BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81428_g1_i1 len=330 path=[308:0-329]

Length=330
                                                                      Score     E

ref|XP_009767974.1|  PREDICTED: probable serine/threonine-protein...  81.6    2e-15   
ref|XP_009613901.1|  PREDICTED: probable serine/threonine-protein...  79.7    9e-15   
ref|XP_010319415.1|  PREDICTED: probable serine/threonine-protein...  68.9    4e-11   
ref|XP_006360468.1|  PREDICTED: uncharacterized protein LOC102598998  65.9    7e-11   
ref|XP_009600763.1|  PREDICTED: probable serine/threonine-protein...  68.2    7e-11   
ref|XP_009600762.1|  PREDICTED: probable serine/threonine-protein...  67.8    1e-10   
ref|XP_009600760.1|  PREDICTED: probable serine/threonine-protein...  67.8    1e-10   
ref|XP_009782267.1|  PREDICTED: probable receptor-like protein ki...  66.6    3e-10   
ref|XP_006360444.1|  PREDICTED: probable serine/threonine-protein...  66.2    4e-10   
ref|XP_009600761.1|  PREDICTED: probable serine/threonine-protein...  65.9    5e-10   
ref|XP_006360460.1|  PREDICTED: probable receptor-like protein ki...  63.2    4e-09   
ref|XP_011076449.1|  PREDICTED: probable receptor-like protein ki...  63.2    4e-09   
ref|XP_009621565.1|  PREDICTED: uncharacterized protein LOC104113163  61.6    6e-09   
ref|XP_009759505.1|  PREDICTED: probable serine/threonine-protein...  62.4    6e-09   
ref|XP_009759502.1|  PREDICTED: probable serine/threonine-protein...  62.4    9e-09   
gb|EYU40782.1|  hypothetical protein MIMGU_mgv1a020244mg              62.0    1e-08   
ref|XP_009759504.1|  PREDICTED: probable serine/threonine-protein...  62.0    1e-08   
ref|XP_011076378.1|  PREDICTED: probable serine/threonine-protein...  61.6    1e-08   
gb|EYU40786.1|  hypothetical protein MIMGU_mgv11b002117mg             60.8    3e-08   
ref|XP_009759501.1|  PREDICTED: probable serine/threonine-protein...  58.5    3e-08   
ref|XP_010320750.1|  PREDICTED: probable serine/threonine-protein...  58.9    1e-07   
ref|XP_004239409.1|  PREDICTED: probable serine/threonine-protein...  58.2    2e-07   
ref|XP_009759508.1|  PREDICTED: probable serine/threonine-protein...  58.2    3e-07   
ref|XP_006344303.1|  PREDICTED: probable receptor-like protein ki...  56.6    8e-07   
ref|XP_009767030.1|  PREDICTED: G-type lectin S-receptor-like ser...  56.2    1e-06   
ref|XP_004239411.2|  PREDICTED: uncharacterized protein LOC101243709  56.6    1e-06   
ref|XP_009600764.1|  PREDICTED: probable serine/threonine-protein...  55.8    1e-06   
ref|XP_006344296.1|  PREDICTED: probable serine/threonine-protein...  55.8    1e-06   
ref|XP_009759506.1|  PREDICTED: probable serine/threonine-protein...  55.5    2e-06   
gb|ABP96804.1|  receptor-like protein kinase                          55.5    2e-06   Capsicum annuum
ref|XP_006344313.1|  PREDICTED: uncharacterized protein LOC102581608  53.9    2e-06   
ref|XP_009621096.1|  PREDICTED: probable receptor-like protein ki...  55.1    2e-06   
ref|XP_004239410.1|  PREDICTED: probable serine/threonine-protein...  55.1    2e-06   
ref|XP_009759507.1|  PREDICTED: probable serine/threonine-protein...  54.7    3e-06   
ref|XP_009767029.1|  PREDICTED: probable receptor-like protein ki...  54.7    4e-06   
ref|XP_009775398.1|  PREDICTED: probable serine/threonine-protein...  53.9    7e-06   
ref|XP_006344161.1|  PREDICTED: probable serine/threonine-protein...  53.5    7e-06   
ref|XP_009600759.1|  PREDICTED: probable serine/threonine-protein...  53.1    1e-05   
ref|XP_009600768.1|  PREDICTED: probable serine/threonine-protein...  52.8    2e-05   
ref|XP_006344162.1|  PREDICTED: probable serine/threonine-protein...  52.4    2e-05   
ref|XP_009801718.1|  PREDICTED: probable serine/threonine-protein...  52.4    2e-05   
ref|XP_009600758.1|  PREDICTED: probable serine/threonine-protein...  52.4    2e-05   
ref|XP_009588466.1|  PREDICTED: probable receptor-like protein ki...  52.4    2e-05   
ref|XP_009767031.1|  PREDICTED: probable receptor-like protein ki...  52.0    2e-05   
ref|XP_009588465.1|  PREDICTED: probable receptor-like protein ki...  52.0    2e-05   
ref|XP_009600756.1|  PREDICTED: probable serine/threonine-protein...  51.6    3e-05   
ref|XP_006344312.1|  PREDICTED: probable serine/threonine-protein...  51.6    3e-05   
ref|XP_006367985.1|  PREDICTED: uncharacterized protein LOC102606311  49.7    4e-05   
ref|XP_004238904.1|  PREDICTED: probable serine/threonine-protein...  50.8    6e-05   
ref|XP_009775396.1|  PREDICTED: probable serine/threonine-protein...  50.4    8e-05   
ref|XP_006344309.1|  PREDICTED: probable receptor-like protein ki...  50.4    9e-05   
gb|EYU40784.1|  hypothetical protein MIMGU_mgv1a0215071mg             48.5    1e-04   
ref|XP_010320749.1|  PREDICTED: probable serine/threonine-protein...  49.7    2e-04   
ref|XP_004238902.1|  PREDICTED: probable serine/threonine-protein...  49.3    2e-04   
ref|XP_009613694.1|  PREDICTED: probable receptor-like protein ki...  49.3    2e-04   
ref|XP_009600757.1|  PREDICTED: probable serine/threonine-protein...  48.9    2e-04   
ref|XP_009600755.1|  PREDICTED: probable serine/threonine-protein...  48.9    3e-04   
ref|XP_009775397.1|  PREDICTED: probable serine/threonine-protein...  48.5    4e-04   
ref|XP_009775395.1|  PREDICTED: probable serine/threonine-protein...  48.1    5e-04   
ref|XP_009613695.1|  PREDICTED: probable receptor-like protein ki...  47.8    5e-04   
ref|XP_003535924.2|  PREDICTED: probable receptor-like protein ki...  47.4    8e-04   



>ref|XP_009767974.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=662

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 62/103 (60%), Gaps = 6/103 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFN--TSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +CS IQLP KW     T N  LF  L+ +F + W++++ C  C+Y+GGRCL D+ NNF C
Sbjct  187  NCSLIQLPIKWRSQQLTQNSSLFDLLTANFTIQWSLSDDCSKCYYQGGRCLADSNNNFLC  246

Query  152  S---KGKHKQKMIRIAVVGSIIAFI-SISLAVVVCVIRHGKKG  36
            S   K + K K I + V+ ++I  I SI L++ +   + GK G
Sbjct  247  SQNPKARRKSKRILVIVLSAVIGLILSICLSIFIWRFKKGKGG  289



>ref|XP_009613901.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=660

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = -2

Query  326  DCSPIQLPFKWHFN-TSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            +CS IQLP KW    T    LF  L+ +F + W +++ C  C+Y+GGRCL D+ NNF CS
Sbjct  186  NCSVIQLPIKWRSQLTQTSSLFDLLTANFTIQWRLSDDCSKCYYQGGRCLADSNNNFLCS  245

Query  149  ---KGKHKQKMIRIAVVGSIIAFI-SISLAVVVCVIRHGKKG  36
               K + K K I + V+ ++I  I SI L++ +   + GK G
Sbjct  246  PNPKARRKSKRILVVVLSAVIGLILSICLSIFIWRFKKGKGG  287



>ref|XP_010319415.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=663

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 6/102 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWH---FNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQ  156
            +CSPI+LP +W+    N  N  LF  L+ +F + W++++ C  C+Y+GGRCL D+ N F 
Sbjct  185  NCSPIRLPIRWNTSRLNDQNSGLFDLLTANFVIQWSLSDDCSKCYYQGGRCLTDSSNRFH  244

Query  155  CSKGKHKQKMIRIAVVGSI--IAFISISLAVVVCVIRHGKKG  36
            CS+   K + + I V+  +  + F+ I L +V+   + GK G
Sbjct  245  CSRVTRKSRRVLIVVLPVVIGLTFL-ICLGIVIWRFKKGKGG  285



>ref|XP_006360468.1| PREDICTED: uncharacterized protein LOC102598998 [Solanum tuberosum]
Length=246

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  323  CSPIQLPFKWHF---NTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            CSPIQLP +W+    N SN  LF  L+ +F + W++++ C  C+Y GGRCL D+ N F C
Sbjct  174  CSPIQLPIRWNTSQSNASNSSLFDLLTGNFSIQWSLSDDCSKCYYGGGRCLTDSSNRFIC  233

Query  152  SKGKHKQK  129
            S      K
Sbjct  234  STSSTDPK  241



>ref|XP_009600763.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X4 [Nicotiana tomentosiformis]
Length=506

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CSPI+LP   H  + + DLF  L P F + W +++ C  CHY GG+C  D  NNF C K
Sbjct  35   NCSPIRLPL--HSVSRDGDLFDLLGPKFLVEWELSDYCYQCHYSGGQCQTDITNNFCCHK  92

Query  146  GKHKQKMIRIAVVGSIIAFI--SISLAVVVCVI  54
                 K  R +++G I+A +   + LA++ C++
Sbjct  93   ---DGKTTRRSMMGLILAAVLGGVGLAMITCLV  122



>ref|XP_009600762.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana tomentosiformis]
Length=588

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CSPI+LP   H  + + DLF  L P F + W +++ C  CHY GG+C  D  NNF C K
Sbjct  117  NCSPIRLPL--HSVSRDGDLFDLLGPKFLVEWELSDYCYQCHYSGGQCQTDITNNFCCHK  174

Query  146  GKHKQKMIRIAVVGSIIAFI--SISLAVVVCVI  54
                 K  R +++G I+A +   + LA++ C++
Sbjct  175  ---DGKTTRRSMMGLILAAVLGGVGLAMITCLV  204



>ref|XP_009600760.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana tomentosiformis]
Length=643

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CSPI+LP   H  + + DLF  L P F + W +++ C  CHY GG+C  D  NNF C K
Sbjct  172  NCSPIRLPL--HSVSRDGDLFDLLGPKFLVEWELSDYCYQCHYSGGQCQTDITNNFCCHK  229

Query  146  GKHKQKMIRIAVVGSIIAFI--SISLAVVVCVI  54
                 K  R +++G I+A +   + LA++ C++
Sbjct  230  ---DGKTTRRSMMGLILAAVLGGVGLAMITCLV  259



>ref|XP_009782267.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=516

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFN--TSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +CS IQLP KW     T N  LF  L+ +F + W++++ C  C+ +GGRCL D+ NNF C
Sbjct  69   NCSLIQLPIKWRSQQLTQNSSLFDLLTANFTIQWSLSDDCSKCYNQGGRCLTDSNNNFLC  128

Query  152  S---KGKHKQKMIRIAVVGS  102
            S   K K K K I  A   S
Sbjct  129  SSNPKVKRKSKRILAAATAS  148



>ref|XP_006360444.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=666

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 41/69 (59%), Gaps = 3/69 (4%)
 Frame = -2

Query  326  DCSPIQLPFKWHF---NTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQ  156
            +CSPIQLP  W+    N  N  LF  L+ +F + W+++  C  CHY+GGRCL D+ N F 
Sbjct  188  NCSPIQLPITWNTSQPNDQNSSLFDLLTVNFVIEWSLSVDCSKCHYQGGRCLTDSNNRFH  247

Query  155  CSKGKHKQK  129
            CS    K +
Sbjct  248  CSTVTRKSR  256



>ref|XP_009600761.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana tomentosiformis]
Length=638

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 52/91 (57%), Gaps = 8/91 (9%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CSPI+LP   H  + + DLF  L P F + W +++ C  CHY GG+C  D  NNF C K
Sbjct  172  NCSPIRLPL--HSVSRDGDLFDLLGPKFLVEWELSDYCYQCHYSGGQCQTDITNNFCCHK  229

Query  146  GKHKQKMIRIAVVGSIIAFISISLAVVVCVI  54
                 K  R +++G I+A     LA++ C++
Sbjct  230  ---DGKTTRRSMMGLILA---AGLAMITCLV  254



>ref|XP_006360460.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=539

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 49/85 (58%), Gaps = 5/85 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNT--SNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +CS IQLP  W   +   N  LF  L+ ++ + W++++ C +C+Y GG+CL D+ N F C
Sbjct  189  NCSMIQLPITWKSPSKGQNSSLFDLLTANYSIQWSLSDDCSNCYYGGGQCLTDSNNKFLC  248

Query  152  S---KGKHKQKMIRIAVVGSIIAFI  87
            S   K   K+K  RI V  ++ + I
Sbjct  249  STTPKAAAKRKSKRILVAAAVTSSI  273



>ref|XP_011076449.1| PREDICTED: probable receptor-like protein kinase At5g39020 [Sesamum 
indicum]
Length=574

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSKG  144
            C   QLP   H N+S  +L   LS  F + WNV+E+C +CH+ GG+CL +  N F+C + 
Sbjct  133  CQFFQLPMNPHNNSS--ELLEMLSTEFTVEWNVSETCYECHHGGGQCLTNALNEFECRQP  190

Query  143  KHKQKMIRIAVVGSIIAFISISLAVVVCVIRHGK  42
             ++ K   I ++G +I  +  S+ ++V + R  K
Sbjct  191  GNR-KFKTILLIGGVILTVIGSIILLVFLGRKHK  223



>ref|XP_009621565.1| PREDICTED: uncharacterized protein LOC104113163 [Nicotiana tomentosiformis]
Length=339

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFN-TSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            +CS IQLP KW         LF  L+ +F + W++++ C  C+Y+GGRCL D+ NNF CS
Sbjct  255  NCSVIQLPIKWRSQLPQTSSLFDLLTANFTIQWSLSDDCSKCYYQGGRCLADSNNNFLCS  314

Query  149  ---KGK  141
               KGK
Sbjct  315  PNPKGK  320



>ref|XP_009759505.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana sylvestris]
Length=502

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 8/101 (8%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP   H  +S+ DLF  L P   + W +++ C  CHY GG+C  D  NNF C K
Sbjct  31   NCSLIRLPI--HSLSSDGDLFHLLGPEVLVEWELSDDCYQCHYSGGQCQTDITNNFCCHK  88

Query  146  GKHKQK-----MIRIAVVGSIIAFISISLAVVVCVIRHGKK  39
              +  +     +I  AV G  +  + I+  VV  ++R+ K+
Sbjct  89   DANTTRRSMMGLILAAVFGG-VGLVMITCLVVYLILRYKKR  128



>ref|XP_009759502.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009759503.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
Length=657

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 8/101 (8%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP   H  +S+ DLF  L P   + W +++ C  CHY GG+C  D  NNF C K
Sbjct  186  NCSLIRLPI--HSLSSDGDLFHLLGPEVLVEWELSDDCYQCHYSGGQCQTDITNNFCCHK  243

Query  146  GKHKQK-----MIRIAVVGSIIAFISISLAVVVCVIRHGKK  39
              +  +     +I  AV G  +  + I+  VV  ++R+ K+
Sbjct  244  DANTTRRSMMGLILAAVFGG-VGLVMITCLVVYLILRYKKR  283



>gb|EYU40782.1| hypothetical protein MIMGU_mgv1a020244mg [Erythranthe guttata]
Length=576

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN-EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            DC  IQLP K +++ S+ E++F  L+  + L WNV+E+C +CH  GG+CL +N   F+C 
Sbjct  168  DCQVIQLPVKPNYDQSSLENVFGLLTSEYILEWNVSENCSECHRGGGQCLTNNIGEFECK  227

Query  149  KGKHKQ  132
                K 
Sbjct  228  SADEKD  233



>ref|XP_009759504.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana sylvestris]
Length=652

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 55/98 (56%), Gaps = 7/98 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP   H  +S+ DLF  L P   + W +++ C  CHY GG+C  D  NNF C K
Sbjct  186  NCSLIRLPI--HSLSSDGDLFHLLGPEVLVEWELSDDCYQCHYSGGQCQTDITNNFCCHK  243

Query  146  GKHKQKMIRIAVVGSIIA--FISISLAVVVCVIRHGKK  39
              +     R +++G I+A   + I+  VV  ++R+ K+
Sbjct  244  DANTT---RRSMMGLILAAGLVMITCLVVYLILRYKKR  278



>ref|XP_011076378.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Sesamum indicum]
Length=644

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 3/101 (3%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSKG  144
            C    LP   + N+S  +L   L+  F + WN++ESC +CH+ GG+CL +  N F+C K 
Sbjct  168  CRLSHLPMNPNKNSS--ELLEMLTAEFTVEWNISESCNECHHGGGQCLTNTLNGFECKKE  225

Query  143  KHKQKMIRIAVVGSIIAFISISLAVVVCVIRHGKKGELRGY  21
            + +  +I +  + S + F  +   +V  +I   KK   RGY
Sbjct  226  RSRLTLILVTTL-SGVGFFLVVCVLVTYIIWQRKKIISRGY  265



>gb|EYU40786.1| hypothetical protein MIMGU_mgv11b002117mg [Erythranthe guttata]
Length=653

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 58/97 (60%), Gaps = 3/97 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNT-SNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            DC  IQLP K +++  S  ++F  L+  + L WNV+E+C +CH  GG+CL ++   F+C 
Sbjct  168  DCQVIQLPVKSNYDQYSPGNVFDMLTNEYILEWNVSENCSECHQGGGQCLSNSMGLFECK  227

Query  149  KGKHKQKMIRIAVVGSIIAFISISLAVVVCVIRHGKK  39
            K + +  ++ +++ G ++  I + L VV  ++   KK
Sbjct  228  KDRSRTLILALSIGGGVL--ILLCLFVVSFIMWQRKK  262



>ref|XP_009759501.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=233

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTS--NEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            CS IQLP      +     DLF  L+ +  L W ++  C  C  KGG+CL+   + F CS
Sbjct  41   CSIIQLPIPLPTPSKLYASDLFELLTSNILLEWELSNDCHHCLEKGGKCLIGREHKFHCS  100

Query  149  KGKHKQKMIR--IAVVGSIIAFISISLAVVVCVIRHGKK  39
            KGK ++  +R  +A V S +  I +S  V++ + R  ++
Sbjct  101  KGKKEKSKLRMILAAVFSGVGLILVSSIVILSIWRRKRR  139



>ref|XP_010320750.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Solanum lycopersicum]
Length=661

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN--EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +CS I+LP K+   +     DLF  LS +F L W V++ C  C Y+ G+C  D++NNF C
Sbjct  182  NCSIIRLPLKYISPSVPVPSDLFELLSSNFTLDWEVSKDCSKCSYREGQCQNDSKNNFFC  241

Query  152  SKGKHKQKMIRIAVVGSI  99
            SK K    +I  +V+G +
Sbjct  242  SKAKKNLGLILGSVLGGL  259



>ref|XP_004239409.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=631

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP+ +     +++L   LS  F + W +++ C +C+Y GGRC  D +NNF C K
Sbjct  178  NCSLIRLPY-YQIEPGDDNLVNFLSSVFLVEWKLSDDCNECYYGGGRCQTDKKNNFLCYK  236

Query  146  G-KHKQKMIRIAVVGSIIAFIS-ISLAVVVCVIR  51
              + K  +I   V G ++  I+ +++ ++ C  R
Sbjct  237  ANRSKLGLILGTVFGGVLVMITCLAVYLIWCYKR  270



>ref|XP_009759508.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=888

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 52/99 (53%), Gaps = 4/99 (4%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTS--NEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            CS IQLP      +     DLF  L+ +  L W ++  C  C  KGG+CL+   + F CS
Sbjct  588  CSIIQLPIPLPTPSKLYASDLFELLTSNILLEWELSNDCHHCLEKGGKCLIGREHKFHCS  647

Query  149  KGKHKQKMIR--IAVVGSIIAFISISLAVVVCVIRHGKK  39
            KGK ++  +R  +A V S +  I +S  V++ + R  ++
Sbjct  648  KGKKEKSKLRMILAAVFSGVGLILVSSIVILSIWRRKRR  686



>ref|XP_006344303.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=629

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 52/98 (53%), Gaps = 8/98 (8%)
 Frame = -2

Query  323  CSPIQLPF--KWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            CS I LP    +   ++N +LF  L+    L W V+ +C  C+  GGRC VD+ N F CS
Sbjct  171  CSMIHLPMVSGYESKSNNSNLFDMLAADVTLGWTVSNTCNHCYSSGGRCQVDSNNKFLCS  230

Query  149  -----KGKHKQKMIRIAVVGSIIAFISISLAVVVCVIR  51
                 KGKH ++ I I V+ ++  F  I + +++   R
Sbjct  231  VTDQGKGKHLRR-IWIIVLATVAVFGCIGILILLFCFR  267



>ref|XP_009767030.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At2g19130 isoform X1 [Nicotiana sylvestris]
Length=659

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 34/62 (55%), Gaps = 2/62 (3%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSKG  144
            CS ++LP     N  N  +F  LSP F + W +++ C  CHY GG+C  D  N F C  G
Sbjct  186  CSLVRLPIVSVSNNGN--VFTMLSPEFQVEWKLSDECYGCHYSGGQCQTDITNKFLCHTG  243

Query  143  KH  138
            +H
Sbjct  244  RH  245



>ref|XP_004239411.2| PREDICTED: uncharacterized protein LOC101243709 [Solanum lycopersicum]
Length=1361

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 50/98 (51%), Gaps = 7/98 (7%)
 Frame = -2

Query  323  CSPIQLPF--KWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            CS I LP    +   ++N +LF  L+    L W+V+ +C  C+  GGRC VD+ N F CS
Sbjct  171  CSMIHLPMVSDYKSKSNNSNLFDMLAADVSLGWSVSRTCNQCYSSGGRCQVDSNNKFVCS  230

Query  149  -----KGKHKQKMIRIAVVGSIIAFISISLAVVVCVIR  51
                 KGKH  +   I V+ ++     I + +++   R
Sbjct  231  VSDQGKGKHHLRRPWIVVLATVAVLGCIGILILLFCFR  268



>ref|XP_009600764.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=657

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 6/102 (6%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTS--NEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            CS IQLP      +     DLF  LS +  L W ++  C  C  KGG+CL+   + F CS
Sbjct  180  CSIIQLPIPLPTPSKPYASDLFELLSSNILLEWELSNDCHHCLDKGGKCLIGRDHKFHCS  239

Query  149  KGKHKQKMIRIAVVGSII--AFISISLAVVVCVIR--HGKKG  36
            KGK ++  +R+ +    I    I +S  V++ + R   GK G
Sbjct  240  KGKKEKSKLRMILAAVFIGVGLILVSSIVILSIWRRKRGKSG  281



>ref|XP_006344296.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=661

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 56/123 (46%), Gaps = 22/123 (18%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP +    +S+ DLF  L P   + W ++E C +CHY GG+C  D  N F C K
Sbjct  183  NCSLIRLPIQ----SSHGDLFDILGPEILVEWKLSEECNECHYSGGQCQTDKTNKFSCHK  238

Query  146  ----------------GKHKQKMIRIAVVGSIIAFISISLAVVVCVIRHGKKGELRGYSH  15
                            G++    I   V G + + +  SLAV   VI   KK +      
Sbjct  239  DAKPPTGSTDQRKETTGRNMVGQILGTVFGGVGSVMITSLAVY--VIWRYKKRKFSSSHF  296

Query  14   FST  6
            FST
Sbjct  297  FST  299



>ref|XP_009759506.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
Length=668

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 54/110 (49%), Gaps = 17/110 (15%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC--  153
            +CS I+LPF  H  + + DLF  L P   + W ++E C  CHY GG+C  D  N F C  
Sbjct  185  NCSLIRLPF--HSVSGDGDLFDLLGPEIHVEWKLSEDCSRCHYGGGQCQTDKTNRFYCHE  242

Query  152  -------SKGKHKQKMIRIAV---VGSI---IAFISISLAVVVCVIRHGK  42
                   S  + K+   R  V   +G++   +  + I+ AVV  + R+ K
Sbjct  243  DTNTTRGSTDQRKESTRRNTVELILGTVFGGVGSVMITCAVVYFIWRYKK  292



>gb|ABP96804.1| receptor-like protein kinase [Capsicum annuum]
Length=627

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP     + ++ DLF RL P F + W +++ C +CH+ GGRC  D  N F C K
Sbjct  175  NCSLIKLPI----HKNDGDLFNRLGPEFLVEWKLSDDCSECHHYGGRCQTDKTNKFYCLK  230



>ref|XP_006344313.1| PREDICTED: uncharacterized protein LOC102581608 [Solanum tuberosum]
Length=262

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 4/68 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTS---NEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQ  156
            +CS I+LP K+   TS     DLF  LS +F L W V++ C  C Y+ G+C  D++NNF 
Sbjct  187  NCSIIRLPLKY-IPTSVPVPSDLFELLSSNFTLDWEVSKDCSKCFYREGQCQSDSKNNFF  245

Query  155  CSKGKHKQ  132
            CSK   K 
Sbjct  246  CSKAAKKN  253



>ref|XP_009621096.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
tomentosiformis]
Length=651

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (49%), Gaps = 12/103 (12%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC--  153
            +CS I+LPF    N  + DLF  L P F + W +++ C  CHY GG+C  D  N F C  
Sbjct  187  NCSLIKLPFDKLSN--DGDLFNLLGPEFLVEWKLSDDCYQCHYSGGQCQTDITNKFLCHT  244

Query  152  ------SKGKHKQKMIRIA--VVGSIIAFISISLAVVVCVIRH  48
                  + G  K+  +R +  +V +   F  I L V++   R 
Sbjct  245  DVSNITAAGTSKRGHLRTSWFIVATGTFFSCIGLLVLLFYFRE  287



>ref|XP_004239410.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Solanum lycopersicum]
Length=662

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 5/80 (6%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN--EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +CS I+LP K+   +     DLF  LS +F L W V++ C  C Y+ G+C  D++NNF C
Sbjct  182  NCSIIRLPLKYISPSVPVPSDLFELLSSNFTLDWEVSKDCSKCSYREGQCQNDSKNNFFC  241

Query  152  SKGKHKQKMIRIAVVGSIIA  93
            SK   K   +   ++GS++ 
Sbjct  242  SKAAKKNLGL---ILGSVLG  258



>ref|XP_009759507.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana sylvestris]
Length=663

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 12/105 (11%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC--  153
            +CS I+LPF  H  + + DLF  L P   + W ++E C  CHY GG+C  D  N F C  
Sbjct  185  NCSLIRLPF--HSVSGDGDLFDLLGPEIHVEWKLSEDCSRCHYGGGQCQTDKTNRFYCHE  242

Query  152  ----SKGKHKQKM--IRIAVVGSIIAF--ISISLAVVVCVIRHGK  42
                ++G   Q+    R   V  I+    + I+ AVV  + R+ K
Sbjct  243  DTNTTRGSTDQRKESTRRNTVELILGTGSVMITCAVVYFIWRYKK  287



>ref|XP_009767029.1| PREDICTED: probable receptor-like protein kinase At1g67000 [Nicotiana 
sylvestris]
Length=647

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 43/86 (50%), Gaps = 14/86 (16%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC--  153
            +CS I+LPF+    + + DLF  L P   + W ++E C  CHY GG+C  D  N F C  
Sbjct  184  NCSLIRLPFR--SVSGDGDLFDLLGPEIQVEWKLSEDCNRCHYGGGQCQTDTTNKFYCQD  241

Query  152  ----------SKGKHKQKMIRIAVVG  105
                      SK  H++++  I + G
Sbjct  242  DLSILTTTGTSKTGHRRRIWLILITG  267



>ref|XP_009775398.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=657

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 4/93 (4%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNED--LFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNN-FQC  153
            CS I+LP   +  + +E   LF  L+    L W V++ C  C+Y+GGRC  D   N F C
Sbjct  176  CSFIRLPVPSNSESKSEKNGLFGMLTDEVVLGWTVSDECNRCYYRGGRCQTDETTNKFHC  235

Query  152  SKGKHKQKMIRIAVVGSIIAFISISLAVVVCVI  54
               K  +K+  I  V + I  +   L  + CVI
Sbjct  236  YNTKGNKKVKVIVAVSAFIGLL-FGLCTIACVI  267



>ref|XP_006344161.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=524

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 47/97 (48%), Gaps = 14/97 (14%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS-  150
            +CS I+LP   H  + + DLF  LS  F + W ++E C  CHY GG+C  D  N F C+ 
Sbjct  39   NCSLIRLP--THSRSDDGDLFNMLSAGFLVEWKLSEDCNKCHYGGGQCQTDITNKFHCAY  96

Query  149  ----------KGKHKQKMIRIAVVGSIIAFISISLAV  69
                        K K ++   AV G  +  + I LAV
Sbjct  97   PNNQHDQDAKMAKRKFRLTLGAVFGG-LGLVMICLAV  132



>ref|XP_009600759.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana tomentosiformis]
Length=655

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 50/104 (48%), Gaps = 15/104 (14%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP        + D+F  LSP+F + W +++ C  CHY GG+C  D    F C+ 
Sbjct  182  NCSLIRLPVNSM--PDDGDVFKMLSPAFRVEWKLSDECYQCHYGGGQCQTDKTKKFHCTN  239

Query  146  --GKHKQ-------KMIRIAVVGSIIAFISISLAVVVCVIRHGK  42
                H Q       K+ R    GS++    I+  VV  + R+ K
Sbjct  240  QYNPHAQGAKTTRSKLRRTLGAGSVM----ITCVVVYFIWRYKK  279



>ref|XP_009600768.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana tomentosiformis]
Length=608

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 42/91 (46%), Gaps = 2/91 (2%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRN-NFQCSK  147
            CS +QLP        + DLF  L+    L W V++ C  C+Y+GG+C  DN    F C  
Sbjct  129  CSFVQLPKSSSSEAESNDLFDLLTDEVTLGWTVSDECNQCYYRGGKCQTDNTTKTFLCYN  188

Query  146  GKHKQKMIRIAVVGSIIAFISISLAVVVCVI  54
             K   K+  I  V + I  +   L  +  VI
Sbjct  189  TKGNTKVKVIVAVSAFIGLL-FGLCTIASVI  218



>ref|XP_006344162.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
isoform X1 [Solanum tuberosum]
Length=642

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 6/85 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP+  +      +L   L  +F + W +++ C  CHY GGRC  D +NNF C K
Sbjct  185  NCSLIRLPY--YQTEPGNNLVNFLRSAFLVEWKLSDDCNKCHYGGGRCQTDKKNNFLCYK  242

Query  146  ----GKHKQKMIRIAVVGSIIAFIS  84
                 + K  +   AV G ++  I+
Sbjct  243  DAKANRSKLGLTLGAVFGGVLVMIT  267



>ref|XP_009801718.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Nicotiana sylvestris]
Length=657

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 8/99 (8%)
 Frame = -2

Query  317  PIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSKGKH  138
            PI LP       SN  LF  L+ +  L W +++ C  C  KGG+CL+   + F CSKGK 
Sbjct  186  PIPLPTPSKPYASN--LFELLTSNILLEWELSKDCHHCLDKGGKCLIGREHKFHCSKGKR  243

Query  137  ---KQKMIRIAVVGSIIAFISISLAVVVCVIR--HGKKG  36
               K +M+  AV G  +  I +S  +++ + R   G+ G
Sbjct  244  GKSKLRMLLAAVFGG-VGLILVSSIIILSIWRRKRGRNG  281



>ref|XP_009600758.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana tomentosiformis]
Length=660

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 48/96 (50%), Gaps = 7/96 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP        + D+F  LSP+F + W +++ C  CHY GG+C  D    F C+ 
Sbjct  182  NCSLIRLPVNSM--PDDGDVFKMLSPAFRVEWKLSDECYQCHYGGGQCQTDKTKKFHCTN  239

Query  146  --GKHKQ--KMIRIAVVGSIIA-FISISLAVVVCVI  54
                H Q  K  R  +  ++ A F  +   ++ CV+
Sbjct  240  QYNPHAQGAKTTRSKLRRTLGAVFGGVGSVMITCVV  275



>ref|XP_009588466.1| PREDICTED: probable receptor-like protein kinase At5g39020 isoform 
X2 [Nicotiana tomentosiformis]
Length=576

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            +CS I+LP   +    + D+F  LSP+F + W +++ C  CHY GG+C  D    F C+
Sbjct  127  NCSLIRLPV--NSMPDDGDVFKMLSPAFRVEWKLSDECYQCHYGGGQCQTDKTKKFHCT  183



>ref|XP_009767031.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana sylvestris]
Length=652

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 12/102 (12%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC---  153
            CS ++LP     N  N  +F  LSP F + W +++ C  CHY GG+C  D  N F C   
Sbjct  186  CSLVRLPIVSVSNNGN--VFTMLSPEFQVEWKLSDECYGCHYSGGQCQTDITNKFLCHTD  243

Query  152  -----SKGKHKQKMIRIA--VVGSIIAFISISLAVVVCVIRH  48
                 + G  K+  +R    +V +   F  I L V++   R 
Sbjct  244  VSNKTAAGTSKRGHLRTPWFIVATGTFFSCIGLLVLLFYFRE  285



>ref|XP_009588465.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana tomentosiformis]
Length=630

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (58%), Gaps = 2/59 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
            +CS I+LP   +    + D+F  LSP+F + W +++ C  CHY GG+C  D    F C+
Sbjct  181  NCSLIRLPV--NSMPDDGDVFKMLSPAFRVEWKLSDECYQCHYGGGQCQTDKTKKFHCT  237



>ref|XP_009600756.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana tomentosiformis]
Length=655

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 10/81 (12%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNE----DLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNF  159
            +C+ I+LP    F + +E    DLF  L+  F L W V+  C DC Y+ G+C  D++N F
Sbjct  177  NCAVIRLPLT--FLSPSEPIPTDLFGLLTSKFKLDWEVSRDCSDCIYREGQCQSDSKNLF  234

Query  158  QCSKGKHKQKMIRIAVVGSII  96
             CSK K    +    VVG+++
Sbjct  235  FCSKAKRNLGL----VVGTVL  251



>ref|XP_006344312.1| PREDICTED: probable serine/threonine-protein kinase At1g18390-like 
[Solanum tuberosum]
Length=1080

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 40/86 (47%), Gaps = 3/86 (3%)
 Frame = -2

Query  323  CSPIQLPF--KWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNN-FQC  153
            CS IQLP        T+   LF  L+    L W V++ C  C+Y GGRC  DN  N F C
Sbjct  557  CSFIQLPLTSNSEAKTNGSGLFHLLTDEVMLGWTVSDECNQCYYTGGRCQTDNATNRFLC  616

Query  152  SKGKHKQKMIRIAVVGSIIAFISISL  75
            S      K  ++ V G+   ++   L
Sbjct  617  SDTNGGHKFAKVIVAGNSYCYVKAPL  642



>ref|XP_006367985.1| PREDICTED: uncharacterized protein LOC102606311 [Solanum tuberosum]
Length=197

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (53%), Gaps = 6/70 (9%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNED-LFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS-  150
            CS I+LP +   + S+   LF  LS SF + W ++E C  CHY GG+C  D  N F C+ 
Sbjct  31   CSLIRLPVR---SISDPGGLFNMLSASFIVEWKLSEDCYQCHYDGGQCQTDITNEFHCTY  87

Query  149  -KGKHKQKMI  123
                H Q  I
Sbjct  88   PYNPHAQDAI  97



>ref|XP_004238904.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
[Solanum lycopersicum]
Length=661

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 47/98 (48%), Gaps = 15/98 (15%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNED-------LFARLSPSFDLTWNVTESCLDCHYKGGRCLVDN-R  168
            CS IQLP      TSN +       LF  L+    L W V++ C  C+Y GG+C  DN  
Sbjct  176  CSFIQLPL-----TSNTEAKENGSGLFHLLTDEVILGWTVSDECNQCYYTGGKCQTDNTT  230

Query  167  NNFQCSKGKHKQKMIRIAVVGSIIAFIS--ISLAVVVC  60
            NNF CSK    + +    V+ ++ A I   + L  + C
Sbjct  231  NNFFCSKTNKDRHLRYAKVIVAVSALIGSLVGLCAIAC  268



>ref|XP_009775396.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Nicotiana sylvestris]
Length=655

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 49/98 (50%), Gaps = 2/98 (2%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN--EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +C+ I+LP  +   +     DLF  LS  F L W V+  C DC Y+ G+C  +++N F C
Sbjct  177  NCAVIRLPLTFLSPSEPIPNDLFDLLSSKFKLDWEVSRDCYDCIYREGQCQSNSKNLFFC  236

Query  152  SKGKHKQKMIRIAVVGSIIAFISISLAVVVCVIRHGKK  39
            SK K    ++   V+   +      + +++C  + G +
Sbjct  237  SKAKRNLGLVLGTVLCGFLIIAISIVILIICCCKKGNR  274



>ref|XP_006344309.1| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Solanum tuberosum]
Length=672

 Score = 50.4 bits (119),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 34/60 (57%), Gaps = 4/60 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP     ++S+ DLF  L P F   W +++ C +CH  GG+C  D  N F C K
Sbjct  177  NCSLIRLPI----HSSHGDLFDVLGPEFLAEWKLSDECNECHDGGGQCQTDKTNKFSCHK  232



>gb|EYU40784.1| hypothetical protein MIMGU_mgv1a0215071mg, partial [Erythranthe 
guttata]
Length=232

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNT-SNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCS  150
             C  IQLP K +++  S E++F   +  + L WN++E C +C   GG+CL ++   F+C 
Sbjct  172  QCHVIQLPVKSNYDQQSPENVFDLFTSEYTLEWNLSEQCSECQRGGGQCLTNDIGEFECK  231

Query  149  K  147
            +
Sbjct  232  R  232



>ref|XP_010320749.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X2 [Solanum lycopersicum]
Length=635

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 4/60 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP +     ++ DLF  L P   + W ++E C  CHY GG C  +  N F C K
Sbjct  184  NCSLIRLPIQ----ATHGDLFDVLGPEILVEWKLSEECNKCHYGGGECQANKTNKFSCHK  239



>ref|XP_004238902.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Solanum lycopersicum]
Length=665

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 4/60 (7%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQCSK  147
            +CS I+LP +     ++ DLF  L P   + W ++E C  CHY GG C  +  N F C K
Sbjct  184  NCSLIRLPIQ----ATHGDLFDVLGPEILVEWKLSEECNKCHYGGGECQANKTNKFSCHK  239



>ref|XP_009613694.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X1 [Nicotiana tomentosiformis]
Length=621

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 41/80 (51%), Gaps = 2/80 (3%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNN-FQCSK  147
            CS +QLP        + DLF  L+    L W V++ C  C+Y+GG+C  DN  + F C  
Sbjct  176  CSFVQLPKSSSSEAESNDLFDLLTDEVTLGWTVSDECNQCYYRGGKCQTDNTTDKFLCYN  235

Query  146  GKHKQKMIRIAVVGSIIAFI  87
             K     I++ V+ ++  F+
Sbjct  236  TKVAGN-IKMKVIVAVTVFL  254



>ref|XP_009600757.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana tomentosiformis]
Length=597

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNE----DLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNF  159
            +C+ I+LP    F + +E    DLF  L+  F L W V+  C DC Y+ G+C  D++N F
Sbjct  177  NCAVIRLPLT--FLSPSEPIPTDLFGLLTSKFKLDWEVSRDCSDCIYREGQCQSDSKNLF  234

Query  158  QCSKGKHKQKMIRIAVVGSII  96
             CSK   +   +   VVG+++
Sbjct  235  FCSKVAKRNLGL---VVGTVL  252



>ref|XP_009600755.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana tomentosiformis]
Length=656

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 9/81 (11%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSNE----DLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNF  159
            +C+ I+LP    F + +E    DLF  L+  F L W V+  C DC Y+ G+C  D++N F
Sbjct  177  NCAVIRLPLT--FLSPSEPIPTDLFGLLTSKFKLDWEVSRDCSDCIYREGQCQSDSKNLF  234

Query  158  QCSKGKHKQKMIRIAVVGSII  96
             CSK   +   +   VVG+++
Sbjct  235  FCSKVAKRNLGL---VVGTVL  252



>ref|XP_009775397.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X3 [Nicotiana sylvestris]
Length=597

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 2/75 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN--EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +C+ I+LP  +   +     DLF  LS  F L W V+  C DC Y+ G+C  +++N F C
Sbjct  177  NCAVIRLPLTFLSPSEPIPNDLFDLLSSKFKLDWEVSRDCYDCIYREGQCQSNSKNLFFC  236

Query  152  SKGKHKQKMIRIAVV  108
            SK   +   + +  V
Sbjct  237  SKAAKRNLGLVLGTV  251



>ref|XP_009775395.1| PREDICTED: probable serine/threonine-protein kinase At1g18390 
isoform X1 [Nicotiana sylvestris]
Length=656

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 2/75 (3%)
 Frame = -2

Query  326  DCSPIQLPFKWHFNTSN--EDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNNFQC  153
            +C+ I+LP  +   +     DLF  LS  F L W V+  C DC Y+ G+C  +++N F C
Sbjct  177  NCAVIRLPLTFLSPSEPIPNDLFDLLSSKFKLDWEVSRDCYDCIYREGQCQSNSKNLFFC  236

Query  152  SKGKHKQKMIRIAVV  108
            SK   +   + +  V
Sbjct  237  SKAAKRNLGLVLGTV  251



>ref|XP_009613695.1| PREDICTED: probable receptor-like protein kinase At1g67000 isoform 
X2 [Nicotiana tomentosiformis]
Length=619

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 43/89 (48%), Gaps = 10/89 (11%)
 Frame = -2

Query  323  CSPIQLPFKWHFNTSNEDLFARLSPSFDLTWNVTESCLDCHYKGGRCLVDNRNN-FQCSK  147
            CS +QLP        + DLF  L+    L W V++ C  C+Y+GG+C  DN  + F C  
Sbjct  176  CSFVQLPKSSSSEAESNDLFDLLTDEVTLGWTVSDECNQCYYRGGKCQTDNTTDKFLCYN  235

Query  146  GKHKQKMIRIAVVGSIIAFISISLAVVVC  60
             K         V G+I   + +++ ++ C
Sbjct  236  TK---------VAGNIKMKVIVAVFLISC  255



>ref|XP_003535924.2| PREDICTED: probable receptor-like protein kinase At1g67000-like 
[Glycine max]
Length=612

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 46/93 (49%), Gaps = 3/93 (3%)
 Frame = -2

Query  323  CSPIQLPFK-WHFNTSNEDLFARLSPSFDLTWNVTESCLDCHY-KGGRCLVDNRNNFQCS  150
            CS + LP +       N +LF  LS    +   V   C  C+Y +GGRC +DN+  F C+
Sbjct  176  CSRVILPIRDSEIVPDNGNLFDYLSADIPVQAEVFHDCSSCYYLRGGRCQLDNQGKFFCA  235

Query  149  KGKHKQKMIRIAVVGSIIAFISISLAVVVCVIR  51
            + K  +K   +    S+   + I L V+ C++R
Sbjct  236  EEKTSKKEKIVVAATSVAGGLGI-LMVLACILR  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 519284018688