAAA+  + +WVMNVVP  S 
Sbjct  456   EDNELWKDRMTYYKKI-DG-LLHKGRYRNVMDMNAYLGGFAAAMSKYPVWVMNVVPFHSN  513

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
              +TLG IYERGLIGTY  WCEA STYPRTYDLIHA  +F++Y+DRC++ +ILLEMDRILR
Sbjct  514   PDTLGAIYERGLIGTYQDWCEAFSTYPRTYDLIHASGVFSIYQDRCDITNILLEMDRILR  573

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+VI RD V++L+K++ IT+G++W+S+++DHE GP   EK+LFAVKTYWT
Sbjct  574   PEGTVIFRDTVEMLVKIRSITEGMRWKSQIMDHESGPFNPEKILFAVKTYWT  625



>gb|EMT22301.1| hypothetical protein F775_16518 [Aegilops tauschii]
Length=629

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/536 (63%), Positives = 428/536 (80%), Gaps = 8/536 (1%)
 Frame = -2

Query  1638  NHDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFG  1459
             N    + ++ PPC +KYSEYTPC D  R+  + +  + YRERHCP K ++ +C IPAP  
Sbjct  88    NESSLATEMIPPCQLKYSEYTPCHDPRRARKFPKAMMQYRERHCPTKDKLFRCLIPAPPN  147

Query  1458  YRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDD  1279
             Y+NPF WP+SRD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF +GADAYIDD
Sbjct  148   YKNPFTWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPHGADAYIDD  207

Query  1278  IGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPAL  1099
             I  LI L DG+IRTALDTGCGVAS+GA+LL R I+TMSFAPRD+H++QVQFALERGVPA+
Sbjct  208   INALIPLTDGNIRTALDTGCGVASWGAFLLKRGIITMSFAPRDSHEAQVQFALERGVPAM  267

Query  1098  IGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKR  919
             IG++A+ R+PYP++AFDMAHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPPIRWK+
Sbjct  268   IGVMATDRIPYPARAFDMAHCSRCLIPWNKLDGLYLVEVDRVLRPGGYWILSGPPIRWKK  327

Query  918   YWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPMC  739
             +++GW RTEEDL+ EQ +IE +A  LCWKK +E DD+A+WQKP NHM+C   R A   + 
Sbjct  328   HYKGWQRTEEDLKQEQDEIEDLAKRLCWKKVVEKDDLAVWQKPINHMECANNRNADEALQ  387

Query  738   PASN-DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
               +N D D AWY  ++TC++PLP+V  E+E     LE WP+R +AVPPRI RG++ GI+ 
Sbjct  388   FCNNSDVDSAWYKKMETCISPLPEVQTEEEVAGGALENWPQRASAVPPRITRGSVSGITP  447

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKFE+D+ LW +R  HY  ++    +  GRYRNV+DM+A +GGFAAAL+++ LWVMNVVP
Sbjct  448   EKFEEDNKLWAERADHYKKLIPP--LAKGRYRNVMDMDAGMGGFAAALMEYPLWVMNVVP  505

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
               S  + LGVIYERG IGT+H WCEA STYPRTYDLIHA+ +F+ Y DRC++  ILLEMD
Sbjct  506   SGSAPDALGVIYERGFIGTFHDWCEAFSTYPRTYDLIHANKVFSFYHDRCDITYILLEMD  565

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V++L+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  566   RILRPEGTVIFRDTVEMLVKIQAITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  621



>ref|XP_008676538.1| PREDICTED: ankyrin protein kinase-like isoform X1 [Zea mays]
 ref|XP_008676541.1| PREDICTED: ankyrin protein kinase-like isoform X1 [Zea mays]
 ref|XP_008676548.1| PREDICTED: ankyrin protein kinase-like isoform X1 [Zea mays]
 ref|XP_008676551.1| PREDICTED: ankyrin protein kinase-like isoform X1 [Zea mays]
 gb|ACN31928.1| unknown [Zea mays]
 gb|ACN35003.1| unknown [Zea mays]
 tpg|DAA49335.1| TPA: ankyrin protein kinase-like protein isoform 1 [Zea mays]
 tpg|DAA49336.1| TPA: ankyrin protein kinase-like protein isoform 2 [Zea mays]
 tpg|DAA49337.1| TPA: ankyrin protein kinase-like protein isoform 3 [Zea mays]
 tpg|DAA49338.1| TPA: ankyrin protein kinase-like protein isoform 4 [Zea mays]
Length=636

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/641 (57%), Positives = 465/641 (73%), Gaps = 26/641 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI-ATA  1768
             PA P    Q   S   +L Y+ +++  C   Y  G WQN         S+I       TA
Sbjct  6     PASP-KAQQLQESKKQRLTYILVVSALCIAFYVLGAWQNTTLPKPIGNSAITRVGCDPTA  64

Query  1767  KTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS-VKVYPPCDVK  1591
              T   SG+  +    + +        LDF  HH        + N D D  ++ +P C + 
Sbjct  65    ATAQSSGSVPSFGPGSGEV-------LDFDAHHRL-----TINNTDGDGELQQFPACPLN  112

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             +SEYTPCED  R   +DR  L+YRERHCP K E ++C IPAP GYR PFKWP SRD A++
Sbjct  113   FSEYTPCEDRRRGRRFDRNMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPRSRDYAYF  172

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PHKEL++EKAVQNWI+ EGD+FKFPGGGTMF  GADAYIDDI KLI+L DG IRTA+
Sbjct  173   NNIPHKELSIEKAVQNWIQVEGDKFKFPGGGTMFPRGADAYIDDINKLISLSDGKIRTAV  232

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++A +RLPYPS+AF
Sbjct  233   DTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMAKQRLPYPSRAF  292

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW ++DG YL EVDR+LRPGGYWILSGPPI WK + +GW+RT++DL+ EQ
Sbjct  293   DMAHCSRCLIPWDEHDGLYLAEVDRILRPGGYWILSGPPINWKTHHRGWERTKDDLKREQ  352

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
              +IE VA SLCW K +E  D++IWQKP NH++C  +++    P +C  S++PD AWYT +
Sbjct  353   DKIEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKTYKTPHIC-KSDNPDAAWYTQM  411

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             + C+TPLP+VS++ E     +EKWP+R   VPPRIKRG I G+  +KF++D  LW KR++
Sbjct  412   EACVTPLPEVSNQGEVAGGAVEKWPERAFLVPPRIKRGMIPGLDAKKFDEDKKLWEKRVA  471

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             +Y   +    +   RYRNV+DMNA +GGFAA+LV + +WVMNVVPV S  +TLG IYERG
Sbjct  472   YYKRTIP---IAENRYRNVMDMNANMGGFAASLVKYPVWVMNVVPVNSDRDTLGAIYERG  528

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++  ILLEMDRILRPEG+ IIRD V
Sbjct  529   FIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITGILLEMDRILRPEGTAIIRDTV  588

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             DVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  589   DVLTKVQAITKRMRWESRIMDHEDGPFNPEKVLMAVKTYWT  629



>ref|XP_009113612.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
 ref|XP_009113613.1| PREDICTED: probable methyltransferase PMT17 [Brassica rapa]
Length=625

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/542 (63%), Positives = 428/542 (79%), Gaps = 14/542 (3%)
 Frame = -2

Query  1638  NHDE-----DSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRI  1474
             N DE      ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C I
Sbjct  76    NQDEFKETNQTIKYFEPCDLSLSEYTPCEDRQRGRKFDRNMMKYRERHCPSKDELLYCLI  135

Query  1473  PAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGAD  1294
             P P  Y+ PFKWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GAD
Sbjct  136   PPPPNYKIPFKWPQSRDYAWYGNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGAD  195

Query  1293  AYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALER  1114
             AYIDDI +LI L +G IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALER
Sbjct  196   AYIDDIARLIPLTNGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALER  255

Query  1113  GVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPP  934
             GVPA+IGI+ S+RLPYP++AFD+AHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPP
Sbjct  256   GVPAIIGIMGSRRLPYPARAFDLAHCSRCLIPWFKNDGLYLMEVDRVLRPGGYWILSGPP  315

Query  933   IRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ-  757
             I WK+YW+GW+RTEEDL+ EQ  IE VA SLCWKK +E  D++IWQKP NH++C +L+Q 
Sbjct  316   INWKQYWRGWERTEEDLKQEQDSIEDVAKSLCWKKVIEKGDLSIWQKPINHIECKKLKQN  375

Query  756   -APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGT  595
                PP+C +S++ D AWY DL+ C+TPLP  ++ +E     LE WP R  AVPPRI RGT
Sbjct  376   NKSPPICSSSDNADSAWYKDLEPCVTPLPNTNNPEESAGGALEDWPDRAFAVPPRIIRGT  435

Query  594   IDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLW  415
             I  I+ E F +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  W
Sbjct  436   IQDINTEMFREDNEVWKERIAHYKKIVPE--LSRGRFRNIMDMNAYLGGFAASMLKYPSW  493

Query  414   VMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMED  235
             VMNVVPV ++  TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +FTLY +RC++  
Sbjct  494   VMNVVPVHAEKQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFTLYDNRCDLTL  553

Query  234   ILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTY  55
             ILLEMDRILRPEG+V++RD+V++L KV++I   ++W +++VDHE GP   EK+L AVKTY
Sbjct  554   ILLEMDRILRPEGTVVLRDNVEMLTKVEKIAKRMKWNTQIVDHEKGPYNPEKILVAVKTY  613

Query  54    WT  49
             WT
Sbjct  614   WT  615



>ref|XP_004982637.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Setaria 
italica]
Length=642

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/646 (57%), Positives = 465/646 (72%), Gaps = 27/646 (4%)
 Frame = -2

Query  1956  PTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI  1777
             P   PA P    Q   S   +L Y+ +++  C   Y  G WQN         S+      
Sbjct  6     PKEYPASP-KAQQLQESKKQRLTYILVVSALCIAFYVLGAWQNTTLPKPVGNSAAI----  60

Query  1776  ATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS---VKVYP  1606
              T   C  + +TA++ +S           LDF  HH        L  +D D+   ++ +P
Sbjct  61    -TRVGCDPATSTASSSASVPSFGPGSGEVLDFDAHHR-------LAINDTDAGAGLQQFP  112

Query  1605  PCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESR  1426
              C + +SEYTPCED  R   +DR  L+YRERHCP K E ++C IPAP GYR PFKWP+SR
Sbjct  113   ACPLNFSEYTPCEDRTRGRRFDRTMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPKSR  172

Query  1425  DVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGS  1246
             D A++ N+PHKEL++EKAVQNWI+ EGD+F+FPGGGTMF  GADAYIDDI KLI+L DG 
Sbjct  173   DYAYFNNIPHKELSIEKAVQNWIQVEGDKFRFPGGGTMFPRGADAYIDDINKLISLSDGQ  232

Query  1245  IRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPY  1066
             IRTA+DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++   RLPY
Sbjct  233   IRTAVDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMGKHRLPY  292

Query  1065  PSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEED  886
             PS+AFDMAHCSRCLIPW  +DG YL EVDR+LRPGGYWILSGPPI WK + +GW+RT++D
Sbjct  293   PSRAFDMAHCSRCLIPWYAHDGLYLAEVDRILRPGGYWILSGPPINWKTHHKGWERTKDD  352

Query  885   LEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMA  712
             L+ EQ +IE VA SLCW K +E  D++IWQKP NH++C  +++    P +C  S++PD A
Sbjct  353   LKQEQDKIEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKTYKTPHIC-KSDNPDAA  411

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WY  ++ C+TPLP+VS++ E     +E+WP+R   VPPRI+RG I G+  +KF++D  LW
Sbjct  412   WYRQMEACVTPLPEVSNQGEVAGGAVERWPERAFIVPPRIRRGMIPGLDAKKFDEDKKLW  471

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              KRI++Y   +    +   RYRNV+DMNA +GGFAA+LV + +WVMNVVPV S  +TLG 
Sbjct  472   EKRIAYYKRTIP---IAENRYRNVMDMNANMGGFAASLVKYPVWVMNVVPVNSDRDTLGA  528

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERG IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ DILLEMDRILRPEG+ I
Sbjct  529   IYERGFIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITDILLEMDRILRPEGTAI  588

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRD VDVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  589   IRDTVDVLTKVQAITKRMRWESRIMDHEDGPFNPEKVLMAVKTYWT  634



>ref|XP_009398109.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398110.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398111.1| PREDICTED: probable methyltransferase PMT18 [Musa acuminata subsp. 
malaccensis]
Length=634

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/529 (65%), Positives = 422/529 (80%), Gaps = 11/529 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +PPC + +SEYTPC+D  R   + R  L YRERHCP + E+++C IPAP  Y+ PFKWP 
Sbjct  102   FPPCALNFSEYTPCQDLTRCKKFARAMLAYRERHCPAQHELIRCLIPAPPKYKTPFKWPR  161

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF  GAD YIDDI  L++L D
Sbjct  162   SRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPRGADVYIDDINALVSLTD  221

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             G IRTA+DTGCGVAS+GAYLL R+ILTMSFAPRDTH++QVQFALERGVPA+IG++A++RL
Sbjct  222   GDIRTAIDTGCGVASWGAYLLKRDILTMSFAPRDTHEAQVQFALERGVPAMIGVMATQRL  281

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYP++AFDMAHCSRCLIPW  +DG YLIEVDRVLRPGGYWILSGPPIRWK+Y+ GW+RT+
Sbjct  282   PYPARAFDMAHCSRCLIPWQDFDGLYLIEVDRVLRPGGYWILSGPPIRWKKYYVGWERTQ  341

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPD  718
             EDL+ EQ  IE VA  LCWKK +E  D+AIWQKP NH DCI+ R+    P +C   N  D
Sbjct  342   EDLKQEQDSIEDVAKRLCWKKVIEKGDLAIWQKPINHADCIQSRRIYKTPHICKNDN-AD  400

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWY  ++ C+TPLP+VS        EL+KWP+R  AVPPRI +GTI G++ +KFE D+T
Sbjct  401   AAWYWKMEACITPLPEVSSSSEVAGGELQKWPQRAFAVPPRISKGTIPGLTVKKFEDDNT  460

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             +W +RI +Y  ++    +  GRYRN +DMNA+LGGFAAAL+D+ +WVMNVVP  S  +TL
Sbjct  461   VWKERIEYYKRIIPP--LSQGRYRNAMDMNAYLGGFAAALMDYPIWVMNVVPANSDYDTL  518

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRC-EMEDILLEMDRILRPEG  196
             GVIYERG IGTY  WCEA STYPRTYDLIHA +IF++Y+DRC ++  ILLEMDRILRPEG
Sbjct  519   GVIYERGFIGTYQDWCEAFSTYPRTYDLIHASAIFSIYQDRCGDITYILLEMDRILRPEG  578

Query  195   SVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             +VI+RD VDVL KV+ I + ++W+ ++VDHE GP   EK+LFAVKTYWT
Sbjct  579   TVIVRDTVDVLTKVQGIAERMRWKCKIVDHESGPFNPEKILFAVKTYWT  627



>ref|NP_192782.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
 sp|Q9SZX8.1|PMTH_ARATH RecName: Full=Probable methyltransferase PMT17 [Arabidopsis thaliana]
 emb|CAB40037.1| putative protein [Arabidopsis thaliana]
 emb|CAB78167.1| putative protein [Arabidopsis thaliana]
 gb|AEE82883.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
Length=633

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/532 (64%), Positives = 428/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PC++  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  89    TIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPVKDELLYCLIPPPPNYKIPF  148

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  149   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  208

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  209   PLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  268

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  269   SRRLPYPARAFDLAHCSRCLIPWFKNDGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  328

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D++IWQKP NH++C +L+Q    PP+C +S
Sbjct  329   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKGDLSIWQKPLNHIECKKLKQNNKSPPIC-SS  387

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D AWY DL+TC+TPLP+ ++  +     LE WP R  AVPPRI RGTI  ++ EKF 
Sbjct  388   DNADSAWYKDLETCITPLPETNNPDDSAGGALEDWPDRAFAVPPRIIRGTIPEMNAEKFR  447

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNAFLGGFAA+++ +  WVMNVVPV+++
Sbjct  448   EDNEVWKERIAHYKKIVPE--LSHGRFRNIMDMNAFLGGFAASMLKYPSWVMNVVPVDAE  505

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY+ RC++  ILLEMDRILR
Sbjct  506   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYEHRCDLTLILLEMDRILR  565

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V+ L KV++I  G++W+S++VDHE GP   EK+L AVKTYWT
Sbjct  566   PEGTVVLRDNVETLNKVEKIVKGMKWKSQIVDHEKGPFNPEKILVAVKTYWT  617



>gb|KDO76804.1| hypothetical protein CISIN_1g006834mg [Citrus sinensis]
Length=629

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S+  +PPCD+ YS+ TPC+D  RS  +DRE   YRERHCPK  E+L+C IPAP  Y+ PF
Sbjct  97    SLHEFPPCDMSYSDITPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPF  156

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA QNWI+ EG RF+FPGGGT F NGADAYID+I +LI
Sbjct  157   KWPQSRDYAWYDNIPHKELSIEKAGQNWIQVEGHRFRFPGGGTTFPNGADAYIDNINELI  216

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L  G+IRTA+DTGCGVAS+GAYLL R+ILTMSFA RDTH++QVQFALERGVPA+IG+++
Sbjct  217   PLTGGNIRTAVDTGCGVASWGAYLLKRDILTMSFARRDTHEAQVQFALERGVPAMIGVIS  276

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFDMAHCS CLIPW  YDG YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  277   SKRLPYPARAFDMAHCSGCLIPWYMYDGLYLLEVDRVLRPGGYWILSGPPIHWKKYWRGW  336

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RT+EDL+ EQ  IE +A  LCWKK +E +D+AIWQKP NH+DC + +     P +C   
Sbjct  337   ERTKEDLKQEQDTIEDIAKRLCWKKLIEKNDLAIWQKPINHIDCNKSKVVYKTPQICGPD  396

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N PD AWY D++ C+TPLP+VS   E     LEKWP+R  +VPPRI  G++ GI+ EK  
Sbjct  397   N-PDTAWYKDMEACITPLPEVSSSDEVAGGALEKWPERAFSVPPRISSGSLSGITAEKLR  455

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ LW  R+++Y  + DG L   GRYRNV+DMNA+LGGFAAA+  + +WVMNVVP  S 
Sbjct  456   EDNELWKDRMTYYKKI-DG-LFHKGRYRNVMDMNAYLGGFAAAMSKYPVWVMNVVPFHSN  513

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
              +TLG IYERGLIGTY  WCEA STYPRTYDLIHA  +F++Y+DRC++ +ILLEMDRILR
Sbjct  514   PDTLGAIYERGLIGTYQDWCEAFSTYPRTYDLIHASGVFSIYQDRCDITNILLEMDRILR  573

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+VI RD V++L+K++ IT+G++W+S+++DHE GP   EK+LFA KTYWT
Sbjct  574   PEGTVIFRDTVEMLVKIRSITEGMRWKSQIMDHESGPFNPEKILFAAKTYWT  625



>ref|XP_004982638.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Setaria 
italica]
Length=638

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/646 (57%), Positives = 465/646 (72%), Gaps = 27/646 (4%)
 Frame = -2

Query  1956  PTYKPALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI  1777
             P   PA P    Q   S   +L Y+ +++  C   Y  G WQN         S+      
Sbjct  2     PKEYPASP-KAQQLQESKKQRLTYILVVSALCIAFYVLGAWQNTTLPKPVGNSAAI----  56

Query  1776  ATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS---VKVYP  1606
              T   C  + +TA++ +S           LDF  HH        L  +D D+   ++ +P
Sbjct  57    -TRVGCDPATSTASSSASVPSFGPGSGEVLDFDAHHR-------LAINDTDAGAGLQQFP  108

Query  1605  PCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESR  1426
              C + +SEYTPCED  R   +DR  L+YRERHCP K E ++C IPAP GYR PFKWP+SR
Sbjct  109   ACPLNFSEYTPCEDRTRGRRFDRTMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPKSR  168

Query  1425  DVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGS  1246
             D A++ N+PHKEL++EKAVQNWI+ EGD+F+FPGGGTMF  GADAYIDDI KLI+L DG 
Sbjct  169   DYAYFNNIPHKELSIEKAVQNWIQVEGDKFRFPGGGTMFPRGADAYIDDINKLISLSDGQ  228

Query  1245  IRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPY  1066
             IRTA+DTGCGVAS+GAYLL RNI+ MSFAPRDTH++QVQFALERGVPA+IG++   RLPY
Sbjct  229   IRTAVDTGCGVASWGAYLLKRNIIAMSFAPRDTHEAQVQFALERGVPAIIGVMGKHRLPY  288

Query  1065  PSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEED  886
             PS+AFDMAHCSRCLIPW  +DG YL EVDR+LRPGGYWILSGPPI WK + +GW+RT++D
Sbjct  289   PSRAFDMAHCSRCLIPWYAHDGLYLAEVDRILRPGGYWILSGPPINWKTHHKGWERTKDD  348

Query  885   LEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMA  712
             L+ EQ +IE VA SLCW K +E  D++IWQKP NH++C  +++    P +C  S++PD A
Sbjct  349   LKQEQDKIEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKTYKTPHIC-KSDNPDAA  407

Query  711   WYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             WY  ++ C+TPLP+VS++ E     +E+WP+R   VPPRI+RG I G+  +KF++D  LW
Sbjct  408   WYRQMEACVTPLPEVSNQGEVAGGAVERWPERAFIVPPRIRRGMIPGLDAKKFDEDKKLW  467

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              KRI++Y   +    +   RYRNV+DMNA +GGFAA+LV + +WVMNVVPV S  +TLG 
Sbjct  468   EKRIAYYKRTIP---IAENRYRNVMDMNANMGGFAASLVKYPVWVMNVVPVNSDRDTLGA  524

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERG IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++ DILLEMDRILRPEG+ I
Sbjct  525   IYERGFIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITDILLEMDRILRPEGTAI  584

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             IRD VDVL KV+ IT  ++WESR++DHEDGP   EK+L AVKTYWT
Sbjct  585   IRDTVDVLTKVQAITKRMRWESRIMDHEDGPFNPEKVLMAVKTYWT  630



>ref|NP_564419.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
 sp|Q9C884.1|PMTI_ARATH RecName: Full=Probable methyltransferase PMT18 [Arabidopsis thaliana]
 gb|AAG51278.1|AC027035_1 hypothetical protein [Arabidopsis thaliana]
 gb|AAM98224.1| unknown protein [Arabidopsis thaliana]
 gb|AAP78933.1| At1g33170 [Arabidopsis thaliana]
 gb|AEE31570.1| putative methyltransferase PMT18 [Arabidopsis thaliana]
Length=639

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/532 (63%), Positives = 424/532 (80%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             +VK + PCD+  SEYTPCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  106   TVKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  165

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EG+RF+FPGGGTMF  GADAYIDDI +LI
Sbjct  166   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLI  225

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG+IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  226   PLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMG  285

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  286   SRRLPYPARAFDLAHCSRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKYWKGW  345

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +R++EDL+ EQ  IE  A SLCWKK  E  D++IWQKP NH++C +L++    PP+C  S
Sbjct  346   ERSQEDLKQEQDSIEDAARSLCWKKVTEKGDLSIWQKPINHVECNKLKRVHKTPPLCSKS  405

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             + PD AWY DL++C+TPLP+ +   E     LE WP R  AVPPRI  GTI  I+ EKF 
Sbjct  406   DLPDFAWYKDLESCVTPLPEANSSDEFAGGALEDWPNRAFAVPPRIIGGTIPDINAEKFR  465

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RIS+Y  +M    +  GR+RN++DMNA+LGGFAAA++ +  WVMNVVPV+++
Sbjct  466   EDNEVWKERISYYKQIMPE--LSRGRFRNIMDMNAYLGGFAAAMMKYPSWVMNVVPVDAE  523

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVI+ERG IGTY  WCE  STYPRTYDLIHA  +F++Y++RC++  ILLEMDRILR
Sbjct  524   KQTLGVIFERGFIGTYQDWCEGFSTYPRTYDLIHAGGLFSIYENRCDVTLILLEMDRILR  583

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V+ RD V++L K++ IT+G++W+SR++DHE GP   EK+L AVK+YWT
Sbjct  584   PEGTVVFRDTVEMLTKIQSITNGMRWKSRILDHERGPFNPEKILLAVKSYWT  635



>ref|NP_001148962.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG33655.1| ankyrin protein kinase-like [Zea mays]
Length=636

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/641 (57%), Positives = 464/641 (72%), Gaps = 26/641 (4%)
 Frame = -2

Query  1944  PALPLHNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKI-ATA  1768
             PA P    Q   S   +L Y+ +++  C   Y  G WQN         S+I       TA
Sbjct  6     PASP-KAQQLQESKKQRLTYILVVSALCIAFYVLGAWQNTTLPKPIGNSAITRVGCDPTA  64

Query  1767  KTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDS-VKVYPPCDVK  1591
              T   SG+  +    + +        LDF  HH        + N D D  ++ +P C + 
Sbjct  65    ATAQSSGSVPSFGPGSGEV-------LDFDAHHRL-----TINNTDGDGELQQFPACPLN  112

Query  1590  YSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWY  1411
             +SEYTPCED  R   +DR  L+YRERHCP K E ++C IPAP GYR PFKWP SRD A++
Sbjct  113   FSEYTPCEDRRRGRRFDRNMLVYRERHCPGKDEQVRCLIPAPPGYRTPFKWPRSRDYAYF  172

Query  1410  TNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTAL  1231
              N+PHKEL++EKAVQNWI+ EGD+FKFPGGGTMF  GADAYIDDI KLI+L DG IRTA+
Sbjct  173   NNIPHKELSIEKAVQNWIQVEGDKFKFPGGGTMFPRGADAYIDDINKLISLSDGKIRTAV  232

Query  1230  DTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAF  1051
             DTGCGVAS+GAYLL RNI+ MSFAPRDTHQ+QVQFALERGVPA+IG++A +RLPYPS+AF
Sbjct  233   DTGCGVASWGAYLLKRNIIAMSFAPRDTHQAQVQFALERGVPAIIGVMAKQRLPYPSRAF  292

Query  1050  DMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQ  871
             DMAHCSRCLIPW ++DG YL EVDR+LRPGGYWILSGPPI WK + +GW+RT++DL+ EQ
Sbjct  293   DMAHCSRCLIPWDEHDGLYLAEVDRILRPGGYWILSGPPINWKTHHRGWERTKDDLKREQ  352

Query  870   TQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDL  697
              +IE VA SLCW K +E  D++IWQKP NH++C  +++    P +C  S++PD AWYT +
Sbjct  353   DKIEDVARSLCWNKVVEKGDLSIWQKPKNHLECANIKKTYKTPHIC-KSDNPDAAWYTQM  411

Query  696   QTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRIS  532
             + C+TPLP+VS++ E     +EKWP+R   VPPRIKRG I G+  +KF++D  LW KR++
Sbjct  412   EACVTPLPEVSNQGEVAGGAVEKWPERAFLVPPRIKRGMIPGLDAKKFDEDKKLWEKRVA  471

Query  531   HYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERG  352
             +Y   +    +   RYRNV+DMNA +GGFAA+LV + +WVMNVVPV S  +TLG IYERG
Sbjct  472   YYKRTIP---IAENRYRNVMDMNANMGGFAASLVKYPVWVMNVVPVNSDRDTLGAIYERG  528

Query  351   LIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDV  172
              IGTY  WCEA STYPRTYDL+HAD++F++Y+DRC++  ILLEMDRILRPEG+ IIRD V
Sbjct  529   FIGTYQDWCEAFSTYPRTYDLLHADNLFSIYQDRCDITGILLEMDRILRPEGTAIIRDTV  588

Query  171   DVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             DVL KV+ IT  ++WESR++D EDGP   EK+L AVKTYWT
Sbjct  589   DVLTKVQAITKRMRWESRIMDXEDGPFNPEKVLMAVKTYWT  629



>ref|XP_002975160.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
 gb|EFJ23945.1| hypothetical protein SELMODRAFT_232460 [Selaginella moellendorffii]
Length=632

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/546 (64%), Positives = 427/546 (78%), Gaps = 17/546 (3%)
 Frame = -2

Query  1641  GNHDEDSVKV---YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKK-SEVLKCRI  1474
             G  D+D   +   +  C +K+SEYTPCED ERSL +DR+RLIYRERHCP + SE L+C I
Sbjct  84    GGGDDDPALLDLAFDSCALKFSEYTPCEDIERSLRFDRDRLIYRERHCPAQDSERLRCLI  143

Query  1473  PAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGAD  1294
             PAP GYRNPF WP+SRD AWY NVPHKELTVEKAVQNWI++EGDRFKFPGGGTMF  GAD
Sbjct  144   PAPPGYRNPFPWPKSRDFAWYANVPHKELTVEKAVQNWIQYEGDRFKFPGGGTMFPKGAD  203

Query  1293  AYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALER  1114
             AYIDDIGKL+ LKDGSIRTALDTGCGVASFGA+LLSRN+LTMSFAPRDTH+ QVQFALER
Sbjct  204   AYIDDIGKLVPLKDGSIRTALDTGCGVASFGAFLLSRNVLTMSFAPRDTHEGQVQFALER  263

Query  1113  GVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPP  934
             GVPA++G++AS+RL YP++AFD+AHCSRCLIPW  YDG YL EVDRVLRPGGYW+LSGPP
Sbjct  264   GVPAMLGVMASQRLLYPARAFDLAHCSRCLIPWKDYDGVYLAEVDRVLRPGGYWVLSGPP  323

Query  933   IRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA  754
             + W+ +W+GW RT+EDL  E T IE++A +LCWKK +E  ++A+W+KP NH DC+R R+ 
Sbjct  324   VNWQTHWKGWQRTQEDLLGEMTAIEELAKALCWKKVVERGNLAVWRKPTNHYDCVRNRKK  383

Query  753   ---PPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRG  598
                 PP+C A  D D AWY  +Q C+TPLP V++  E     L KWP R   VPPR+  G
Sbjct  384   VYRDPPICKA-EDADEAWYKPMQACITPLPAVTERSEVSGGKLAKWPSRATEVPPRVATG  442

Query  597   TIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALV-DHS  421
              + G++ + +E D+ LWN+R+ +Y   +   L + GRYRN++DMNA LGGFAAA   D+ 
Sbjct  443   LVPGVTPDVYEADTKLWNERVGYYKNSVIPPLGQ-GRYRNIMDMNAGLGGFAAAFANDNR  501

Query  420   LWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDR--C  247
             +WVMN         TLGVIYERG IG YH WCEA STYPRTYD IHA+ +F++Y+ R  C
Sbjct  502   VWVMNAQSSFMDNTTLGVIYERGFIGVYHDWCEAFSTYPRTYDFIHANRVFSMYRARNKC  561

Query  246   EMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFA  67
             ++ DILLEMDRILRPEG+VIIRD+VDVL KVKRI  G++WESR+VDHE GP  REK+L +
Sbjct  562   DLVDILLEMDRILRPEGAVIIRDEVDVLNKVKRIASGMKWESRMVDHETGPFNREKILVS  621

Query  66    VKTYWT  49
             VK+YW 
Sbjct  622   VKSYWV  627



>ref|XP_002891032.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67291.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/532 (63%), Positives = 424/532 (80%), Gaps = 9/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             +VK + PCD+  SEYTPCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  106   TVKYFEPCDMSLSEYTPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  165

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EG+RF+FPGGGTMF  GADAYIDDI +LI
Sbjct  166   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGERFRFPGGGTMFPRGADAYIDDIARLI  225

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG+IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  226   PLTDGAIRTAIDTGCGVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMG  285

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  286   SRRLPYPARAFDLAHCSRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKYWKGW  345

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +R++EDL+ EQ  IE  A SLCWKK  E  D++IWQKP NH++C +L++    PP+C  S
Sbjct  346   ERSQEDLKQEQDSIEDAARSLCWKKVTEKGDLSIWQKPINHIECNKLKRVHKSPPLCSKS  405

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             + PD AWY DL++C+TPLP+ +   E     LE WP R  AVPPRI RGTI   + EKF 
Sbjct  406   DLPDFAWYKDLESCVTPLPEANSPDEFAGGALEDWPDRAFAVPPRIIRGTIPDTNAEKFR  465

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI++Y  +M    +  GR+RN++DMNA+LGGFAAA++ +  WVMNVVPV+++
Sbjct  466   EDNEVWKERIAYYKQIMPE--LSKGRFRNIMDMNAYLGGFAAAMMKYPSWVMNVVPVDAE  523

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVI+ERG IGTY  WCE  STYPRTYDLIHA  +F++Y++RC++  +LLEMDRILR
Sbjct  524   KQTLGVIFERGFIGTYQDWCEGFSTYPRTYDLIHAGGLFSIYENRCDVTLLLLEMDRILR  583

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V+ RD V++L K++ IT+G++W+SR++DHE GP   EK+L AVK+YWT
Sbjct  584   PEGTVVFRDTVEMLTKIQSITNGMRWKSRILDHEKGPFNPEKILLAVKSYWT  635



>ref|XP_010529685.1| PREDICTED: probable methyltransferase PMT18 isoform X1 [Tarenaya 
hassleriana]
Length=663

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/647 (57%), Positives = 472/647 (73%), Gaps = 19/647 (3%)
 Frame = -2

Query  1962  YTPTYKPALPLHN--HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissif  1789
             +  T  PA+   N  H +  S   +L ++  ++  C L Y  G+WQN    +  S     
Sbjct  20    FAVTEGPAMAKENSGHHHADSRRKRLTWILGVSGLCILFYVLGSWQNSTIPTSPSEVYSR  79

Query  1788  tAKIATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVY  1609
                    ++   S +++++        SS  A LDF +HH       V       +VK +
Sbjct  80    V-GCDNNQSPPSSSSSSSSDDDPPLLSSSEPAELDFESHHQLDLKETV------QTVKQF  132

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC++ +SEYTPCED ER   +DR  L YRERHCP K E+L C IP P  Y+ PFKWP+S
Sbjct  133   PPCEMSFSEYTPCEDRERGRRFDRNMLKYRERHCPTKDELLYCLIPPPPKYKIPFKWPQS  192

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGT F  GADAYIDDI +LI L DG
Sbjct  193   RDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTGFPRGADAYIDDISRLIPLTDG  252

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
              IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ S RLP
Sbjct  253   GIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMGSNRLP  312

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YP++AFD+AHCSRCLIPW QYDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW+RTEE
Sbjct  313   YPARAFDLAHCSRCLIPWFQYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGWERTEE  372

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL+ EQ  IE VA SLCWKK +E  D +IWQKP NH++C +L++    PP+C + N  D 
Sbjct  373   DLKQEQDSIENVARSLCWKKVIEKGDFSIWQKPINHVECNKLKRVHKTPPICNSDNQ-DS  431

Query  714   AWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTL  550
             AWYT+L+ C+TPLP+ S+ +E     LE WP R  AVPPRI RGTI GI+ EKF +D+ +
Sbjct  432   AWYTELEHCITPLPEASNPEELAGGALEDWPDRAFAVPPRIIRGTIPGINTEKFREDNEV  491

Query  549   WNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLG  370
             W +R+S+Y  ++    +  GR+RN++DMNA+LGGFAAA++ + +WVMNVVPV+S+  TLG
Sbjct  492   WKERVSYYKRIIPE--LSTGRFRNIMDMNAYLGGFAAAMLKYPVWVMNVVPVDSEKQTLG  549

Query  369   VIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSV  190
              IYERGLIGTY  WCE  STYPRTYDLIHA  +F++Y +RC++  ILLEMDRILRPEG+ 
Sbjct  550   AIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSIYDNRCDITLILLEMDRILRPEGTA  609

Query  189   IIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             + RD+VD L K++ +T+G++W+SR+VDHE+GP   EK+L AVKTYWT
Sbjct  610   VFRDNVDTLTKIQSLTNGMRWKSRIVDHENGPFNPEKILVAVKTYWT  656



>ref|XP_010529687.1| PREDICTED: probable methyltransferase PMT18 isoform X2 [Tarenaya 
hassleriana]
Length=660

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/644 (57%), Positives = 471/644 (73%), Gaps = 19/644 (3%)
 Frame = -2

Query  1953  TYKPALPLHN--HQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAK  1780
             T  PA+   N  H +  S   +L ++  ++  C L Y  G+WQN    +  S        
Sbjct  20    TEGPAMAKENSGHHHADSRRKRLTWILGVSGLCILFYVLGSWQNSTIPTSPSEVYSRV-G  78

Query  1779  IATAKTCLFSGNtattlssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPC  1600
                 ++   S +++++        SS  A LDF +HH       V       +VK +PPC
Sbjct  79    CDNNQSPPSSSSSSSSDDDPPLLSSSEPAELDFESHHQLDLKETV------QTVKQFPPC  132

Query  1599  DVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDV  1420
             ++ +SEYTPCED ER   +DR  L YRERHCP K E+L C IP P  Y+ PFKWP+SRD 
Sbjct  133   EMSFSEYTPCEDRERGRRFDRNMLKYRERHCPTKDELLYCLIPPPPKYKIPFKWPQSRDY  192

Query  1419  AWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIR  1240
             AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGT F  GADAYIDDI +LI L DG IR
Sbjct  193   AWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTGFPRGADAYIDDISRLIPLTDGGIR  252

Query  1239  TALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPS  1060
             TA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ S RLPYP+
Sbjct  253   TAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMGSNRLPYPA  312

Query  1059  KAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLE  880
             +AFD+AHCSRCLIPW QYDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW+RTEEDL+
Sbjct  313   RAFDLAHCSRCLIPWFQYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGWERTEEDLK  372

Query  879   AEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWY  706
              EQ  IE VA SLCWKK +E  D +IWQKP NH++C +L++    PP+C + N  D AWY
Sbjct  373   QEQDSIENVARSLCWKKVIEKGDFSIWQKPINHVECNKLKRVHKTPPICNSDNQ-DSAWY  431

Query  705   TDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNK  541
             T+L+ C+TPLP+ S+ +E     LE WP R  AVPPRI RGTI GI+ EKF +D+ +W +
Sbjct  432   TELEHCITPLPEASNPEELAGGALEDWPDRAFAVPPRIIRGTIPGINTEKFREDNEVWKE  491

Query  540   RISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIY  361
             R+S+Y  ++    +  GR+RN++DMNA+LGGFAAA++ + +WVMNVVPV+S+  TLG IY
Sbjct  492   RVSYYKRII--PELSTGRFRNIMDMNAYLGGFAAAMLKYPVWVMNVVPVDSEKQTLGAIY  549

Query  360   ERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIR  181
             ERGLIGTY  WCE  STYPRTYDLIHA  +F++Y +RC++  ILLEMDRILRPEG+ + R
Sbjct  550   ERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSIYDNRCDITLILLEMDRILRPEGTAVFR  609

Query  180   DDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             D+VD L K++ +T+G++W+SR+VDHE+GP   EK+L AVKTYWT
Sbjct  610   DNVDTLTKIQSLTNGMRWKSRIVDHENGPFNPEKILVAVKTYWT  653



>ref|XP_003557272.1| PREDICTED: probable methyltransferase PMT17 [Brachypodium distachyon]
 ref|XP_010228140.1| PREDICTED: probable methyltransferase PMT17 [Brachypodium distachyon]
 ref|XP_010228142.1| PREDICTED: probable methyltransferase PMT17 [Brachypodium distachyon]
Length=625

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/526 (63%), Positives = 426/526 (81%), Gaps = 9/526 (2%)
 Frame = -2

Query  1608  PPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPES  1429
             PPC +KYSEYTPC D  R+  + +  + YRERHCPKK ++ +C IPAP  Y+NPFKWP+S
Sbjct  96    PPCQLKYSEYTPCHDPRRARKFPKAMMQYRERHCPKKEDLFRCLIPAPPNYKNPFKWPQS  155

Query  1428  RDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDG  1249
             RD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF +GADAYIDDI  LI L DG
Sbjct  156   RDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPHGADAYIDDINALIPLTDG  215

Query  1248  SIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLP  1069
             +IRTALDTGCGVAS+GA+LL R I+TMSFAPRD+H++QVQFALERGVPA+IG++ ++R+P
Sbjct  216   NIRTALDTGCGVASWGAFLLKRGIITMSFAPRDSHEAQVQFALERGVPAMIGVMGTERIP  275

Query  1068  YPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEE  889
             YP++AFDMAHCSRCLIPW + DG YLIEVDRVLRPGGYWILSGPPI WKR+ +GW RTE+
Sbjct  276   YPARAFDMAHCSRCLIPWNKLDGIYLIEVDRVLRPGGYWILSGPPIHWKRHSKGWQRTED  335

Query  888   DLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDM  715
             DL+ EQ +IE +A  LCWKK +E DD+AIWQKP NH++C   R+A   PP+C  S+D D 
Sbjct  336   DLKQEQDEIEDLAKRLCWKKVVEKDDLAIWQKPINHIECANNRKADETPPIC-KSSDVDS  394

Query  714   AWYTDLQTCLTPLPQVSDEK----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLW  547
             AWY  ++TC++PLP V  E+     LEKWPKR   VPPRI RG++ G++ EKF++D+ LW
Sbjct  395   AWYKKMETCISPLPNVKSEEVAGGALEKWPKRALTVPPRITRGSVSGLTPEKFQEDNKLW  454

Query  546   NKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGV  367
              +R+++Y  ++    +  GRYRNV+DM+A +GGFAAAL+ + LWVMNVVP  S  +TLGV
Sbjct  455   AERVNYYKKLIPP--LAKGRYRNVMDMDAGMGGFAAALMKYPLWVMNVVPEGSSNDTLGV  512

Query  366   IYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVI  187
             IYERG +G Y  WCEA STYPRTYDLIHAD +F+ Y+DRC++  ILLEMDRILRPEG+VI
Sbjct  513   IYERGFVGAYQDWCEAFSTYPRTYDLIHADKVFSFYQDRCDITYILLEMDRILRPEGTVI  572

Query  186   IRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
              RD V++L+K++ I++G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  573   FRDTVEILVKIQAISEGMRWKSQIMDHESGPYNPEKILVAVKTYWT  618



>gb|EMS54302.1| putative methyltransferase PMT17 [Triticum urartu]
Length=629

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/531 (63%), Positives = 425/531 (80%), Gaps = 8/531 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             + ++ PPC +KYSEYTPC D   +  + +  + YRERHCP K ++ +C IPAP  Y+NPF
Sbjct  93    ATEMIPPCQLKYSEYTPCHDPRTARKFPKAMMQYRERHCPTKEKLFRCLIPAPPKYKNPF  152

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
              WP+SRD AWY N+PH+EL++EKAVQNWI+ EGDRF+FPGGGTMF +GADAYIDDI  LI
Sbjct  153   TWPQSRDYAWYDNIPHRELSIEKAVQNWIQVEGDRFRFPGGGTMFPHGADAYIDDIDALI  212

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG+IRTALDTGCGVAS+GA+LL R I+TMSFAPRD+H++QVQFALERGVPA+IG++A
Sbjct  213   PLTDGNIRTALDTGCGVASWGAFLLKRGIITMSFAPRDSHEAQVQFALERGVPAMIGVMA  272

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             + R+PYP++AFDMAHCSRCLIPW + DG YL+EVDRVLRPGGYWILSGPPIRWK++++GW
Sbjct  273   TDRIPYPARAFDMAHCSRCLIPWNKLDGLYLVEVDRVLRPGGYWILSGPPIRWKKHYKGW  332

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCI-RLRQAPPPMCPASN  727
              RTEEDL+ EQ +IE +A  LCWKK +E DD+A+WQKP NHM+    L     P    S+
Sbjct  333   QRTEEDLKQEQDEIEDLAKRLCWKKVVEKDDLAVWQKPINHMESANNLNADETPQFCNSS  392

Query  726   DPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEK  562
             D D AWY  ++TC++PLP+V  E+E     LEKWP+R +AVPPRI RG++ GI+ EKFE+
Sbjct  393   DVDTAWYKKMETCISPLPEVQTEEEAAGGALEKWPERASAVPPRINRGSVSGITPEKFEE  452

Query  561   DSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKL  382
             D  LW +R  HY  ++    +  GRYRNV+DM+A +GGFAAAL+++ LWVMNVVP  S  
Sbjct  453   DKKLWAERADHYKKLVPP--LAKGRYRNVMDMDAGMGGFAAALMEYPLWVMNVVPSGSAP  510

Query  381   NTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRP  202
             + LGVIYERG IGT+H WCEA STYPRTYDLIHAD +F+ Y+DRC++  ILLEMDRILRP
Sbjct  511   DALGVIYERGFIGTFHDWCEAFSTYPRTYDLIHADKVFSFYQDRCDITYILLEMDRILRP  570

Query  201   EGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             EG+VI RD V++L+K++ IT+G++W+S+++DHE GP   EK+L AVKTYWT
Sbjct  571   EGTVIFRDTVEMLVKIQAITNGMRWKSQIMDHESGPFNPEKILVAVKTYWT  621



>ref|XP_009397639.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009397640.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009397641.1| PREDICTED: probable methyltransferase PMT17 [Musa acuminata subsp. 
malaccensis]
Length=630

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/627 (57%), Positives = 463/627 (74%), Gaps = 34/627 (5%)
 Frame = -2

Query  1896  KLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFS--GNtattlss  1723
             +L +L  +   C L Y  G WQN    S             TA + L +  G  +    S
Sbjct  20    RLTHLLAVIGLCVLFYILGAWQNKTTPSL------------TADSGLTTKVGCESVLPKS  67

Query  1722  ttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKV--YPPCDVKYSEYTPCEDTERSL  1549
                +     A LDF  HH            DE S+ +  +PPCD+ +SEYTPC+D  R  
Sbjct  68    NASASLPSDATLDFDAHHQQSV--------DERSMVIEKFPPCDLNFSEYTPCQDRARGR  119

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + R  L+YRERHCP+K + ++C IPAP  Y+ PFKWP+SRD AW+ N+PH+EL++EKAV
Sbjct  120   RFARAMLVYRERHCPEKDDTIRCLIPAPPKYKTPFKWPQSRDYAWFDNIPHRELSIEKAV  179

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNWI+ EG+RF+FPGGGTMF  GADAYIDDI  LI+L DG+IRTA+DTGCGVAS+GAYLL
Sbjct  180   QNWIQVEGNRFRFPGGGTMFPRGADAYIDDINDLISLTDGNIRTAIDTGCGVASWGAYLL  239

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
              R+I+TMSFAPRDTH++QVQFALERGVPA+IG++A++RLPYP++AFDMAHCSRCLIPW  
Sbjct  240   KRDIVTMSFAPRDTHEAQVQFALERGVPAMIGVMATQRLPYPARAFDMAHCSRCLIPWQA  299

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
             YDG YLIEVDRVLRPGGYWILSGPPI WK++++GW+RT+EDL+ EQ  IE+VA  LCWKK
Sbjct  300   YDGLYLIEVDRVLRPGGYWILSGPPIHWKKHFRGWERTQEDLKKEQDSIEEVAKRLCWKK  359

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              +E DD+AIWQKP NH++CI  R+    P +C   N  D AWY  ++TC+TPLP+VS + 
Sbjct  360   LIEKDDLAIWQKPINHVECIESRRIYKTPHICKNDN-ADAAWYKKMKTCITPLPEVSSQD  418

Query  654   -----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
                  EL+KWP+R  AVPPRI  G++ G++ + ++ D+T+W +RI++Y  ++    +  G
Sbjct  419   EVAGGELKKWPERAFAVPPRISSGSVPGLTTKTYKDDNTMWKERIANYKRIIPP--LSQG  476

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRNV+DMNA+LGGFAAA++ + +WVMNVVP  S  +TLGVI+ERG IG Y  WCEA ST
Sbjct  477   RYRNVMDMNAYLGGFAAAMMKYPVWVMNVVPANSDQDTLGVIHERGFIGAYQDWCEAFST  536

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYDLIHA  +F++Y+DRC++  ILLEMDRILRPEG+VIIRD VDVL KVK +TDG++
Sbjct  537   YPRTYDLIHASGLFSIYQDRCDITYILLEMDRILRPEGTVIIRDVVDVLTKVKALTDGMR  596

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             W+S+++DHE GP   EK+L AVKTYWT
Sbjct  597   WKSQIMDHESGPFNPEKILVAVKTYWT  623



>ref|XP_010455441.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=633

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 424/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  94    TIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  153

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  154   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  213

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  214   PLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  273

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW + DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  274   SRRLPYPARAFDLAHCSRCLIPWFKNDGLYLTEVDRVLRPGGYWILSGPPINWKQYWRGW  333

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D++IWQKP NH+DC  L+Q    PP+C +S
Sbjct  334   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKGDLSIWQKPLNHIDCKNLKQNKKSPPIC-SS  392

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D AWY DL++C+TPLP+ S+  E     LE WP R  AVPPRI RGTI  ++ EKF 
Sbjct  393   DNGDFAWYKDLESCITPLPETSNPDEYAGGALEDWPDRAFAVPPRIIRGTIPDMNAEKFR  452

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNVVPV+++
Sbjct  453   EDNEVWKERIAHYKKIIPE--LSHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVVPVDAE  510

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY  RC++  ILLEMDRILR
Sbjct  511   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYGHRCDLTLILLEMDRILR  570

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V++L KV +I  G++W+S++VDHE G    EK+L AVKTYWT
Sbjct  571   PEGTVVLRDNVEMLNKVDKIVKGMKWKSQIVDHEKGSSNPEKILVAVKTYWT  622



>ref|XP_010421961.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=637

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/532 (64%), Positives = 422/532 (79%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K + PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  94    TIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  153

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  154   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  213

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  214   PLNDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  273

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW + DG YL EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  274   SRRLPYPARAFDLAHCSRCLIPWFKNDGLYLTEVDRVLRPGGYWILSGPPINWKQYWRGW  333

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D++IWQKP NH+DC  L+Q    PP+C + 
Sbjct  334   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKVDLSIWQKPLNHIDCKNLKQNKKSPPICSSG  393

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWY DL++C+TPLP+ S+  E     LE WP R  AVPPRI RGTI  ++ EKF 
Sbjct  394   NG-DFAWYKDLESCITPLPETSNPDEYAGGALEDWPDRAFAVPPRIIRGTIPDMNAEKFR  452

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNA+LGGFAA+++ +  WVMNVVPV+++
Sbjct  453   EDNEVWKERIAHYKKIIPE--LSHGRFRNIMDMNAYLGGFAASMLKYPSWVMNVVPVDAE  510

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY  RC++  ILLEMDRILR
Sbjct  511   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYGHRCDLTLILLEMDRILR  570

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+V++RD+V++L KV +I  G++W+S++VDHE G    EK+L AVKTYWT
Sbjct  571   PEGTVVLRDNVEMLNKVDKIVKGMKWKSQIVDHEKGSSNPEKILVAVKTYWT  622



>ref|XP_010542260.1| PREDICTED: probable methyltransferase PMT17 isoform X5 [Tarenaya 
hassleriana]
Length=647

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  108   SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  167

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  168   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  227

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  228   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  287

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  288   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  347

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  348   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  407

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  408   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  466

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  467   EDNEVWKTRVAHYKKIIPE--LSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  524

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  525   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  584

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  585   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  636



>ref|XP_010542245.1| PREDICTED: probable methyltransferase PMT17 isoform X3 [Tarenaya 
hassleriana]
Length=664

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  125   SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  184

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  185   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  244

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  245   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  304

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  305   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  364

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  365   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  424

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  425   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  483

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  484   EDNEVWKTRVAHYKKII--PELSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  541

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  542   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  601

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  602   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  653



>ref|XP_010542252.1| PREDICTED: probable methyltransferase PMT17 isoform X4 [Tarenaya 
hassleriana]
Length=657

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  118   SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  177

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  178   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  237

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  238   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  297

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  298   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  357

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  358   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  417

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  418   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  476

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  477   EDNEVWKTRVAHYKKIIPE--LSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  534

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  535   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  594

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  595   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  646



>ref|XP_010919407.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010919408.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010919409.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
 ref|XP_010919410.1| PREDICTED: probable methyltransferase PMT17 [Elaeis guineensis]
Length=626

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/627 (57%), Positives = 455/627 (73%), Gaps = 23/627 (4%)
 Frame = -2

Query  1908  SPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFSGNtattl  1729
             S   +  Y+   +  C L Y  G WQN      +         ++    C  +  ++   
Sbjct  15    SRRQRFTYIFAASGLCVLFYILGAWQNSAVPKPSG-------NVSNKIECNPANPSSNPR  67

Query  1728  ssttqslsshsAGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEYTPCEDTERSL  1549
             S+   S SS  A LDF   H          N    +V+ +PPC + +SEYTPC+D  R  
Sbjct  68    STAVPSFSSSDATLDFEARHRLDL------NATWVTVEKFPPCPLNFSEYTPCQDRTRGR  121

Query  1548  AYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVPHKELTVEKAV  1369
              + RE LIYRERHCP   E+++C IPAP  Y+ PFKWP+SRD AW+ N+PHKEL++EKAV
Sbjct  122   RFAREMLIYRERHCPGNDELIRCLIPAPPNYKTPFKWPQSRDYAWFDNIPHKELSIEKAV  181

Query  1368  QNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGCGVASFGAYLL  1189
             QNW+  EGDRF+FPGGGTMF  GA AYIDDI  LI L DGSIRTA+DTGCGVAS GAYLL
Sbjct  182   QNWVIVEGDRFRFPGGGTMFPRGAGAYIDDISALIPLTDGSIRTAIDTGCGVASLGAYLL  241

Query  1188  SRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAHCSRCLIPWGQ  1009
              R+++TMSFAPRDTH++QVQFALERGVPA+IG++ S+R+PYP++AFDMAHCSRCLIPW +
Sbjct  242   KRDVITMSFAPRDTHEAQVQFALERGVPAMIGVIGSQRMPYPARAFDMAHCSRCLIPWFK  301

Query  1008  YDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIEKVADSLCWKK  829
              DG YL EVDRVLRPGGYWILSGPPI WK++++GW+RT+EDL+ EQ  IE VA  LCWKK
Sbjct  302   NDGVYLAEVDRVLRPGGYWILSGPPIHWKKHYRGWERTQEDLKQEQDSIEDVAKRLCWKK  361

Query  828   FMEVDDIAIWQKPYNHMDCIRLRQ--APPPMCPASNDPDMAWYTDLQTCLTPLPQVSDEK  655
              +E DD+AIWQKP NH++CI+ R+    P +C  +++ D AWY  L+ C+TPLP+V +E+
Sbjct  362   KIEKDDLAIWQKPINHVECIQRRKIYKTPHIC-KNDNADSAWYKKLEACITPLPEVKNEE  420

Query  654   E-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSAVMDGQLVEAG  490
             E     L+KWP R  +VPPRI RG+I G++ + FE D+ +W +R+ HY  ++       G
Sbjct  421   EVAGGDLKKWPDRAFSVPPRISRGSIPGVTSKIFEDDNQMWKERVMHYKQIVPP--FPQG  478

Query  489   RYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGTYHTWCEAMST  310
             RYRNV+DMNA LGGFAAA++ + +WVMNVVP  S  +TLGVIYERG IGTY  WCEA ST
Sbjct  479   RYRNVMDMNANLGGFAAAMMKYPVWVMNVVPANSDRDTLGVIYERGFIGTYQDWCEAFST  538

Query  309   YPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLIKVKRITDGLQ  130
             YPRTYDL+HAD +F+ Y+DRC++  ILLEMDRILRPEG+VIIRD V+VL KVK ITDG++
Sbjct  539   YPRTYDLLHADGVFSTYQDRCDITYILLEMDRILRPEGTVIIRDMVEVLTKVKAITDGMR  598

Query  129   WESRVVDHEDGPLQREKLLFAVKTYWT  49
             W+S+++DHE GP   EK+L AV+TYWT
Sbjct  599   WKSQIMDHESGPFNPEKILVAVRTYWT  625



>ref|XP_010542268.1| PREDICTED: probable methyltransferase PMT17 isoform X6 [Tarenaya 
hassleriana]
 ref|XP_010542276.1| PREDICTED: probable methyltransferase PMT17 isoform X6 [Tarenaya 
hassleriana]
Length=635

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  96    SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  155

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  156   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  215

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  216   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  275

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  276   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  335

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  336   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  395

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  396   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  454

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  455   EDNEVWKTRVAHYKKII--PELSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  512

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  513   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  572

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  573   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  624



>ref|XP_009124372.1| PREDICTED: probable methyltransferase PMT18 [Brassica rapa]
Length=638

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/637 (56%), Positives = 463/637 (73%), Gaps = 18/637 (3%)
 Frame = -2

Query  1929  HNHQYYSSPNNKLLYLALLAIFCTLSYHFGTWQNgggasgtsissiftAKIATAKTCLFS  1750
             ++H +  +   +L+++  ++ FC LSY  G WQ     S +S      A    +K    S
Sbjct  6     NSHHHAEAKRKRLIWILCVSGFCILSYVLGAWQTNTLPSSSSEVFSRKACETQSKLSTSS  65

Query  1749  GNtattlssttqslsshs---AGLDFtthhgdgdgGAVLGNHDEDSVKVYPPCDVKYSEY  1579
              +   +LSS++   SS S     LDF +HH               ++K + PCD+  SEY
Sbjct  66    EDEDASLSSSSSLSSSSSSEPVELDFESHHKLEL------KQKNQTIKYFEPCDMSLSEY  119

Query  1578  TPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPESRDVAWYTNVP  1399
             TPCED ER   +DR  + YRERHCP K E+L C IP P  Y+ PFKWP+SRD AWY N+P
Sbjct  120   TPCEDRERGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPFKWPQSRDYAWYDNIP  179

Query  1398  HKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKDGSIRTALDTGC  1219
             HKEL++EKA+QNWI+ EG+RF+FPGGGT F  GADAYIDDI +LI L DG+IRTA+DTGC
Sbjct  180   HKELSIEKAIQNWIQVEGERFRFPGGGTGFPRGADAYIDDISRLIPLTDGAIRTAIDTGC  239

Query  1218  GVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRLPYPSKAFDMAH  1039
             GVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ S RLPYP++AFD+AH
Sbjct  240   GVASFGAYLLKRDIVAMSFAPRDTHEAQVQFALERGVPAIIGIMGSIRLPYPARAFDLAH  299

Query  1038  CSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTEEDLEAEQTQIE  859
             CSRCLIPW Q DG YL EVDRVLRPGGYWILSGPPI WK++W+GW+RT+EDL+ EQ  IE
Sbjct  300   CSRCLIPWFQNDGLYLTEVDRVLRPGGYWILSGPPINWKKHWKGWERTQEDLKQEQDSIE  359

Query  858   KVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPASNDPDMAWYTDLQTCL  685
               A SLCWKK  E  D +IWQKP NH+ C +L++A   PP+C  +  PD AWY +L++C+
Sbjct  360   NAARSLCWKKVTEKGDFSIWQKPINHIACKKLKRAHKSPPICTKAVQPDFAWYKELESCV  419

Query  684   TPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFEKDSTLWNKRISHYSA  520
              PLP+ +   E     LE WP R  AVPPRI +GTI  I+ EKF++D+ +W +RI++Y  
Sbjct  420   MPLPEANSPDEFAGGALEDWPDRAFAVPPRIIQGTIPEINAEKFKEDNEVWKERIAYYKQ  479

Query  519   VMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTLGVIYERGLIGT  340
             ++    +  GR+RN++DMNA+LGGFAAA+V +  WVMNVVPV+++  TLG IYERG IGT
Sbjct  480   ILPE--LSRGRFRNIMDMNAYLGGFAAAIVKYPSWVMNVVPVDAEKQTLGAIYERGFIGT  537

Query  339   YHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGSVIIRDDVDVLI  160
             Y  WCEA STYPRTYDLIHA  +F++Y++RC++  ILLEMDRILRPEG+V+ RD V++L 
Sbjct  538   YQDWCEAFSTYPRTYDLIHAGGLFSMYENRCDVTLILLEMDRILRPEGTVVFRDTVEMLT  597

Query  159   KVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             K++ IT+G++W SR++DHE GP   EK+L AVK+YWT
Sbjct  598   KIQSITNGMKWTSRIMDHEKGPFIPEKILLAVKSYWT  634



>ref|XP_010542228.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542234.1| PREDICTED: probable methyltransferase PMT17 isoform X1 [Tarenaya 
hassleriana]
Length=716

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  177   SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  236

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  237   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  296

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  297   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  356

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  357   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  416

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  417   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  476

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  477   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  535

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  536   EDNEVWKTRVAHYKKIIPE--LSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  593

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  594   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  653

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  654   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  705



>ref|XP_006352227.1| PREDICTED: probable methyltransferase PMT18-like [Solanum tuberosum]
Length=624

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/536 (62%), Positives = 429/536 (80%), Gaps = 11/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSE--VLKCRIPAPF  1462
             ++  S++ + PC++ YSEYTPC++ +R   +DR  L YRERHCP K E   L+C IPAP 
Sbjct  87    NNTKSLENFSPCEMLYSEYTPCQEPQRGRKFDRNMLKYRERHCPNKEEKEALRCLIPAPP  146

Query  1461  GYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYID  1282
              Y+ PFKWP+SRD AW+ N+PHKEL++EKAVQNW++ EGDR +FPGGGTMF +GADAYID
Sbjct  147   NYKIPFKWPQSRDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYID  206

Query  1281  DIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPA  1102
             DI +L+ L  G+IRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVPA
Sbjct  207   DISELVPLTSGTIRTAIDTGCGVASWGAYLLKRDIIAMSFAPRDTHEAQVWFALERGVPA  266

Query  1101  LIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWK  922
             +IG++ S+RLPYP++AFDMAHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPIRWK
Sbjct  267   MIGVMGSQRLPYPARAFDMAHCSRCLIPWYKYDGLYLIEVDRVLRPGGYWVLSGPPIRWK  326

Query  921   RYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPM  742
              YW+GW+R++EDL+ EQ  IE+ A  LCWKK +E  D+++WQKP NH  CI+ +   P +
Sbjct  327   TYWRGWERSQEDLKKEQDSIEETARQLCWKKVIEKGDLSVWQKPLNHNKCIKNKS--PFI  384

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C A N  D AWY D++ C+TPLP+V++  E     LEKWP+R  A+PPRI  G+I  I+ 
Sbjct  385   CKARNKADAAWYQDMEACITPLPEVTNSDEVAGGALEKWPERAFAIPPRISTGSIPSITV  444

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ +WN+R+S+Y  ++   L+  GRYRNV+D NA+LGGFAAAL  + +WVMNVVP
Sbjct  445   EKFKEDNQVWNERVSYYKRLIG--LLPQGRYRNVMDANAYLGGFAAALSKYPVWVMNVVP  502

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
              +++ +TLG+IYERG IGTY+ WCEA STYPRTYDLIHA  + +LY+DRC++  ILLEMD
Sbjct  503   AKNEPDTLGIIYERGFIGTYNDWCEAFSTYPRTYDLIHAGGLISLYQDRCDITYILLEMD  562

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+ L+K+K I DG++W+SR+VDHE GP   EK+L AVKTYWT
Sbjct  563   RILRPEGTVIFRDGVEALVKIKSIADGMRWQSRIVDHESGPFNPEKILIAVKTYWT  618



>ref|XP_004244735.1| PREDICTED: probable methyltransferase PMT18 [Solanum lycopersicum]
Length=631

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/536 (62%), Positives = 429/536 (80%), Gaps = 11/536 (2%)
 Frame = -2

Query  1635  HDEDSVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSE--VLKCRIPAPF  1462
             ++  S++ +PPC++ YSEYTPC++ +R   +DR  L YRERHCP K E   L+C IPAP 
Sbjct  94    NNTKSLENFPPCEMLYSEYTPCQEPQRGRKFDRNMLKYRERHCPNKEEKEALRCLIPAPP  153

Query  1461  GYRNPFKWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYID  1282
              Y+ PFKWP+S+D AW+ N+PHKEL++EKAVQNW++ EGDR +FPGGGTMF +GADAYID
Sbjct  154   NYKIPFKWPQSKDYAWFANIPHKELSIEKAVQNWVQVEGDRLRFPGGGTMFPHGADAYID  213

Query  1281  DIGKLINLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPA  1102
             DI  L+ L  G+IRTA+DTGCGVAS+GAYLL R+I+ MSFAPRDTH++QV FALERGVPA
Sbjct  214   DISALVPLTTGTIRTAIDTGCGVASWGAYLLRRDIIAMSFAPRDTHEAQVWFALERGVPA  273

Query  1101  LIGILASKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWK  922
             +IG++ S+RLPYP++AFDMAHCSRCLIPW +YDG YLIEVDRVLRPGGYWILSGPPIRWK
Sbjct  274   MIGVMGSQRLPYPARAFDMAHCSRCLIPWYKYDGLYLIEVDRVLRPGGYWILSGPPIRWK  333

Query  921   RYWQGWDRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAPPPM  742
              YW+GW+R++EDL+ EQ  IE+ A  LCWKK +E  D+++WQKP NH  CI+ ++  P M
Sbjct  334   MYWRGWERSQEDLKKEQDSIEETARQLCWKKVIEKGDLSVWQKPLNHNKCIKNKK--PLM  391

Query  741   CPASNDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISG  577
             C + +  D AWY D++ C+TPLP+V++  E     LEKWP+R  A+PPRI  G++  I+ 
Sbjct  392   CKSRDKADAAWYQDMEACITPLPEVTNSNEVAGGALEKWPERAFAIPPRISTGSVPSITV  451

Query  576   EKFEKDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVP  397
             EKF++D+ +W++R+S+Y  ++   L+  GRYRNV+D NA+LGGFAAAL  H +WVMNVVP
Sbjct  452   EKFKEDNKVWSERVSYYKRLIG--LLPQGRYRNVMDANAYLGGFAAALAKHPVWVMNVVP  509

Query  396   VESKLNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMD  217
              + + +TLG+IYERG IGTY+ WCEA STYPRTYDLIHA  + +LY+DRC++  ILLEMD
Sbjct  510   AKIEPDTLGIIYERGFIGTYNDWCEAFSTYPRTYDLIHAGGLISLYQDRCDITYILLEMD  569

Query  216   RILRPEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             RILRPEG+VI RD V+ L+K+K I DG++W+SR+VDHE GP   EK+L AVKTYWT
Sbjct  570   RILRPEGTVIFRDGVEALVKIKSIADGMRWQSRIVDHESGPFNPEKILIAVKTYWT  625



>ref|XP_006286418.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
 gb|EOA19316.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
Length=637

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/532 (63%), Positives = 426/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             ++K   PCD+  SEYTPCED +R   +DR  + YRERHCP K E+L C IP P  Y+ PF
Sbjct  95    TIKYLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPPPPNYKIPF  154

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL+VEKAVQNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  155   KWPQSRDYAWYDNIPHKELSVEKAVQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  214

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ +SFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  215   PLTDGGIRTAIDTGCGVASFGAYLLKRDIMAVSFAPRDTHEAQVQFALERGVPAIIGIMG  274

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             S+RLPYP++AFD+AHCSRCLIPW +  G YL+EVDRVLRPGGYWILSGPPI WK+YW+GW
Sbjct  275   SRRLPYPARAFDLAHCSRCLIPWFKNGGLYLMEVDRVLRPGGYWILSGPPINWKQYWRGW  334

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E  D++IWQKP NH++C +L+Q+   PP+C +S
Sbjct  335   ERTEEDLKKEQDSIEDVAKSLCWKKVTEKGDLSIWQKPLNHIECKKLKQSNKSPPIC-SS  393

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             ++ D AWY DL++C++PLP+ ++  E     L+ WP R  AVPPRI RGTI  ++ EKF 
Sbjct  394   DNADFAWYKDLESCISPLPETNNPDESAGGALDDWPDRAFAVPPRIIRGTIPDMNAEKFR  453

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W +RI+HY  ++    +  GR+RN++DMNAFLGGFAA+++ +  WVMNVVPV+++
Sbjct  454   EDNEVWKERIAHYKKIIPE--LSHGRFRNIMDMNAFLGGFAASMLKYPSWVMNVVPVDAE  511

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLGVIYERGLIGTY  WCE  STYPRTYD+IHA  +F+LY+ RC++  ILLEMDRILR
Sbjct  512   KQTLGVIYERGLIGTYQDWCEGFSTYPRTYDMIHAGGLFSLYEHRCDLTLILLEMDRILR  571

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             P+G+V++RD+V+ L KV++I  G++W S++VDHE GP   EK+L AVKTYWT
Sbjct  572   PKGTVVLRDNVETLNKVEKIVKGMKWTSQIVDHEKGPYNPEKILVAVKTYWT  623



>ref|XP_010542237.1| PREDICTED: probable methyltransferase PMT17 isoform X2 [Tarenaya 
hassleriana]
Length=715

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/532 (65%), Positives = 425/532 (80%), Gaps = 10/532 (2%)
 Frame = -2

Query  1623  SVKVYPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPF  1444
             S K +PPCD+ +SEYTPCED +R   +DR  L YRERHCP K E++ C IP P  Y+ PF
Sbjct  176   SDKQFPPCDMSFSEYTPCEDRQRGRRFDRNMLKYRERHCPTKDELMYCLIPPPPKYKIPF  235

Query  1443  KWPESRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLI  1264
             KWP+SRD AWY N+PHKEL++EKA+QNWI+ EGDRF+FPGGGTMF  GADAYIDDI +LI
Sbjct  236   KWPQSRDYAWYDNIPHKELSIEKAIQNWIQVEGDRFRFPGGGTMFPRGADAYIDDIARLI  295

Query  1263  NLKDGSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILA  1084
              L DG IRTA+DTGCGVASFGAYLL R+I+ MSFAPRDTH++QVQFALERGVPA+IGI+ 
Sbjct  296   PLTDGGIRTAIDTGCGVASFGAYLLKRDIIAMSFAPRDTHEAQVQFALERGVPAIIGIMG  355

Query  1083  SKRLPYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGW  904
             SKRLPYP++AFD+AHCSRCLIPW +YDG YLIEVDRVLRPGGYW+LSGPPI WK+YW+GW
Sbjct  356   SKRLPYPARAFDLAHCSRCLIPWFKYDGLYLIEVDRVLRPGGYWVLSGPPIHWKKYWRGW  415

Query  903   DRTEEDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQA--PPPMCPAS  730
             +RTEEDL+ EQ  IE VA SLCWKK  E DD+++WQKP NH++C +L++    PP+C + 
Sbjct  416   ERTEEDLKQEQDSIESVARSLCWKKVTEKDDLSVWQKPINHVECNKLKRVHKNPPICNSE  475

Query  729   NDPDMAWYTDLQTCLTPLPQVSDEKE-----LEKWPKRLNAVPPRIKRGTIDGISGEKFE  565
             N  D AWYTDL+ C+T LP+ S  +E     LE WP R  +VPPRI RGTI GI+ EKF 
Sbjct  476   NQ-DSAWYTDLEPCITSLPEASTPEEFAGGSLEDWPDRAFSVPPRINRGTIPGINAEKFR  534

Query  564   KDSTLWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESK  385
             +D+ +W  R++HY  ++    +  GR+RN++DMNA LGGFAAA++ + +WVMNVVPV S+
Sbjct  535   EDNEVWKTRVAHYKKIIPE--LSRGRFRNIMDMNADLGGFAAAVLKYPVWVMNVVPVHSE  592

Query  384   LNTLGVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILR  205
               TLG IYERGLIGTY  WCE  STYPRTYDLIHA  +F+LY  RC++  ILLEMDRILR
Sbjct  593   KQTLGAIYERGLIGTYQDWCEGFSTYPRTYDLIHAGGLFSLYASRCDITLILLEMDRILR  652

Query  204   PEGSVIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYWT  49
             PEG+ + RDDV+ L K++ IT+G++W+SR++DHE+GP   EK+L AVKTYWT
Sbjct  653   PEGTAVFRDDVETLTKIQSITNGMRWKSRILDHENGPFNPEKILVAVKTYWT  704



>ref|XP_008800812.1| PREDICTED: probable methyltransferase PMT15 [Phoenix dactylifera]
Length=917

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/527 (65%), Positives = 419/527 (80%), Gaps = 9/527 (2%)
 Frame = -2

Query  1611  YPPCDVKYSEYTPCEDTERSLAYDRERLIYRERHCPKKSEVLKCRIPAPFGYRNPFKWPE  1432
             +P CD  Y++YTPC D  RS  + RER  + ERHCP K+E+L+C +P P GY+ P  WPE
Sbjct  74    FPVCDAMYTDYTPCHDHSRSSKFPRERHAHMERHCPAKNELLRCLVPPPAGYQRPLPWPE  133

Query  1431  SRDVAWYTNVPHKELTVEKAVQNWIRFEGDRFKFPGGGTMFRNGADAYIDDIGKLINLKD  1252
             SRD AW+ NVPH +L V+K  QNW+  EGDRF+FPGGGT F  GADAYI +I +LI L+D
Sbjct  134   SRDAAWFANVPHPKLVVDKGKQNWVGVEGDRFRFPGGGTTFPWGADAYIKEIERLIPLRD  193

Query  1251  GSIRTALDTGCGVASFGAYLLSRNILTMSFAPRDTHQSQVQFALERGVPALIGILASKRL  1072
             GSIRTALD GCGVAS+GAYLLSR+ILTMSFAPRD+H++QVQ ALERGVPA++GI A+ RL
Sbjct  194   GSIRTALDAGCGVASWGAYLLSRSILTMSFAPRDSHKAQVQLALERGVPAMLGIFATDRL  253

Query  1071  PYPSKAFDMAHCSRCLIPWGQYDGAYLIEVDRVLRPGGYWILSGPPIRWKRYWQGWDRTE  892
             PYPS+AFDMAHCSRCLIPW  YDG YLIE+DR+LRPGGYWILSGPPI WK++W+GW   +
Sbjct  254   PYPSRAFDMAHCSRCLIPWHLYDGLYLIEIDRILRPGGYWILSGPPINWKQHWKGWQMKQ  313

Query  891   EDLEAEQTQIEKVADSLCWKKFMEVDDIAIWQKPYNHMDCIRLRQAP--PPMCPASNDPD  718
             +DL A Q+ IE +A SLCWKK  E  DIAIWQKP NH++C   R+A   P  C A  DPD
Sbjct  314   KDLRALQSTIEAIARSLCWKKLKEKGDIAIWQKPANHIECNATRKASLMPGFCSA-QDPD  372

Query  717   MAWYTDLQTCLTPLPQVSDEK-----ELEKWPKRLNAVPPRIKRGTIDGISGEKFEKDST  553
              AWYT ++ C+TP P+V+  +     EL+KWPKRL AVPPRI  G+I+G++ + F KD+ 
Sbjct  373   AAWYTKMEACITPQPEVAGMQEKAGGELKKWPKRLMAVPPRIGSGSINGVAPKMFLKDTE  432

Query  552   LWNKRISHYSAVMDGQLVEAGRYRNVLDMNAFLGGFAAALVDHSLWVMNVVPVESKLNTL  373
             LW +R+ +Y      +L + GRYRN+LDMN+ LGGFA AL+D  +WVMN+VP  +  +TL
Sbjct  433   LWKRRVRYYKEA-STELTQKGRYRNLLDMNSGLGGFATALIDDPVWVMNMVPTIATADTL  491

Query  372   GVIYERGLIGTYHTWCEAMSTYPRTYDLIHADSIFTLYKDRCEMEDILLEMDRILRPEGS  193
             GVIYERGLIGTYH WCEAMSTYPRTYDL+HAD +FTLYKDRCEMEDILLEMDRILRPEG+
Sbjct  492   GVIYERGLIGTYHDWCEAMSTYPRTYDLLHADLVFTLYKDRCEMEDILLEMDRILRPEGT  551

Query  192   VIIRDDVDVLIKVKRITDGLQWESRVVDHEDGPLQREKLLFAVKTYW  52
             VI RDDVD+L+ +K ITDG++W++R+VDHEDGPLQREKLLFAVK  W
Sbjct  552   VIFRDDVDILVGIKSITDGMRWDTRIVDHEDGPLQREKLLFAVKLRW  598



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6329964200262