BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81501_g1_i1 len=710 path=[1:0-709]

Length=710
                                                                      Score     E

dbj|BAD07002.1|  hypothetical protein                                 89.0    7e-19   Ipomoea nil [qian niu]



>dbj|BAD07002.1| hypothetical protein [Ipomoea nil]
Length=98

 Score = 89.0 bits (219),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 73/81 (90%), Gaps = 4/81 (5%)
 Frame = +1

Query  169  LSRGCLDSQTQLFPTLQSCPRAASHRFLFPSLKGlplsldspptlplqldpppppHERIH  348
            LSRGCLDSQTQLFPTLQSCPRAASHRFLFPSLKGLPLSLDSPPTLPLQLDPPPPPHERIH
Sbjct  1    LSRGCLDSQTQLFPTLQSCPRAASHRFLFPSLKGLPLSLDSPPTLPLQLDPPPPPHERIH  60

Query  349  HFLHY----LAASALYFCQMV  399
            HFLHY    L+ S  ++C+ +
Sbjct  61   HFLHYLPPQLSTSVKWYCRSI  81


 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +2

Query  368  PPQLSTSVKWYCRSIADSLISSSMYHLVVWIA  463
            PPQLSTSVKWYCRSIADSLISSSMYHLVVWIA
Sbjct  67   PPQLSTSVKWYCRSIADSLISSSMYHLVVWIA  98



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1141669978128