BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8142_g2_i1 len=263 path=[1863:0-262]

Length=263
                                                                      Score     E

ref|XP_011092025.1|  PREDICTED: putative F-box protein PP2-B12        51.2    2e-05   
emb|CDP04245.1|  unnamed protein product                              51.2    2e-05   
ref|XP_010529881.1|  PREDICTED: putative F-box protein PP2-B12        50.1    3e-05   
emb|CBI38318.3|  unnamed protein product                              47.8    2e-04   
ref|XP_002270048.1|  PREDICTED: F-box protein PP2-B10                 47.8    3e-04   Vitis vinifera
emb|CDP04244.1|  unnamed protein product                              47.4    3e-04   
gb|EYU34847.1|  hypothetical protein MIMGU_mgv1a010720mg              47.0    4e-04   
ref|XP_009407172.1|  PREDICTED: putative F-box protein PP2-B12 is...  47.0    5e-04   
ref|XP_010241136.1|  PREDICTED: putative F-box protein PP2-B12 is...  46.2    7e-04   
ref|XP_009419887.1|  PREDICTED: putative F-box protein PP2-B12        46.2    9e-04   
ref|XP_002512468.1|  conserved hypothetical protein                   45.8    0.001   Ricinus communis



>ref|XP_011092025.1| PREDICTED: putative F-box protein PP2-B12 [Sesamum indicum]
Length=306

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 35/46 (76%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKDILVL-GIEIRP  136
            WMEVELGE F++ G + +  ++ISLKEV GG WK  L++ G+EIRP
Sbjct  259  WMEVELGEYFVKSGYDGE--LEISLKEVKGGNWKSGLIIQGVEIRP  302



>emb|CDP04245.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWK-DILVLGIEIRP  136
            WMEV+LGEIFI+GG  ED  ++++L EV GG WK  ++V GIE+RP
Sbjct  251  WMEVKLGEIFIKGG--EDVDMEMALTEVKGGNWKRGLIVQGIEVRP  294



>ref|XP_010529881.1| PREDICTED: putative F-box protein PP2-B12 [Tarenaya hassleriana]
Length=285

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 36/46 (78%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWK-DILVLGIEIRP  136
            W+EVELGE F++ G EE+  +++S+ E++GG WK  +L+ GIEIRP
Sbjct  239  WLEVELGEYFVKAGAEEE--LEMSILEISGGNWKGGLLIQGIEIRP  282



>emb|CBI38318.3| unnamed protein product [Vitis vinifera]
Length=287

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKD-ILVLGIEIRPN  139
            W E+ELGE FI GG  ED  ++I+L EV  G WKD ++V GIEIRP 
Sbjct  240  WFEIELGEFFIEGG--EDTELEITLMEVKAGHWKDGLIVEGIEIRPK  284



>ref|XP_002270048.1| PREDICTED: F-box protein PP2-B10 [Vitis vinifera]
Length=349

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 3/47 (6%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKD-ILVLGIEIRPN  139
            W E+ELGE FI GG  ED  ++I+L EV  G WKD ++V GIEIRP 
Sbjct  302  WFEIELGEFFIEGG--EDTELEITLMEVKAGHWKDGLIVEGIEIRPK  346



>emb|CDP04244.1| unnamed protein product [Coffea canephora]
Length=283

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 3/47 (6%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKD-ILVLGIEIRPN  139
            WMEVELGEIFI+ G + D  +++SL EV GG WK  ++V GIEIRP 
Sbjct  236  WMEVELGEIFIKEGQDVD--LEMSLMEVKGGNWKSGLIVEGIEIRPK  280



>gb|EYU34847.1| hypothetical protein MIMGU_mgv1a010720mg [Erythranthe guttata]
Length=304

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKDILVL-GIEIRP  136
            WMEVELGE F++ G + D  + +SL EV GG WK  L++ G EIRP
Sbjct  255  WMEVELGEYFVKEGQDCD--LKVSLMEVNGGNWKSGLIIQGFEIRP  298



>ref|XP_009407172.1| PREDICTED: putative F-box protein PP2-B12 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=291

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKDILVL-GIEIRP  136
            WME ELGE++I  G  ED  V++SL EV GG WK  L++ GIEIRP
Sbjct  246  WMEAELGELYIDEG--EDGEVEMSLMEVRGGHWKKGLIIQGIEIRP  289



>ref|XP_010241136.1| PREDICTED: putative F-box protein PP2-B12 isoform X2 [Nelumbo 
nucifera]
Length=262

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKD-ILVLGIEIRP  136
            WME+++GE F   G  ED  V++SL EV GG WK  I++ GIE+RP
Sbjct  215  WMEIQMGEFF--NGPGEDGEVEMSLMEVKGGHWKSGIIIQGIELRP  258



>ref|XP_009419887.1| PREDICTED: putative F-box protein PP2-B12 [Musa acuminata subsp. 
malaccensis]
Length=301

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKDILVL-GIEIRP  136
            WME+ELGE +I  G  +D  V+ISL E+ GG WK  L++ GIEIRP
Sbjct  254  WMELELGEFYIDEG--DDGEVNISLLEMKGGDWKKGLIIEGIEIRP  297



>ref|XP_002512468.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49920.1| conserved hypothetical protein [Ricinus communis]
Length=283

 Score = 45.8 bits (107),  Expect = 0.001, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 3/46 (7%)
 Frame = +2

Query  2    WMEVELGEIFIRGGVEEDEWVDISLKEVTGGLWKDILVL-GIEIRP  136
            W+E+ELGE F+ G  E DE V +SLKEV G   K  L++ GIE+RP
Sbjct  234  WLEIELGEFFVNG--ESDEEVKMSLKEVKGQHLKGGLIIEGIEVRP  277



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523274929020