BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8151_g1_i1 len=964 path=[975:0-963]

Length=964
                                                                      Score     E

gb|EMT11613.1|  Adenosylhomocysteinase                                  479   3e-167   
emb|CAH69227.1|  putative adenosylhomocysteinase                        475   5e-166   Nicotiana glauca [glaucous tobacco]
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             482   2e-165   
ref|XP_010466741.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    474   2e-165   
gb|EMS57067.1|  Adenosylhomocysteinase                                  479   3e-165   
gb|AFV46215.1|  hypothetical protein                                    474   5e-165   
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             480   1e-164   
gb|AGT16642.1|  Adenosylhomocysteinase                                  479   2e-164   
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               479   2e-164   Oryza sativa Japonica Group [Japonica rice]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             478   3e-164   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             478   4e-164   
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  478   5e-164   
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             478   8e-164   Hordeum vulgare [barley]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    478   1e-163   
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  478   1e-163   
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             477   1e-163   
gb|AFK46472.1|  unknown                                                 470   1e-163   
ref|NP_001148534.1|  adenosylhomocysteinase                             477   1e-163   Zea mays [maize]
dbj|BAH57232.1|  AT4G13940                                              470   1e-163   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    476   2e-163   Hordeum vulgare [barley]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         477   2e-163   
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  477   2e-163   
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             477   2e-163   
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      477   2e-163   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             477   2e-163   
gb|ACN34730.1|  unknown                                                 477   2e-163   Zea mays [maize]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   477   2e-163   
ref|NP_001067845.2|  Os11g0455500                                       478   2e-163   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01272.1|  Adenosylhomocysteinase                                  476   2e-163   
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           476   2e-163   
ref|NP_001289538.1|  adenosylhomocysteinase                             476   3e-163   
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     476   3e-163   Nicotiana tabacum [American tobacco]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      476   3e-163   Gossypium hirsutum [American cotton]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       476   3e-163   Nicotiana suaveolens
gb|KHN12344.1|  Adenosylhomocysteinase                                  473   4e-163   
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   476   4e-163   
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             476   4e-163   
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             476   4e-163   
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    476   4e-163   
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   476   5e-163   
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   476   5e-163   
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   476   6e-163   
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   476   6e-163   
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   476   6e-163   
gb|KHG17040.1|  Adenosylhomocysteinase                                  476   6e-163   
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    476   6e-163   
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   476   6e-163   
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   476   6e-163   
emb|CDY50423.1|  BnaCnng19320D                                          476   6e-163   
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   475   7e-163   
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             479   7e-163   
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             475   7e-163   
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   475   7e-163   
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   475   7e-163   
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                475   7e-163   
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   475   7e-163   
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  475   8e-163   
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             475   8e-163   
dbj|BAA03710.1|  cytokinin binding protein CBP57                        474   8e-163   Nicotiana sylvestris
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   475   8e-163   
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   475   8e-163   
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             475   9e-163   
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       475   9e-163   
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             475   9e-163   
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     475   1e-162   
emb|CDY01177.1|  BnaA04g06420D                                          475   1e-162   
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   475   1e-162   
emb|CDY47309.1|  BnaAnng08830D                                          475   1e-162   
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   474   1e-162   
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    474   1e-162   Catharanthus roseus [chatas]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       474   1e-162   
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   474   2e-162   
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   474   2e-162   
gb|KHN44476.1|  Adenosylhomocysteinase                                  467   2e-162   
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             474   2e-162   
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           474   2e-162   
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   474   2e-162   
gb|EPS72602.1|  adenosylhomocysteinase                                  477   2e-162   
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   474   3e-162   
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    474   3e-162   
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             474   3e-162   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       474   3e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             474   3e-162   
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   474   4e-162   
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   474   4e-162   
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   474   4e-162   
ref|NP_189023.1|  adenosylhomocysteinase 2                              474   4e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                473   4e-162   
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             473   4e-162   
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              473   4e-162   
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   473   4e-162   
ref|NP_001031627.1|  adenosylhomocysteinase 1                           469   4e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                473   5e-162   
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             473   6e-162   
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  473   6e-162   
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   473   6e-162   
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     473   7e-162   Nicotiana tabacum [American tobacco]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             473   7e-162   
ref|NP_001031628.1|  adenosylhomocysteinase 1                           471   8e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  473   9e-162   
ref|XP_006373090.1|  adenosylhomocysteinase family protein              473   9e-162   
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    473   9e-162   
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  473   1e-161   
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        473   1e-161   
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   473   1e-161   
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   473   1e-161   
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   473   1e-161   
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             472   1e-161   
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  472   1e-161   
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   472   1e-161   
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   472   1e-161   
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   472   1e-161   
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             473   1e-161   
ref|XP_003601687.1|  Adenosylhomocysteinase                             472   1e-161   
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase-like             472   2e-161   
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             472   2e-161   
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   472   2e-161   
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             471   2e-161   
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                471   2e-161   
emb|CDP11183.1|  unnamed protein product                                471   3e-161   
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   471   3e-161   
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  471   3e-161   
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       471   3e-161   
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   471   3e-161   
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             471   3e-161   Vitis vinifera
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             471   4e-161   
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    471   4e-161   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             471   4e-161   
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    471   5e-161   Medicago sativa [alfalfa]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             471   6e-161   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                470   7e-161   
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  470   7e-161   
ref|XP_010097949.1|  hypothetical protein L484_026840                   470   7e-161   
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                470   8e-161   
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               470   8e-161   
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   470   1e-160   
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             470   1e-160   
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             469   1e-160   
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    469   2e-160   
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
ref|NP_193130.1|  adenosylhomocysteinase 1                              469   2e-160   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA38860.1|  TPA: hypothetical protein ZEAMMB73_022938              461   2e-160   
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     469   2e-160   
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                469   3e-160   
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       471   3e-160   
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     469   3e-160   
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     469   3e-160   
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     469   3e-160   
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     469   3e-160   
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     469   3e-160   
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                469   3e-160   
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             469   3e-160   
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     468   4e-160   
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   468   4e-160   Ricinus communis
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       468   5e-160   
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             468   5e-160   
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             468   5e-160   
gb|EMS57266.1|  Adenosylhomocysteinase                                  477   6e-160   
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     468   6e-160   
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     468   7e-160   
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    468   7e-160   
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             468   7e-160   
gb|ACN40278.1|  unknown                                                 468   8e-160   Picea sitchensis
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                468   8e-160   
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    468   8e-160   Lupinus luteus
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  468   8e-160   
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     468   9e-160   
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    468   9e-160   
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             468   1e-159   
gb|AAM62888.1|  adenosylhomocysteinase                                  468   1e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  467   1e-159   Vitis vinifera
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            467   1e-159   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  467   1e-159   
gb|ABR16547.1|  unknown                                                 467   1e-159   Picea sitchensis
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            467   1e-159   Arabidopsis thaliana [mouse-ear cress]
gb|AEI54335.1|  adenosylhomocysteinase                                  467   1e-159   
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   
ref|NP_001234012.1|  adenosylhomocysteinase                             467   1e-159   
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  467   1e-159   
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     467   1e-159   
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             467   2e-159   
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    466   2e-159   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     467   2e-159   
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           467   2e-159   
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     467   2e-159   
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     466   2e-159   
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            466   2e-159   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17322.1|  unknown                                                 466   2e-159   Picea sitchensis
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     466   2e-159   
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     466   3e-159   
gb|ABR16573.1|  unknown                                                 466   3e-159   Picea sitchensis
ref|XP_002300147.1|  adenosylhomocysteinase family protein              466   3e-159   Populus trichocarpa [western balsam poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     466   3e-159   
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     466   3e-159   
gb|ABK24229.1|  unknown                                                 466   3e-159   Picea sitchensis
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     466   3e-159   
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    466   4e-159   Mesembryanthemum crystallinum
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     466   4e-159   
gb|ABR16138.1|  unknown                                                 466   5e-159   Picea sitchensis
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     466   5e-159   
gb|ABK25129.1|  unknown                                                 466   5e-159   Picea sitchensis
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     466   5e-159   
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     466   5e-159   
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    466   6e-159   Petroselinum crispum
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  466   6e-159   
gb|ABR16616.1|  unknown                                                 464   6e-159   Picea sitchensis
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        465   7e-159   
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     465   8e-159   
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     465   9e-159   
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     465   1e-158   
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    464   2e-158   Phalaenopsis sp.
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      464   3e-158   Petunia x hybrida [garden petunia]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                466   3e-158   
ref|NP_001265954.1|  adenosylhomocysteinase-like                        463   5e-158   
dbj|BAE71233.1|  putative adenosylhomocysteinase                        462   1e-157   Trifolium pratense [peavine clover]
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             462   2e-157   
ref|XP_008671500.1|  PREDICTED: adenosylhomocysteinase-like             459   2e-157   
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    464   3e-157   
emb|CDP15078.1|  unnamed protein product                                461   4e-157   
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                464   5e-157   
gb|ABJ53283.1|  S-adenosyl-L-homocysteine hydrolase                     454   7e-157   Ligularia fischeri
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          460   1e-156   
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                460   1e-156   
ref|XP_003629610.1|  Adenosylhomocysteinase                             460   1e-156   
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             459   1e-156   
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    459   2e-156   
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             459   3e-156   
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                458   4e-156   Solanum tuberosum [potatoes]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             456   2e-155   
ref|XP_001755926.1|  predicted protein                                  447   1e-151   
ref|XP_001755929.1|  predicted protein                                  447   1e-151   
ref|XP_001755906.1|  predicted protein                                  445   5e-151   
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     442   1e-149   
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                437   5e-148   
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  435   4e-147   
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      432   4e-146   Brassica oleracea var. alboglabra
gb|AAA33855.1|  S-adenosylhomocysteine hydrolase                        422   7e-146   Petroselinum crispum
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     421   9e-142   
emb|CDX85127.1|  BnaC07g07790D                                          421   2e-141   
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           420   2e-141   
emb|CDY50106.1|  BnaC01g43540D                                          421   3e-141   
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              419   1e-140   
gb|ACI31554.1|  S-adenosyl homocysteine hydrolase                       405   1e-139   Nicotiana benthamiana
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       415   3e-139   
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                415   4e-139   
emb|CDX77483.1|  BnaA07g06210D                                          413   8e-139   
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  412   6e-138   Chlamydomonas reinhardtii
emb|CDY53211.1|  BnaC03g74050D                                          411   6e-138   
emb|CDY58805.1|  BnaC08g46780D                                          410   2e-137   
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     411   4e-137   
ref|XP_005708566.1|  adenosylhomocysteinase                             407   5e-136   
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       404   1e-134   
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     404   1e-134   
ref|XP_003057172.1|  adenosylhomocysteinase                             403   2e-134   
ref|XP_002505983.1|  adenosylhomocysteinase                             403   2e-134   Micromonas commoda
gb|KFM24323.1|  Adenosylhomocysteinase                                  401   6e-133   
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            393   2e-131   
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    394   1e-130   
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                392   3e-129   
gb|AAL09400.1|AF307335_1  cytokinin binding protein                     384   8e-128   Petunia x hybrida [garden petunia]
ref|XP_001419579.1|  predicted protein                                  385   1e-127   Ostreococcus lucimarinus CCE9901
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    385   2e-127   
gb|EJY87176.1|  Adenosylhomocysteinase                                  382   2e-126   
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      381   6e-126   
gb|ABR16332.1|  unknown                                                 380   2e-125   Picea sitchensis
gb|ETO08386.1|  hypothetical protein RFI_29000                          369   3e-124   
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  374   3e-123   
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                374   4e-123   
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  372   1e-122   
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   371   2e-122   
gb|KFG60763.1|  putative adenosylhomocysteinase                         367   4e-122   
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   370   6e-122   
ref|XP_002177758.1|  adenosylhomocysteinase                             369   3e-121   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   369   3e-121   
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             368   9e-121   
gb|EPT27008.1|  adenosylhomocysteinase, putative                        369   6e-120   
ref|XP_008872075.1|  adenosylhomocysteinase 2                           365   7e-120   
gb|KFG55060.1|  putative adenosylhomocysteinase                         369   7e-120   
gb|AHG90399.1|  Adenosylhomocysteinase                                  366   8e-120   
gb|EPR62066.1|  putative adenosylhomocysteinase                         369   8e-120   
gb|KFH13893.1|  putative adenosylhomocysteinase                         369   8e-120   
gb|KFG42936.1|  putative adenosylhomocysteinase                         369   1e-119   
gb|ESS32583.1|  putative adenosylhomocysteinase                         368   1e-119   
ref|XP_009493630.1|  adenosylhomocysteinase 1                           364   3e-119   
ref|WP_022926989.1|  S-adenosyl-L-homocysteine hydrolase                363   4e-119   
ref|XP_008611237.1|  adenosylhomocysteinase                             363   7e-119   
ref|WP_013450695.1|  S-adenosyl-L-homocysteine hydrolase                362   1e-118   
ref|XP_009833581.1|  adenosylhomocysteinase 2                           361   3e-118   
dbj|GAE20305.1|  adenosylhomocysteinase                                 355   7e-118   
dbj|GAE21599.1|  adenosylhomocysteinase                                 355   7e-118   
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              360   1e-117   
ref|WP_036944508.1|  hypothetical protein                               359   1e-117   
ref|WP_017355275.1|  S-adenosyl-L-homocysteine hydrolase                359   3e-117   
ref|XP_004025117.1|  hypothetical protein IMG5_191490                   358   4e-117   
ref|WP_012157556.1|  S-adenosyl-L-homocysteine hydrolase                358   5e-117   
ref|WP_023840013.1|  MULTISPECIES: adenosylhomocysteinase               357   8e-117   
ref|WP_026851018.1|  adenosylhomocysteinase                             357   9e-117   
ref|WP_011438808.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    357   9e-117   
ref|WP_018502367.1|  S-adenosyl-L-homocysteine hydrolase                357   1e-116   
ref|WP_026910859.1|  S-adenosyl-L-homocysteine hydrolase                357   2e-116   
ref|WP_030534490.1|  MULTISPECIES: adenosylhomocysteinase               357   3e-116   
ref|XP_001023087.1|  adenosylhomocysteinase family protein              356   3e-116   
ref|WP_024305137.1|  adenosylhomocysteinase                             351   3e-116   
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       356   4e-116   
ref|WP_029917627.1|  hypothetical protein                               356   4e-116   
emb|CCA20123.1|  unnamed protein product                                355   9e-116   
ref|WP_019878251.1|  S-adenosyl-L-homocysteine hydrolase                355   9e-116   
ref|WP_027072847.1|  S-adenosyl-L-homocysteine hydrolase                355   1e-115   
ref|WP_020676549.1|  hypothetical protein                               355   1e-115   
ref|WP_018636612.1|  S-adenosyl-L-homocysteine hydrolase                355   1e-115   
gb|EJK64241.1|  hypothetical protein THAOC_15047                        345   1e-115   
ref|WP_028061676.1|  hypothetical protein                               354   2e-115   
ref|WP_029416908.1|  S-adenosyl-L-homocysteine hydrolase                353   2e-115   
ref|WP_027325990.1|  adenosylhomocysteinase                             353   2e-115   
ref|WP_012854369.1|  S-adenosyl-L-homocysteine hydrolase                354   2e-115   
ref|WP_019661087.1|  S-adenosyl-L-homocysteine hydrolase                354   3e-115   
ref|WP_009155258.1|  S-adenosyl-L-homocysteine hydrolase                354   3e-115   
ref|WP_011607815.1|  S-adenosyl-L-homocysteine hydrolase                353   3e-115   
ref|WP_009947852.1|  S-adenosyl-L-homocysteine hydrolase                354   3e-115   
ref|WP_006538559.1|  S-adenosyl-L-homocysteine hydrolase                353   4e-115   
emb|CDJ37737.1|  adenosylhomocysteinase, putative                       353   5e-115   
ref|WP_010481888.1|  S-adenosyl-L-homocysteine hydrolase [              353   5e-115   
ref|WP_038690480.1|  S-adenosyl-L-homocysteine hydrolase                353   6e-115   
gb|ETO04662.1|  hypothetical protein RFI_32734                          344   6e-115   
ref|WP_029720180.1|  hypothetical protein                               353   6e-115   
ref|WP_033834449.1|  S-adenosyl-L-homocysteine hydrolase                353   7e-115   
ref|WP_015679205.1|  adenosylhomocysteinase                             351   7e-115   
ref|WP_027069325.1|  S-adenosyl-L-homocysteine hydrolase                352   8e-115   
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                353   8e-115   
ref|WP_031446773.1|  S-adenosyl-L-homocysteine hydrolase                352   9e-115   
ref|WP_005415311.1|  S-adenosyl-L-homocysteine hydrolase                352   9e-115   
emb|CDA85923.1|  adenosylhomocysteinase                                 350   1e-114   
ref|WP_010568439.1|  S-adenosyl-L-homocysteine hydrolase                351   1e-114   
ref|WP_022301900.1|  adenosylhomocysteinase                             350   1e-114   
gb|ACF28652.1|  adenosylhomocysteinase                                  347   1e-114   
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    352   1e-114   
ref|WP_026415696.1|  S-adenosyl-L-homocysteine hydrolase                352   1e-114   
gb|KFX74750.1|  adenosylhomocysteinase                                  352   1e-114   
ref|WP_021645958.1|  adenosylhomocysteinase                             352   1e-114   
ref|WP_032576381.1|  adenosylhomocysteinase                             352   1e-114   
ref|WP_005781763.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    352   2e-114   
emb|CCI50303.1|  unnamed protein product                                352   2e-114   
ref|WP_011984485.1|  S-adenosyl-L-homocysteine hydrolase                352   2e-114   
ref|WP_010409859.1|  S-adenosyl-L-homocysteine hydrolase                350   2e-114   
ref|WP_008770078.1|  S-adenosyl-L-homocysteine hydrolase                352   2e-114   
ref|WP_003465484.1|  S-adenosyl-L-homocysteine hydrolase                351   2e-114   
ref|WP_004788105.1|  S-adenosyl-L-homocysteine hydrolase                350   3e-114   
ref|WP_027006534.1|  hypothetical protein                               351   3e-114   
ref|WP_015895661.1|  S-adenosyl-L-homocysteine hydrolase                352   3e-114   
ref|XP_002765933.1|  conserved hypothetical protein                     351   3e-114   
ref|WP_039007649.1|  S-adenosyl-L-homocysteine hydrolase                351   3e-114   
ref|WP_030509358.1|  S-adenosyl-L-homocysteine hydrolase                351   3e-114   
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             348   3e-114   
ref|WP_012476655.1|  S-adenosyl-L-homocysteine hydrolase                350   3e-114   
ref|WP_010535621.1|  S-adenosyl-L-homocysteine hydrolase                350   4e-114   
ref|WP_016268876.1|  adenosylhomocysteinase                             350   4e-114   
ref|WP_008765354.1|  S-adenosyl-L-homocysteine hydrolase                350   4e-114   
ref|WP_003475714.1|  adenosylhomocysteinase                             350   5e-114   
ref|WP_009576960.1|  Adenosylhomocysteinase                             350   5e-114   
ref|WP_032850487.1|  adenosylhomocysteinase                             350   5e-114   
dbj|BAQ16042.1|  adenosylhomocysteinase                                 350   6e-114   
ref|WP_016551225.1|  adenosylhomocysteinase                             349   6e-114   
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                350   6e-114   
ref|WP_005465635.1|  S-adenosyl-L-homocysteine hydrolase                350   7e-114   
ref|WP_034269570.1|  hypothetical protein                               350   7e-114   
gb|EFI04196.1|  adenosylhomocysteinase                                  350   7e-114   
ref|WP_019182466.1|  S-adenosyl-L-homocysteine hydrolase                350   7e-114   
ref|WP_006801116.1|  S-adenosyl-L-homocysteine hydrolase                350   8e-114   
ref|XP_002902721.1|  adenosylhomocysteinase                             350   8e-114   
ref|WP_002558259.1|  adenosylhomocysteinase                             350   9e-114   
ref|WP_015786997.1|  S-adenosyl-L-homocysteine hydrolase                350   9e-114   
ref|WP_007487570.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_020590636.1|  S-adenosyl-L-homocysteine hydrolase                348   1e-113   
ref|WP_019629152.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_025876541.1|  S-adenosyl-L-homocysteine hydrolase                350   1e-113   
ref|XP_008893590.1|  adenosylhomocysteinase                             350   1e-113   
ref|WP_009741556.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_014036003.1|  S-adenosyl-L-homocysteine hydrolase                350   1e-113   
ref|WP_008019385.1|  S-adenosyl-L-homocysteine hydrolase, NAD bin...    345   1e-113   
ref|WP_004154241.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    349   1e-113   
ref|WP_012917260.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_026403633.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             349   1e-113   
ref|WP_019338084.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_034636511.1|  S-adenosyl-L-homocysteine hydrolase                349   1e-113   
ref|WP_026633760.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
dbj|GAE86521.1|  adenosylhomocysteinase                                 348   2e-113   
ref|WP_012501941.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
ref|WP_030837066.1|  adenosylhomocysteinase                             349   2e-113   
ref|WP_024957291.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
ref|WP_032974920.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
gb|ERP38824.1|  S-adenosyl-L-homocysteine hydrolase                     348   2e-113   
ref|WP_020252885.1|  hypothetical protein                               348   2e-113   
ref|WP_033830371.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
ref|WP_005458181.1|  S-adenosyl-L-homocysteine hydrolase                349   2e-113   
ref|WP_026869144.1|  adenosylhomocysteinase                             347   2e-113   
gb|AAX40985.1|  S-adenosyl-L-homocysteine hydrolase                     345   3e-113   
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                349   3e-113   
ref|WP_014645960.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_010311525.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_017915311.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_006841877.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_017909629.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
ref|WP_009132416.1|  adenosylhomocysteinase                             348   3e-113   
ref|WP_007661865.1|  S-adenosyl-L-homocysteine hydrolase                348   3e-113   
gb|AJC45879.1|  S-adenosyl-L-homocysteine hydrolase                     348   4e-113   
ref|WP_036327944.1|  S-adenosyl-L-homocysteine hydrolase                348   5e-113   
gb|KGK58630.1|  S-adenosyl-L-homocysteine hydrolase                     348   5e-113   
gb|KDS83885.1|  adenosylhomocysteinase                                  348   5e-113   
ref|WP_010572375.1|  S-adenosyl-L-homocysteine hydrolase                347   5e-113   
ref|WP_039564728.1|  S-adenosyl-L-homocysteine hydrolase                348   5e-113   
ref|WP_022275430.1|  adenosylhomocysteinase                             348   5e-113   
ref|WP_039404132.1|  S-adenosyl-L-homocysteine hydrolase                348   5e-113   
ref|WP_002086497.1|  adenosylhomocysteinase                             345   6e-113   
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    348   6e-113   
ref|WP_005928473.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    347   6e-113   
ref|WP_030543976.1|  adenosylhomocysteinase                             348   6e-113   
ref|WP_011108485.1|  S-adenosyl-L-homocysteine hydrolase                347   7e-113   
ref|WP_010150950.1|  S-adenosyl-L-homocysteine hydrolase                346   8e-113   
ref|WP_037954273.1|  adenosylhomocysteinase                             348   8e-113   
ref|XP_002788757.1|  conserved hypothetical protein                     347   9e-113   
ref|WP_025831901.1|  adenosylhomocysteinase                             347   9e-113   
ref|WP_006239887.1|  S-adenosyl-L-homocysteine hydrolase                347   9e-113   
ref|WP_010342174.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
ref|WP_030168968.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
ref|WP_000117570.1|  S-adenosyl-L-homocysteine hydrolase                345   1e-112   
ref|WP_024987950.1|  adenosylhomocysteinase                             347   1e-112   
ref|WP_016762474.1|  S-adenosyl-L-homocysteine hydrolase                345   1e-112   
ref|WP_034274048.1|  adenosylhomocysteinase                             347   1e-112   
ref|WP_029219085.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
gb|KFA30189.1|  S-adenosyl-L-homocysteine hydrolase                     343   1e-112   
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
ref|WP_031421135.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
ref|WP_014089407.1|  S-adenosyl-L-homocysteine hydrolase                347   1e-112   
ref|WP_011346442.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    347   2e-112   
ref|WP_005910841.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    347   2e-112   
ref|WP_020762639.1|  adenosylhomocysteinase                             345   2e-112   
ref|WP_007761981.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                347   2e-112   
ref|WP_022391602.1|  adenosylhomocysteinase                             346   2e-112   
ref|WP_014177043.1|  S-adenosyl-L-homocysteine hydrolase                347   2e-112   
ref|WP_026474546.1|  adenosylhomocysteinase                             346   2e-112   
ref|WP_001277005.1|  S-adenosyl-L-homocysteine hydrolase                345   2e-112   
ref|WP_004766537.1|  adenosylhomocysteinase                             345   2e-112   
ref|WP_000117571.1|  S-adenosyl-L-homocysteine hydrolase                345   2e-112   
ref|WP_019466297.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_004756351.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    345   2e-112   
gb|EZG78269.1|  adenosylhomocysteinase                                  348   2e-112   
gb|EDM21735.1|  adenosylhomocysteinase                                  346   2e-112   
ref|WP_002114585.1|  adenosylhomocysteinase                             345   2e-112   
ref|WP_004302401.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    346   2e-112   
ref|WP_004296427.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_026367128.1|  adenosylhomocysteinase                             346   2e-112   
ref|WP_005681774.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_019245937.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_022209421.1|  adenosylhomocysteinase                             346   2e-112   
ref|WP_007219288.1|  S-adenosyl-L-homocysteine hydrolase                346   2e-112   
ref|WP_019815305.1|  S-adenosyl-L-homocysteine hydrolase                346   3e-112   
ref|WP_036194122.1|  S-adenosyl-L-homocysteine hydrolase                346   3e-112   
ref|WP_027585853.1|  adenosylhomocysteinase                             346   3e-112   
ref|WP_022041363.1|  adenosylhomocysteinase                             346   3e-112   
ref|WP_002980690.1|  adenosylhomocysteinase                             345   3e-112   
ref|WP_028081726.1|  S-adenosyl-L-homocysteine hydrolase                346   3e-112   
gb|EWM11842.1|  adenosylhomocysteinase                                  346   3e-112   
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                346   3e-112   
gb|EEZ06043.1|  adenosylhomocysteinase                                  346   3e-112   
ref|WP_004317528.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    345   3e-112   
ref|WP_009000954.1|  S-adenosyl-L-homocysteine hydrolase                345   3e-112   
ref|WP_010576301.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    344   3e-112   
ref|WP_008023149.1|  S-adenosyl-L-homocysteine hydrolase                345   3e-112   
ref|WP_027715052.1|  hypothetical protein                               346   4e-112   
ref|WP_025548907.1|  S-adenosyl-L-homocysteine hydrolase                340   4e-112   
ref|WP_018046312.1|  S-adenosyl-L-homocysteine hydrolase                344   4e-112   
ref|WP_008946161.1|  S-adenosyl-L-homocysteine hydrolase                344   4e-112   
ref|WP_008642653.1|  S-adenosyl-L-homocysteine hydrolase                345   4e-112   
ref|WP_021595983.1|  S-adenosyl-L-homocysteine hydrolase                345   4e-112   
ref|WP_015531741.1|  adenosylhomocysteinase                             345   4e-112   
ref|WP_012524242.1|  S-adenosyl-L-homocysteine hydrolase                346   4e-112   
ref|WP_002179979.1|  MULTISPECIES: adenosylhomocysteinase               344   4e-112   
ref|WP_032839083.1|  adenosylhomocysteinase                             345   4e-112   
ref|WP_013421278.1|  S-adenosyl-L-homocysteine hydrolase                345   4e-112   
gb|EEX47469.1|  adenosylhomocysteinase                                  345   4e-112   
ref|WP_012631604.1|  S-adenosyl-L-homocysteine hydrolase                346   4e-112   
ref|WP_030907351.1|  S-adenosyl-L-homocysteine hydrolase                345   4e-112   
ref|WP_007211807.1|  S-adenosyl-L-homocysteine hydrolase                346   4e-112   
ref|WP_037057837.1|  hypothetical protein                               345   5e-112   
ref|WP_005447827.1|  S-adenosyl-L-homocysteine hydrolase                345   5e-112   
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                346   5e-112   



>gb|EMT11613.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=292

 Score =   479 bits (1233),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  50   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  109

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVSDADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  110  MEGIQILTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  169

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  170  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  229

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIPVEGPYKPA 
Sbjct  230  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPAA  289

Query  243  YRY  235
            YRY
Sbjct  290  YRY  292



>emb|CAH69227.1| putative adenosylhomocysteinase [Nicotiana glauca]
Length=264

 Score =   475 bits (1222),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  22   GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  81

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  82   MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  141

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  142  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  201

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  202  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  261

Query  243  YRY  235
            YRY
Sbjct  262  YRY  264



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   482 bits (1241),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 227/243 (93%), Positives = 238/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+  Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010466741.1| PREDICTED: adenosylhomocysteinase 2-like isoform X2 [Camelina 
sativa]
Length=291

 Score =   474 bits (1221),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  49   GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  108

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  109  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  168

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  169  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  228

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKPA+
Sbjct  229  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPAN  288

Query  243  YRY  235
            YRY
Sbjct  289  YRY  291



>gb|EMS57067.1| Adenosylhomocysteinase [Triticum urartu]
Length=416

 Score =   479 bits (1232),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  174  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  233

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  234  MEGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  293

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  294  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  353

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIPVEGPYKPA 
Sbjct  354  LWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAA  413

Query  243  YRY  235
            YRY
Sbjct  414  YRY  416



>gb|AFV46215.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=302

 Score =   474 bits (1219),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIVTEIDPICALQA 
Sbjct  60   GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAFALKQAGARVIVTEIDPICALQAL  119

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  120  MEGFQVLTLEDVVSEGDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  179

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  180  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  239

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS YISIPVEGPYKP H
Sbjct  240  LWKERTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPH  299

Query  243  YRY  235
            YRY
Sbjct  300  YRY  302



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   480 bits (1236),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+  QS YIS+P+EGPYKPAH
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKSQSDYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT  Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   479 bits (1234),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   478 bits (1229),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  208  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  267

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  268  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  327

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  328  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  387

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  388  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAH  447

Query  243  YRY  235
            YRY
Sbjct  448  YRY  450



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   478 bits (1231),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   478 bits (1231),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 238/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLPVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKEKTTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   478 bits (1230),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVSDADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIQILTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIPVEGPYKP+ 
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVEGPYKPSA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   478 bits (1229),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS YISIP+EGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   478 bits (1229),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 238/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +Q+ YIS+PVEGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVV+DADI VTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVTDADILVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTPEQ+AYIS+PVEGPYKPAH
Sbjct  423  LWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AFK46472.1| unknown [Lotus japonicus]
Length=290

 Score =   470 bits (1209),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  48   GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  107

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQV TLED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAI+ NIGHFDNEIDM GLE+
Sbjct  108  MEGLQVQTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIISNIGHFDNEIDMHGLET  167

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  168  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  227

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL  +QS YISIP+EGPYKPAH
Sbjct  228  LWKEKGSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLRKDQSDYISIPIEGPYKPAH  287

Query  243  YRY  235
            YRY
Sbjct  288  YRY  290



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   477 bits (1228),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT  Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>dbj|BAH57232.1| AT4G13940 [Arabidopsis thaliana]
Length=291

 Score =   470 bits (1209),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  49   GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  108

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  109  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  168

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  169  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  228

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  229  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  288

Query  243  YRY  235
            YRY
Sbjct  289  YRY  291



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   476 bits (1224),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  208  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  267

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  268  MEGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  327

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  328  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  387

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIP+EGPYKPA 
Sbjct  388  LWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKPAA  447

Query  243  YRY  235
            YRY
Sbjct  448  YRY  450



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   477 bits (1228),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 238/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSDADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW+EK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   477 bits (1228),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS+ADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+P+EGPYKP H
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPAQAEYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ V+TLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVITLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YISIP+EGPYKPAH
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+P EGPYKP H
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPTEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT  Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   477 bits (1227),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   478 bits (1230),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 226/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  273  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  332

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  333  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  392

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  393  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  452

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  453  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKSQADYISVPVEGPYKPAH  512

Query  243  YRY  235
            YRY
Sbjct  513  YRY  515



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIPVEGPYKPA 
Sbjct  423  LWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPVEGPYKPAA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   476 bits (1226),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPGH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA LTKLT +Q+ YIS+P+EGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   476 bits (1226),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KHN12344.1| Adenosylhomocysteinase [Glycine soja]
Length=408

 Score =   473 bits (1218),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  166  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  225

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  226  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  285

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  286  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  345

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+L+  Q+ YIS+PVEGPYKPAH
Sbjct  346  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAH  405

Query  243  YRY  235
            YRY
Sbjct  406  YRY  408



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1225),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   476 bits (1225),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPIEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   476 bits (1225),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVI+TEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIITEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ V+TLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVITLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YISIP+EGPYKPAH
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   476 bits (1225),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQ+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+S+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT  Q+ YISIP+EGPYKPAH
Sbjct  423  LWKERSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKSQADYISIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIVVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA LTKLT +Q+ YIS+P+EGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGANLTKLTKDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS YISIP++GPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYISIPIQGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   476 bits (1224),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKH DEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHFDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   479 bits (1233),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  346  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  405

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  406  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  465

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  466  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  525

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS YISIP+EGPYKPAH
Sbjct  526  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPAH  585

Query  243  YRY  235
            YRY
Sbjct  586  YRY  588



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP  
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVS  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ V TLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVQTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQ+E
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLADGRLMNLGCATGHPSFVMSCSFTNQVIAQIE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTPEQ+AYIS+PVEGPYKPAH
Sbjct  423  LWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPG+KRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGIKRITIKPQTDRWVFPETSTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+PVEGPYKP H
Sbjct  423  LWKERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   474 bits (1220),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  208  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  267

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  268  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  327

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  328  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  387

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  388  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPH  447

Query  243  YRY  235
            YRY
Sbjct  448  YRY  450



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1223),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   475 bits (1223),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ADIFVTTTGNKDIIMV HMRKMKNNAI+CNIGHFDNEIDMQGLE+
Sbjct  303  MEGYQVLTLEDVVSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+P+EGPYKP H
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   475 bits (1223),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 225/243 (93%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSDADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVK+ITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKKITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKP  
Sbjct  423  LWKEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPLA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   475 bits (1223),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS YISIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMK+NAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKSNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMR+MKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   475 bits (1222),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 224/244 (92%), Positives = 238/244 (98%), Gaps = 1/244 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLED-VVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLE  607
            MEGLQVLTLED VVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE
Sbjct  303  MEGLQVLTLEDDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLE  362

Query  606  SYPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL  427
            ++PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL
Sbjct  363  TFPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL  422

Query  426  ELWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPA  247
            ELW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKPA
Sbjct  423  ELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPA  482

Query  246  HYRY  235
            HYRY
Sbjct  483  HYRY  486



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMR+MKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRRMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +Q+ YIS+P+EGPYKPAH
Sbjct  423  LWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   474 bits (1221),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSNVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGAR+IVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARMIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVAPLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KHN44476.1| Adenosylhomocysteinase [Glycine soja]
Length=291

 Score =   467 bits (1202),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQA 
Sbjct  49   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQAL  108

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIM++HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  109  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLET  168

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
             PGVKRI IKPQTDR+VFPDTK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  169  CPGVKRINIKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  228

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK SGKYEKKVY+LPKHLDEKVA+LHLG+LGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  229  LWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAH  288

Query  243  YRY  235
            YRY
Sbjct  289  YRY  291



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   474 bits (1221),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKPA+
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPAN  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1220),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITI+PQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIEPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   477 bits (1228),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGK+ VVCGYGDVGKGCAAALKQAGARV+VTEIDPICALQA 
Sbjct  325  GCRHSLPDGLMRATDVMIAGKIGVVCGYGDVGKGCAAALKQAGARVVVTEIDPICALQAL  384

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  385  MEGFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  444

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGV+RITIKPQTDR+VFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  445  YPGVERITIKPQTDRYVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  504

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+SSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+ VEGPYKPAH
Sbjct  505  LWKERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVAVEGPYKPAH  564

Query  243  YRY  235
            YRY
Sbjct  565  YRY  567



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1220),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PG KRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGAKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKPA+
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPAN  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   474 bits (1219),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVEHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARL KL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLAKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWSEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YR+
Sbjct  483  YRH  485



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKV++LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVHVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   474 bits (1219),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   473 bits (1218),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   473 bits (1218),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+P Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPAQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1218),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGL RATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLTRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1218),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPD  +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDISSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_001031627.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83346.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=364

 Score =   469 bits (1206),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  122  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  181

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  182  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  241

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  242  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  301

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  302  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  361

Query  243  YRY  235
            YRY
Sbjct  362  YRY  364



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   473 bits (1218),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+QVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKPA+
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPAN  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+PV+GPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS+ADIFVTTTGNKDI+MV HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSEADIFVTTTGNKDILMVGHMRKMKNNAIVCNIGHFDNEIDMHGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YI++P+EGPYKPAH
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYINVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1217),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM G E+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGPET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   473 bits (1216),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  237  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  296

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  297  MEGLQVLTLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  356

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  357  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  416

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+PV+GPYKP H
Sbjct  417  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPVDGPYKPPH  476

Query  243  YRY  235
            YRY
Sbjct  477  YRY  479



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   473 bits (1217),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HM KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMTKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_001031628.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83347.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=440

 Score =   471 bits (1212),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  198  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  257

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  258  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  317

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  318  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  377

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  378  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  437

Query  243  YRY  235
            YRY
Sbjct  438  YRY  440



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   473 bits (1216),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARV+VTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVVVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKP H
Sbjct  423  LWKERATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   473 bits (1216),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   473 bits (1216),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+ +ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLPEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ E
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQPE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEI M GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIGMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   473 bits (1216),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSDADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+ VEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLD KVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDGKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGR MNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRPMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVASEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+S KYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSSKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   473 bits (1217),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  265  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  324

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  325  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  384

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  385  FPGVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  444

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  445  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYVSIPIEGPYKPVH  504

Query  243  YRY  235
            YRY
Sbjct  505  YRY  507



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   472 bits (1215),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+E
Sbjct  363  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLG+LGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase-like [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL +EDVVSDADIFVTTTGNKDIIM+ HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPIEDVVSDADIFVTTTGNKDIIMLEHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGV+RITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVQRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+P+EGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+L+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   472 bits (1214),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFP T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPVTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   471 bits (1213),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDV+S+ADIFVTTTGNKDIIMV HMRKMKNNAI+CNIGHFDNEIDM GLE+
Sbjct  303  MEGYQVLTLEDVLSEADIFVTTTGNKDIIMVGHMRKMKNNAIICNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+P+EGPYKP H
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   471 bits (1213),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDVVSEADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            G RHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GRRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDV+++ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE 
Sbjct  303  MEGIPVLTLEDVLAEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLEI  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
             PGVKRITIKPQTDR+VFPDT +G+I+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  LPGVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+AYIS+PVEGPYKPAH
Sbjct  423  LWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSEQAAYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   471 bits (1213),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITI PQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITILPQTDRWVFPDTSSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   471 bits (1212),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGA+VIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGAQVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS ADIFVTTTGNKDIIMV+HM++MKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSKADIFVTTTGNKDIIMVHHMKQMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+PEQ+AYIS+PVEGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSPEQAAYISVPVEGPYKPTH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVSDADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+LT EQ+ YIS+  +GPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 223/243 (92%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIP+EGPYK   
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKSQSDYISIPIEGPYKLRL  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   471 bits (1212),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS+ DIFVTTTGNKDIIMV HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSEVDIFVTTTGNKDIIMVEHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKERETGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQAEYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   471 bits (1211),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+E
Sbjct  363  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLG+LGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   471 bits (1211),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPK LDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKRLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   470 bits (1210),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 237/243 (98%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVHHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   470 bits (1210),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   470 bits (1210),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ +LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPLLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+++GKYEKKVY+LPKHLDEKVAALHL KLGA+LTKLT EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERTTGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   470 bits (1210),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +QS YIS+P+EGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQSDYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   470 bits (1210),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA + GYGDVGKGCAAA+KQAGARVIV+EIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAFIAGYGDVGKGCAAAMKQAGARVIVSEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVSD DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSDVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +G+I+LAEGRLMNLGCA GHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGVIVLAEGRLMNLGCAAGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   470 bits (1209),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+SDADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+LT EQ+ YIS+  +GPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   470 bits (1209),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   469 bits (1208),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            Y GVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YAGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLT+EDVVS ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTIEDVVSTADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK SGKYEKKVY+LPKHLDEKVAALHL KLGA LTKL+PEQ+AYI++PVEGPYKPAH
Sbjct  423  LWNEKKSGKYEKKVYVLPKHLDEKVAALHLPKLGAHLTKLSPEQAAYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1208),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>tpg|DAA38860.1| TPA: hypothetical protein ZEAMMB73_022938 [Zea mays]
Length=270

 Score =   461 bits (1186),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 231/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGAR+I+TEIDPICAL A 
Sbjct  28   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARIIITEIDPICALLAL  87

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  88   MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  147

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQ DR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLE
Sbjct  148  YPGVKRITIKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLE  207

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKV ALHLGK GA+LTKLT  Q+ YI +P+EGPYK AH
Sbjct  208  LWKEKNSGKYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAH  267

Query  243  YRY  235
            YRY
Sbjct  268  YRY  270



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1207),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKY K+VY+LPKHLDEKVAALHLGKLGA+LTKLT EQS YISIPVEGPYKP H
Sbjct  423  LWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQSDYISIPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   471 bits (1212),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/257 (87%), Positives = 239/257 (93%), Gaps = 0/257 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPAH  482

Query  243  YRY*FNGRVDIVYGFVG  193
            YR  F G   ++   VG
Sbjct  483  YRLNFVGVCGVMGKMVG  499



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   469 bits (1208),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 221/242 (91%), Positives = 234/242 (97%), Gaps = 0/242 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVV +ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVCEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMCGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK++GKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+ EQ+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKATGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSKEQADYISVPVEGPYKPAH  482

Query  243  YR  238
            YR
Sbjct  483  YR  484



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   469 bits (1206),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLG+LG +LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   468 bits (1205),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   468 bits (1205),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVL LEDVVS+ADIFVTTTGNKDI+MV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGYQVLPLEDVVSEADIFVTTTGNKDIVMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW+EK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWREKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   468 bits (1205),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVFGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVK+ITIKPQTDR+VFPDT +GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKKITIKPQTDRWVFPDTNSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWNEKTSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPLH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   468 bits (1205),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ V TL+DVVS+ADIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVRTLKDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+P+EGPYKPAH
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   468 bits (1204),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+SDADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEID+ GLE+
Sbjct  303  MEGLQVLTLEDVLSDADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDVLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS+GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+LT EQ+ YIS+  +GPYKP H
Sbjct  423  LWKEKSTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTRLTKEQADYISVSADGPYKPLH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|EMS57266.1| Adenosylhomocysteinase [Triticum urartu]
Length=752

 Score =   477 bits (1228),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 224/243 (92%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  510  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  569

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+Q+LTLEDVVSDADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  570  MEGIQILTLEDVVSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMNGLET  629

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  630  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  689

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK++GKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT  QS YISIPV+GPYKPA 
Sbjct  690  LWNEKATGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKAQSEYISIPVDGPYKPAA  749

Query  243  YRY  235
            YRY
Sbjct  750  YRY  752



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   468 bits (1204),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPD+K+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDSKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   468 bits (1204),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDG MRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGFMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   468 bits (1204),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   468 bits (1203),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIM++HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
             PGVKRI IKPQTDR+VFPDTK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  CPGVKRINIKPQTDRWVFPDTKRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK SGKYEKKVY+LPKHLDEKVA+LHLG+LGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKGSGKYEKKVYVLPKHLDEKVASLHLGQLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   468 bits (1203),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   468 bits (1203),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 222/243 (91%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCR SLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRPSLPDGLMRATDVMIAGKVAVIWGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKLT +QS Y+SIPVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLTKDQSDYVSIPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   468 bits (1203),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIM++HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  HPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   468 bits (1203),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVV++ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVAEADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT EQ+ YIS+PVEGPYKPA 
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKEQADYISVPVEGPYKPAA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   468 bits (1203),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLT+L+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTELSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   468 bits (1203),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  246  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  305

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIM++HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  306  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMLDHMKKMKNNAIVCNIGHFDNEIDMLGLET  365

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  366  HPGVKRITIKPQTDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  425

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+ +Q+ YIS+PVEGPYKP H
Sbjct  426  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLEKLGAKLTKLSKDQADYISVPVEGPYKPFH  485

Query  243  YRY  235
            YRY
Sbjct  486  YRY  488



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   468 bits (1203),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLED +S+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDAISEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQ+E
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQIE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLG+LGARLTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKTSGKYEKKVYVLPKHLDEKVAALHLGQLGARLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   468 bits (1203),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +Q  Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQXDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ V T+EDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVQTIEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKP H
Sbjct  423  LWKEKASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHL+EKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLNEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK +GKY+K+VY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIP+EGPYKPA 
Sbjct  423  LWNEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYLSIPIEGPYKPAA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLE+VVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLENVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSF NQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFINQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 221/243 (91%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL 
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLG  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKS GKYEKKVY+LPKHLDEKVAALHLGKLGA+LT+L+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKSIGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTQLSKSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIM +HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMADHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLFLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+SSGKYEKKVY+LPKHLDEKVAALHLGK GA+LTKLT +Q+ YI +PVEGPYKPAH
Sbjct  423  LWNERSSGKYEKKVYVLPKHLDEKVAALHLGKFGAKLTKLTKDQADYIYVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFT+QVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTDQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV CGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVACGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   467 bits (1202),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL L+DVVS+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKY+K+VY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKP H
Sbjct  423  LWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1201),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFD+EIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDSEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSEDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1201),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIA KVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIASKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS  DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSGIDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK+GI++LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKSGILVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKVAALHLG+LG +LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKEKASGKYEKKVYVLPKHLDEKVAALHLGQLGVKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   466 bits (1199),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  225  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  284

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  285  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  344

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK GII+LA+GRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  345  YPGVKRITIKPQTDRWVFPETKAGIIVLAQGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  404

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARL KL+ +QS Y+SIP+EGPYKP H
Sbjct  405  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLRKLSKDQSDYVSIPIEGPYKPPH  464

Query  243  YRY  235
            YRY
Sbjct  465  YRY  467



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+ PKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVSPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG Q+LTLED+VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQILTLEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKP H
Sbjct  423  LWKEKGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSTDQADYISVPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   467 bits (1201),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
             EGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  TEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVT TGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK  II+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETKAEIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVA LHLGKLGARLTKL+ +QS Y+SIP+EGPYKP H
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVALLHLGKLGARLTKLSKDQSDYVSIPIEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1200),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGA VIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGASVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1200),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGH DNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHLDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++P+EGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 215/243 (88%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVISEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++P+EGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPIEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSC FTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCLFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTL DVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLVDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEID+QGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDIQGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   466 bits (1199),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLED VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDAVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
             PGVKRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  CPGVKRITIKPQTDRWVFPETNVGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   466 bits (1199),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG Q+LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQILTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDRFVFP+T TGII+LAEGRLM LGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRFVFPETNTGIIVLAEGRLMKLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1198),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL 
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLV  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRK+KNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKIKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQL 
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLV  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDI+M++HMRKMKNNAIVCNIGHFDNEID+QGLE+
Sbjct  303  MEGLPVLTLEDVVSTADIFVTTTGNKDIVMLDHMRKMKNNAIVCNIGHFDNEIDIQGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKKITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+P+Q+ YI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSPDQAEYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCG+GDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGHGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGV+RITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   466 bits (1198),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNE+DM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEVDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGH SFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHSSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   466 bits (1198),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEVDIFVTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDT  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   466 bits (1198),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQA 
Sbjct  245  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQAL  304

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG Q+LTLEDV+++ DIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  305  MEGFQILTLEDVLAEGDIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMHGLET  364

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPG+KRITIKPQTDRFVFP+TK+G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  365  YPGIKRITIKPQTDRFVFPETKSGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKLT +QS Y+SIPVEGPYKPAH
Sbjct  425  LWNEKASGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLTKDQSDYLSIPVEGPYKPAH  484

Query  243  YRY  235
            YRY
Sbjct  485  YRY  487



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   464 bits (1194),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGC+AALK AGARVIVTEIDPICALQA 
Sbjct  208  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCSAALKVAGARVIVTEIDPICALQAL  267

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VLTLEDVVS ADIFVTTTGNKDIIM++HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  268  MEGLPVLTLEDVVSTADIFVTTTGNKDIIMLDHMRKMKNNAIVCNIGHFDNEIDMQGLET  327

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVK+ITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  328  FPGVKKITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  387

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGARLTKL+P+Q+ YI++PV+GPYKPAH
Sbjct  388  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGARLTKLSPDQAEYINVPVDGPYKPAH  447

Query  243  YRY  235
            YRY
Sbjct  448  YRY  450



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   465 bits (1197),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 219/243 (90%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS ADIFVTTTGNKD+IMV+ M++MKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSVADIFVTTTGNKDVIMVSDMKRMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK+SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKLT EQ+ YIS+P+EGPYKPA 
Sbjct  423  LWNEKASGKYEKKVYVLPKHLDEKVAALHLSKLGAKLTKLTKEQADYISVPIEGPYKPAA  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   465 bits (1197),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 236/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K+AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKRAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTG+KDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGSKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   465 bits (1196),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 235/243 (97%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGV+RITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVRRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+L LGKLGARLTKL+ +Q+ YI++PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLRLGKLGARLTKLSKDQADYINVPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   465 bits (1196),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQ LTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQDLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYE+KVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YI+ PVEGPYKPA 
Sbjct  423  LWNERKTGKYERKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYINAPVEGPYKPAQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   464 bits (1194),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 220/243 (91%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVG GCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGLGCAAALKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL VL LEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLES
Sbjct  303  MEGLPVLRLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLES  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR VFPDT +GI++LAEGRLMNLGCATGHPSFVMS SFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRRVFPDTNSGILVLAEGRLMNLGCATGHPSFVMSSSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE++SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTP Q+ YIS+PVEGPYKPAH
Sbjct  423  LWKERASGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   464 bits (1193),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCA +LKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCAMSLKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVV+DADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVADADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPS VMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSVVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YI++PVEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYINVPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   466 bits (1198),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQA 
Sbjct  305  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQAL  364

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDV+S+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  365  MEGFQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  424

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  425  FPGVKRITIKPQTDRWVFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  484

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKY K+VY+LPKHLDEKVAALHLGKLGA+LTKLT +QS Y+SIPVEGPYKP H
Sbjct  485  LWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYVSIPVEGPYKPPH  544

Query  243  YRY  235
            YRY
Sbjct  545  YRY  547



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   463 bits (1191),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 218/243 (90%), Positives = 230/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS ADIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDVVSIADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMAGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNERNSGKYEKKVYVLPKHLDEKVAALHLNKLGAKLTKLSQSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   462 bits (1189),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 230/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAVALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDVVS ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDVVSYADIFVTTTGNKDIIMVDDMKKMKNNAIVCNIGHFDNEIDMSGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR++FP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWLFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   462 bits (1188),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTL+DVVS ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLDDVVSVADIFVTTTGNKDIIMVSHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKR  IKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRTNIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKYEKKVY+LPKHLDEKVA+LHLG+LGA+LTKLT EQ+ YIS+PVEGPYKP H
Sbjct  423  LWKEKGTGKYEKKVYVLPKHLDEKVASLHLGQLGAKLTKLTKEQADYISVPVEGPYKPVH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_008671500.1| PREDICTED: adenosylhomocysteinase-like [Zea mays]
Length=426

 Score =   459 bits (1181),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 231/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGAR+I+TEIDPICAL A 
Sbjct  184  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARIIITEIDPICALLAL  243

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  244  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  303

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQ DR+VFP+T TGIIILAEGRLMNLGCATGHPSFVMSCSFTNQV+AQLE
Sbjct  304  YPGVKRITIKPQIDRWVFPETNTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVLAQLE  363

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK+SGKYEKKVY+LPKHLDEKV ALHLGK GA+LTKLT  Q+ YI +P+EGPYK AH
Sbjct  364  LWKEKNSGKYEKKVYVLPKHLDEKVNALHLGKHGAKLTKLTKSQADYIRVPIEGPYKLAH  423

Query  243  YRY  235
            YRY
Sbjct  424  YRY  426



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   464 bits (1193),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 217/243 (89%), Positives = 234/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCAAA+KQAGARVIVTEIDPICALQA 
Sbjct  319  GCRHSLPDGLMRATDVMIAGKVAVVLGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAL  378

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLED V++ADIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  379  MEGLQVLTLEDCVAEADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMNGLET  438

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  439  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  498

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVA+LHLGKLGARLTKL+ +Q+ YIS+PVEGPYKPA 
Sbjct  499  LWNERASGKYEKKVYVLPKHLDEKVASLHLGKLGARLTKLSKDQADYISVPVEGPYKPAQ  558

Query  243  YRY  235
            YRY
Sbjct  559  YRY  561



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   461 bits (1186),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKSAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS ADIFVTTTGNKDII+V+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVSKADIFVTTTGNKDIIIVDHMKKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKR+TIKPQTDR++FP+ +TGIIILAEGRL NLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRVTIKPQTDRWIFPENETGIIILAEGRLTNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK++GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT  Q+AYI++PVEGPYKP H
Sbjct  423  LWKEKATGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTSGQAAYINVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   464 bits (1193),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA +LKQAGARVIVTEIDPICALQA 
Sbjct  332  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCAISLKQAGARVIVTEIDPICALQAL  391

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLEDV+S+ADIFVTTTGNKDIIMV+ M++MKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  392  MEGFQVLTLEDVLSEADIFVTTTGNKDIIMVDQMKRMKNNAIVCNIGHFDNEIDMQGLEN  451

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+TK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  452  YPGVKRITIKPQTDRWVFPETKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  511

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKY K+VY+LPKHLDEKVAALHLGKLGA+LTKLT +QS YISIPVEGPYKP H
Sbjct  512  LWNERKSGKYGKEVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQSDYISIPVEGPYKPPH  571

Query  243  YRY  235
            YRY
Sbjct  572  YRY  574



>gb|ABJ53283.1| S-adenosyl-L-homocysteine hydrolase [Ligularia fischeri]
Length=327

 Score =   454 bits (1168),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+KQAGARV+VTEIDPICALQA 
Sbjct  85   GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKQAGARVVVTEIDPICALQAA  144

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  145  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVSDMKKMKNNAIVCNIGHFDNEIDMLGLET  204

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGV+RITIKPQTDR+VFP+TK GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  205  YPGVQRITIKPQTDRWVFPETKAGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  264

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKY+ +VY+LPKHLDEKVAALHLGKLGA+LT L+ +Q+ YI++PVEGPYKP +
Sbjct  265  LWNERKSGKYKNEVYVLPKHLDEKVAALHLGKLGAKLTVLSKDQADYINVPVEGPYKPLN  324

Query  243  YRY  235
            YRY
Sbjct  325  YRY  327



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   460 bits (1183),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCASALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVVS+ADIFVT TGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGIPVLTLEDVVSEADIFVTATGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKR TIKPQTDR+VFP+T +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRNTIKPQTDRWVFPETNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKY+K+VY+LPKHLDEKVA+LHLGKLGA LTKL+P+Q+ YI++P+EGPYKP  
Sbjct  423  LWKEKGTGKYQKQVYVLPKHLDEKVASLHLGKLGAHLTKLSPDQAEYINVPIEGPYKPPQ  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   460 bits (1183),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 232/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VVCGYGDVGKGCA ALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVCGYGDVGKGCALALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTLED+VS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLEDIVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEK +GKY+K+VY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P++GPYKP H
Sbjct  423  LWKEKGTGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIDGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   460 bits (1183),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 229/243 (94%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKV VV GYGDVGKGCA ALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVGVVAGYGDVGKGCAVALKQAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTL+DVVS ADIFVTTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLDDVVSYADIFVTTTGNKDIIMVDDMRKMKNNAIVCNIGHFDNEIDMSGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKR+TIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRVTIKPQTDRWVFPETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+  Q+ YIS+PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSQSQADYISVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   459 bits (1182),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVV GYGDVGKGCA+A+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVAGYGDVGKGCASAMKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGL+VLTLEDVVS ADIFVTTTGNKDIIMV+HM+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLEVLTLEDVVSVADIFVTTTGNKDIIMVDHMKKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFP+T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPETGTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ SGKYEKKVY+LPKHLDEKVAALHL KLGA+LTKL+ +Q+AYI++PVEGPYKPAH
Sbjct  423  LWNERKSGKYEKKVYVLPKHLDEKVAALHLPKLGAKLTKLSADQAAYINVPVEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   459 bits (1180),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/243 (88%), Positives = 230/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTL DVVS+ADIFVTTTGNKDIIMV+ MRKMKNNAIV NIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +P VKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPDVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPAH
Sbjct  423  LWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   459 bits (1180),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 215/243 (88%), Positives = 230/243 (95%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTL DVVS+ADIFVTTTGNKDIIMV+ MRKMKNNAIV NIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +P VKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPDVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPAH
Sbjct  423  LWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   458 bits (1179),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 231/243 (95%), Gaps = 1/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVA+V GYGDVGKGCAAA+KQAGARVIVTEIDPICALQAT
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVALVAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQAT  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL LEDVVS+ DIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLPLEDVVSEVDIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMHGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITI    DR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIS-SNDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  421

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+SSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +Q+ YIS+PVEGPYKPAH
Sbjct  422  LWNERSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKDQADYISVPVEGPYKPAH  481

Query  243  YRY  235
            YRY
Sbjct  482  YRY  484



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   456 bits (1174),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 213/243 (88%), Positives = 229/243 (94%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCA ALKQ GARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAFALKQGGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVLTL DVVS+ADIFVTTTGNKDIIMV+ MRKMKNNAIV NIGHFDNEIDM GLE+
Sbjct  303  MEGFQVLTLNDVVSEADIFVTTTGNKDIIMVSDMRKMKNNAIVSNIGHFDNEIDMNGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +P VKRITIKPQTDR+VFPDT +GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPDVKRITIKPQTDRWVFPDTNSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+P+EGPYKPAH
Sbjct  423  LWNERKTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPIEGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   447 bits (1150),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 226/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVL LED V  ADIF TTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM+GLE+
Sbjct  303  MEGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK SGKYEKKVY+LPKHLDEKVA LHL KLGARLTKL+ +Q++YI++PV GPYKPAH
Sbjct  423  LWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   447 bits (1149),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 226/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVL LED V  ADIF TTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM+GLE+
Sbjct  303  MEGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VFPDTK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EK SGKYEKKVY+LPKHLDEKVA LHL KLGARLTKL+ +Q++YI++PV GPYKPAH
Sbjct  423  LWNEKKSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSEDQASYINVPVGGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   445 bits (1145),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/243 (86%), Positives = 227/243 (93%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+ GYGDVGKGCA+A+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVIFGYGDVGKGCASAMKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG QVL LED V  ADIF TTTGNKDIIMV+ MRKMKNNAIVCNIGHFDNEIDM+GLE+
Sbjct  303  MEGYQVLRLEDCVEYADIFCTTTGNKDIIMVSDMRKMKNNAIVCNIGHFDNEIDMEGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK G+IILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKRGVIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW E++SGKYEKKVY+LPKHLDEKVA LHL KLGARLTKL+ +Q++YI++PV GPYKPAH
Sbjct  423  LWNERTSGKYEKKVYVLPKHLDEKVALLHLEKLGARLTKLSDDQASYINVPVGGPYKPAH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   442 bits (1136),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 210/243 (86%), Positives = 223/243 (92%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHS PDGLMRATDVMIAGKVAVVCGYGDVGKGCAAA+K  GARVIVTEIDP CALQA 
Sbjct  243  GCRHSSPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAAMKPGGARVIVTEIDPFCALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            ME  + LT   + SDADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEAFRFLTGGCLYSDADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLEN  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPGVKRITIKPQTDR+VF +T TGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGVKRITIKPQTDRWVFLETNTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGARLTKL+ +Q+ YIS+ VEGPYKP H
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGARLTKLSKDQADYISVAVEGPYKPTH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   437 bits (1125),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/243 (89%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLEDVV++ADIFVTTTGNKDIIMV HM++MKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDVVAEADIFVTTTGNKDIIMVCHMKQMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPG+KRITIKPQTDR+VFP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGIKRITIKPQTDRWVFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+ +GKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLTPEQ+AYIS+PVEGPYKP  
Sbjct  423  LWKERGTGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTPEQAAYISVPVEGPYKPPR  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   435 bits (1119),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 211/243 (87%), Positives = 233/243 (96%), Gaps = 0/243 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGK+AVVCGYGDVGKGCAAALK AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKIAVVCGYGDVGKGCAAALKAAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEG+ VLTLED+V++ADIFVTTTGNKDIIMV+HM++MKNNA+VCNIGHFDNEIDM GLE+
Sbjct  303  MEGIPVLTLEDMVAEADIFVTTTGNKDIIMVSHMKQMKNNAVVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            YPG+KRITIKPQTDR++FP+T  GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  YPGIKRITIKPQTDRWIFPETNRGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKE+ SGKYEKKVY+LPKHLDE V +LHLGKLGA+LTKLTP+Q+AYIS+PVEGPYKP H
Sbjct  423  LWKERGSGKYEKKVYVLPKHLDEMVGSLHLGKLGAKLTKLTPDQAAYISVPVEGPYKPPH  482

Query  243  YRY  235
            YRY
Sbjct  483  YRY  485



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   432 bits (1111),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/223 (92%), Positives = 217/223 (97%), Gaps = 0/223 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAM  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIFVTTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDMQGLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMQGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMS  FTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSYPFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPE  295
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKLGA+LTKLT +
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAKLTKLTKD  465



>gb|AAA33855.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=227

 Score =   422 bits (1085),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 202/227 (89%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -2

Query  915  MIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQATMEGLQVLTLEDVVSDA  736
            MIAGKVA++ GYGDVGKGCAAA+KQAGARVIVTEIDPICALQATMEGLQVL LEDVVS+ 
Sbjct  1    MIAGKVALIAGYGDVGKGCAAAMKQAGARVIVTEIDPICALQATMEGLQVLPLEDVVSEV  60

Query  735  DIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLESYPGVKRITIKPQTDRF  556
            DIFVTTTGNKDIIMV+ MRKMKNNAIV NIGHFDNEIDM GLE+YPGVKRITIKPQTDR+
Sbjct  61   DIFVTTTGNKDIIMVSDMRKMKNNAIVDNIGHFDNEIDMLGLETYPGVKRITIKPQTDRW  120

Query  555  VFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWKEKSSGKYEKKVYI  376
            VFPDT  GIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELW EKSSGKYEKKVY+
Sbjct  121  VFPDTGRGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYV  180

Query  375  LPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAHYRY  235
             PKHLDEKVAALHLGKLGA+LTKL+ +Q+ YIS+PVEGPYKPAHYRY
Sbjct  181  CPKHLDEKVAALHLGKLGAKLTKLSKDQADYISVPVEGPYKPAHYRY  227



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   421 bits (1082),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 202/243 (83%), Positives = 218/243 (90%), Gaps = 18/243 (7%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATD                  GCAAALKQAGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATD------------------GCAAALKQAGARVIVTEIDPICALQAL  284

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVL L+DVVS+ADIFVTTTGNKDIIMV+ M+KMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  285  MEGLQVLPLQDVVSEADIFVTTTGNKDIIMVHDMKKMKNNAIVCNIGHFDNEIDMHGLEN  344

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTK+GII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  345  FPGVKRITIKPQTDRWVFPDTKSGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  404

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKLGARLTKLTPEQSAYISIPVEGPYKPAH  244
            LWKEKSSGKY+K+VY+LPKHLDEKVAALHLGKLGA+LTKL+ EQ+ YIS+PVEGPYKP H
Sbjct  405  LWKEKSSGKYKKEVYVLPKHLDEKVAALHLGKLGAKLTKLSKEQADYISVPVEGPYKPPH  464

Query  243  YRY  235
            YRY
Sbjct  465  YRY  467



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   421 bits (1081),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = -2

Query  963  GCRHSLPDGLMRATDVMIAGKVAVVCGYGDVGKGCAAALKQAGARVIVTEIDPICALQAT  784
            GCRHSLPDGLMRATDVMIAGKVAV+CGYGDVGKGCAAA+K AGARVIVTEIDPICALQA 
Sbjct  243  GCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICALQAL  302

Query  783  MEGLQVLTLEDVVSDADIFVTTTGNKDIIMVNHMRKMKNNAIVCNIGHFDNEIDMQGLES  604
            MEGLQVLTLEDVVS+ADIF TTTGNKDIIMV+HMRKMKNNAIVCNIGHFDNEIDM GLE+
Sbjct  303  MEGLQVLTLEDVVSEADIFCTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLET  362

Query  603  YPGVKRITIKPQTDRFVFPDTKTGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  424
            +PGVKRITIKPQTDR+VFPDTKTGII+LAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE
Sbjct  363  FPGVKRITIKPQTDRWVFPDTKTGIIVLAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLE  422

Query  423  LWKEKSSGKYEKKVYILPKHLDEKVAALHLGKL  325
            LW EKSSGKYEKKVY+LPKHLDEKVAALHLGKL
Sbjct  423  LWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKL  455



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2084674577848