BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81394_g1_i1 len=1499 path=[1477:0-1498]

Length=1499
                                                                      Score     E

ref|XP_006352136.1|  PREDICTED: adipocyte plasma membrane-associa...    650   0.0      
ref|XP_009796703.1|  PREDICTED: strictosidine synthase 1                650   0.0      
ref|XP_004234762.1|  PREDICTED: strictosidine synthase                  648   0.0      
gb|EYU41103.1|  hypothetical protein MIMGU_mgv1a007213mg                645   0.0      
ref|XP_009630288.1|  PREDICTED: strictosidine synthase                  643   0.0      
ref|XP_011091642.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    640   0.0      
emb|CDO97660.1|  unnamed protein product                                639   0.0      
ref|XP_002310427.2|  strictosidine synthase family protein              638   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008363735.1|  PREDICTED: strictosidine synthase-like             637   0.0      
ref|XP_011011510.1|  PREDICTED: strictosidine synthase-like             636   0.0      
ref|XP_007222749.1|  hypothetical protein PRUPE_ppa006506mg             634   0.0      
ref|XP_009363644.1|  PREDICTED: strictosidine synthase                  634   0.0      
ref|XP_008439075.1|  PREDICTED: strictosidine synthase                  633   0.0      
ref|XP_006372847.1|  strictosidine synthase family protein              632   0.0      
ref|XP_006478730.1|  PREDICTED: strictosidine synthase-like             632   0.0      
ref|XP_003632076.1|  PREDICTED: strictosidine synthase 1                632   0.0      
ref|XP_004147676.1|  PREDICTED: adipocyte plasma membrane-associa...    632   0.0      
gb|KGN57252.1|  hypothetical protein Csa_3G174550                       632   0.0      
ref|XP_007033906.1|  Calcium-dependent phosphotriesterase superfa...    630   0.0      
ref|XP_008222532.1|  PREDICTED: strictosidine synthase 1-like           630   0.0      
ref|XP_010086695.1|  Strictosidine synthase 1                           627   0.0      
ref|XP_010243901.1|  PREDICTED: strictosidine synthase 1                627   0.0      
ref|XP_010512212.1|  PREDICTED: strictosidine synthase-like             627   0.0      
ref|XP_010469307.1|  PREDICTED: strictosidine synthase-like             626   0.0      
ref|XP_011037120.1|  PREDICTED: strictosidine synthase 1-like           625   0.0      
ref|XP_010524154.1|  PREDICTED: strictosidine synthase 1                625   0.0      
ref|XP_010413679.1|  PREDICTED: strictosidine synthase-like isofo...    624   0.0      
ref|XP_010672238.1|  PREDICTED: strictosidine synthase                  624   0.0      
ref|XP_006291212.1|  hypothetical protein CARUB_v10017342mg             624   0.0      
ref|XP_002529482.1|  strictosidine synthase, putative                   622   0.0      Ricinus communis
ref|XP_002876509.1|  hypothetical protein ARALYDRAFT_907457             623   0.0      
ref|XP_009138905.1|  PREDICTED: strictosidine synthase-like             622   0.0      
ref|XP_004290318.1|  PREDICTED: adipocyte plasma membrane-associa...    620   0.0      
ref|XP_010527673.1|  PREDICTED: strictosidine synthase-like             620   0.0      
gb|KDP43882.1|  hypothetical protein JCGZ_20892                         619   0.0      
gb|AAO42227.1|  putative strictosidine synthase                         619   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116620.1|  PREDICTED: strictosidine synthase                  618   0.0      
ref|XP_010046542.1|  PREDICTED: strictosidine synthase                  616   0.0      
ref|XP_006402679.1|  hypothetical protein EUTSA_v10006000mg             616   0.0      
ref|XP_003597527.1|  Adipocyte plasma membrane-associated protein       610   0.0      
ref|XP_004486908.1|  PREDICTED: adipocyte plasma membrane-associa...    610   0.0      
ref|XP_003546986.2|  PREDICTED: adipocyte plasma membrane-associa...    607   0.0      
ref|XP_007150441.1|  hypothetical protein PHAVU_005G153700g             607   0.0      
gb|KHN33299.1|  Adipocyte plasma membrane-associated protein            606   0.0      
gb|AAX38236.1|  strictosidine synthase family protein                   606   0.0      Brassica napus [oilseed rape]
ref|XP_003542061.2|  PREDICTED: adipocyte plasma membrane-associa...    606   0.0      
gb|KHN30094.1|  Adipocyte plasma membrane-associated protein            605   0.0      
emb|CDY05993.1|  BnaA09g37870D                                          594   0.0      
emb|CDX71901.1|  BnaC08g29730D                                          592   0.0      
ref|NP_191512.1|  pollen development protein LAP3                       591   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX89027.1|  BnaA04g01590D                                          591   0.0      
ref|XP_009384587.1|  PREDICTED: strictosidine synthase                  580   0.0      
gb|EPS72604.1|  hypothetical protein M569_02148                         579   0.0      
ref|XP_010906109.1|  PREDICTED: strictosidine synthase 1                574   0.0      
ref|XP_006847905.1|  hypothetical protein AMTR_s00029p00110150          572   0.0      
emb|CDY00623.1|  BnaC04g23020D                                          596   0.0      
dbj|BAJ99293.1|  predicted protein                                      553   0.0      
emb|CBI36701.3|  unnamed protein product                                547   0.0      
gb|AAV70496.1|  putative male sterility protein                         547   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|EMS61191.1|  Adipocyte plasma membrane-associated protein            547   0.0      
ref|XP_006649792.1|  PREDICTED: adipocyte plasma membrane-associa...    543   0.0      
ref|XP_003558297.1|  PREDICTED: strictosidine synthase 1                541   0.0      
ref|XP_002465509.1|  hypothetical protein SORBIDRAFT_01g040240          539   0.0      Sorghum bicolor [broomcorn]
gb|EMT22896.1|  Adipocyte plasma membrane-associated protein            536   0.0      
ref|NP_001049635.1|  Os03g0263600                                       535   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ26352.1|  hypothetical protein OsJ_10233                          535   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY89345.1|  hypothetical protein OsI_10849                          534   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004984702.1|  PREDICTED: strictosidine synthase-like             529   0.0      
ref|XP_008660311.1|  PREDICTED: strictosidine synthase                  528   0.0      
gb|ACG38465.1|  strictosidine synthase 1 precursor                      528   0.0      Zea mays [maize]
ref|XP_006442992.1|  hypothetical protein CICLE_v10021444mg             496   4e-171   
ref|XP_002979343.1|  hypothetical protein SELMODRAFT_110258             447   5e-150   
ref|XP_002992336.1|  hypothetical protein SELMODRAFT_135098             446   8e-150   
gb|KDO42881.1|  hypothetical protein CISIN_1g039124mg                   355   2e-116   
gb|ABK24858.1|  unknown                                                 339   9e-108   Picea sitchensis
gb|AGU43759.1|  strictosidine synthase                                  337   3e-107   
ref|XP_004981761.1|  PREDICTED: adipocyte plasma membrane-associa...    336   9e-107   
ref|XP_002463871.1|  hypothetical protein SORBIDRAFT_01g007960          335   2e-106   Sorghum bicolor [broomcorn]
ref|XP_008677622.1|  PREDICTED: strictosidine synthase isoform X1       333   8e-106   
ref|XP_009394278.1|  PREDICTED: strictosidine synthase 1-like           332   3e-105   
ref|XP_010932965.1|  PREDICTED: strictosidine synthase 3-like           331   4e-105   
ref|XP_010031590.1|  PREDICTED: adipocyte plasma membrane-associa...    331   6e-105   
ref|XP_002966382.1|  hypothetical protein SELMODRAFT_230896             330   8e-105   
ref|XP_003596929.1|  Adipocyte plasma membrane-associated protein       330   8e-105   
ref|NP_001150008.1|  strictosidine synthase precursor                   330   1e-104   Zea mays [maize]
gb|AES67180.2|  strictosidine synthase family protein                   330   1e-104   
ref|XP_010031589.1|  PREDICTED: adipocyte plasma membrane-associa...    330   2e-104   
gb|ABR18211.1|  unknown                                                 330   2e-104   Picea sitchensis
ref|XP_011088992.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    329   2e-104   
ref|XP_002991340.1|  hypothetical protein SELMODRAFT_448383             329   3e-104   
ref|XP_002978184.1|  hypothetical protein SELMODRAFT_108020             328   8e-104   
ref|XP_009412315.1|  PREDICTED: strictosidine synthase 3-like           328   9e-104   
ref|XP_010247897.1|  PREDICTED: strictosidine synthase 3-like           327   1e-103   
ref|XP_008776219.1|  PREDICTED: adipocyte plasma membrane-associa...    327   3e-103   
ref|XP_010263076.1|  PREDICTED: adipocyte plasma membrane-associa...    326   3e-103   
emb|CDP21347.1|  unnamed protein product                                325   9e-103   
gb|EAZ28597.1|  hypothetical protein OsJ_12584                          322   3e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007132511.1|  hypothetical protein PHAVU_011G100400g             323   9e-102   
ref|XP_004487437.1|  PREDICTED: adipocyte plasma membrane-associa...    322   1e-101   
gb|EPS65875.1|  hypothetical protein M569_08902                         322   1e-101   
ref|XP_009148103.1|  PREDICTED: strictosidine synthase 3                322   1e-101   
ref|XP_004506244.1|  PREDICTED: adipocyte plasma membrane-associa...    322   1e-101   
ref|NP_001051286.2|  Os03g0750700                                       322   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009378622.1|  PREDICTED: strictosidine synthase 3-like           323   2e-101   
ref|XP_010525478.1|  PREDICTED: strictosidine synthase 1-like           321   3e-101   
dbj|BAJ89445.1|  predicted protein                                      322   3e-101   
dbj|BAJ91613.1|  predicted protein                                      322   4e-101   
emb|CDX93560.1|  BnaA06g04880D                                          321   4e-101   
ref|XP_002984195.1|  hypothetical protein SELMODRAFT_156492             321   5e-101   
ref|XP_002298158.2|  strictosidine synthase family protein              321   5e-101   Populus trichocarpa [western balsam poplar]
ref|XP_008382118.1|  PREDICTED: strictosidine synthase 3                323   5e-101   
ref|XP_009765833.1|  PREDICTED: strictosidine synthase 3                320   6e-101   
ref|XP_010535734.1|  PREDICTED: adipocyte plasma membrane-associa...    321   6e-101   
ref|XP_003559512.1|  PREDICTED: strictosidine synthase-like             320   8e-101   
ref|XP_002278088.1|  PREDICTED: strictosidine synthase 3                320   8e-101   Vitis vinifera
ref|XP_006340314.1|  PREDICTED: adipocyte plasma membrane-associa...    320   1e-100   
ref|XP_007205319.1|  hypothetical protein PRUPE_ppa006884mg             320   1e-100   
ref|XP_006417683.1|  hypothetical protein EUTSA_v10007865mg             320   1e-100   
ref|XP_006487831.1|  PREDICTED: adipocyte plasma membrane-associa...    319   2e-100   
gb|KDO48949.1|  hypothetical protein CISIN_1g015463mg                   318   3e-100   
gb|AAR87254.1|  putative strictosidine synthase                         321   4e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010544326.1|  PREDICTED: strictosidine synthase 3                318   6e-100   
ref|XP_002513740.1|  strictosidine synthase, putative                   317   9e-100   Ricinus communis
ref|XP_006424057.1|  hypothetical protein CICLE_v10028617mg             317   1e-99    
ref|XP_004172338.1|  PREDICTED: adipocyte plasma membrane-associa...    317   1e-99    
ref|XP_004137361.1|  PREDICTED: adipocyte plasma membrane-associa...    317   2e-99    
ref|XP_008230556.1|  PREDICTED: strictosidine synthase 3                317   2e-99    
ref|XP_010253308.1|  PREDICTED: adipocyte plasma membrane-associa...    317   2e-99    
ref|XP_004251214.1|  PREDICTED: strictosidine synthase 3                317   2e-99    
ref|XP_010475646.1|  PREDICTED: strictosidine synthase 3-like           316   3e-99    
gb|KDP42972.1|  hypothetical protein JCGZ_23914                         316   4e-99    
ref|XP_007015611.1|  Strictosidine synthase-like 3                      315   1e-98    
gb|KEH29729.1|  strictosidine synthase family protein                   314   2e-98    
ref|XP_011037298.1|  PREDICTED: strictosidine synthase 3-like           314   2e-98    
ref|XP_011090280.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    315   3e-98    
ref|XP_010685469.1|  PREDICTED: strictosidine synthase 3-like           313   4e-98    
ref|XP_006361111.1|  PREDICTED: adipocyte plasma membrane-associa...    313   4e-98    
ref|XP_004241357.2|  PREDICTED: strictosidine synthase 3-like           314   5e-98    
ref|XP_010488915.1|  PREDICTED: strictosidine synthase 3-like           313   5e-98    
gb|KHG12177.1|  Adipocyte plasma membrane-associated                    313   9e-98    
ref|XP_006826427.1|  hypothetical protein AMTR_s00004p00163660          311   2e-97    
ref|XP_009587970.1|  PREDICTED: strictosidine synthase 3-like           311   2e-97    
ref|XP_009623916.1|  PREDICTED: strictosidine synthase 3-like           311   2e-97    
ref|XP_011044611.1|  PREDICTED: strictosidine synthase 3-like           311   3e-97    
ref|XP_008453519.1|  PREDICTED: strictosidine synthase 3                311   5e-97    
ref|NP_680189.1|  strictosidine synthase family protein                 310   5e-97    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95409.1|  putative strictosidine synthase - like                 310   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010090518.1|  Adipocyte plasma membrane-associated protein       310   1e-96    
ref|XP_002972283.1|  hypothetical protein SELMODRAFT_231921             309   1e-96    
ref|XP_009797832.1|  PREDICTED: strictosidine synthase 3-like           309   1e-96    
ref|XP_002874041.1|  strictosidine synthase family protein              309   2e-96    
ref|XP_002892459.1|  strictosidine synthase family protein              308   2e-96    
ref|XP_007028511.1|  Calcium-dependent phosphotriesterase superfa...    308   2e-96    
ref|XP_010458085.1|  PREDICTED: strictosidine synthase 3-like           308   2e-96    
ref|XP_003527512.1|  PREDICTED: adipocyte plasma membrane-associa...    310   3e-96    
emb|CDY16615.1|  BnaC09g36580D                                          308   3e-96    
ref|XP_009120693.1|  PREDICTED: strictosidine synthase 3                308   3e-96    
ref|XP_002308895.2|  hypothetical protein POPTR_0006s03930g             308   4e-96    Populus trichocarpa [western balsam poplar]
ref|XP_006305032.1|  hypothetical protein CARUB_v10009397mg             308   5e-96    
ref|XP_010427563.1|  PREDICTED: strictosidine synthase 1-like           307   6e-96    
gb|EYU22112.1|  hypothetical protein MIMGU_mgv1a007437mg                308   6e-96    
gb|KHN41250.1|  Adipocyte plasma membrane-associated protein            305   1e-95    
ref|XP_010420991.1|  PREDICTED: adipocyte plasma membrane-associa...    306   1e-95    
gb|KHG24912.1|  Adipocyte plasma membrane-associated                    306   2e-95    
emb|CBI24410.3|  unnamed protein product                                304   2e-95    
ref|XP_010045161.1|  PREDICTED: strictosidine synthase 3-like           306   3e-95    
ref|XP_006287902.1|  hypothetical protein CARUB_v10001136mg             306   3e-95    
gb|EPS66876.1|  hypothetical protein M569_07898                         305   5e-95    
ref|XP_010493259.1|  PREDICTED: strictosidine synthase 3-like           305   5e-95    
gb|KFK26348.1|  hypothetical protein AALP_AA8G236100                    305   6e-95    
gb|KFK43153.1|  hypothetical protein AALP_AA1G086800                    305   6e-95    
ref|NP_563818.1|  strictosidine synthase-like 3                         304   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400707.1|  hypothetical protein EUTSA_v10013741mg             304   2e-94    
ref|XP_010516308.1|  PREDICTED: strictosidine synthase 1-like           303   2e-94    
ref|XP_011027270.1|  PREDICTED: strictosidine synthase 3-like iso...    303   2e-94    
ref|NP_191262.2|  calcium-dependent phosphotriesterase superfamil...    303   3e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CAB72173.1|  putative protein                                       302   4e-94    Arabidopsis thaliana [mouse-ear cress]
gb|EPS68312.1|  hypothetical protein M569_06455                         303   4e-94    
ref|XP_002878128.1|  strictosidine synthase family protein              302   5e-94    
ref|XP_004493426.1|  PREDICTED: strictosidine synthase 1-like           301   7e-94    
ref|XP_006651825.1|  PREDICTED: adipocyte plasma membrane-associa...    299   9e-94    
gb|KDO48948.1|  hypothetical protein CISIN_1g015463mg                   302   1e-93    
ref|XP_002323253.2|  strictosidine synthase family protein              300   2e-93    Populus trichocarpa [western balsam poplar]
ref|XP_003554139.1|  PREDICTED: strictosidine synthase 1-like           300   3e-93    
ref|XP_010108508.1|  Adipocyte plasma membrane-associated protein       303   3e-93    
dbj|BAE99809.1|  hypothetical protein                                   300   4e-93    Arabidopsis thaliana [mouse-ear cress]
emb|CDX95058.1|  BnaC05g06130D                                          300   4e-93    
gb|KFK34942.1|  hypothetical protein AALP_AA5G213900                    299   5e-93    
ref|XP_001762553.1|  predicted protein                                  300   6e-93    
ref|XP_006494390.1|  PREDICTED: strictosidine synthase 1-like           299   8e-93    
ref|XP_010454464.1|  PREDICTED: strictosidine synthase 3-like           300   8e-93    
ref|XP_002273764.1|  PREDICTED: strictosidine synthase 1                298   8e-93    Vitis vinifera
ref|XP_010504622.1|  PREDICTED: strictosidine synthase 1-like           298   1e-92    
ref|XP_002532594.1|  strictosidine synthase, putative                   298   1e-92    Ricinus communis
ref|XP_004249227.1|  PREDICTED: strictosidine synthase 1                297   3e-92    
ref|XP_007162124.1|  hypothetical protein PHAVU_001G125900g             297   3e-92    
ref|XP_006291321.1|  hypothetical protein CARUB_v10017454mg             297   3e-92    
ref|XP_003521146.1|  PREDICTED: strictosidine synthase 1-like           296   1e-91    
gb|KEH23602.1|  strictosidine synthase family protein                   295   1e-91    
ref|XP_002323255.1|  strictosidine synthase family protein              295   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010269382.1|  PREDICTED: strictosidine synthase 1-like           295   2e-91    
ref|XP_001769001.1|  predicted protein                                  296   2e-91    
ref|XP_010056166.1|  PREDICTED: strictosidine synthase 1-like           295   4e-91    
gb|KDP37825.1|  hypothetical protein JCGZ_06727                         294   5e-91    
ref|XP_009116408.1|  PREDICTED: strictosidine synthase 1                293   9e-91    
ref|XP_011000438.1|  PREDICTED: strictosidine synthase 1                293   1e-90    
ref|XP_009797408.1|  PREDICTED: strictosidine synthase 1-like           293   1e-90    
ref|XP_010672984.1|  PREDICTED: strictosidine synthase 1-like           293   1e-90    
ref|XP_001783886.1|  predicted protein                                  293   1e-90    
ref|XP_009627580.1|  PREDICTED: strictosidine synthase 1-like           292   3e-90    
ref|XP_008443273.1|  PREDICTED: strictosidine synthase 1                292   4e-90    
ref|XP_010108510.1|  Strictosidine synthase 1                           291   7e-90    
ref|XP_010672985.1|  PREDICTED: strictosidine synthase 1-like           291   1e-89    
ref|XP_006421116.1|  hypothetical protein CICLE_v10005245mg             290   2e-89    
gb|AES81258.2|  strictosidine synthase family protein                   289   3e-89    
ref|XP_006351273.1|  PREDICTED: strictosidine synthase 1-like           289   4e-89    
ref|XP_006494389.1|  PREDICTED: strictosidine synthase 1-like           289   4e-89    
ref|XP_004307669.1|  PREDICTED: strictosidine synthase 1-like iso...    288   9e-89    
ref|XP_001759191.1|  predicted protein                                  290   1e-88    
gb|KDO41714.1|  hypothetical protein CISIN_1g046018mg                   286   1e-88    
emb|CDX92388.1|  BnaA10g14270D                                          288   1e-88    
ref|XP_010023798.1|  PREDICTED: strictosidine synthase 1-like           287   2e-88    
ref|XP_010042385.1|  PREDICTED: strictosidine synthase 1-like           287   2e-88    
ref|XP_001783026.1|  predicted protein                                  288   3e-88    
ref|XP_008244844.1|  PREDICTED: strictosidine synthase 1                287   3e-88    
emb|CDP09527.1|  unnamed protein product                                286   4e-88    
ref|XP_009339573.1|  PREDICTED: strictosidine synthase 3-like           286   6e-88    
ref|XP_008392402.1|  PREDICTED: strictosidine synthase 1-like           285   1e-87    
ref|XP_009799719.1|  PREDICTED: strictosidine synthase 1-like           284   2e-87    
emb|CDY06143.1|  BnaA09g36370D                                          285   3e-87    
ref|XP_009631158.1|  PREDICTED: strictosidine synthase 1-like           283   3e-87    
gb|AAF22901.1|AC006932_18  T27G7.16                                     286   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|KEH23600.1|  strictosidine synthase family protein                   281   2e-86    
ref|XP_008244837.1|  PREDICTED: strictosidine synthase 1                283   2e-86    
ref|XP_011027271.1|  PREDICTED: strictosidine synthase 3-like iso...    282   2e-86    
ref|XP_010922155.1|  PREDICTED: strictosidine synthase 3-like           282   2e-86    
ref|XP_006847661.1|  hypothetical protein AMTR_s00149p00021810          282   3e-86    
ref|XP_007204530.1|  hypothetical protein PRUPE_ppa017675mg             280   4e-86    
ref|XP_002532597.1|  strictosidine synthase, putative                   281   6e-86    Ricinus communis
ref|XP_007202861.1|  hypothetical protein PRUPE_ppa015510mg             279   1e-85    
emb|CDP09528.1|  unnamed protein product                                280   2e-85    
ref|XP_002267323.1|  PREDICTED: strictosidine synthase 3                278   8e-85    Vitis vinifera
ref|XP_004307668.1|  PREDICTED: strictosidine synthase 1-like iso...    278   1e-84    
ref|XP_011000464.1|  PREDICTED: strictosidine synthase 3-like           276   1e-84    
ref|XP_006291448.1|  hypothetical protein CARUB_v10017585mg             275   3e-84    
gb|AFK33536.1|  unknown                                                 273   1e-83    
ref|XP_004164012.1|  PREDICTED: strictosidine synthase 1-like           275   2e-83    
ref|XP_004136643.1|  PREDICTED: strictosidine synthase 1-like           275   2e-83    
ref|XP_004237337.1|  PREDICTED: strictosidine synthase 3-like           274   3e-83    
ref|XP_006340100.1|  PREDICTED: strictosidine synthase 1-like iso...    273   7e-83    
ref|XP_006340101.1|  PREDICTED: strictosidine synthase 1-like iso...    273   1e-82    
gb|EYU18639.1|  hypothetical protein MIMGU_mgv1a009932mg                271   2e-82    
ref|XP_010427562.1|  PREDICTED: strictosidine synthase 1-like           271   2e-82    
ref|XP_008811198.1|  PREDICTED: strictosidine synthase 1-like           270   2e-82    
ref|XP_006344500.1|  PREDICTED: adipocyte plasma membrane-associa...    271   4e-82    
gb|AHA95469.1|  strictosidine synthase-like protein                     270   6e-82    
ref|XP_008777477.1|  PREDICTED: strictosidine synthase 1-like           270   2e-81    
gb|AHA95468.1|  strictosidine synthase-like protein                     268   4e-81    
gb|EYU18642.1|  hypothetical protein MIMGU_mgv1a008518mg                268   4e-81    
ref|XP_010425613.1|  PREDICTED: strictosidine synthase 3-like           267   6e-81    
ref|XP_006348986.1|  PREDICTED: strictosidine synthase 1-like           268   7e-81    
ref|XP_009803216.1|  PREDICTED: strictosidine synthase 1-like           268   1e-80    
ref|XP_003521147.1|  PREDICTED: strictosidine synthase 1-like           268   1e-80    
gb|EMT04709.1|  Adipocyte plasma membrane-associated protein            263   2e-80    
ref|XP_009614698.1|  PREDICTED: strictosidine synthase 1-like           266   2e-80    
gb|AHA95467.1|  strictosidine synthase-like protein                     266   3e-80    
ref|XP_009783664.1|  PREDICTED: strictosidine synthase 3-like           266   3e-80    
ref|XP_010056146.1|  PREDICTED: strictosidine synthase 1                266   3e-80    
ref|XP_010412433.1|  PREDICTED: strictosidine synthase 1-like           265   5e-80    
ref|XP_010430839.1|  PREDICTED: strictosidine synthase 1-like           263   6e-80    
ref|XP_010504621.1|  PREDICTED: strictosidine synthase 1-like           264   7e-80    
gb|EMS48382.1|  Adipocyte plasma membrane-associated protein            261   1e-79    
ref|XP_006421117.1|  hypothetical protein CICLE_v10006948mg             261   4e-79    
ref|XP_009133479.1|  PREDICTED: strictosidine synthase 3                263   4e-79    
ref|XP_008465977.1|  PREDICTED: strictosidine synthase 1-like           263   5e-79    
ref|XP_004493427.1|  PREDICTED: adipocyte plasma membrane-associa...    263   1e-78    
ref|XP_011075408.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    262   1e-78    
gb|KHF98782.1|  Adipocyte plasma membrane-associated                    263   1e-78    
emb|CDX72079.1|  BnaC08g27950D                                          259   3e-78    
ref|XP_009599899.1|  PREDICTED: strictosidine synthase 3-like           261   4e-78    
emb|CDX79943.1|  BnaA05g02130D                                          260   4e-78    
ref|XP_009142737.1|  PREDICTED: strictosidine synthase 3-like           260   5e-78    
emb|CDY23857.1|  BnaC04g01800D                                          260   5e-78    
emb|CDY22517.1|  BnaC03g23270D                                          260   5e-78    
ref|XP_006411395.1|  hypothetical protein EUTSA_v10016720mg             261   1e-77    
ref|XP_010507098.1|  PREDICTED: uncharacterized protein LOC104783669    267   1e-77    
gb|KFK36981.1|  hypothetical protein AALP_AA4G197000                    258   3e-77    
ref|XP_010554777.1|  PREDICTED: strictosidine synthase 3-like           258   3e-77    
ref|XP_010554776.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    258   3e-77    
ref|XP_010525477.1|  PREDICTED: strictosidine synthase 1-like           258   4e-77    
emb|CDP09529.1|  unnamed protein product                                257   6e-77    
ref|XP_003625042.1|  Adipocyte plasma membrane-associated protein       258   1e-76    
emb|CBI30108.3|  unnamed protein product                                256   1e-76    
ref|XP_004150130.1|  PREDICTED: strictosidine synthase 1-like           256   2e-76    
gb|KHN36514.1|  Adipocyte plasma membrane-associated protein            254   3e-76    
ref|XP_010529101.1|  PREDICTED: strictosidine synthase 3-like           255   3e-76    
ref|XP_004169880.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    254   7e-76    
ref|XP_002881767.1|  hypothetical protein ARALYDRAFT_321816             254   8e-76    
ref|XP_011075619.1|  PREDICTED: protein STRICTOSIDINE SYNTHASE-LI...    253   8e-76    
ref|XP_006348919.1|  PREDICTED: strictosidine synthase 1-like           253   1e-75    
ref|XP_003625041.1|  Adipocyte plasma membrane-associated protein       254   2e-75    
ref|XP_006437788.1|  hypothetical protein CICLE_v10032008mg             253   2e-75    
ref|NP_001234466.1|  uncharacterized protein LOC543656 precursor        253   2e-75    
ref|NP_191261.1|  calcium-dependent phosphotriesterase superfamil...    253   4e-75    
gb|AHA95470.1|  strictosidine synthase-like protein                     252   6e-75    
ref|XP_003577068.1|  PREDICTED: strictosidine synthase 3-like           252   7e-75    
emb|CDP12339.1|  unnamed protein product                                251   8e-75    
gb|KCW90057.1|  hypothetical protein EUGRSUZ_A02258                     249   9e-75    
ref|XP_004243243.1|  PREDICTED: strictosidine synthase 1-like           251   1e-74    
ref|XP_010504619.1|  PREDICTED: strictosidine synthase 1-like           251   2e-74    
gb|KDO70174.1|  hypothetical protein CISIN_1g019290mg                   249   3e-74    
gb|ABA91449.1|  Strictosidine synthase family protein                   249   6e-74    
ref|XP_003576476.1|  PREDICTED: strictosidine synthase 3-like           249   1e-73    
ref|XP_010427560.1|  PREDICTED: strictosidine synthase 1-like iso...    249   1e-73    
gb|AFK49602.1|  unknown                                                 249   1e-73    
emb|CAB69786.1|  hypothetical protein                                   248   2e-73    
ref|XP_006291330.1|  hypothetical protein CARUB_v10017465mg             248   2e-73    
ref|XP_006402922.1|  hypothetical protein EUTSA_v10006039mg             248   2e-73    
emb|CDP07817.1|  unnamed protein product                                247   2e-73    
ref|XP_003531955.1|  PREDICTED: strictosidine synthase 3-like           247   3e-73    
ref|XP_010516306.1|  PREDICTED: strictosidine synthase 1-like           248   3e-73    
ref|XP_006291318.1|  hypothetical protein CARUB_v10017464mg             248   3e-73    
ref|XP_009400113.1|  PREDICTED: strictosidine synthase 1-like           247   5e-73    
ref|XP_007162125.1|  hypothetical protein PHAVU_001G126000g             248   5e-73    
ref|XP_010516307.1|  PREDICTED: strictosidine synthase 1-like           247   6e-73    
ref|NP_191260.1|  calcium-dependent phosphotriesterase superfamil...    247   8e-73    
ref|XP_010427561.1|  PREDICTED: strictosidine synthase 3-like iso...    246   9e-73    
ref|XP_006291334.1|  hypothetical protein CARUB_v10017468mg             246   1e-72    
ref|XP_010504618.1|  PREDICTED: strictosidine synthase 1-like           246   1e-72    
ref|NP_181662.3|  strictosidine synthase-like 1                         247   1e-72    
gb|ABA95779.2|  Strictosidine synthase family protein, expressed        248   2e-72    
gb|EAY79903.1|  hypothetical protein OsI_35066                          246   2e-72    
ref|XP_002273580.1|  PREDICTED: strictosidine synthase 3                244   2e-72    
ref|NP_001030876.1|  calcium-dependent phosphotriesterase superfa...    245   2e-72    
emb|CAN63240.1|  hypothetical protein VITISV_034462                     244   3e-72    
ref|XP_006662726.1|  PREDICTED: strictosidine synthase 3-like           245   3e-72    
ref|XP_006411394.1|  hypothetical protein EUTSA_v10016811mg             245   4e-72    
gb|ACU23577.1|  unknown                                                 244   4e-72    
emb|CBX24423.1|  hypothetical_protein                                   248   4e-72    
ref|XP_009104037.1|  PREDICTED: strictosidine synthase 1-like           245   4e-72    
ref|XP_003617474.1|  Strictosidine synthase                             243   5e-72    
gb|AAK43996.1|AF370181_1  unknown protein                               245   5e-72    
gb|EAZ01725.1|  hypothetical protein OsI_23751                          244   5e-72    
ref|XP_004978641.1|  PREDICTED: strictosidine synthase 3-like iso...    243   1e-71    
gb|EAZ01722.1|  hypothetical protein OsI_23748                          243   1e-71    
gb|KDP29321.1|  hypothetical protein JCGZ_18242                         242   1e-71    
ref|XP_002514533.1|  strictosidine synthase, putative                   243   2e-71    
emb|CBX25468.1|  hypothetical_protein                                   243   2e-71    
ref|XP_006402921.1|  hypothetical protein EUTSA_v10006043mg             243   2e-71    
ref|XP_006291310.1|  hypothetical protein CARUB_v10017457mg             243   3e-71    
ref|XP_002878125.1|  strictosidine synthase family protein              243   3e-71    
ref|XP_009139051.1|  PREDICTED: strictosidine synthase 1-like           243   3e-71    
emb|CDY54042.1|  BnaCnng26110D                                          243   3e-71    
gb|EAY82206.1|  hypothetical protein OsI_37409                          242   4e-71    
ref|XP_004977501.1|  PREDICTED: strictosidine synthase 1-like           242   4e-71    
emb|CDX77108.1|  BnaC04g39030D                                          242   4e-71    
ref|XP_009140788.1|  PREDICTED: strictosidine synthase 1-like           242   4e-71    
emb|CDY30962.1|  BnaC04g24620D                                          242   5e-71    
gb|AAC78542.1|  putative strictosidine synthase                         243   5e-71    
ref|XP_010257835.1|  PREDICTED: strictosidine synthase 3-like           241   5e-71    
dbj|BAJ33861.1|  unnamed protein product                                242   5e-71    
ref|XP_004298326.1|  PREDICTED: strictosidine synthase-like             241   7e-71    
gb|ABA95780.1|  Strictosidine synthase family protein, expressed        242   7e-71    
gb|EAZ01726.1|  hypothetical protein OsI_23752                          241   9e-71    
emb|CDM84363.1|  unnamed protein product                                239   9e-71    
ref|XP_006402920.1|  hypothetical protein EUTSA_v10006018mg             242   9e-71    
ref|XP_007045664.1|  Calcium-dependent phosphotriesterase superfa...    241   1e-70    
gb|KFK34941.1|  hypothetical protein AALP_AA5G213800                    241   1e-70    
ref|XP_003561520.1|  PREDICTED: strictosidine synthase 1-like           240   1e-70    
emb|CDX67673.1|  BnaA07g17130D                                          241   1e-70    
emb|CDX76030.1|  BnaA04g02940D                                          241   1e-70    
dbj|BAD35676.1|  putative strictosidine synthase precursor              240   1e-70    
emb|CDX72080.1|  BnaC08g27940D                                          241   2e-70    
ref|XP_010427557.1|  PREDICTED: strictosidine synthase 3-like           241   2e-70    
emb|CDY30963.1|  BnaC04g24610D                                          241   2e-70    
emb|CDY30558.1|  BnaA04g15750D                                          240   2e-70    
ref|XP_009139053.1|  PREDICTED: strictosidine synthase 3-like           240   3e-70    
ref|XP_007045667.1|  Calcium-dependent phosphotriesterase superfa...    243   4e-70    
emb|CDY30959.1|  BnaC04g24650D                                          239   4e-70    
ref|XP_008243874.1|  PREDICTED: strictosidine synthase 3-like           239   5e-70    
ref|XP_004974462.1|  PREDICTED: strictosidine synthase 1-like           238   5e-70    
gb|EAZ37681.1|  hypothetical protein OsJ_22019                          237   5e-70    
ref|XP_010504616.1|  PREDICTED: strictosidine synthase 3-like           239   6e-70    
gb|KFK34932.1|  hypothetical protein AALP_AA5G212900                    239   7e-70    
gb|EAZ01723.1|  hypothetical protein OsI_23749                          238   7e-70    
ref|XP_004967164.1|  PREDICTED: strictosidine synthase 1-like           238   8e-70    
dbj|BAK04872.1|  predicted protein                                      239   9e-70    
emb|CDX76033.1|  BnaA04g02970D                                          239   9e-70    
dbj|BAD35674.1|  putative strictosidine synthase                        237   9e-70    
ref|XP_004298328.1|  PREDICTED: strictosidine synthase-like             238   1e-69    
gb|KFK34933.1|  hypothetical protein AALP_AA5G213000                    239   1e-69    
ref|XP_007156378.1|  hypothetical protein PHAVU_003G281200g             237   2e-69    
ref|XP_003580953.1|  PREDICTED: strictosidine synthase 1-like           237   2e-69    
gb|EMT33531.1|  Strictosidine synthase 1                                236   2e-69    
ref|XP_009116407.1|  PREDICTED: strictosidine synthase 1                238   2e-69    
ref|XP_002312353.2|  hypothetical protein POPTR_0008s10940g             237   2e-69    
emb|CDY06144.1|  BnaA09g36360D                                          238   2e-69    
ref|XP_004967140.1|  PREDICTED: strictosidine synthase 1-like           236   2e-69    
ref|XP_009391266.1|  PREDICTED: strictosidine synthase 3-like           236   3e-69    
ref|XP_006663808.1|  PREDICTED: strictosidine synthase 3-like           238   3e-69    
ref|XP_010516303.1|  PREDICTED: strictosidine synthase 3-like           238   3e-69    
ref|XP_002448962.1|  hypothetical protein SORBIDRAFT_05g002520          238   3e-69    
ref|XP_010516304.1|  PREDICTED: strictosidine synthase-like             237   5e-69    
ref|XP_010656041.1|  PREDICTED: strictosidine synthase 1-like           235   5e-69    
ref|XP_006294436.1|  hypothetical protein CARUB_v10023450mg             237   5e-69    
gb|EMT05184.1|  Strictosidine synthase 1                                236   5e-69    
ref|XP_004978210.1|  PREDICTED: strictosidine synthase 1-like           236   6e-69    
ref|XP_010517618.1|  PREDICTED: strictosidine synthase 3-like           237   6e-69    
ref|XP_002467870.1|  hypothetical protein SORBIDRAFT_01g035660          235   7e-69    
ref|XP_008443270.1|  PREDICTED: strictosidine synthase 3                236   7e-69    
ref|XP_009139050.1|  PREDICTED: strictosidine synthase 1-like           236   9e-69    
ref|XP_006291314.1|  hypothetical protein CARUB_v10017448mg             236   1e-68    
emb|CBI28990.3|  unnamed protein product                                235   1e-68    
ref|XP_006402919.1|  hypothetical protein EUTSA_v10005873mg             241   1e-68    
ref|XP_010655935.1|  PREDICTED: strictosidine synthase 1-like           234   1e-68    
gb|EMT18390.1|  Strictosidine synthase 1                                234   2e-68    
dbj|BAD35673.1|  putative strictosidine synthase precursor              234   2e-68    
ref|XP_004963976.1|  PREDICTED: strictosidine synthase-like             234   2e-68    
ref|XP_009133478.1|  PREDICTED: strictosidine synthase 3                235   3e-68    
gb|KFK34939.1|  hypothetical protein AALP_AA5G213600                    234   3e-68    
ref|XP_010663511.1|  PREDICTED: strictosidine synthase 1-like           233   3e-68    
ref|XP_004971567.1|  PREDICTED: strictosidine synthase 1-like           234   3e-68    
ref|XP_002454704.1|  hypothetical protein SORBIDRAFT_04g035910          234   4e-68    
gb|AHA95471.1|  strictosidine synthase-like protein                     231   4e-68    
ref|XP_002881766.1|  hypothetical protein ARALYDRAFT_483200             234   4e-68    
ref|XP_004986966.1|  PREDICTED: strictosidine synthase 3-like           233   5e-68    
ref|XP_004974473.1|  PREDICTED: strictosidine synthase 1-like           233   8e-68    
ref|XP_004967142.1|  PREDICTED: strictosidine synthase 1-like           233   8e-68    
emb|CDM86638.1|  unnamed protein product                                233   9e-68    
ref|XP_004974461.1|  PREDICTED: strictosidine synthase 1-like           233   9e-68    
ref|XP_002452919.1|  hypothetical protein SORBIDRAFT_04g034960          233   1e-67    
gb|EMT00978.1|  Strictosidine synthase 1                                232   1e-67    
emb|CBI28987.3|  unnamed protein product                                231   1e-67    
ref|XP_010508735.1|  PREDICTED: strictosidine synthase 3                233   1e-67    
emb|CDM84367.1|  unnamed protein product                                238   1e-67    
ref|XP_002452976.1|  hypothetical protein SORBIDRAFT_04g035870          232   1e-67    
ref|XP_004986991.1|  PREDICTED: strictosidine synthase 3-like           232   2e-67    
gb|KHN17996.1|  Strictosidine synthase 3                                232   2e-67    
ref|XP_010658741.1|  PREDICTED: strictosidine synthase 1-like           231   2e-67    
gb|KFK36980.1|  hypothetical protein AALP_AA4G196900                    233   2e-67    
ref|XP_004136779.1|  PREDICTED: adipocyte plasma membrane-associa...    233   2e-67    
ref|XP_004986993.1|  PREDICTED: strictosidine synthase 3-like           231   2e-67    
ref|XP_004974468.1|  PREDICTED: strictosidine synthase 1-like           231   3e-67    
ref|XP_004984421.1|  PREDICTED: strictosidine synthase-like             231   3e-67    
ref|XP_002438841.1|  hypothetical protein SORBIDRAFT_10g027060          231   3e-67    
ref|XP_008655533.1|  PREDICTED: strictosidine synthase 3-like           231   4e-67    
emb|CDY70367.1|  BnaAnng33490D                                          228   4e-67    
ref|XP_009356499.1|  PREDICTED: strictosidine synthase 3-like           231   5e-67    
ref|XP_003575472.1|  PREDICTED: strictosidine synthase 1-like           231   5e-67    
gb|EMT14932.1|  Strictosidine synthase 3                                231   5e-67    
ref|NP_001059909.2|  Os07g0543600                                       229   8e-67    
ref|XP_004978640.1|  PREDICTED: strictosidine synthase 3-like iso...    231   8e-67    
ref|XP_004979009.1|  PREDICTED: strictosidine synthase 3-like           231   9e-67    
ref|XP_008652645.1|  PREDICTED: strictosidine synthase 3-like           231   9e-67    
dbj|BAC83776.1|  putative strictosidine synthase                        230   1e-66    
ref|XP_004517249.1|  PREDICTED: adipocyte plasma membrane-associa...    228   1e-66    
ref|XP_010516305.1|  PREDICTED: strictosidine synthase-like             230   1e-66    
ref|XP_002460151.1|  hypothetical protein SORBIDRAFT_02g023470          230   1e-66    
ref|NP_181661.1|  strictosidine synthase-like 2                         231   1e-66    
ref|XP_002452451.1|  hypothetical protein SORBIDRAFT_04g026050          229   1e-66    
emb|CBI28988.3|  unnamed protein product                                229   2e-66    
ref|XP_009142736.1|  PREDICTED: strictosidine synthase 3-like           230   2e-66    
ref|XP_010505898.1|  PREDICTED: strictosidine synthase 3-like           230   2e-66    
ref|XP_003576994.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    229   2e-66    
ref|XP_010655933.1|  PREDICTED: strictosidine synthase 1-like           231   2e-66    
ref|XP_003581637.1|  PREDICTED: strictosidine synthase 1-like           229   2e-66    
ref|XP_003547789.1|  PREDICTED: strictosidine synthase-like             229   2e-66    
gb|KFK34940.1|  hypothetical protein AALP_AA5G213700                    229   2e-66    
gb|KCW90054.1|  hypothetical protein EUGRSUZ_A02256                     227   3e-66    
gb|EAZ04232.1|  hypothetical protein OsI_26376                          229   3e-66    
emb|CDX79944.1|  BnaA05g02120D                                          229   3e-66    
ref|XP_003564761.1|  PREDICTED: strictosidine synthase 3-like           228   4e-66    
ref|XP_004955242.1|  PREDICTED: strictosidine synthase 1-like           228   4e-66    
emb|CBI40188.3|  unnamed protein product                                226   4e-66    
ref|NP_001065719.1|  Os11g0142400                                       226   4e-66    
ref|XP_003635414.1|  PREDICTED: strictosidine synthase 1-like           228   4e-66    
emb|CDY23858.1|  BnaC04g01790D                                          229   5e-66    
emb|CBI18784.3|  unnamed protein product                                228   5e-66    
gb|AAC27642.1|  putative strictosidine synthase                         229   6e-66    
gb|KDO42880.1|  hypothetical protein CISIN_1g042294mg                   220   6e-66    
ref|XP_004974464.1|  PREDICTED: strictosidine synthase 1-like           228   8e-66    
ref|XP_004955258.1|  PREDICTED: strictosidine synthase 1-like           228   9e-66    
ref|XP_008657057.1|  PREDICTED: LOW QUALITY PROTEIN: strictosidin...    227   9e-66    
ref|XP_008657056.1|  PREDICTED: strictosidine synthase 3-like           227   1e-65    
ref|XP_010246302.1|  PREDICTED: strictosidine synthase 3-like           228   1e-65    
emb|CBX25285.1|  hypothetical_protein                                   231   1e-65    
ref|XP_002438640.1|  hypothetical protein SORBIDRAFT_10g023490          227   1e-65    
ref|XP_002450243.1|  hypothetical protein SORBIDRAFT_05g002470          228   1e-65    
ref|XP_010230125.1|  PREDICTED: strictosidine synthase 1-like           227   1e-65    
gb|EMT11668.1|  Strictosidine synthase 1                                226   2e-65    
ref|XP_003576963.1|  PREDICTED: strictosidine synthase 3-like           226   2e-65    
ref|XP_003572967.1|  PREDICTED: strictosidine synthase 1-like           226   2e-65    
ref|XP_004970743.1|  PREDICTED: strictosidine synthase 3-like           226   3e-65    
ref|XP_008655524.1|  PREDICTED: strictosidine synthase 3-like           226   3e-65    
ref|XP_002275622.2|  PREDICTED: strictosidine synthase 1-like           226   3e-65    
tpg|DAA45309.1|  TPA: hypothetical protein ZEAMMB73_979948              226   3e-65    
ref|XP_004956696.1|  PREDICTED: strictosidine synthase 3-like           226   4e-65    
gb|AFW84563.1|  hypothetical protein ZEAMMB73_589231                    226   4e-65    
emb|CDY22515.1|  BnaC03g23250D                                          226   5e-65    
ref|XP_004955245.1|  PREDICTED: strictosidine synthase 1-like           226   5e-65    



>ref|XP_006352136.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=407

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/381 (79%), Positives = 337/381 (88%), Gaps = 0/381 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESL  381
               ++ DPF LSPVG   F PVKNDIAPYK+VME WHGD  +RLGLGNLEFV+E++GPESL
Sbjct  27    AFLVADPFGLSPVGDTDFNPVKNDIAPYKQVMESWHGDKNNRLGLGNLEFVNEIYGPESL  86

Query  382   EFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQ  561
             EFD LG GPY GLADGRIVRWMG++AGWETFALVT NWSEK+C  G DSTTPKQ++ E +
Sbjct  87    EFDILGHGPYAGLADGRIVRWMGEDAGWETFALVTRNWSEKLCAKGKDSTTPKQYRVEPE  146

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRF+K+TGDLYIADAYYGLLVVGP+GG+AT LATHVEG  ILFANDLDIH NGS
Sbjct  147   CGRPLGLRFNKQTGDLYIADAYYGLLVVGPEGGVATSLATHVEGNRILFANDLDIHTNGS  206

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             IFFTDTS+KYNRVNHFLIMLEGE +GRLLRYD  T  THVVLD L FPNGVQ S+D +FL
Sbjct  207   IFFTDTSKKYNRVNHFLIMLEGEDSGRLLRYDIATKSTHVVLDGLTFPNGVQLSKDQTFL  266

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             LFTETTNCRLMKYW+EGPK G  E++ANLPGFPDNVR NEKGQ+WVAIDCCRTR QEVLI
Sbjct  267   LFTETTNCRLMKYWIEGPKRGIVEIVANLPGFPDNVRVNEKGQFWVAIDCCRTRAQEVLI  326

Query  1102  NHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             N+PW RS+YFRLP+ M+YLAR  GMKMYTVISLF++NGE++DVL+DK G VMKLVSEVRE
Sbjct  327   NNPWMRSIYFRLPIQMRYLARLMGMKMYTVISLFNENGEIIDVLQDKKGVVMKLVSEVRE  386

Query  1282  VDGKLWIGTVAHNHIATLPYP  1344
             ++GKLWIGTVAHNHIATLPYP
Sbjct  387   INGKLWIGTVAHNHIATLPYP  407



>ref|XP_009796703.1| PREDICTED: strictosidine synthase 1 [Nicotiana sylvestris]
Length=420

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/403 (76%), Positives = 350/403 (87%), Gaps = 1/403 (0%)
 Frame = +1

Query  139   MEKIRREVF-QQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGD  315
             ++ IR ++F Q+    LL V    ++ DPF LSPVG   FRPVKNDIAPY++VME WHGD
Sbjct  18    IQLIRSQLFVQRPYLFLLSVAFAFLVTDPFGLSPVGENDFRPVKNDIAPYEQVMESWHGD  77

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
              KSRL  GNLEFV+E++GPESLEFD  GRGPY GLADGRIVRW+G++ GWETFALVT NW
Sbjct  78    KKSRLSRGNLEFVNEIYGPESLEFDISGRGPYAGLADGRIVRWLGEDIGWETFALVTHNW  137

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             SEK+C  G DSTT KQWK E QCGRPLGLRF+K++GDLYIADAY+GLLVVGP+GG+ATPL
Sbjct  138   SEKLCAKGKDSTTSKQWKVEPQCGRPLGLRFNKQSGDLYIADAYHGLLVVGPEGGVATPL  197

Query  676   ATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKT  855
             ATHVEGKPILFANDLDIH NGSIFFTDTS+KYNRVNHFLIMLEGE +GR+LRYD  T  T
Sbjct  198   ATHVEGKPILFANDLDIHTNGSIFFTDTSKKYNRVNHFLIMLEGEDSGRILRYDIATRST  257

Query  856   HVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRA  1035
             HVVLD LAFPNGVQ S+D SFLLFTETTNCRLMK W+EG K+G  EVIANLPGFPDNVRA
Sbjct  258   HVVLDGLAFPNGVQLSKDQSFLLFTETTNCRLMKLWLEGQKAGNVEVIANLPGFPDNVRA  317

Query  1036  NEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNG  1215
             NEKG++WVAIDCCRTR QEVLI++PW RS+YFRLP+ M+YLAR  GM+MYTVISLF++NG
Sbjct  318   NEKGEFWVAIDCCRTRSQEVLIHNPWMRSIYFRLPVQMRYLARLMGMRMYTVISLFNENG  377

Query  1216  EVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             E++DVLEDK G VMKLVSEVRE++GKLWIGTVAHNHIATL YP
Sbjct  378   EIIDVLEDKKGVVMKLVSEVREINGKLWIGTVAHNHIATLHYP  420



>ref|XP_004234762.1| PREDICTED: strictosidine synthase [Solanum lycopersicum]
Length=414

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/381 (79%), Positives = 338/381 (89%), Gaps = 0/381 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESL  381
               ++ DPF LSPVG   F PVKNDIAPYK+VME WHGD  +RLGLGNLEFV+E++GPESL
Sbjct  34    AFLVADPFGLSPVGDTDFNPVKNDIAPYKQVMESWHGDKNNRLGLGNLEFVNEIYGPESL  93

Query  382   EFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQ  561
             EFD LG GPY GLADGRIVRWMG++AGWETFA+VT NWSEK+C  G DSTTPKQ++ E +
Sbjct  94    EFDILGHGPYAGLADGRIVRWMGEDAGWETFAVVTRNWSEKLCAKGKDSTTPKQYRVEPE  153

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRF+K+TGDLYIADAYYGLLVVGP+GG+AT LATHVEGK ILFANDLDIH NGS
Sbjct  154   CGRPLGLRFNKQTGDLYIADAYYGLLVVGPEGGVATSLATHVEGKRILFANDLDIHTNGS  213

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             IFFTDTS+KYNRVNHFLIMLEGE +GRLLRYD  T  T+VVLD L FPNGVQ S+D +FL
Sbjct  214   IFFTDTSKKYNRVNHFLIMLEGEDSGRLLRYDIATKSTNVVLDGLTFPNGVQLSKDQTFL  273

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             LFTETTNCRLMKYW+EGPK G  E++ANLPGFPDNVR NEKGQ+WVAIDCCRTR QEVLI
Sbjct  274   LFTETTNCRLMKYWIEGPKRGIVEIVANLPGFPDNVRVNEKGQFWVAIDCCRTRAQEVLI  333

Query  1102  NHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             N+PW RS+YFRLP+ M+YLAR  GMKMYTVISLF++NGE++DVL+DK G VMKLVSEVRE
Sbjct  334   NNPWMRSIYFRLPIQMRYLARLMGMKMYTVISLFNENGEIIDVLQDKKGVVMKLVSEVRE  393

Query  1282  VDGKLWIGTVAHNHIATLPYP  1344
             V+GKLWIGTVAHNHIATLPYP
Sbjct  394   VNGKLWIGTVAHNHIATLPYP  414



>gb|EYU41103.1| hypothetical protein MIMGU_mgv1a007213mg [Erythranthe guttata]
Length=415

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/381 (78%), Positives = 340/381 (89%), Gaps = 0/381 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             +  M+ DPFELSPVGG  F PV+NDIAPYK VME W  DN+SRLGLGNLEF DE+FGPES
Sbjct  26    LSFMVMDPFELSPVGGLDFSPVENDIAPYKSVMESWPWDNRSRLGLGNLEFKDEIFGPES  85

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD+LGRGPY GL DGR+VRWMG  +GWETFALV+ NWSEK C  GVDSTT KQWK ES
Sbjct  86    LEFDSLGRGPYAGLGDGRVVRWMGQESGWETFALVSRNWSEKQCAQGVDSTTKKQWKMES  145

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
             +CGRPLGLRFD K+GDLYIADAYYGL+VVGP GG+ATPLATHV+G PILFANDLDIH+NG
Sbjct  146   ECGRPLGLRFDTKSGDLYIADAYYGLMVVGPSGGVATPLATHVDGDPILFANDLDIHENG  205

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++YNRVNHF I+LEGEATGRLLRYDP T  THVVL+ LAFPNGVQ S+D SF
Sbjct  206   SIFFTDTSKRYNRVNHFFILLEGEATGRLLRYDPSTKTTHVVLEGLAFPNGVQLSKDQSF  265

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCR+MKY++EGPKSG+TE++ NLPGFPDNVR NE+G++WVAIDCCRT  QEV 
Sbjct  266   LLFTETTNCRIMKYFLEGPKSGKTELVVNLPGFPDNVRVNERGEFWVAIDCCRTAAQEVF  325

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
             + +PW RSVYFRLP+PM+YLARFAGM+MYT+I+L +  G++LDVL+DK+GDVMKLVSEVR
Sbjct  326   VRNPWLRSVYFRLPVPMRYLARFAGMRMYTMIALLNDKGDILDVLDDKNGDVMKLVSEVR  385

Query  1279  EVDGKLWIGTVAHNHIATLPY  1341
             EV+G+LWIGTVAHNHIATLPY
Sbjct  386   EVNGRLWIGTVAHNHIATLPY  406



>ref|XP_009630288.1| PREDICTED: strictosidine synthase [Nicotiana tomentosiformis]
Length=398

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/381 (79%), Positives = 338/381 (89%), Gaps = 0/381 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESL  381
               ++ DPF LSPVG   FRPVKNDIAPY++V+E WHGD KSRL LGNLEFV+E++GPESL
Sbjct  18    AFLVTDPFGLSPVGENDFRPVKNDIAPYEQVIESWHGDKKSRLSLGNLEFVNEIYGPESL  77

Query  382   EFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQ  561
             EFD  GRGPY GLADGRIVRW+G++ GWETFALVT NWSEK+C  G DSTT KQWK E +
Sbjct  78    EFDISGRGPYAGLADGRIVRWLGEDIGWETFALVTHNWSEKLCAKGKDSTTSKQWKVEPK  137

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRF+K++GDLYIADAYYGLLVVGP+GG+AT LATHVEGKPILFANDLDIH NGS
Sbjct  138   CGRPLGLRFNKQSGDLYIADAYYGLLVVGPEGGVATSLATHVEGKPILFANDLDIHTNGS  197

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             IFFTDTS+KYNRVNHFLIMLEGE TGR+LRYD  T  THVVLD LAFPNGVQ S+D SFL
Sbjct  198   IFFTDTSKKYNRVNHFLIMLEGEDTGRILRYDIATRSTHVVLDGLAFPNGVQLSKDQSFL  257

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             LFTETTNCRLMK W+EG K+G  EVIANLPGFPDNVRAN+KG++WVAIDCCRTR QE+LI
Sbjct  258   LFTETTNCRLMKLWLEGGKAGSVEVIANLPGFPDNVRANDKGEFWVAIDCCRTRSQEILI  317

Query  1102  NHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             ++PW RS+YFRLP+ M+YLAR  GM+MYTVISLF++NGE++DVLEDK G VMKLVSEVRE
Sbjct  318   HNPWMRSIYFRLPVQMRYLARLMGMRMYTVISLFNENGEIIDVLEDKKGVVMKLVSEVRE  377

Query  1282  VDGKLWIGTVAHNHIATLPYP  1344
              +GKLWIGTVAHNHIATLPYP
Sbjct  378   NNGKLWIGTVAHNHIATLPYP  398



>ref|XP_011091642.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 12 [Sesamum indicum]
Length=414

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/395 (75%), Positives = 350/395 (89%), Gaps = 0/395 (0%)
 Frame = +1

Query  160   VFQQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLG  339
             ++Q    ++  + +  ++ DPFELSPVGG  FRPV+N+IAPY++VME W  DN SRLGLG
Sbjct  13    LYQHPCIVIFVLALSFIVMDPFELSPVGGHDFRPVENEIAPYQQVMESWPWDNGSRLGLG  72

Query  340   NLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLG  519
             NL F DE+FGPESLEFD LGRGPY GLADGR+VRWMG +AGWETFALVT NW+EK+C  G
Sbjct  73    NLVFKDEIFGPESLEFDVLGRGPYAGLADGRVVRWMGKDAGWETFALVTHNWTEKLCAQG  132

Query  520   VDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKP  699
             V+STT KQWK E++CGRPLGLRFD+KTG+LYIADAYYGL+VVGP+GG+ATPLATHV+G P
Sbjct  133   VNSTTTKQWKIEAKCGRPLGLRFDQKTGNLYIADAYYGLMVVGPEGGVATPLATHVDGNP  192

Query  700   ILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLA  879
             ILFANDLDIH NGSIFFTDTS++YNRV+HF I+LEGEATGRLLRYDP T  THVV++ LA
Sbjct  193   ILFANDLDIHDNGSIFFTDTSRRYNRVDHFFILLEGEATGRLLRYDPHTRTTHVVMEGLA  252

Query  880   FPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWV  1059
             FPNGVQ S+D SFLLFTETTNCR+MK+++EGPK+G+TEV+ANLPGFPDNVR NEKG++WV
Sbjct  253   FPNGVQLSKDQSFLLFTETTNCRIMKHFLEGPKTGKTEVVANLPGFPDNVRINEKGEFWV  312

Query  1060  AIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLED  1239
             AIDCCRT  QEVLI++PW RSVYFRLP+PM++LAR  GM+MYTVI+L +  GE+LDVL+D
Sbjct  313   AIDCCRTAAQEVLIHNPWLRSVYFRLPIPMRHLARMVGMRMYTVIALLNGEGEILDVLDD  372

Query  1240  KHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             K GDVMKLVSEV+EV+GKLWIGTVAHNHIATLPYP
Sbjct  373   KRGDVMKLVSEVKEVNGKLWIGTVAHNHIATLPYP  407



>emb|CDO97660.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/382 (77%), Positives = 338/382 (88%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             +G ++ DPF+LSPVGG  FRPVKND+APYK+VME W  DN+SRLG GNLEFVDE+FGPES
Sbjct  25    VGFLVMDPFDLSPVGGIDFRPVKNDVAPYKQVMESWPRDNRSRLGEGNLEFVDEIFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD  GRGPY GLADGRIVRWMG +AGWETFALVT NW+EK+C  G DST+ K WK E 
Sbjct  85    LEFDIQGRGPYTGLADGRIVRWMGKDAGWETFALVTRNWTEKLCAKGKDSTSSKHWKDEP  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
             +CGRPLGLRFDK+TG LYIADAYYGLLVVGP+GGIATPL+T V GKPILFANDLDIHKNG
Sbjct  145   KCGRPLGLRFDKQTGKLYIADAYYGLLVVGPEGGIATPLSTQVGGKPILFANDLDIHKNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS +YNRV HF I+LEGE+TGRLLRYDPPTG THVVLD LAF NGVQ S+DH+F
Sbjct  205   SIFFTDTSTRYNRVKHFFILLEGESTGRLLRYDPPTGTTHVVLDGLAFANGVQLSKDHTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LL+TETTN RLMK W+EGPKSG  E++A+LPGFPDNVR NEKG++WVAIDCCRT++QE L
Sbjct  265   LLYTETTNSRLMKLWLEGPKSGSRELVADLPGFPDNVRINEKGEFWVAIDCCRTKVQETL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
             I +PW R+VYFRLP+PM+YLAR  GMKMYTVISLF++ GE++DVLED+ G  MKLVSEVR
Sbjct  325   IRNPWMRNVYFRLPIPMRYLARMVGMKMYTVISLFNEKGEIVDVLEDRKGKAMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E++GKLWIGTVAHNHIAT+PYP
Sbjct  385   ELNGKLWIGTVAHNHIATIPYP  406



>ref|XP_002310427.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEE90877.2| strictosidine synthase family protein [Populus trichocarpa]
Length=406

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/382 (77%), Positives = 342/382 (90%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             IG +I DPF++ P+G   F+PVK+D+APYK+VME W  DNKSRLG GNLEFV+EVFGPES
Sbjct  25    IGFVIMDPFKMGPLGHHDFKPVKHDLAPYKQVMENWPRDNKSRLGSGNLEFVNEVFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD+LGRGPY GLADGR+VRWMG++ GWETFALV+ NWSEK+C  GVDSTT KQWK E 
Sbjct  85    LEFDSLGRGPYAGLADGRVVRWMGEDVGWETFALVSTNWSEKLCARGVDSTTSKQWKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRF K++G+LYIADAYYGLLVVGP+GG+ATPLATHV G+PILFANDLDIHKNG
Sbjct  145   LCGRPLGLRFHKESGNLYIADAYYGLLVVGPEGGLATPLATHVRGEPILFANDLDIHKNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++Y+RV+HF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNGVQ S+D +F
Sbjct  205   SIFFTDTSKRYDRVDHFFILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGVQLSKDQTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             L+FTETTNCR+MKYW+EGPK+G+ E++ANLPGFPDNVR NEKGQ+WVAIDCCRT  QEVL
Sbjct  265   LVFTETTNCRIMKYWLEGPKTGKVELVANLPGFPDNVRLNEKGQFWVAIDCCRTAAQEVL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              N+PW +SVYFRLP+ M+YLA   GMKMYTV+SLF++NGE+L+VLED  G VMKLVSEVR
Sbjct  325   TNNPWVKSVYFRLPIRMRYLAWLMGMKMYTVVSLFNENGEILEVLEDPKGVVMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV+GKLWIGTVAHNHIATLPYP
Sbjct  385   EVEGKLWIGTVAHNHIATLPYP  406



>ref|XP_008363735.1| PREDICTED: strictosidine synthase-like [Malus domestica]
Length=408

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/381 (77%), Positives = 338/381 (89%), Gaps = 0/381 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESL  381
             G ++ DP ++ P+G  +F+PVK+ IAPYK+VMERW  DN+SRLGLG LEF D+VFGPESL
Sbjct  28    GFVMMDPLQMGPLGNHEFKPVKHSIAPYKQVMERWPRDNESRLGLGKLEFEDQVFGPESL  87

Query  382   EFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQ  561
             EFD LGRGPY GLADGR+VRWMG + GWETFALVT NWSEK+C  G+DSTT KQWK E +
Sbjct  88    EFDALGRGPYTGLADGRVVRWMGKDLGWETFALVTTNWSEKVCAKGIDSTTHKQWKHEKK  147

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRFDK++GDLYIADAYYGLLVVGP+GGIA+ L+THVEGKPILFANDLDIHKNGS
Sbjct  148   CGRPLGLRFDKESGDLYIADAYYGLLVVGPEGGIASTLSTHVEGKPILFANDLDIHKNGS  207

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             IFFTDTS++YNRV+HF+I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNG+Q S+D +FL
Sbjct  208   IFFTDTSKRYNRVDHFVILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGIQLSQDQTFL  267

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             LFTETTNCRLMKYW+EGPK+G  E++ANLPGFPDN+R NEKGQ+WVAIDCCRT+ QEVL 
Sbjct  268   LFTETTNCRLMKYWLEGPKTGTVEIVANLPGFPDNIRINEKGQFWVAIDCCRTQAQEVLS  327

Query  1102  NHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             ++PW RSVYFRLP+ M YLAR  GMKMYT+ISLFD+ GE+L+VLED+ G VMKLVSEVRE
Sbjct  328   HNPWIRSVYFRLPIRMTYLARIMGMKMYTMISLFDEKGEILEVLEDRKGVVMKLVSEVRE  387

Query  1282  VDGKLWIGTVAHNHIATLPYP  1344
               GKLWIGTVAHNHIATL YP
Sbjct  388   AKGKLWIGTVAHNHIATLTYP  408



>ref|XP_011011510.1| PREDICTED: strictosidine synthase-like [Populus euphratica]
Length=406

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/382 (77%), Positives = 341/382 (89%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             IG +I DPF++ P+G   F+PVK+D+APYK+VME W  DNKSRLG GNLEFVDEVFGPES
Sbjct  25    IGFVIMDPFKMGPLGHHDFKPVKHDLAPYKQVMENWPRDNKSRLGSGNLEFVDEVFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD+LGRGPY GLADGR+VRWMG++ GWETFALV+ NWSEK+C  GVDSTT KQWK E 
Sbjct  85    LEFDSLGRGPYAGLADGRVVRWMGEDVGWETFALVSTNWSEKLCARGVDSTTSKQWKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRF K++G+LYIADAYYGLLVVGP+GG+ATPLATHV G PILFANDLDIHKNG
Sbjct  145   LCGRPLGLRFHKESGNLYIADAYYGLLVVGPEGGLATPLATHVRGDPILFANDLDIHKNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++Y+RV+HF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNGVQ S+D +F
Sbjct  205   SIFFTDTSKRYDRVDHFFILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGVQLSKDQTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             L+FTETTNCR+MKYW+EGPK+G+ E++ANLPGFPDNVR NEKGQ+WVAIDCCRT  QEVL
Sbjct  265   LVFTETTNCRIMKYWLEGPKTGKVELVANLPGFPDNVRLNEKGQFWVAIDCCRTAAQEVL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW +SVYFRLP+ M+YLA   GMKMYTV+SLF++NGE+L+VLED  G VMKLVSEVR
Sbjct  325   THNPWVKSVYFRLPIRMRYLAWLMGMKMYTVVSLFNENGEILEVLEDPKGVVMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV+GKLWIGTVAHNHIAT+PYP
Sbjct  385   EVEGKLWIGTVAHNHIATIPYP  406



>ref|XP_007222749.1| hypothetical protein PRUPE_ppa006506mg [Prunus persica]
 gb|EMJ23948.1| hypothetical protein PRUPE_ppa006506mg [Prunus persica]
Length=408

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/376 (78%), Positives = 335/376 (89%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DP ++ P+G  +FRPVK++IAPYK+VMERW  DN+SRLG G LEF DEVFGPESLEFD  
Sbjct  33    DPLQMGPLGDHEFRPVKHNIAPYKQVMERWPRDNESRLGFGKLEFEDEVFGPESLEFDAF  92

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG++ GWETFALVT NWS+++C  G+DSTT KQWK E +CGRPL
Sbjct  93    GRGPYTGLADGRIVRWMGNDLGWETFALVTSNWSKQVCAKGIDSTTHKQWKHEKKCGRPL  152

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK++GDLYIADAYYGLLVVGP GG+ATPL+THVEGKPILFANDLDIHKNGSIFFTD
Sbjct  153   GLRFDKESGDLYIADAYYGLLVVGPQGGLATPLSTHVEGKPILFANDLDIHKNGSIFFTD  212

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRVNHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D +FLLFTET
Sbjct  213   TSKRYNRVNHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGLQLSKDQTFLLFTET  272

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMKYW+EGPK+G  E++ANLPGFPDN+R NEKGQ+WVAIDCCRT  QEVL ++PW 
Sbjct  273   TNCRLMKYWLEGPKNGTVELVANLPGFPDNIRINEKGQFWVAIDCCRTPAQEVLSHNPWI  332

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RSVYFRLP+ M YLARF GMKMYT+ISLF++ GE+L+VLED+ G VMKLVSEVRE  GKL
Sbjct  333   RSVYFRLPIRMTYLARFMGMKMYTLISLFNEKGEILEVLEDQKGAVMKLVSEVREAKGKL  392

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATLPYP
Sbjct  393   WIGTVAHNHIATLPYP  408



>ref|XP_009363644.1| PREDICTED: strictosidine synthase [Pyrus x bretschneideri]
Length=408

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/376 (78%), Positives = 334/376 (89%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DP ++ P+G  +F+PVK+ IAPYK+VMERW  DN+SRLGLG LEF D+VFGPESLEFD L
Sbjct  33    DPLQMGPLGNHEFKPVKHSIAPYKQVMERWPRDNESRLGLGKLEFEDQVFGPESLEFDAL  92

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG + GWETFALVT NWSEK+C  G+DSTT KQWK E +CGRPL
Sbjct  93    GRGPYTGLADGRIVRWMGKDLGWETFALVTTNWSEKVCAKGIDSTTHKQWKHEKKCGRPL  152

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK++GDLYIADAYYGLLVVGP+GGIAT L+THVEGKPILFANDLDIH+NGSIFFTD
Sbjct  153   GLRFDKESGDLYIADAYYGLLVVGPEGGIATTLSTHVEGKPILFANDLDIHRNGSIFFTD  212

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRV+HF+I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNG+Q S+D +FLLFTET
Sbjct  213   TSKRYNRVDHFVILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGIQLSKDQTFLLFTET  272

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMKYW+EGPK+G  E++ANLPGFPDN+R NEKGQ+WVAIDCCRT  QEVL ++PW 
Sbjct  273   TNCRLMKYWLEGPKTGTVELVANLPGFPDNIRINEKGQFWVAIDCCRTPAQEVLSHNPWI  332

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RSVYFRLP+ M YLAR  GMKMYT+ISLFD+ GE+L+VLED+ G VMKLVSEVRE  GKL
Sbjct  333   RSVYFRLPIRMTYLARIMGMKMYTMISLFDEKGEILEVLEDRKGVVMKLVSEVREAKGKL  392

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATL YP
Sbjct  393   WIGTVAHNHIATLTYP  408



>ref|XP_008439075.1| PREDICTED: strictosidine synthase [Cucumis melo]
Length=421

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/376 (78%), Positives = 332/376 (88%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPFE+SPVGG  FRPVK+DIAPY +VM  W  DN+SRLGLGNLEF DEVFGPESLEFD L
Sbjct  31    DPFEMSPVGGYDFRPVKHDIAPYSQVMGHWPKDNESRLGLGNLEFEDEVFGPESLEFDAL  90

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG+  GWETFA+VTPNWSEK+C  GVDSTT KQWK E +CGRPL
Sbjct  91    GRGPYTGLADGRIVRWMGEEIGWETFAIVTPNWSEKVCAKGVDSTTAKQWKNEKKCGRPL  150

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF+K++G+LYIADAYYGLLVVGP GG ATPLATHVEG PILFANDLDIH NGSIFFTD
Sbjct  151   GLRFEKQSGNLYIADAYYGLLVVGPQGGTATPLATHVEGTPILFANDLDIHNNGSIFFTD  210

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRV HF I+LEGEA+GRLLRYDP T  THVVL+ LAFPNGVQ S+DH+FLL+TET
Sbjct  211   TSKRYNRVEHFFILLEGEASGRLLRYDPSTKTTHVVLNGLAFPNGVQLSKDHTFLLYTET  270

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMK W+EG ++G+ EV+ANLPGFPDNVR NE+ +YWVAIDCCRT+ QEVL ++PW 
Sbjct  271   TNCRLMKLWLEGARNGKVEVVANLPGFPDNVRRNERNEYWVAIDCCRTKAQEVLTHNPWI  330

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RS+YFRLPL M +LAR  GMKMYTVISLF +NGE+L+VLED+ G+VM+L+SEVREV GKL
Sbjct  331   RSIYFRLPLRMSFLARLIGMKMYTVISLFSENGEILEVLEDQKGEVMELMSEVREVQGKL  390

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATL YP
Sbjct  391   WIGTVAHNHIATLTYP  406



>ref|XP_006372847.1| strictosidine synthase family protein [Populus trichocarpa]
 gb|ERP50644.1| strictosidine synthase family protein [Populus trichocarpa]
Length=406

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/382 (76%), Positives = 336/382 (88%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             I  +I DPF + P+G   F+P K+D+APYK+VME W  DN+SRLG GNLEFVDEVFGPES
Sbjct  25    ISFVIMDPFRMGPLGDHDFKPFKHDLAPYKQVMENWPRDNRSRLGSGNLEFVDEVFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD+LGRGPY GLADGR+VRWMG + GWETFALVT NWSEK+C  GVDSTT KQWK E 
Sbjct  85    LEFDSLGRGPYAGLADGRVVRWMGQDVGWETFALVTTNWSEKLCARGVDSTTSKQWKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLR  K++G+LYIADAYYGLLVVGP+GG+ATPLATH+ G PILFANDLDIHKNG
Sbjct  145   LCGRPLGLRLHKESGNLYIADAYYGLLVVGPEGGLATPLATHLGGDPILFANDLDIHKNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++Y+RV+HF I+LEGE+TGRLLRYDPPT  THVVLD LAFPNGVQ S D +F
Sbjct  205   SIFFTDTSKRYDRVDHFFILLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGVQLSRDQTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             ++FTETTNCRLMKYW+EGPK+GR E++ANLPGFPDNVR N++GQ+WVAIDCCRT  QEVL
Sbjct  265   IVFTETTNCRLMKYWLEGPKTGRVELVANLPGFPDNVRLNDRGQFWVAIDCCRTAAQEVL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
               +PW +SVYFRLP+ M+YLAR  GMKMYTV+SLF++NGE+L+VLED  G+VMKLVSEVR
Sbjct  325   TQNPWMKSVYFRLPIQMRYLARMMGMKMYTVVSLFNENGEILEVLEDPKGEVMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV+GKLWIGTVAHNHIATLPYP
Sbjct  385   EVEGKLWIGTVAHNHIATLPYP  406



>ref|XP_006478730.1| PREDICTED: strictosidine synthase-like [Citrus sinensis]
Length=406

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/382 (77%), Positives = 333/382 (87%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             +G +I DP ++ P+GG +FRPVK+DIAPY++VM+ W  DN SRL  G LEFVDEVFGPES
Sbjct  25    LGFLIMDPLQMGPLGGHEFRPVKHDIAPYRQVMQSWPRDNLSRLVTGKLEFVDEVFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD LGRGPY GLADGRIVRWMG+N GWETFA+VT NWSEK+C  GVDSTT KQWK E 
Sbjct  85    LEFDGLGRGPYAGLADGRIVRWMGENVGWETFAIVTSNWSEKLCARGVDSTTAKQWKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRF+K TGDLYIADAYYGLLVVG  GG+ATPLAT   GKPILFANDLD+HKNG
Sbjct  145   WCGRPLGLRFNKDTGDLYIADAYYGLLVVGSKGGLATPLATQAGGKPILFANDLDVHKNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++YNRV+HF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNGVQ S+DHSF
Sbjct  205   SIFFTDTSKRYNRVDHFFILLEGESTGRLLRYDPPTKATHIVLDGLAFPNGVQLSKDHSF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCRLMKYW+EGPK+G  E++ANLPGFPDNVR NE+GQ+WVAIDCCRT  QEVL
Sbjct  265   LLFTETTNCRLMKYWLEGPKTGTVELVANLPGFPDNVRINERGQFWVAIDCCRTAAQEVL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW RS+YFRLP+ M +LAR  GMKMYTVISLF++NGE+L+VLED  G VMKLVSEV+
Sbjct  325   SHNPWIRSIYFRLPIRMSFLARVMGMKMYTVISLFNENGEILEVLEDPRGVVMKLVSEVK  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E  GKLWIGTVAHNHIATLPYP
Sbjct  385   EAQGKLWIGTVAHNHIATLPYP  406



>ref|XP_003632076.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=406

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/376 (78%), Positives = 331/376 (88%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF + P+GG +F PVK+DIAPYK VME W  DN+SRLG G LEFVDEVFGPESLEFD  
Sbjct  31    DPFHMGPIGGHEFMPVKHDIAPYKRVMEDWPRDNRSRLGQGKLEFVDEVFGPESLEFDIF  90

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMGD+ GWETFALVTPNWSEK+C  G+DSTT KQWK E +CGRPL
Sbjct  91    GRGPYTGLADGRIVRWMGDSVGWETFALVTPNWSEKLCAKGIDSTTSKQWKVEQRCGRPL  150

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF K+TGDLYIADAYYGLLVVGP+GG+ATPL THV+GKPILFANDLDIHKNGSIFFTD
Sbjct  151   GLRFHKETGDLYIADAYYGLLVVGPEGGLATPLVTHVQGKPILFANDLDIHKNGSIFFTD  210

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNR+NHF I+LEGEATGRLLRYDPPT  TH+VLD LAFPNGVQ S D SFLLFTET
Sbjct  211   TSKRYNRMNHFFILLEGEATGRLLRYDPPTRTTHLVLDGLAFPNGVQLSGDQSFLLFTET  270

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMKYW+EGPKSG  E++ANLPGFPDNVR NE+GQ+WVAIDCCRT  QEVL ++PW 
Sbjct  271   TNCRLMKYWLEGPKSGIVELVANLPGFPDNVRLNERGQFWVAIDCCRTPAQEVLTHNPWL  330

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             +++YFRLP+ +  LAR  GMKMYTVISLF++ GE+L+VLED+ G VM+LVSEVREV GKL
Sbjct  331   KNIYFRLPVKLSMLARLMGMKMYTVISLFNEKGEILEVLEDRKGLVMRLVSEVREVKGKL  390

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATL YP
Sbjct  391   WIGTVAHNHIATLSYP  406



>ref|XP_004147676.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
 ref|XP_004160659.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
Length=421

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/376 (78%), Positives = 332/376 (88%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPFE+SPVGG  FRPVK+DIAPY +VM  W  DN+SRLGLGNLEF DEVFGPESLEFD L
Sbjct  31    DPFEMSPVGGYDFRPVKHDIAPYSQVMGHWPKDNESRLGLGNLEFEDEVFGPESLEFDAL  90

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG+  GWETFA+VTPNWSEK+C  GVDSTT KQWK E +CGRPL
Sbjct  91    GRGPYTGLADGRIVRWMGEEIGWETFAIVTPNWSEKVCAKGVDSTTAKQWKNEKKCGRPL  150

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF+K++G+LYIADAYYGLLVVGP GG ATPLATHVEG PILFANDLDIH NGSIFFTD
Sbjct  151   GLRFEKQSGNLYIADAYYGLLVVGPQGGTATPLATHVEGTPILFANDLDIHNNGSIFFTD  210

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRV HF I+LEGEA+GRLLRYDP T  THVVL+ LAFPNGVQ S+DH+FLL+TET
Sbjct  211   TSKRYNRVEHFFILLEGEASGRLLRYDPSTKTTHVVLNGLAFPNGVQLSKDHTFLLYTET  270

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMK W+EG ++G+ EV+ANLPGFPDNVR N++ +YWVAIDCCRT+ QEVL ++PW 
Sbjct  271   TNCRLMKLWLEGARNGKVEVVANLPGFPDNVRRNDRNEYWVAIDCCRTKAQEVLTHNPWI  330

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RS+YFRLPL M +LAR  GMKMYTVISLF +NGE+L+VLED+ G+VM+L+SEVREV GKL
Sbjct  331   RSIYFRLPLRMSFLARLIGMKMYTVISLFSENGEILEVLEDQKGEVMELMSEVREVQGKL  390

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATL YP
Sbjct  391   WIGTVAHNHIATLTYP  406



>gb|KGN57252.1| hypothetical protein Csa_3G174550 [Cucumis sativus]
Length=422

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/376 (78%), Positives = 332/376 (88%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPFE+SPVGG  FRPVK+DIAPY +VM  W  DN+SRLGLGNLEF DEVFGPESLEFD L
Sbjct  31    DPFEMSPVGGYDFRPVKHDIAPYSQVMGHWPKDNESRLGLGNLEFEDEVFGPESLEFDAL  90

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG+  GWETFA+VTPNWSEK+C  GVDSTT KQWK E +CGRPL
Sbjct  91    GRGPYTGLADGRIVRWMGEEIGWETFAIVTPNWSEKVCAKGVDSTTAKQWKNEKKCGRPL  150

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF+K++G+LYIADAYYGLLVVGP GG ATPLATHVEG PILFANDLDIH NGSIFFTD
Sbjct  151   GLRFEKQSGNLYIADAYYGLLVVGPQGGTATPLATHVEGTPILFANDLDIHNNGSIFFTD  210

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRV HF I+LEGEA+GRLLRYDP T  THVVL+ LAFPNGVQ S+DH+FLL+TET
Sbjct  211   TSKRYNRVEHFFILLEGEASGRLLRYDPSTKTTHVVLNGLAFPNGVQLSKDHTFLLYTET  270

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMK W+EG ++G+ EV+ANLPGFPDNVR N++ +YWVAIDCCRT+ QEVL ++PW 
Sbjct  271   TNCRLMKLWLEGARNGKVEVVANLPGFPDNVRRNDRNEYWVAIDCCRTKAQEVLTHNPWI  330

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RS+YFRLPL M +LAR  GMKMYTVISLF +NGE+L+VLED+ G+VM+L+SEVREV GKL
Sbjct  331   RSIYFRLPLRMSFLARLIGMKMYTVISLFSENGEILEVLEDQKGEVMELMSEVREVQGKL  390

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATL YP
Sbjct  391   WIGTVAHNHIATLTYP  406



>ref|XP_007033906.1| Calcium-dependent phosphotriesterase superfamily protein [Theobroma 
cacao]
 gb|EOY04832.1| Calcium-dependent phosphotriesterase superfamily protein [Theobroma 
cacao]
Length=406

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/382 (78%), Positives = 336/382 (88%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
              G ++ DPF+L PVGG +FRPVK+DIAPYKEVM  W  DNKSRLG G LEFVDEV+GPES
Sbjct  25    FGFVMMDPFQLGPVGGLQFRPVKHDIAPYKEVMGSWPRDNKSRLGDGKLEFVDEVYGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD+LGRGPY GLADGRIVRWMG++ GWETFA+VT NWSEK+C  G DSTT KQWK E 
Sbjct  85    LEFDSLGRGPYAGLADGRIVRWMGEDIGWETFAIVTSNWSEKLCARGADSTTAKQWKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRF+K++GDLYIADA+YGLL VGPDGG+ATPLATHVEGK ILFANDLDIH+NG
Sbjct  145   WCGRPLGLRFNKESGDLYIADAHYGLLRVGPDGGLATPLATHVEGKLILFANDLDIHRNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS+KYNRVNHF I+LEGEATGRLLRYDPPT  TH+VLD LAFPNGVQFS D +F
Sbjct  205   SIFFTDTSKKYNRVNHFFILLEGEATGRLLRYDPPTKTTHIVLDGLAFPNGVQFSMDQTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             L+FTETTNCRLMKYW+EGPK+G  E++A+LPGFPDNVR N+KGQ+WVAIDCCRT  QEVL
Sbjct  265   LVFTETTNCRLMKYWLEGPKTGTVELVAHLPGFPDNVRINDKGQFWVAIDCCRTPAQEVL  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW RS+YFRLP+ M  LAR  GM+MYTVISLF++ GE+L+VLED  G VMKLVSEVR
Sbjct  325   THNPWMRSLYFRLPIRMSVLARIIGMRMYTVISLFNEKGEILEVLEDPRGVVMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E+ GKLWIGTVAHNHIATLPYP
Sbjct  385   EIQGKLWIGTVAHNHIATLPYP  406



>ref|XP_008222532.1| PREDICTED: strictosidine synthase 1-like [Prunus mume]
Length=408

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/376 (77%), Positives = 334/376 (89%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DP ++ P+G  +FRPVK++IAPYK+VMERW  DN+SRLG G LEF DEVFGPESLEFD L
Sbjct  33    DPLQMGPLGDHEFRPVKHNIAPYKQVMERWPRDNESRLGFGKLEFEDEVFGPESLEFDAL  92

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGRIVRWMG++ GWETFALVT NWS+ +C  G+DSTT KQWK E +CGRPL
Sbjct  93    GRGPYTGLADGRIVRWMGNDLGWETFALVTTNWSKPVCAKGIDSTTHKQWKHEKKCGRPL  152

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK++GDLYIADAYYGLLVVGP GG+ATPL+THVEGKPILFANDLDIHKNGSIFFTD
Sbjct  153   GLRFDKESGDLYIADAYYGLLVVGPQGGLATPLSTHVEGKPILFANDLDIHKNGSIFFTD  212

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS++YNRVNHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D +FL FTET
Sbjct  213   TSKRYNRVNHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGLQLSKDQTFLFFTET  272

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCRLMKYW+EGPK+G  E++A+LPGFPDN+R NEKGQ+WVAIDCCRT  QEVL ++PW 
Sbjct  273   TNCRLMKYWLEGPKNGTVELVADLPGFPDNIRINEKGQFWVAIDCCRTPAQEVLSHNPWI  332

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RSVYFRLP+ M YLARF GMKMYT+ISLF++ GE+L+VLED+ G VMKLVSEVRE  GKL
Sbjct  333   RSVYFRLPIRMTYLARFMGMKMYTLISLFNEKGEILEVLEDQKGAVMKLVSEVRESKGKL  392

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATLPYP
Sbjct  393   WIGTVAHNHIATLPYP  408



>ref|XP_010086695.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXB23111.1| Strictosidine synthase 1 [Morus notabilis]
Length=407

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/382 (77%), Positives = 332/382 (87%), Gaps = 1/382 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPES  378
              ++I DP ++ P+GG+++RPVK+ IAPYK+VME W  DN+SRLG LG LEFV EVFGPES
Sbjct  26    ALVIMDPLKMGPLGGREYRPVKHSIAPYKQVMESWPRDNQSRLGRLGKLEFVGEVFGPES  85

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD  G GPY GLADGRIVRWMG + GWETFALVT NWSEK+C  G DSTT KQWK E 
Sbjct  86    LEFDNRGCGPYTGLADGRIVRWMGKDVGWETFALVTKNWSEKLCAKGTDSTTTKQWKVEM  145

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
             +CGRPLGLRFDK++GDLYIADAYYGLLVVGP+GGIA PLA HV+GKPILFANDLDIH NG
Sbjct  146   KCGRPLGLRFDKESGDLYIADAYYGLLVVGPEGGIANPLAAHVDGKPILFANDLDIHSNG  205

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTSQ+YNRV+HF I+LEGEATGRLLRYDPPT  THVVLD LAFPNGVQ S D +F
Sbjct  206   SIFFTDTSQRYNRVDHFFILLEGEATGRLLRYDPPTKTTHVVLDGLAFPNGVQISRDQTF  265

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCRLMKYW+EGPK+G  E +ANLPGFPDNVR NEKGQ+WVAIDCCRT  QE+ 
Sbjct  266   LLFTETTNCRLMKYWLEGPKTGLVEAVANLPGFPDNVRINEKGQFWVAIDCCRTPAQEIF  325

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW RSVYFRLP+ M +LAR  GMKMYTVISLF+  GE+L+VLED++G VMKLVSEVR
Sbjct  326   SHNPWIRSVYFRLPVRMSFLARLMGMKMYTVISLFNDKGEILEVLEDRNGTVMKLVSEVR  385

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV+GKLWIGTVAHNHIATLPYP
Sbjct  386   EVNGKLWIGTVAHNHIATLPYP  407



>ref|XP_010243901.1| PREDICTED: strictosidine synthase 1 [Nelumbo nucifera]
Length=407

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/395 (74%), Positives = 342/395 (87%), Gaps = 0/395 (0%)
 Frame = +1

Query  160   VFQQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLG  339
             +FQ  ++ L+ + +  +  DPF+L P+GG+ FRPVK+D+APYK VM  W  DN+SRLG G
Sbjct  13    LFQHPVFFLIALAMAFIFMDPFQLGPLGGRDFRPVKHDVAPYKRVMGNWPKDNQSRLGSG  72

Query  340   NLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLG  519
              LEFV+EVFGPESLEFD  G+GPY GLADGRIVRWMGDN GWETFALVTPNWSEK+C  G
Sbjct  73    KLEFVNEVFGPESLEFDLNGQGPYAGLADGRIVRWMGDNVGWETFALVTPNWSEKLCVNG  132

Query  520   VDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKP  699
             + ST  KQ+K E +CGRPLGLRFD+  G+LYIADAYYGLLVVGP+GGIATPL THVEGKP
Sbjct  133   IHSTAAKQYKIEHRCGRPLGLRFDRTGGNLYIADAYYGLLVVGPEGGIATPLTTHVEGKP  192

Query  700   ILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLA  879
             I+FANDLDIHKNGSIFFTDTS++YNR+NHF I+LEGE+TGRLLRYD PT  TH+VL+ LA
Sbjct  193   IVFANDLDIHKNGSIFFTDTSKRYNRLNHFFILLEGESTGRLLRYDLPTKTTHIVLEGLA  252

Query  880   FPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWV  1059
             FPNGVQ S+D SFLLFTETTNCRLM+YW+EGPKSG  EV+A+LPG+PDNVR NEKGQ+WV
Sbjct  253   FPNGVQLSKDQSFLLFTETTNCRLMRYWLEGPKSGDVEVVADLPGYPDNVRINEKGQFWV  312

Query  1060  AIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLED  1239
             AIDCCRT  QEVL ++PW +S+YFRLPL M +LAR  GMKMYTVISLF + GE+L+VLED
Sbjct  313   AIDCCRTPAQEVLSHNPWIKSIYFRLPLKMSFLARLMGMKMYTVISLFSEKGEILEVLED  372

Query  1240  KHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             + G+VMKLVSEV+EV+GKLWIGTVAHNHIATLPYP
Sbjct  373   QKGEVMKLVSEVKEVNGKLWIGTVAHNHIATLPYP  407



>ref|XP_010512212.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
 ref|XP_010512213.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
 ref|XP_010512214.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
 ref|XP_010512215.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
Length=415

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 336/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VMERW  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  34    DPFHISPIGGREFKPVKHEVAPYKQVMERWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKACVRGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLL+VGP+GGIATPLATHVEGKPILFANDLD+H+NGSIFFT
Sbjct  154   LGLRFDKETGNLYIADAYYGLLMVGPEGGIATPLATHVEGKPILFANDLDVHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  THVVLD LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK+G  EV+A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL N+PW
Sbjct  274   TTNCRLVKYWLEGPKTGDVEVVADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLTNNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  334   IKSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  394   LWIGTVAHNHIATLPYP  410



>ref|XP_010469307.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
 ref|XP_010469308.1| PREDICTED: strictosidine synthase-like [Camelina sativa]
Length=415

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/377 (77%), Positives = 336/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VMERW  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  34    DPFHISPIGGREFKPVKHEVAPYKQVMERWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKACVRGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLL+VGP+GGIATPLATHVEGKPILFANDLD+H+NGSIFFT
Sbjct  154   LGLRFDKETGNLYIADAYYGLLMVGPEGGIATPLATHVEGKPILFANDLDVHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  THVVLD LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK+G  EV+A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL N+PW
Sbjct  274   TTNCRLVKYWLEGPKTGDVEVVADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLTNNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  334   IKSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  394   LWIGTVAHNHIATLPYP  410



>ref|XP_011037120.1| PREDICTED: strictosidine synthase 1-like [Populus euphratica]
Length=413

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/379 (76%), Positives = 334/379 (88%), Gaps = 0/379 (0%)
 Frame = +1

Query  205   IMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLE  384
              +I DPF++ P+G   F+P K+D+APYK+VME W  DN+SRLG GNLEFVDEVFGPESLE
Sbjct  27    FVIIDPFKMGPLGDHDFKPFKHDLAPYKQVMENWPRDNRSRLGSGNLEFVDEVFGPESLE  86

Query  385   FDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQC  564
             FD+LGRGPY GLADGR+VRWMG + GWETFALVT NWSEK+C  GVDSTT KQWK E  C
Sbjct  87    FDSLGRGPYAGLADGRVVRWMGQDVGWETFALVTSNWSEKLCARGVDSTTSKQWKHEKLC  146

Query  565   GRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSI  744
             GRPLGLRF K++G+LYIADAYYGLLVVGP+GG+ATPLATH+ G  ILFANDLDIHKNGSI
Sbjct  147   GRPLGLRFHKESGNLYIADAYYGLLVVGPEGGLATPLATHLGGDQILFANDLDIHKNGSI  206

Query  745   FFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLL  924
             FFTDTS++Y+RV+HF  +LEGE+TGRLLRYDPPT  THVVLD LAFPNGVQ S D +F++
Sbjct  207   FFTDTSKRYDRVDHFFRLLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGVQLSRDQTFIV  266

Query  925   FTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLIN  1104
             FTETTNCRLMKYW+EGPK+GR E++ANLPGFPDNVR N++GQ+WVAIDCCRT  QEVL  
Sbjct  267   FTETTNCRLMKYWLEGPKTGRVELVANLPGFPDNVRLNDRGQFWVAIDCCRTAAQEVLTQ  326

Query  1105  HPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             +PW +SVYFRLP+ M+YLAR  GMKMYTV+SLF++NGE+L+VLED  G+VMKLVSEVREV
Sbjct  327   NPWMKSVYFRLPIQMRYLARMVGMKMYTVVSLFNENGEILEVLEDPKGEVMKLVSEVREV  386

Query  1285  DGKLWIGTVAHNHIATLPY  1341
             +GKLWIGTVAHNHIATLPY
Sbjct  387   EGKLWIGTVAHNHIATLPY  405



>ref|XP_010524154.1| PREDICTED: strictosidine synthase 1 [Tarenaya hassleriana]
Length=413

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/383 (77%), Positives = 331/383 (86%), Gaps = 1/383 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPE  375
             +G ++ DPF+++PVGG +FRPVK+ IAPY  VME W  DN SRL   G LEFVDEVFGPE
Sbjct  27    VGFIVVDPFDMAPVGGHEFRPVKHKIAPYTRVMEDWKRDNLSRLARHGKLEFVDEVFGPE  86

Query  376   SLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFE  555
             SLEFD+LGRGPY GLADGRIVRWMG+  GWETFA VT NWSEK C  GVDSTT KQWK E
Sbjct  87    SLEFDSLGRGPYTGLADGRIVRWMGEATGWETFAAVTSNWSEKACARGVDSTTHKQWKHE  146

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDK+TG+L+IADAYYGLLVVGP+GG+AT L+THVEGKPILFANDLDIHKN
Sbjct  147   KLCGRPLGLRFDKQTGNLFIADAYYGLLVVGPEGGLATSLSTHVEGKPILFANDLDIHKN  206

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             GSIFFTDTS++Y+RVNHF I+LEGEATGRLLRYDPPT  TH+VLD LAFPNGVQFS+D S
Sbjct  207   GSIFFTDTSKRYDRVNHFFILLEGEATGRLLRYDPPTKTTHIVLDGLAFPNGVQFSKDQS  266

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             FLL+TETTNCRLMKYWVEGPK+G  EV+ +LPGFPDNVR NEKGQ+WVAIDCCRT  QEV
Sbjct  267   FLLYTETTNCRLMKYWVEGPKTGEIEVVVDLPGFPDNVRMNEKGQFWVAIDCCRTPAQEV  326

Query  1096  LINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEV  1275
             L  +PW +S+YFRLP+ M   A+  GM+MYTVISL D+ G++L+VLED  G+VMKLVSEV
Sbjct  327   LAKNPWMKSIYFRLPIRMSLTAKVMGMRMYTVISLLDEEGKILEVLEDAEGEVMKLVSEV  386

Query  1276  REVDGKLWIGTVAHNHIATLPYP  1344
             REV GKLWIGTVAHNHIATLPYP
Sbjct  387   REVQGKLWIGTVAHNHIATLPYP  409



>ref|XP_010413679.1| PREDICTED: strictosidine synthase-like isoform X1 [Camelina sativa]
 ref|XP_010413680.1| PREDICTED: strictosidine synthase-like isoform X1 [Camelina sativa]
 ref|XP_010413681.1| PREDICTED: strictosidine synthase-like isoform X2 [Camelina sativa]
Length=415

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/377 (77%), Positives = 335/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VMERW  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  34    DPFHISPIGGREFKPVKHEVAPYKQVMERWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKACVRGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLL+VGP+GGIATPLATHVEGKPILFANDLD+H+NGSIFFT
Sbjct  154   LGLRFDKETGNLYIADAYYGLLMVGPEGGIATPLATHVEGKPILFANDLDVHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK G  EV+A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL N+PW
Sbjct  274   TTNCRLVKYWLEGPKMGDVEVVADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLTNNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  334   IKSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  394   LWIGTVAHNHIATLPYP  410



>ref|XP_010672238.1| PREDICTED: strictosidine synthase [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/382 (77%), Positives = 337/382 (88%), Gaps = 1/382 (0%)
 Frame = +1

Query  202   GIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPES  378
             G ++ DPFE+ P+GG +F+PV N IAPYKEVM+ W  DN+SRLG    LEFVD+VFGPES
Sbjct  26    GFILMDPFEMGPLGGHEFKPVTNQIAPYKEVMKYWPRDNQSRLGQHAKLEFVDQVFGPES  85

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD LGRGPY GLADGRIVRWMG+  GWETFA VT  WS K+CG GVDSTTPKQW+FE 
Sbjct  86    LEFDNLGRGPYTGLADGRIVRWMGEKIGWETFATVTSTWSMKVCGQGVDSTTPKQWRFEQ  145

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRFDK+ G+LYIADAYYGLLVVGP+GG+ATPLATHV G PILFANDLDIHKNG
Sbjct  146   LCGRPLGLRFDKEYGNLYIADAYYGLLVVGPEGGLATPLATHVGGDPILFANDLDIHKNG  205

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++YNRVNHFLI+LEGEATGRLLRYDP T +THVVLD LAFPNGVQ S+  +F
Sbjct  206   SIFFTDTSKRYNRVNHFLILLEGEATGRLLRYDPSTKETHVVLDGLAFPNGVQLSKHQTF  265

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCRL+K W+EGPK+G+ EV+ANLPGFPDNVR NEKG++WVAIDCCRT  QE+L
Sbjct  266   LLFTETTNCRLLKLWLEGPKTGQVEVVANLPGFPDNVRLNEKGEFWVAIDCCRTAPQELL  325

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
             I++PW R +YFR+PLP++ LAR  GMKMYTVISLF+++G++L+VLEDK G VM+LVSEVR
Sbjct  326   IHNPWLRRMYFRIPLPLKTLARLMGMKMYTVISLFNEDGKILEVLEDKKGVVMQLVSEVR  385

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV+GKLWIGTVAHNHIATLPYP
Sbjct  386   EVNGKLWIGTVAHNHIATLPYP  407



>ref|XP_006291212.1| hypothetical protein CARUB_v10017342mg [Capsella rubella]
 gb|EOA24110.1| hypothetical protein CARUB_v10017342mg [Capsella rubella]
Length=414

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/377 (77%), Positives = 333/377 (88%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VME W  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  33    DPFHISPIGGREFKPVKHEVAPYKQVMESWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WS K C  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSAKACVRGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK TG+LYIADAYYGLL+VGP+GGIATPLATHVEGKPILFANDLD+H+NGSIFFT
Sbjct  153   LGLRFDKATGNLYIADAYYGLLMVGPEGGIATPLATHVEGKPILFANDLDVHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK+G  EV+ANLPGFPDNVR NEKGQ+WVAIDCCRT  QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGPKTGDVEVVANLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLTNNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  333   IKSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  392

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  393   LWIGTVAHNHIATLPYP  409



>ref|XP_002529482.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF32892.1| strictosidine synthase, putative [Ricinus communis]
Length=372

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/372 (77%), Positives = 327/372 (88%), Gaps = 0/372 (0%)
 Frame = +1

Query  229   LSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGP  408
             + P+G   FRPV++D+APYK+VME W  D ++RLG G LEFVDEVFGPESLEFD+LGRGP
Sbjct  1     MGPLGRHDFRPVEHDVAPYKQVMENWPRDKEARLGTGKLEFVDEVFGPESLEFDSLGRGP  60

Query  409   YGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRF  588
             Y GLADGRIVRWMG+  GWETFA+VT NWSEKIC  GVDSTT KQWK E +CGRPLGLRF
Sbjct  61    YAGLADGRIVRWMGEAVGWETFAVVTTNWSEKICAKGVDSTTAKQWKHEKRCGRPLGLRF  120

Query  589   DKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQK  768
             DK TG+LY+AD+YYGLLV+GP+GG+A PLAT V GKPILFANDLDIH+NGSIFFTDTS++
Sbjct  121   DKNTGNLYVADSYYGLLVIGPEGGLAKPLATQVAGKPILFANDLDIHENGSIFFTDTSKR  180

Query  769   YNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCR  948
             Y+RVNHF I+LEGE+TGRLLRYDPPTG TH+VLD LAFPNGVQ S+D  FLLFTETTNCR
Sbjct  181   YDRVNHFFILLEGESTGRLLRYDPPTGTTHIVLDGLAFPNGVQLSKDQKFLLFTETTNCR  240

Query  949   LMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVY  1128
             +MKYW+EGPK+G  E++ANLPGFPDN+R N+KG YWVAIDCCRTR QE+L ++PW RSVY
Sbjct  241   IMKYWIEGPKTGNVELVANLPGFPDNIRVNDKGHYWVAIDCCRTRAQEILTHNPWIRSVY  300

Query  1129  FRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGT  1308
             FRLP+ M  LAR  GMKMYTV+SLF++NGE+L+VLED  G VMKLVSEVREV GKLWIGT
Sbjct  301   FRLPIRMSILARLMGMKMYTVVSLFNENGEILEVLEDPKGVVMKLVSEVREVQGKLWIGT  360

Query  1309  VAHNHIATLPYP  1344
             VAHNHIATLPYP
Sbjct  361   VAHNHIATLPYP  372



>ref|XP_002876509.1| hypothetical protein ARALYDRAFT_907457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52768.1| hypothetical protein ARALYDRAFT_907457 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/377 (77%), Positives = 334/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VME W  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  33    DPFHMSPIGGREFKPVKHEVAPYKQVMESWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKACVRGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K+TG+LYIADAYYGLLVVGP+GGIATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK+G  EV+A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGPKTGEVEVVADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLTNNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  333   IKSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  392

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  393   LWIGTVAHNHIATLPYP  409



>ref|XP_009138905.1| PREDICTED: strictosidine synthase-like [Brassica rapa]
 ref|XP_009138906.1| PREDICTED: strictosidine synthase-like [Brassica rapa]
Length=414

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/377 (76%), Positives = 334/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VME W  DN S+LG  G LEFVD+VFGPESLEFD 
Sbjct  34    DPFHMSPIGGREFKPVKHEVAPYKQVMENWPRDNLSQLGQHGKLEFVDQVFGPESLEFDG  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEATGWETFSVVTSKWSEEACARGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  154   LGLRFDKETGNLYIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+A+LPGFPDNVR NEKG++WVAIDCCRTR QEVL N+PW
Sbjct  274   TTNCRLVKYWLEGAKTGEVEVVADLPGFPDNVRMNEKGEFWVAIDCCRTRPQEVLTNNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GMKMYTVIS FD +GEVL+VLED+ G VMKLVSEVREV GK
Sbjct  334   IKSIYFRLPIPMKLLAKAMGMKMYTVISRFDADGEVLEVLEDRQGKVMKLVSEVREVQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIA++PYP
Sbjct  394   LWIGTVAHNHIASVPYP  410



>ref|XP_004290318.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Fragaria vesca subsp. vesca]
Length=409

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/404 (73%), Positives = 343/404 (85%), Gaps = 1/404 (0%)
 Frame = +1

Query  136   IMEKIRREVFQQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGD  315
             + EK    + Q  + L L +++G +I DP ++ P+GG +F+PVK+ IAPY +VMERW  D
Sbjct  6     LKEKDEALLLQHPVVLFLILVLGFVIMDPLQIGPLGGHEFKPVKHSIAPYNKVMERWPKD  65

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             N SRLGLG LEF DEVFGPESLEFD LGRGPY GLADGR+VRWMG + GWETFALVT NW
Sbjct  66    NLSRLGLGKLEFEDEVFGPESLEFDALGRGPYTGLADGRVVRWMGPDVGWETFALVTANW  125

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             SE++C  G +STT KQWK E +CGRPLGLRFDK TG+LYIADAYYGLLVVGP+GG+ATPL
Sbjct  126   SEQVCAKGNESTTYKQWKHEKRCGRPLGLRFDKVTGNLYIADAYYGLLVVGPEGGLATPL  185

Query  676   ATH-VEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             ++  VEG PILFANDLDIH NGS+FFTDTS++YNRV+HFLI+LEGE+TGRLLRYDPPT  
Sbjct  186   SSQDVEGNPILFANDLDIHTNGSVFFTDTSKRYNRVDHFLILLEGESTGRLLRYDPPTKT  245

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
             T+VVLD LAFPNGVQ S+D +FLLFTETTNCRL KYW+EGPKSG  E++A+LPGFPDNVR
Sbjct  246   TYVVLDGLAFPNGVQLSQDQTFLLFTETTNCRLTKYWLEGPKSGTVELVADLPGFPDNVR  305

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              NEKGQ+WVAIDCCRT  QE+L ++PW RSVYFRLP+ M YLAR  GMKMYT+ISLFD  
Sbjct  306   MNEKGQFWVAIDCCRTPAQEILSHNPWLRSVYFRLPIRMNYLARLMGMKMYTLISLFDDK  365

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             GE+L+VLED+ G+VMKLVSEVRE  GKLWIGTVAHNHIAT+PYP
Sbjct  366   GEILEVLEDRKGEVMKLVSEVRESKGKLWIGTVAHNHIATIPYP  409



>ref|XP_010527673.1| PREDICTED: strictosidine synthase-like [Tarenaya hassleriana]
Length=409

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/383 (76%), Positives = 330/383 (86%), Gaps = 1/383 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPE  375
             +G ++ DPF++ PVGG +FRPVK++IAPYK VM  W  DN SRL   G LEFVDEVFGPE
Sbjct  27    VGFIVVDPFDMGPVGGHEFRPVKHEIAPYKRVMGSWPRDNLSRLAHHGKLEFVDEVFGPE  86

Query  376   SLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFE  555
             SLEFD+LGRGPY GLADGR+VRWMG+  GWETFA+VT NWSEK C  GVDSTT KQWK E
Sbjct  87    SLEFDSLGRGPYTGLADGRVVRWMGEATGWETFAVVTSNWSEKACARGVDSTTHKQWKHE  146

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDK+TG+L+IADAYYGLLVVGP+GG+AT L+ HVEGKPILFANDLDIHKN
Sbjct  147   KLCGRPLGLRFDKQTGNLFIADAYYGLLVVGPEGGLATSLSIHVEGKPILFANDLDIHKN  206

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             GSIFFTDTS++Y+RVNHF I+LEGEATGRLLRYDPPT  TH+VLD LAFPNGVQFS D S
Sbjct  207   GSIFFTDTSKRYDRVNHFFILLEGEATGRLLRYDPPTKTTHIVLDGLAFPNGVQFSRDQS  266

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             FLL+TETTNCRLMKYW+EGPK+G  EV+ +LPGFPDNVR NE+G++WVAIDCCRT  QEV
Sbjct  267   FLLYTETTNCRLMKYWLEGPKTGEIEVVVDLPGFPDNVRMNERGEFWVAIDCCRTPAQEV  326

Query  1096  LINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEV  1275
             L N+PW +S YFRLP+ M  LA+  GM+MYTVISL D+ G +L+VLED  G+VMKLVSEV
Sbjct  327   LTNNPWMKSFYFRLPMKMSLLAKVMGMRMYTVISLLDEEGNILEVLEDAQGEVMKLVSEV  386

Query  1276  REVDGKLWIGTVAHNHIATLPYP  1344
             REV GKLWIGTVAHNHIATLPYP
Sbjct  387   REVQGKLWIGTVAHNHIATLPYP  409



>gb|KDP43882.1| hypothetical protein JCGZ_20892 [Jatropha curcas]
Length=408

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/382 (75%), Positives = 336/382 (88%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             +G ++ DPF++ P+G   FRPVK+++APYK+VM  W  D K RLG G LEFV+EVFGPES
Sbjct  27    LGFVVMDPFKMGPLGRHDFRPVKHEVAPYKKVMGSWPRDEKGRLGNGKLEFVNEVFGPES  86

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD +G GPY GLADGR+VRWMG++ GWETFA+VT NWSEK+C  GVDSTT KQWK+E 
Sbjct  87    LEFDAIGNGPYTGLADGRVVRWMGEDVGWETFAVVTTNWSEKLCSRGVDSTTSKQWKYER  146

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRFDKKTG+LYIADAYYGL+VVGP+GG+A PLATH  GKPILFANDLD+H+NG
Sbjct  147   VCGRPLGLRFDKKTGNLYIADAYYGLMVVGPEGGLAIPLATHAGGKPILFANDLDLHENG  206

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS++Y+RV+HF I+LEGE+TGRLLRYDPPT +THVVLD LAFPNGVQ S+D +F
Sbjct  207   SIFFTDTSKRYDRVSHFYILLEGESTGRLLRYDPPTKETHVVLDGLAFPNGVQLSKDQTF  266

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCRLMKYW+EGP++GR EV+A+LPGFPDNVR NEKGQ+WVAIDCCRT+ QE+L
Sbjct  267   LLFTETTNCRLMKYWLEGPRTGRVEVVADLPGFPDNVRLNEKGQFWVAIDCCRTQAQEIL  326

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW R+ YFRLP+ M  LAR  GMKMYTVISLF++NGE+L+VLED +G VMKLVSEVR
Sbjct  327   SHNPWIRNFYFRLPVKMSLLARMMGMKMYTVISLFNENGEILEVLEDPNGLVMKLVSEVR  386

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             EV GKLWIGTVAHNHIATLPYP
Sbjct  387   EVKGKLWIGTVAHNHIATLPYP  408



>gb|AAO42227.1| putative strictosidine synthase [Arabidopsis thaliana]
 gb|AAO64095.1| putative strictosidine synthase [Arabidopsis thaliana]
Length=414

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/377 (76%), Positives = 332/377 (88%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYKEVM  W  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  33    DPFHMSPIGGREFKPVKHEVAPYKEVMGSWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K+TG+LYIADAYYGLLVVGP+GGIATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK G  EV+A+LPGFPDNVR NE+GQ+WVAIDCCRT  QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGPKMGEVEVVADLPGFPDNVRINEEGQFWVAIDCCRTPAQEVLTNNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              RS+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VMKLVSEVREV GK
Sbjct  333   IRSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVMKLVSEVREVQGK  392

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  393   LWIGTVAHNHIATLPYP  409



>ref|XP_009116620.1| PREDICTED: strictosidine synthase [Brassica rapa]
Length=413

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/377 (76%), Positives = 334/377 (89%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SPVGG++F+PVK+++APYK+VM+ W  DN S+LG  G LEFVDEVFGPESLEFD+
Sbjct  33    DPFHISPVGGREFKPVKHEVAPYKQVMDNWPRDNLSQLGHHGKLEFVDEVFGPESLEFDS  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEKIC  GV STT KQ K E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKICARGVHSTTNKQRKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK++G+LYIADAYYGLL+VGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFDKESGNLYIADAYYGLLMVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  THVVLD LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K G  EV+A+LPGFPDNVR NEKG++WVAIDCCRT +QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGSKRGEIEVVADLPGFPDNVRMNEKGEFWVAIDCCRTPVQEVLANNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA   GMKMYTVIS FD++G+VL+VLED+HG VMKLVSEVREV GK
Sbjct  333   IKSIYFRLPIPMKLLATAMGMKMYTVISRFDEDGKVLEVLEDRHGKVMKLVSEVREVQGK  392

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  393   LWIGTVAHNHIATLPYP  409



>ref|XP_010046542.1| PREDICTED: strictosidine synthase [Eucalyptus grandis]
 gb|KCW87728.1| hypothetical protein EUGRSUZ_A00101 [Eucalyptus grandis]
Length=407

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/382 (74%), Positives = 329/382 (86%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
             +G  + DPF + PVGG +FRPV++ IAPYK VME W  DN+S+L  G LEF  +VFGPES
Sbjct  26    LGFCMVDPFNMGPVGGHEFRPVRHAIAPYKRVMESWPRDNQSKLRFGKLEFAGQVFGPES  85

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD  GRGPY GLADGR+VRWMG+ +GWETFA VTPNWSEK+C  GVDSTTPKQWK E 
Sbjct  86    LEFDPSGRGPYTGLADGRVVRWMGEGSGWETFAFVTPNWSEKVCAKGVDSTTPKQWKVEK  145

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
             +CGRPLGLRF+K+TG LYIADAY+GLLVVGP+GG ATPLATHV G+PILFANDLD+H NG
Sbjct  146   KCGRPLGLRFNKETGQLYIADAYFGLLVVGPEGGYATPLATHVHGQPILFANDLDLHSNG  205

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS +Y+RVNHF I+LEGEATGR+LRYDPPT  THVVL+ LAFPNG+Q S + +F
Sbjct  206   SIFFTDTSTRYDRVNHFYILLEGEATGRILRYDPPTNTTHVVLEGLAFPNGIQLSRNQNF  265

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCRLMKYW+EGPK+G TEV+A+LPG+PDNVR NEKGQ+WVAIDCCRT  QE+L
Sbjct  266   LLFTETTNCRLMKYWLEGPKTGTTEVLADLPGYPDNVRINEKGQFWVAIDCCRTPAQELL  325

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              ++PW +S+YFRLP+ M  LAR  GM+MYTVISLF++ GE+L+VLED+ G VMKL SEVR
Sbjct  326   SHNPWFKSIYFRLPIKMSILARPMGMRMYTVISLFNEEGEILEVLEDRKGTVMKLASEVR  385

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E DGKLWIGTVAHNHIATLPYP
Sbjct  386   EADGKLWIGTVAHNHIATLPYP  407



>ref|XP_006402679.1| hypothetical protein EUTSA_v10006000mg [Eutrema salsugineum]
 gb|ESQ44132.1| hypothetical protein EUTSA_v10006000mg [Eutrema salsugineum]
Length=421

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/377 (75%), Positives = 333/377 (88%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VME W  DN S+LG  G LEFVD+VFGPESLEFD+
Sbjct  42    DPFHISPIGGREFKPVKHEVAPYKQVMENWPRDNLSQLGHHGKLEFVDQVFGPESLEFDS  101

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  102   LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKACVRGVDSTTNKQWKHEKLCGRP  161

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K+TG+LYIADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  162   LGLRFHKETGNLYIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  221

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VLD LAFPNG+Q S+D SFLLFTE
Sbjct  222   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLDGLAFPNGIQLSKDQSFLLFTE  281

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+A+LPGFPDNVR N+KGQ+WVAIDCCRT  QE+L N+PW
Sbjct  282   TTNCRLVKYWLEGSKTGEVEVVADLPGFPDNVRINDKGQFWVAIDCCRTPAQEILTNNPW  341

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +++YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+V ED+ G VMKLVSEVREV+GK
Sbjct  342   IKNIYFRLPIPMKLLAKAMGMRMYTVISKFDEEGKVLEVFEDRQGKVMKLVSEVREVEGK  401

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  402   LWIGTVAHNHIATLPYP  418



>ref|XP_003597527.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
 gb|AES67778.1| strictosidine synthase family protein [Medicago truncatula]
Length=407

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/407 (72%), Positives = 338/407 (83%), Gaps = 5/407 (1%)
 Frame = +1

Query  139   MEK---IRREVF-QQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERW  306
             MEK   ++ E F QQ   L + + +  ++ DPF L P+G  +FRPVK+++APYK+VM+ W
Sbjct  1     MEKKNFLKDETFLQQHKVLAIFLFLSFVLMDPFHLGPLGEHEFRPVKHNVAPYKQVMKNW  60

Query  307   HGDNKSRLGL-GNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
               DN SRLGL G LEF +EVFGPESLEFD +GRGPY GLADGR+VRWMG+  GWETFA+V
Sbjct  61    PKDNMSRLGLHGKLEFENEVFGPESLEFDNMGRGPYTGLADGRVVRWMGEQLGWETFAVV  120

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             T NW+EK C  G DSTTPKQWK E  CGRPLGLRFDK++GDLYIADAYYGLL+VGP+GG+
Sbjct  121   TSNWTEKTCMRGNDSTTPKQWKHEKTCGRPLGLRFDKESGDLYIADAYYGLLMVGPNGGL  180

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPLATHVEGKPILFANDLDIHKNGSIFFTDTS +YNRV HF I+LEGE TGRLLRYDPP
Sbjct  181   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSTRYNRVAHFFILLEGEGTGRLLRYDPP  240

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
             T  THVVLD L FPNGVQ S+D SFLLFTETTNCRLMK W++GPK G  E +A+LPGFPD
Sbjct  241   TKTTHVVLDGLVFPNGVQISKDQSFLLFTETTNCRLMKLWIDGPKDGTVECVADLPGFPD  300

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLF  1203
             NVR NEKGQ+WVAIDCCRT  QEVL N+PW RS+YFRLP+ M  LA+  GMKMYT+I+L 
Sbjct  301   NVRMNEKGQFWVAIDCCRTGPQEVLSNNPWLRSIYFRLPVRMSLLAKAMGMKMYTMIALL  360

Query  1204  DQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             D NG++L+VLED+ G VMKLVSEV+E  GKLWIGTVAHNHI+TLPYP
Sbjct  361   DDNGKILEVLEDREGKVMKLVSEVKEEKGKLWIGTVAHNHISTLPYP  407



>ref|XP_004486908.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=407

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/383 (75%), Positives = 324/383 (85%), Gaps = 1/383 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPE  375
             +  ++ DPF++ PV   +FRPVK+DIAPY++VM+ W  DN SRLGL G LEF ++VFGPE
Sbjct  25    LSFVVMDPFQMGPVSEHQFRPVKHDIAPYQKVMKSWPRDNMSRLGLHGKLEFENQVFGPE  84

Query  376   SLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFE  555
             SLEFD +GRGPY GLADGRIVRWMG+  GWETFA+VT NW+EK+C  G DSTT KQWK E
Sbjct  85    SLEFDNMGRGPYTGLADGRIVRWMGEELGWETFAVVTSNWTEKLCMRGNDSTTSKQWKHE  144

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDK+ GDLYIADAYYGLL+VGP+GG+AT LATH+EGKPILFANDLDIH N
Sbjct  145   KTCGRPLGLRFDKENGDLYIADAYYGLLMVGPNGGLATSLATHIEGKPILFANDLDIHNN  204

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             GSIFFTDTS++YNRV HF I+LEGEATGRLLRYDPPT  THVVLD LAFPNGVQFS+D S
Sbjct  205   GSIFFTDTSKRYNRVAHFFILLEGEATGRLLRYDPPTKTTHVVLDGLAFPNGVQFSKDQS  264

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             FLLFTETTNCRLMK W+EGPK G  E +A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEV
Sbjct  265   FLLFTETTNCRLMKLWIEGPKRGSVEHVADLPGFPDNVRINEKGQFWVAIDCCRTSAQEV  324

Query  1096  LINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEV  1275
             L N+PW RS+YFRLP+ M  LAR  GMKMYTVIS  D  G VL+VLED+ G VMKLVSEV
Sbjct  325   LSNNPWLRSIYFRLPIKMSLLARVMGMKMYTVISRLDDKGNVLEVLEDREGQVMKLVSEV  384

Query  1276  REVDGKLWIGTVAHNHIATLPYP  1344
             +EV GKLWIGTVAHNHI+TL YP
Sbjct  385   KEVKGKLWIGTVAHNHISTLTYP  407



>ref|XP_003546986.2| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Glycine max]
Length=410

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/377 (76%), Positives = 321/377 (85%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF L PV   +FRPVK+ IAPY +VM+ W  DN SRL L G  EF ++VFGPESLEFD 
Sbjct  34    DPFHLGPVAEHEFRPVKHSIAPYHQVMKNWPRDNMSRLALHGKSEFKNQVFGPESLEFDN  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             +GRGPY GLADGR+VRWMG+  GWETFA+VT NW+EK+C  G DSTT KQWK E  CGRP
Sbjct  94    MGRGPYTGLADGRVVRWMGEQHGWETFAVVTSNWTEKLCFRGNDSTTEKQWKHEKTCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK++GDLYIADAYYGLLVVGP+GG+AT LATHVEGKPILFANDLDIHKNGSIFFT
Sbjct  154   LGLRFDKESGDLYIADAYYGLLVVGPNGGLATSLATHVEGKPILFANDLDIHKNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++YNRV HF I+LEGEATGRLLRYDPPT  THVVLD L FPNGVQFS+DHSFLL+TE
Sbjct  214   DTSKRYNRVAHFFILLEGEATGRLLRYDPPTKTTHVVLDGLVFPNGVQFSKDHSFLLYTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRLMK W+EGPKSG  E++A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL ++PW
Sbjct  274   TTNCRLMKLWIEGPKSGTVELLADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLSHNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              R++YFRLP+ M  LAR  GMKMYTVISL D  GEVL+VLED+ G VMKLVSEVRE  GK
Sbjct  334   LRNIYFRLPIRMSLLARAMGMKMYTVISLLDDKGEVLEVLEDQQGQVMKLVSEVREEQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATL YP
Sbjct  394   LWIGTVAHNHIATLSYP  410



>ref|XP_007150441.1| hypothetical protein PHAVU_005G153700g [Phaseolus vulgaris]
 gb|ESW22435.1| hypothetical protein PHAVU_005G153700g [Phaseolus vulgaris]
Length=410

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/410 (71%), Positives = 339/410 (83%), Gaps = 8/410 (2%)
 Frame = +1

Query  139   MEKIRREVF-------QQllylllpvlIGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVM  297
             MEKI+ ++        Q    L L ++ G+++ DPF L PV   +FRPVK+DIAPY +VM
Sbjct  1     MEKIKLKLLIKDETFLQHPFVLTLVLVFGLVMMDPFHLGPVSEHEFRPVKHDIAPYHQVM  60

Query  298   ERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETF  474
             + W  DN SRL L G  EF +EVFGPESLEFD +GRGPY GLADGR+VRWMG+  GWETF
Sbjct  61    KNWPRDNMSRLALYGKSEFNNEVFGPESLEFDNMGRGPYSGLADGRVVRWMGEELGWETF  120

Query  475   ALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPD  654
             A+VT NW+EK+C  G DSTT KQWK E  CGRPLG+RFDK++GDLYIADAYYGLLVVGP+
Sbjct  121   AVVTSNWTEKLCFRGHDSTTDKQWKHEKTCGRPLGIRFDKESGDLYIADAYYGLLVVGPN  180

Query  655   GGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRY  834
             GG+ATPLATHVEGKPILFANDLDIH+NGSIFFTDTS++YNRV HF I+LEGEATGRLLRY
Sbjct  181   GGLATPLATHVEGKPILFANDLDIHRNGSIFFTDTSKRYNRVEHFFILLEGEATGRLLRY  240

Query  835   DPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPG  1014
             DPPT  THVVLD LAFPNGVQFSED SFLLFTETTNCRLMK+WV+GP+SG  E+ A+LPG
Sbjct  241   DPPTKTTHVVLDGLAFPNGVQFSEDQSFLLFTETTNCRLMKFWVDGPRSGSVELFADLPG  300

Query  1015  FPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVI  1194
             FPDNVR N KG++WVAIDCCRT  QEVL ++PW R++YFRLP+ M  LAR  GM+MYTV+
Sbjct  301   FPDNVRMNGKGEFWVAIDCCRTAAQEVLSHNPWLRNIYFRLPIRMSLLARAMGMRMYTVV  360

Query  1195  SLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             SL D  G+V++VLED+ G+VMKLVSEVRE  GKLWIGTVAHNHIATL YP
Sbjct  361   SLLDDKGKVIEVLEDREGEVMKLVSEVREEQGKLWIGTVAHNHIATLSYP  410



>gb|KHN33299.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=401

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/377 (76%), Positives = 321/377 (85%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF L PV   +FRPVK+ IAPY +VM+ W  DN SRL L G  EF ++VFGPESLEFD 
Sbjct  25    DPFHLGPVSEHEFRPVKHSIAPYHQVMKNWPRDNMSRLALHGKSEFKNQVFGPESLEFDN  84

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             +GRGPY GLADGR+VRWMG+  GWETFA+VT NW+EK+C  G DSTT KQWK E  CGRP
Sbjct  85    MGRGPYTGLADGRVVRWMGEQHGWETFAVVTSNWTEKLCFRGNDSTTEKQWKHEKTCGRP  144

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK++GDLYIADAYYGLLVVGP+GG+AT LATHVEGKPILFANDLDIHKNGSIFFT
Sbjct  145   LGLRFDKESGDLYIADAYYGLLVVGPNGGLATSLATHVEGKPILFANDLDIHKNGSIFFT  204

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++YNRV HF I+LEGEATGRLLRYDPPT  THVVLD L FPNGVQFS+DHSFLL+TE
Sbjct  205   DTSKRYNRVAHFFILLEGEATGRLLRYDPPTKTTHVVLDGLVFPNGVQFSKDHSFLLYTE  264

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRLMK W+EGPKSG  E++A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL ++PW
Sbjct  265   TTNCRLMKLWIEGPKSGTVELLADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLSHNPW  324

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              R++YFRLP+ M  LAR  GMKMYTVISL D  GEVL+VLED+ G VMKLVSEVRE  GK
Sbjct  325   LRNIYFRLPIRMSLLARAMGMKMYTVISLLDDKGEVLEVLEDQQGQVMKLVSEVREEQGK  384

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATL YP
Sbjct  385   LWIGTVAHNHIATLSYP  401



>gb|AAX38236.1| strictosidine synthase family protein [Brassica napus]
Length=414

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/377 (74%), Positives = 329/377 (87%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+P+K+++APYK+VME W  DN S+LG  G LEFVD VFGPESLEFD 
Sbjct  34    DPFHMSPIGGREFKPMKHEVAPYKQVMENWPRDNLSQLGQHGKLEFVDRVFGPESLEFDG  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEAVGWETFSVVTSKWSEEACARGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K+TG+LYIADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  154   LGLRFVKETGNLYIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+V + LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVQEGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+ +LPGFPDNVR N+KG++WVAIDCCRT  QEVL ++PW
Sbjct  274   TTNCRLVKYWLEGAKTGEVEVVVDLPGFPDNVRMNKKGEFWVAIDCCRTPAQEVLTDNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GMKMYTVIS FD +GEVL+VLED+ G VMKLVSEVREV GK
Sbjct  334   IKSIYFRLPIPMKLLAKAMGMKMYTVISRFDADGEVLEVLEDRQGKVMKLVSEVREVQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIA++PYP
Sbjct  394   LWIGTVAHNHIASVPYP  410



>ref|XP_003542061.2| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Glycine max]
Length=410

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/377 (77%), Positives = 320/377 (85%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF L PV   +FRPVK+ IAPY +VM+ W  DN SRL L G  EF ++VFGPESLEFD 
Sbjct  34    DPFHLGPVSEHEFRPVKHSIAPYHQVMKNWPRDNMSRLALHGKSEFKNQVFGPESLEFDH  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             +GRGPY GLADGR+VRWMG+  GWETFA+VT NW+EK+C  G DSTT KQWK E  CGRP
Sbjct  94    MGRGPYTGLADGRVVRWMGEQLGWETFAVVTSNWTEKLCFRGNDSTTAKQWKHEKTCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK  GDLYIADAYYGLLVVGP+GG+AT LATHVEGKPILFANDLDIHKNGSIFFT
Sbjct  154   LGLRFDKVNGDLYIADAYYGLLVVGPNGGLATSLATHVEGKPILFANDLDIHKNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++YNRV HF I+LEGEATGRLLRYDPPT  THVVLD LAFPNGVQFS+DHSFLL+TE
Sbjct  214   DTSKRYNRVAHFFILLEGEATGRLLRYDPPTKTTHVVLDGLAFPNGVQFSKDHSFLLYTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRLMK W EGPKSG  E++A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL ++PW
Sbjct  274   TTNCRLMKLWTEGPKSGSVELLADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLSHNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              R++YFRLP+ M  LAR  GMKMYTVISL D  GEVL+VLED+ G+VMKLVSEVRE  GK
Sbjct  334   LRNIYFRLPIRMSLLARAMGMKMYTVISLLDDKGEVLEVLEDQKGEVMKLVSEVREEQGK  393

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATL YP
Sbjct  394   LWIGTVAHNHIATLSYP  410



>gb|KHN30094.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=401

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/377 (77%), Positives = 319/377 (85%), Gaps = 1/377 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF L PV   +FRPVK+ IAPY +VM+ W  DN SRL L G  EF ++VFGPESLEFD 
Sbjct  25    DPFHLGPVSEHEFRPVKHSIAPYHQVMKNWPRDNMSRLALHGKSEFKNQVFGPESLEFDH  84

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             +GRGPY GLADGR+VRWMG+  GWETFA+VT NW+EK+C  G DSTT KQWK E  CGRP
Sbjct  85    MGRGPYTGLADGRVVRWMGEQLGWETFAVVTSNWTEKLCFRGNDSTTAKQWKHEKTCGRP  144

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK  GDLYIADAYYGLLVVGP+GG+AT LATHVEGKPILFANDLDIHKNGSIFFT
Sbjct  145   LGLRFDKVNGDLYIADAYYGLLVVGPNGGLATSLATHVEGKPILFANDLDIHKNGSIFFT  204

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++YNRV HF I+LEGEATGRLLRYDPPT  THVVLD LAFPNGVQFS+DHSFLL+TE
Sbjct  205   DTSKRYNRVAHFFILLEGEATGRLLRYDPPTKTTHVVLDGLAFPNGVQFSKDHSFLLYTE  264

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRLMK W EGPKSG  E++A+LPGFPDNVR NEKGQ+WVAIDCCRT  QEVL ++PW
Sbjct  265   TTNCRLMKLWTEGPKSGSVELLADLPGFPDNVRINEKGQFWVAIDCCRTPAQEVLSHNPW  324

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              R++YFRLP+ M  LAR  GMKMYTVISL D  GEVL+VLED+ G VMKLVSEVRE  GK
Sbjct  325   LRNIYFRLPIRMSLLARAMGMKMYTVISLLDDKGEVLEVLEDQQGQVMKLVSEVREEQGK  384

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATL YP
Sbjct  385   LWIGTVAHNHIATLSYP  401



>emb|CDY05993.1| BnaA09g37870D [Brassica napus]
Length=403

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/377 (73%), Positives = 327/377 (87%), Gaps = 11/377 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SPVGG++F+PVK+++APYK+VM+ W  DN S+LG  G LEFVD+VFGPESLEFD 
Sbjct  33    DPFHISPVGGREFKPVKHEVAPYKQVMDNWPRDNLSQLGHHGKLEFVDQVFGPESLEFDG  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSEKIC  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEKICARGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK++G+L+IADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFDKESGNLFIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT +TH+VLD LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKETHIVLDGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+A+LPGFPDNVR NEKG++WVAIDCCRT +QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGSKTGEVEVVADLPGFPDNVRMNEKGEFWVAIDCCRTPVQEVLANNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA   GMKMYTVIS F+++G+VL+VLED+ G VMKL          
Sbjct  333   IKSIYFRLPIPMKLLATAMGMKMYTVISRFNEDGKVLEVLEDRQGKVMKL----------  382

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  383   LWIGTVAHNHIATLPYP  399



>emb|CDX71901.1| BnaC08g29730D [Brassica napus]
Length=403

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/377 (73%), Positives = 323/377 (86%), Gaps = 11/377 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SPVGG++F+PVK+++APYK+VM+ W  DN SRLG  G LEFV+EVFGPESLEFD 
Sbjct  33    DPFHISPVGGREFKPVKHEVAPYKQVMDNWPRDNLSRLGHHGKLEFVEEVFGPESLEFDG  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++ T  WSEK C  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVATSKWSEKTCARGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK++G+L+IADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFDKESGNLFIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  THVVLD LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHVVLDGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K G  EV+A+LPGFPDNVR NEKG++WVAIDCCRT +QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGSKRGEVEVVADLPGFPDNVRMNEKGEFWVAIDCCRTPVQEVLTNNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA   GM+MYTVIS FD++G+VL+VLED+ G VMKL          
Sbjct  333   IKSIYFRLPIPMKLLATAMGMRMYTVISRFDEDGKVLEVLEDRQGKVMKL----------  382

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  383   LWIGTVAHNHIATLPYP  399



>ref|NP_191512.1| pollen development protein LAP3 [Arabidopsis thaliana]
 ref|NP_974462.1| pollen development protein LAP3 [Arabidopsis thaliana]
 sp|Q9M1B4.1|SSL13_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 13; Short=AtSSL13; 
AltName: Full=Protein LESS ADHERENT POLLEN 3; AltName: 
Full=Strictosidine synthase 11; Short=AtSS11; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB75450.1| putative protein [Arabidopsis thaliana]
 gb|AEE79936.1| pollen development protein LAP3 [Arabidopsis thaliana]
 gb|AEE79937.1| pollen development protein LAP3 [Arabidopsis thaliana]
Length=403

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/377 (74%), Positives = 322/377 (85%), Gaps = 12/377 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLG-LGNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYKEVM  W  DN SRLG  G LEFVD+VFGPESLEFD+
Sbjct  33    DPFHMSPIGGREFKPVKHEVAPYKEVMGSWPRDNLSRLGNHGKLEFVDQVFGPESLEFDS  92

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  93    LGRGPYTGLADGRVVRWMGEAIGWETFSVVTSKWSEEACVRGVDSTTNKQWKHEKLCGRP  152

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K+TG+LYIADAYYGLLVVGP+GGIATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  153   LGLRFHKETGNLYIADAYYGLLVVGPEGGIATPLATHVEGKPILFANDLDIHRNGSIFFT  212

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D SFLLFTE
Sbjct  213   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGIQLSKDQSFLLFTE  272

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EGPK G  EV+A+LPGFPDNVR NE+GQ+WVAIDCCRT  QEVL N+PW
Sbjct  273   TTNCRLVKYWLEGPKMGEVEVVADLPGFPDNVRINEEGQFWVAIDCCRTPAQEVLTNNPW  332

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              RS+YFRLP+PM+ LA+  GM+MYTVIS FD+ G+VL+VLED+ G VM           K
Sbjct  333   IRSIYFRLPIPMKLLAKTMGMRMYTVISRFDEEGKVLEVLEDRQGKVM-----------K  381

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIATLPYP
Sbjct  382   LWIGTVAHNHIATLPYP  398



>emb|CDX89027.1| BnaA04g01590D [Brassica napus]
Length=404

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/377 (73%), Positives = 324/377 (86%), Gaps = 11/377 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+PVK+++APYK+VME W  DN S+LG  G LEFVD+VFGPESLEFD 
Sbjct  34    DPFHMSPIGGREFKPVKHEVAPYKQVMENWPRDNLSQLGQHGKLEFVDQVFGPESLEFDG  93

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  94    LGRGPYTGLADGRVVRWMGEATGWETFSVVTSKWSEEACARGVDSTTNKQWKHEKLCGRP  153

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLL+VGP+GG+ATPLATHVEG+PILFANDLDIH+NGSIFFT
Sbjct  154   LGLRFDKETGNLYIADAYYGLLMVGPEGGVATPLATHVEGRPILFANDLDIHRNGSIFFT  213

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+VL+ LAFPNG+Q S+D SFLLFTE
Sbjct  214   DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVLEGLAFPNGIQLSKDQSFLLFTE  273

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+A+LPGFPDNVR NEKG++WVAIDCCRT  QEVL N+PW
Sbjct  274   TTNCRLVKYWLEGAKTGEVEVVADLPGFPDNVRMNEKGEFWVAIDCCRTPPQEVLTNNPW  333

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GMKMYTVIS FD +GEVL+VLED+ G VMKL          
Sbjct  334   IKSIYFRLPIPMKLLAKAMGMKMYTVISRFDADGEVLEVLEDRQGKVMKL----------  383

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIA++PYP
Sbjct  384   LWIGTVAHNHIASVPYP  400



>ref|XP_009384587.1| PREDICTED: strictosidine synthase [Musa acuminata subsp. malaccensis]
Length=406

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/382 (70%), Positives = 318/382 (83%), Gaps = 0/382 (0%)
 Frame = +1

Query  199   IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
              G++  DPF L P+GG  +RPVK++IAPY +VM+RW  D +SRL  G LEFVDEVFGPES
Sbjct  25    FGLVFMDPFHLGPLGGHDYRPVKHNIAPYDQVMQRWPRDCRSRLRFGKLEFVDEVFGPES  84

Query  379   LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
             LEFD  GRGPY GLADGR+VRWMG++  W+TFALV+PNWSEK+C  GV+STT KQ K E 
Sbjct  85    LEFDPQGRGPYAGLADGRVVRWMGESIRWKTFALVSPNWSEKVCANGVESTTAKQHKHEK  144

Query  559   QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
              CGRPLGLRFDK +G LYIADAY GL  VG  GG+AT L+THV+G+P+LFANDLD+H+NG
Sbjct  145   LCGRPLGLRFDKTSGKLYIADAYLGLAAVGHHGGVATLLSTHVQGRPVLFANDLDVHRNG  204

Query  739   SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             SIFFTDTS +Y+R +HF I+LEGEATGRLLRYDP +G THVVL  LAFPNGVQ S+D +F
Sbjct  205   SIFFTDTSSRYSRSDHFFILLEGEATGRLLRYDPASGATHVVLRGLAFPNGVQLSKDQTF  264

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LLFTETTNCR+M+ W+EGPK+G+ EV A+LPGFPDN+R  EKGQ+W AIDCCRTR QEV 
Sbjct  265   LLFTETTNCRIMRLWMEGPKAGKLEVFADLPGFPDNIRITEKGQFWAAIDCCRTRAQEVF  324

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
               +PW RSVYFRLPL + +LA   GMKM+T+ISLFD+ G V++VLED+ G+VMKLVSEVR
Sbjct  325   SRNPWLRSVYFRLPLRLSFLAGMTGMKMFTMISLFDEEGNVVEVLEDRGGEVMKLVSEVR  384

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             +V GKLW+GTVAHN IATLPYP
Sbjct  385   QVQGKLWVGTVAHNSIATLPYP  406



>gb|EPS72604.1| hypothetical protein M569_02148, partial [Genlisea aurea]
Length=390

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/379 (73%), Positives = 310/379 (82%), Gaps = 3/379 (1%)
 Frame = +1

Query  208   MIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLE  384
             M  DP  LSP+ G  F PV+NDIAPY +VM  W  DN SRLGL  NLEF D+VFGPESLE
Sbjct  12    MAIDPLNLSPLAGHDFVPVQNDIAPYIDVMNTWPWDNTSRLGLLANLEFKDQVFGPESLE  71

Query  385   FDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQC  564
             FD LGRGPY GLADG I RWMG   GWETFALVTPNWS   C  GV STT  QWK E QC
Sbjct  72    FDILGRGPYSGLADGTIARWMGPELGWETFALVTPNWSRNTCATGVHSTTYTQWKVEPQC  131

Query  565   GRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSI  744
             GRPLGLRFD+KTGDLYIADAYYGLLVVGP+GG+A PL+ +V GKP+LFANDLDIH NGSI
Sbjct  132   GRPLGLRFDRKTGDLYIADAYYGLLVVGPEGGLAIPLSNNVHGKPLLFANDLDIHPNGSI  191

Query  745   FFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLL  924
             FFTDTS +YNR NHF I+LEGEATGRLLRYDPPT  THVVL+ LAFPNGVQFS+D+SF+L
Sbjct  192   FFTDTSARYNRANHFFILLEGEATGRLLRYDPPTKTTHVVLEGLAFPNGVQFSKDYSFIL  251

Query  925   FTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQ-YWVAIDCCRTRIQEVLI  1101
               ETTNCR++KY+VEGPK GR E + NLPGFPDN+R   +G+ YWVAIDCCRT  QE+L+
Sbjct  252   LAETTNCRIVKYFVEGPKMGRVETLVNLPGFPDNIRRRSEGELYWVAIDCCRTAAQELLV  311

Query  1102  NHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFD-QNGEVLDVLEDKHGDVMKLVSEVR  1278
               PW RSVYFRLP+PM+YLAR AGM+MYT+I+L   + GE++D LEDK G +MKLVSEVR
Sbjct  312   RRPWMRSVYFRLPIPMRYLARMAGMRMYTMIALVSGEGGEIVDALEDKEGQIMKLVSEVR  371

Query  1279  EVDGKLWIGTVAHNHIATL  1335
             E  GKLWIGTVAHNHI+TL
Sbjct  372   EFKGKLWIGTVAHNHISTL  390



>ref|XP_010906109.1| PREDICTED: strictosidine synthase 1 [Elaeis guineensis]
Length=377

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/375 (70%), Positives = 318/375 (85%), Gaps = 0/375 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+GG  ++PVK+ IA YK+V+++W  DN+SRL  G LEFVDEVFGPES+EFD  
Sbjct  2     DPFHLGPLGGHDYQPVKHSIASYKQVIQQWPRDNQSRLRFGRLEFVDEVFGPESIEFDLE  61

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG++ GW+TFA+V PNWSEK+C  GVDSTT KQ K E  CGRPL
Sbjct  62    GRGPYTGLADGRVVRWMGESIGWQTFAVVNPNWSEKVCANGVDSTTSKQHKNEKFCGRPL  121

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF++KT +LYIADAY+GL+VVG +GGIATPLATH +G+PILFANDLD+H NGSIFFTD
Sbjct  122   GLRFNQKTRELYIADAYFGLMVVGSNGGIATPLATHAQGRPILFANDLDVHSNGSIFFTD  181

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +HF+IMLEGEATG+LLRYDP +  TH+VL  LAFPNGVQ S+D  FLLFTET
Sbjct  182   TSMRYHRKDHFIIMLEGEATGKLLRYDPVSKTTHIVLRGLAFPNGVQISKDQEFLLFTET  241

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW++G K+G+ EV A+LPGFPDN+R NEKGQ+WVAIDCCRT IQEV   +PW 
Sbjct  242   TNCRIMRYWLQGHKTGQLEVFADLPGFPDNIRMNEKGQFWVAIDCCRTPIQEVFSRNPWL  301

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R +YFRLPL M +LAR  GM+MYTVISLF+  G++++VLED+ G+V+KLVSEVREV+GKL
Sbjct  302   RRIYFRLPLKMNFLARLVGMEMYTVISLFNNEGKIVEVLEDRGGEVVKLVSEVREVNGKL  361

Query  1297  WIGTVAHNHIATLPY  1341
             WIGTV HNHIAT  Y
Sbjct  362   WIGTVVHNHIATFLY  376



>ref|XP_006847905.1| hypothetical protein AMTR_s00029p00110150 [Amborella trichopoda]
 gb|ERN09486.1| hypothetical protein AMTR_s00029p00110150 [Amborella trichopoda]
Length=406

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 321/380 (84%), Gaps = 0/380 (0%)
 Frame = +1

Query  205   IMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLE  384
              ++ +PF L P+GG  FRPV+++IAPY+EVM  W  DN+SRL  G  EFV+EV+GPES++
Sbjct  27    FIVLNPFHLGPLGGHDFRPVRHNIAPYREVMANWPKDNQSRLRFGKREFVNEVYGPESID  86

Query  385   FDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQC  564
             FD  GRGPY GLADGR+VRWMGD  GWETFALVTP WSE +C  G+ STT KQ K E +C
Sbjct  87    FDLEGRGPYTGLADGRVVRWMGDGLGWETFALVTPGWSESLCANGIHSTTSKQSKHEHRC  146

Query  565   GRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSI  744
             GRPLGLRF++K+GDLYIADAY+GL++VGP GGIATPLATH EG+PILFANDLDIH+NGSI
Sbjct  147   GRPLGLRFNRKSGDLYIADAYHGLMMVGPQGGIATPLATHAEGEPILFANDLDIHRNGSI  206

Query  745   FFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLL  924
             FFTDTS++YNR+NHF I+LEGE TGRLLRYDP T  T VVL  L+F NGVQ S+D ++LL
Sbjct  207   FFTDTSRRYNRLNHFFILLEGEDTGRLLRYDPLTKMTSVVLRGLSFANGVQISKDQTYLL  266

Query  925   FTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLIN  1104
             FTETTNCR+M+YW+EGPK+G  E+ A+LPGFPDNVR N+KGQ+WVAIDCCRT +QE+L +
Sbjct  267   FTETTNCRIMRYWLEGPKAGSMELFADLPGFPDNVRLNDKGQFWVAIDCCRTPVQEILSH  326

Query  1105  HPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             +PW R++YFRLPL M  LAR  GMKMYTVI+LF+++ E+++VLED+ GDV KLVSEV+EV
Sbjct  327   NPWIRNIYFRLPLKMSILARKMGMKMYTVIALFNEDREIVEVLEDRRGDVAKLVSEVKEV  386

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             +G+LWIGTVAHN I TL +P
Sbjct  387   NGRLWIGTVAHNQITTLSFP  406



>emb|CDY00623.1| BnaC04g23020D [Brassica napus]
Length=1270

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/377 (72%), Positives = 323/377 (86%), Gaps = 11/377 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFDT  393
             DPF +SP+GG++F+P+K+++APYK+VME W  DN S+LG  G LEFVD VFGPESLEFD 
Sbjct  900   DPFHMSPIGGREFKPMKHEVAPYKQVMENWPRDNLSQLGQHGKLEFVDRVFGPESLEFDG  959

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY GLADGR+VRWMG+  GWETF++VT  WSE+ C  GVDSTT KQWK E  CGRP
Sbjct  960   LGRGPYTGLADGRVVRWMGEAVGWETFSVVTSKWSEEACARGVDSTTNKQWKHEKLCGRP  1019

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDK+TG+LYIADAYYGLLVVGP+GG+ATPLATHVEGKPILFANDLDIH+NGSIFFT
Sbjct  1020  LGLRFDKETGNLYIADAYYGLLVVGPEGGVATPLATHVEGKPILFANDLDIHRNGSIFFT  1079

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             DTS++Y+R NHF I+LEGE+TGRLLRYDPPT  TH+V + LAFPNG+Q S+D SFLLFTE
Sbjct  1080  DTSKRYDRANHFFILLEGESTGRLLRYDPPTKTTHIVQEGLAFPNGIQLSKDQSFLLFTE  1139

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             TTNCRL+KYW+EG K+G  EV+A+LPGFPDNVR N+KG++WVAIDCCRT  QEVL ++PW
Sbjct  1140  TTNCRLVKYWLEGAKTGEVEVVADLPGFPDNVRMNKKGEFWVAIDCCRTPAQEVLTDNPW  1199

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              +S+YFRLP+PM+ LA+  GMKMYTVIS FD++GEVL+VLED+ G VMKL          
Sbjct  1200  IKSIYFRLPIPMKLLAKAMGMKMYTVISRFDEDGEVLEVLEDRQGKVMKL----------  1249

Query  1294  LWIGTVAHNHIATLPYP  1344
             LWIGTVAHNHIA++PYP
Sbjct  1250  LWIGTVAHNHIASVPYP  1266



>dbj|BAJ99293.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08281.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/376 (68%), Positives = 303/376 (81%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPVK+++APY+EVM+RW  DN SRL LG LEFV+EVFGPES+EFD  
Sbjct  36    DPFHLGPLAGIDYRPVKHELAPYREVMQRWPRDNGSRLRLGRLEFVNEVFGPESIEFDRQ  95

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMGD  GWETFA++ P+WSEK+C  GV+STT KQ   E  CGRPL
Sbjct  96    GRGPYAGLADGRVVRWMGDMTGWETFAVMNPDWSEKVCANGVESTTKKQHGKEKWCGRPL  155

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF ++TG+L+IADAYYGL+ VG  GG+AT LA    G P+ FANDLDIH NGSIFFTD
Sbjct  156   GLRFHRETGELFIADAYYGLMAVGDSGGVATSLAREAGGDPVHFANDLDIHMNGSIFFTD  215

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYDP TG  HVVL  L FPNGVQ S+D  FLLF+ET
Sbjct  216   TSTRYSRKDHLNILLEGEGTGRLLRYDPETGAVHVVLSGLVFPNGVQISQDQQFLLFSET  275

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGPK+G+ EV ANLPGFPDNVR N KGQ+WVAIDCCRT +QEV    PW 
Sbjct  276   TNCRIMRYWLEGPKAGQVEVFANLPGFPDNVRMNSKGQFWVAIDCCRTPMQEVFARRPWL  335

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             RS YF++P+ M+ L +   MKMYT+++L D  G V++VLED+ G+VMKLVSEVREVD +L
Sbjct  336   RSAYFKIPVSMKTLGKMVSMKMYTLLALLDGEGNVVEVLEDRGGEVMKLVSEVREVDRRL  395

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIATLPYP
Sbjct  396   WIGTVAHNHIATLPYP  411



>emb|CBI36701.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/359 (72%), Positives = 299/359 (83%), Gaps = 5/359 (1%)
 Frame = +1

Query  295   MERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETF  474
             ME W  DN+SRLG G LEFVDEVFGPESLEFD  GRGPY GLADGRIVRWMGD+ GWETF
Sbjct  1     MEDWPRDNRSRLGQGKLEFVDEVFGPESLEFDIFGRGPYTGLADGRIVRWMGDSVGWETF  60

Query  475   ALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPD  654
             ALVTPNWSEK+C  G+DSTT KQWK E +CGRPLGLRF K+TGDLYIADAYYGLLVVGP+
Sbjct  61    ALVTPNWSEKLCAKGIDSTTSKQWKVEQRCGRPLGLRFHKETGDLYIADAYYGLLVVGPE  120

Query  655   GGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRY  834
             GG+ATPL THV+GKPILFANDLDIHKNGSIFFTDTS++YNR+NHF I+LEGEATGRLLRY
Sbjct  121   GGLATPLVTHVQGKPILFANDLDIHKNGSIFFTDTSKRYNRMNHFFILLEGEATGRLLRY  180

Query  835   DPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPG  1014
             DPPT  TH+VLD LAFPNGVQ S D SFLLFTETTNCRLMKYW+EGPKSG  E++ANLPG
Sbjct  181   DPPTRTTHLVLDGLAFPNGVQLSGDQSFLLFTETTNCRLMKYWLEGPKSGIVELVANLPG  240

Query  1015  FPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVI  1194
             FPDNVR NE+GQ+WVAIDCCRT  QEVL ++PW +++YFRLP+ +  LAR  GMKMYTVI
Sbjct  241   FPDNVRLNERGQFWVAIDCCRTPAQEVLTHNPWLKNIYFRLPVKLSMLARLMGMKMYTVI  300

Query  1195  SLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP*FNCITLLY  1371
             SLF++ GE+L+VLED+ G VM+L   +  V+  L    +  N I+ + +   NC   ++
Sbjct  301   SLFNEKGEILEVLEDRKGLVMRLAYSI--VNTSL---VLIENFISAIIFFSINCDNCIF  354



>gb|AAV70496.1| putative male sterility protein [Triticum aestivum]
 emb|CAG38622.1| hypothetical protein [Triticum aestivum]
Length=413

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 303/376 (81%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPVK+++APY+EVM+RW  DN SRL LG LEFV+EVFGPES+EFD  
Sbjct  36    DPFHLGPLAGIDYRPVKHELAPYREVMQRWPRDNGSRLRLGRLEFVNEVFGPESIEFDRQ  95

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMGD AGWETFA++ P+WSEK+C  GV+STT KQ   E  CGRPL
Sbjct  96    GRGPYAGLADGRVVRWMGDKAGWETFAVMNPDWSEKVCANGVESTTKKQHGKEQWCGRPL  155

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF ++TG+L+IADAYYGL+ VG  GG+AT LA    G P+ FANDLDIH NGSIFFTD
Sbjct  156   GLRFHRETGELFIADAYYGLMAVGESGGVATSLAREAGGDPVHFANDLDIHMNGSIFFTD  215

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYD  TG  HVVL+ L FPNGVQ S+D  FLLF+ET
Sbjct  216   TSTRYSRKDHLNILLEGEGTGRLLRYDRETGAVHVVLNGLVFPNGVQISQDQQFLLFSET  275

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G+ EV ANLPGFPDNVR N KGQ+WVAIDCCRT  QEV    PW 
Sbjct  276   TNCRIMRYWLEGPRAGQVEVFANLPGFPDNVRLNSKGQFWVAIDCCRTPTQEVFARWPWL  335

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R+ YF++P+ M+ L +   MKMYT+++L D  G V++VLED+ G+VMKLVSEVREVD +L
Sbjct  336   RTAYFKIPVSMKTLGKMVSMKMYTLLALLDGEGNVVEVLEDRGGEVMKLVSEVREVDRRL  395

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  396   WIGTVAHNHIATIPYP  411



>gb|EMS61191.1| Adipocyte plasma membrane-associated protein [Triticum urartu]
Length=413

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 303/376 (81%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPVK+++APY+EVM+RW  DN SRL LG LEFV+EVFGPES+EFD  
Sbjct  36    DPFHLGPLAGIDYRPVKHELAPYREVMQRWPRDNGSRLRLGRLEFVNEVFGPESIEFDRQ  95

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMGD AGWETFA++ P+WSEK+C  GV+STT KQ   E  CGRPL
Sbjct  96    GRGPYAGLADGRVVRWMGDKAGWETFAVMNPDWSEKVCANGVESTTKKQHGKEKWCGRPL  155

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF ++TG+L+IADAYYGL+ VG  GG+AT LA    G P+ FANDLDIH NGSIFFTD
Sbjct  156   GLRFHRETGELFIADAYYGLMAVGESGGVATSLAREAGGDPVHFANDLDIHMNGSIFFTD  215

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYD  TG  HVVL+ L FPNGVQ S+D  FLLF+ET
Sbjct  216   TSTRYSRKDHLNILLEGEGTGRLLRYDRETGAVHVVLNGLVFPNGVQISQDQQFLLFSET  275

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G+ EV ANLPGFPDNVR N KGQ+WVAIDCCRT  QEV    PW 
Sbjct  276   TNCRIMRYWLEGPRAGQVEVFANLPGFPDNVRLNSKGQFWVAIDCCRTPTQEVFARWPWL  335

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R+ YF++P+ M+ L +   MKMYT+++L D  G V++VLED+ G+VMKLVSEVREVD +L
Sbjct  336   RTAYFKIPVSMKTLGKMVSMKMYTLLALLDGEGNVVEVLEDRGGEVMKLVSEVREVDRRL  395

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  396   WIGTVAHNHIATIPYP  411



>ref|XP_006649792.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Oryza brachyantha]
Length=426

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/378 (65%), Positives = 303/378 (80%), Gaps = 0/378 (0%)
 Frame = +1

Query  211   IGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             + DPF L P+ G  +RPVK+++APY+EVM RW  DN SRL LG LEFV EVFGPES+EFD
Sbjct  35    VTDPFHLGPLAGVDYRPVKHELAPYREVMARWPRDNGSRLRLGRLEFVGEVFGPESIEFD  94

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY GLADGR+VRWMG+  GWETFA+ +P WSE++C  GV+STT KQ + E QCGR
Sbjct  95    RHGRGPYAGLADGRVVRWMGEETGWETFAVTSPGWSEQVCANGVESTTKKQHEVERQCGR  154

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF + TG+LY+ADAYYGL+ VGP+GG+AT +A  V G PI FANDLDIH+NGS+FF
Sbjct  155   PLGLRFHRDTGELYVADAYYGLMAVGPNGGVATSVARQVGGNPINFANDLDIHRNGSVFF  214

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TDTS +Y+R +H  ++LEGE TGRLLRYDP T   HVVL  L FPNGVQ S+D  FLLF+
Sbjct  215   TDTSMRYSRKDHLNVLLEGEGTGRLLRYDPETNAVHVVLSGLVFPNGVQISDDQRFLLFS  274

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             ETTNCR+M+YW+EGP++G+ EV A+LPGFPDNVR +  GQ+WVA+DCCRT  QEV    P
Sbjct  275   ETTNCRIMRYWLEGPRAGQVEVFADLPGFPDNVRLSSGGQFWVAVDCCRTAAQEVFAKRP  334

Query  1111  WTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDG  1290
             W R++YF+LPL M+ L +   ++M+T+++L D  G V++VLED+ G+VM+LVSEVREV  
Sbjct  335   WLRTLYFKLPLTMRTLGKMVSVRMHTLLALLDGEGNVVEVLEDRGGEVMRLVSEVREVGR  394

Query  1291  KLWIGTVAHNHIATLPYP  1344
             KLWIGTVAHNHIAT+PYP
Sbjct  395   KLWIGTVAHNHIATIPYP  412



>ref|XP_003558297.1| PREDICTED: strictosidine synthase 1 [Brachypodium distachyon]
Length=412

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/378 (66%), Positives = 300/378 (79%), Gaps = 0/378 (0%)
 Frame = +1

Query  211   IGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             + DPF L P+ G  +RPV++++APY EVM RW  DN SRL LG LEFV+EVFGPES+EFD
Sbjct  33    VMDPFHLGPLAGIDYRPVRHELAPYGEVMARWPRDNGSRLRLGRLEFVNEVFGPESIEFD  92

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY GLADGR+VRWMG+  GWETFA++ P+WSE++C  GV+STT KQ   E  CGR
Sbjct  93    RLGRGPYAGLADGRVVRWMGEETGWETFAVMNPDWSEEVCANGVESTTRKQHGKEQWCGR  152

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF   TG+L IADAYYGL+ VG  GG+AT LA    G P+ FANDLD+HKNGSIFF
Sbjct  153   PLGLRFHGDTGELLIADAYYGLMSVGQSGGVATSLAREAGGSPVHFANDLDVHKNGSIFF  212

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TDTS +Y+R +H  I+LEGE TGRLLRYDP T   HVVLD L FPNGVQ S+D  FLLF+
Sbjct  213   TDTSTRYSRKDHLNILLEGEGTGRLLRYDPDTRSAHVVLDGLVFPNGVQISQDQRFLLFS  272

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             ETTNCR+M+YW+EGP++G+ E+ ANLPGFPDNVR N  GQ+WVAIDCCRT  QEV    P
Sbjct  273   ETTNCRIMRYWLEGPRAGQVELFANLPGFPDNVRLNSNGQFWVAIDCCRTPTQEVFARRP  332

Query  1111  WTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDG  1290
             W R+ YF++P+PM+ L +   M+MYT+++L D  G V++VLED+ G+VMKLVSEVREVD 
Sbjct  333   WLRAAYFKIPVPMKALGKMVSMRMYTLLALLDVEGNVVEVLEDRGGEVMKLVSEVREVDR  392

Query  1291  KLWIGTVAHNHIATLPYP  1344
             +LWIGTVAHNHIATLPYP
Sbjct  393   RLWIGTVAHNHIATLPYP  410



>ref|XP_002465509.1| hypothetical protein SORBIDRAFT_01g040240 [Sorghum bicolor]
 gb|EER92507.1| hypothetical protein SORBIDRAFT_01g040240 [Sorghum bicolor]
Length=412

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/376 (66%), Positives = 301/376 (80%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF LSP+ G  +RPVK+++APY EVM  W  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  35    DPFGLSPLAGVDYRPVKHELAPYAEVMGSWPRDNASRLRRGRLEFVGEVFGPESIEFDRE  94

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG+ AGWETFA++ P WSE++C  GV+STT KQ + E  CGRPL
Sbjct  95    GRGPYAGLADGRVVRWMGEEAGWETFAVMNPEWSEEVCANGVNSTTRKQHEKEEFCGRPL  154

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF ++TG+LY+ADAYYGL+V+G  GG+A+ +A   +G  I FANDLDIH+NGS+FFTD
Sbjct  155   GLRFHRETGELYVADAYYGLMVIGQSGGVASSVAREADGDLIRFANDLDIHRNGSVFFTD  214

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYDP T   HVVL  L FPNGVQ SED  FLLF+ET
Sbjct  215   TSMRYSRKDHLNILLEGEGTGRLLRYDPETNAVHVVLKGLVFPNGVQISEDQQFLLFSET  274

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G  EV ANLPGFPDNVR+N KGQ+WVAIDCCRTR Q V    PW 
Sbjct  275   TNCRIMRYWLEGPRTGEVEVFANLPGFPDNVRSNGKGQFWVAIDCCRTRAQAVFAKRPWL  334

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R++YF+ PL ++ L R A  +M+TV++L D++G V++VLED+  +VMKLVSEVREVD KL
Sbjct  335   RTLYFKFPLTLKMLTRRAAKRMHTVLALLDRDGRVVEVLEDRGREVMKLVSEVREVDRKL  394

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  395   WIGTVAHNHIATIPYP  410



>gb|EMT22896.1| Adipocyte plasma membrane-associated protein [Aegilops tauschii]
Length=425

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/388 (65%), Positives = 302/388 (78%), Gaps = 12/388 (3%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPVK+++APY+EVM+RW  DN SRL LG LEFV+EVFGPES+EFD  
Sbjct  36    DPFHLGPLAGIDYRPVKHELAPYREVMQRWPRDNGSRLRLGRLEFVNEVFGPESIEFDRQ  95

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNW------------SEKICGLGVDSTTPK  540
             GRGPY GLADGR+VRWMGD AGWETFA++ P+W            SEK+C  GV+STT K
Sbjct  96    GRGPYAGLADGRVVRWMGDKAGWETFAVMNPDWYWLTAEKPIAYLSEKVCANGVESTTKK  155

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
             Q   E  CGRPLGLRF ++TG+L+IADAYYGL+ VG  GG+AT LA    G P+ FANDL
Sbjct  156   QHGKEKWCGRPLGLRFHRETGELFIADAYYGLMAVGERGGVATSLAREAGGDPVHFANDL  215

Query  721   DIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQF  900
             DIH NGSIFFTDTS +Y+R +H  I+LEGE TGRLLRYD  TG  HVVL+ L FPNGVQ 
Sbjct  216   DIHMNGSIFFTDTSTRYSRKDHLNILLEGEGTGRLLRYDRETGAVHVVLNGLVFPNGVQI  275

Query  901   SEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRT  1080
             S+D  FLLF+ETTNCR+M+YW+EGP+ G+ EV ANLPGFPDNVR N KGQ+WVAIDCCRT
Sbjct  276   SQDQQFLLFSETTNCRIMRYWLEGPRVGQVEVFANLPGFPDNVRLNSKGQFWVAIDCCRT  335

Query  1081  RIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               QEV    PW R+ YF++P+ M+ L +   MKMYT+++L D  G V++VLED+ G+VMK
Sbjct  336   PTQEVFARWPWLRTAYFKIPVSMKTLGKMVSMKMYTLLALLDGEGNVVEVLEDRGGEVMK  395

Query  1261  LVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             LVSEVREVD +LWIGTVAHNHIAT+PYP
Sbjct  396   LVSEVREVDRRLWIGTVAHNHIATIPYP  423



>ref|NP_001049635.1| Os03g0263600 [Oryza sativa Japonica Group]
 gb|AAP06859.1| putative male fertility protein [Zea mays] [Oryza sativa Japonica 
Group]
 gb|ABF95112.1| Strictosidine synthase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11549.1| Os03g0263600 [Oryza sativa Japonica Group]
 dbj|BAG94615.1| unnamed protein product [Oryza sativa Japonica Group]
Length=427

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 305/379 (80%), Gaps = 3/379 (1%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPV++++APY+EVM RW  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  37    DPFHLGPLAGVDYRPVRHELAPYREVMARWPRDNGSRLRHGRLEFVGEVFGPESIEFDRH  96

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG++AGWETFA+++P+WSEK+C  GV+STT KQ + E +CGRPL
Sbjct  97    GRGPYAGLADGRVVRWMGEDAGWETFAVMSPDWSEKVCANGVESTTKKQHEMERRCGRPL  156

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF  +TG+LY+ADAYYGL+ VGP+GG+AT LA  V G P+ FANDLDIH+NGS+FFTD
Sbjct  157   GLRFHGETGELYVADAYYGLMSVGPNGGVATSLAREVGGSPVNFANDLDIHRNGSVFFTD  216

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +YNR +H  ++LEGE TGRLLRYDP T   HVVL  L FPNGVQ S+D  FLLF+ET
Sbjct  217   TSTRYNRKDHLNVLLEGEGTGRLLRYDPETKAAHVVLSGLVFPNGVQISDDQQFLLFSET  276

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR---ANEKGQYWVAIDCCRTRIQEVLINH  1107
             TNCR+M+YW+EGP++G+ EV A+LPGFPDNVR       G++WVAIDCCRT  QEV    
Sbjct  277   TNCRIMRYWLEGPRAGQVEVFADLPGFPDNVRLSSGGGGGRFWVAIDCCRTAAQEVFAKR  336

Query  1108  PWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
             PW R++YF+LPL M+ L +   M+M+T+++L D  G+V++VLED+ G+VM+LVSEVREV 
Sbjct  337   PWLRTLYFKLPLTMRTLGKMVSMRMHTLVALLDGEGDVVEVLEDRGGEVMRLVSEVREVG  396

Query  1288  GKLWIGTVAHNHIATLPYP  1344
              KLWIGTVAHNHIAT+PYP
Sbjct  397   RKLWIGTVAHNHIATIPYP  415



>gb|EAZ26352.1| hypothetical protein OsJ_10233 [Oryza sativa Japonica Group]
Length=427

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 305/379 (80%), Gaps = 3/379 (1%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPV++++APY+EVM RW  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  37    DPFHLGPLAGVDYRPVRHELAPYREVMARWPRDNGSRLRHGRLEFVGEVFGPESIEFDRN  96

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG++AGWETFA+++P+WSEK+C  GV+STT KQ + E +CGRPL
Sbjct  97    GRGPYAGLADGRVVRWMGEDAGWETFAVMSPDWSEKVCANGVESTTKKQHEMERRCGRPL  156

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF  +TG+LY+ADAYYGL+ VGP+GG+AT LA  V G P+ FANDLDIH+NGS+FFTD
Sbjct  157   GLRFHGETGELYVADAYYGLMSVGPNGGVATSLAREVGGSPVNFANDLDIHRNGSVFFTD  216

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +YNR +H  ++LEGE TGRLLRYDP T   HVVL  L FPNGVQ S+D  FLLF+ET
Sbjct  217   TSTRYNRKDHLNVLLEGEGTGRLLRYDPETKAAHVVLSGLVFPNGVQISDDQQFLLFSET  276

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR---ANEKGQYWVAIDCCRTRIQEVLINH  1107
             TNCR+M+YW+EGP++G+ EV A+LPGFPDNVR       G++WVAIDCCRT  QEV    
Sbjct  277   TNCRIMRYWLEGPRAGQVEVFADLPGFPDNVRLSSGGGGGRFWVAIDCCRTAAQEVFAKR  336

Query  1108  PWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
             PW R++YF+LPL M+ L +   M+M+T+++L D  G+V++VLED+ G+VM+LVSEVREV 
Sbjct  337   PWLRTLYFKLPLTMRTLGKMVSMRMHTLVALLDGEGDVVEVLEDRGGEVMRLVSEVREVG  396

Query  1288  GKLWIGTVAHNHIATLPYP  1344
              KLWIGTVAHNHIAT+PYP
Sbjct  397   RKLWIGTVAHNHIATIPYP  415



>gb|EAY89345.1| hypothetical protein OsI_10849 [Oryza sativa Indica Group]
Length=430

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 305/379 (80%), Gaps = 3/379 (1%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L P+ G  +RPV++++APY+EVM RW  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  37    DPFHLGPLAGVDYRPVRHELAPYREVMARWPRDNGSRLRHGRLEFVGEVFGPESIEFDRH  96

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG++AGWETFA+++P+WSEK+C  GV+STT KQ + E +CGRPL
Sbjct  97    GRGPYAGLADGRVVRWMGEDAGWETFAVMSPDWSEKVCANGVESTTKKQHEMERRCGRPL  156

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF  +TG+LY+ADAYYGL+ VGP+GG+AT LA  V G P+ FANDLDIH+NGS+FFTD
Sbjct  157   GLRFHGETGELYVADAYYGLMSVGPNGGVATSLAREVGGSPVNFANDLDIHRNGSVFFTD  216

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +YNR +H  ++LEGE TGRLLRYDP T   HVVL  L FPNGVQ S+D  FLLF+ET
Sbjct  217   TSTRYNRKDHLNVLLEGEGTGRLLRYDPETKAAHVVLSGLVFPNGVQISDDQQFLLFSET  276

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR---ANEKGQYWVAIDCCRTRIQEVLINH  1107
             TNCR+M+YW+EGP++G+ EV A+LPGFPDNVR       G++WVAIDCCRT  QEV    
Sbjct  277   TNCRIMRYWLEGPRAGQVEVFADLPGFPDNVRLSSGGGGGRFWVAIDCCRTAAQEVFAKR  336

Query  1108  PWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
             PW R++YF+LPL M+ L +   M+M+T+++L D  G+V++VLED+ G+VM+LVSEVREV 
Sbjct  337   PWLRTLYFKLPLTMRTLGKMVSMRMHTLVALLDGEGDVVEVLEDRGGEVMRLVSEVREVG  396

Query  1288  GKLWIGTVAHNHIATLPYP  1344
              KLWIGTVAHNHIAT+PYP
Sbjct  397   RKLWIGTVAHNHIATIPYP  415



>ref|XP_004984702.1| PREDICTED: strictosidine synthase-like [Setaria italica]
Length=413

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 296/376 (79%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF LSP+ G  +RPVK+++APY EVM  W  D+ SRL  G LEFV EVFGPES+EFD  
Sbjct  35    DPFRLSPLAGVDYRPVKHELAPYGEVMGSWPRDDASRLRRGRLEFVGEVFGPESIEFDGE  94

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG+ AGWETFA++ P+WSEK+C  G +STT  Q   E  CGRPL
Sbjct  95    GRGPYAGLADGRVVRWMGEEAGWETFAVMNPDWSEKVCANGANSTTRTQHDKEEFCGRPL  154

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF ++TG+LY+ADAYYGL+++G  GG+AT LA    G PI FANDLD+HKNGS+FFTD
Sbjct  155   GLRFHRETGELYVADAYYGLMIIGRSGGVATSLAREAGGDPIRFANDLDVHKNGSVFFTD  214

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYDP TG   VVL  L FPNG+Q SEDH FLLF+ET
Sbjct  215   TSMRYSRKDHLNILLEGEGTGRLLRYDPGTGAVSVVLQGLVFPNGLQISEDHQFLLFSET  274

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G  EV ANLPGFPDNVR+N KGQ+WVAIDCCRT  QEV    PW 
Sbjct  275   TNCRIMRYWLEGPRTGELEVFANLPGFPDNVRSNGKGQFWVAIDCCRTPAQEVFAKRPWL  334

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R+ YF+ PL ++ L R A  +M+T+++L D  G V++VLED+  +VMKLVSEVREV  KL
Sbjct  335   RTAYFKFPLTLKMLTRRATTRMHTMLALLDGEGRVVEVLEDRGREVMKLVSEVREVGRKL  394

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  395   WIGTVAHNHIATVPYP  410



>ref|XP_008660311.1| PREDICTED: strictosidine synthase [Zea mays]
 gb|AAK52489.1|AF360356_1 male fertility protein [Zea mays]
Length=412

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/376 (65%), Positives = 298/376 (79%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF LSP+    +RPVK+++APY EVM  W  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  34    DPFGLSPLAEVDYRPVKHELAPYGEVMGSWPRDNASRLRRGRLEFVGEVFGPESIEFDLQ  93

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG+ AGWETFA++ P+WSE++C  GV+STT KQ + E  CGRPL
Sbjct  94    GRGPYAGLADGRVVRWMGEEAGWETFAVMNPDWSEEVCANGVNSTTRKQHEKEEFCGRPL  153

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF  +TG+LY+ADAYYGL+VVG  GG+A+ +A   +G PI FANDLD+H+NGS+FFTD
Sbjct  154   GLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRFANDLDVHRNGSVFFTD  213

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYDP T   HVVL  L FPNGVQ SEDH FLLF+ET
Sbjct  214   TSMRYSRKDHLNILLEGEGTGRLLRYDPETSGVHVVLKGLVFPNGVQISEDHQFLLFSET  273

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G  EV ANLPGFPDNVR+N +GQ+WVAIDCCRT  QEV    PW 
Sbjct  274   TNCRIMRYWLEGPRAGEVEVFANLPGFPDNVRSNGRGQFWVAIDCCRTPAQEVFAKRPWL  333

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R++YF+ PL ++ L   A  +M+TV++L D  G V++VLED+  +VMKLVSEVREV  KL
Sbjct  334   RTLYFKFPLSLKVLTWKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGRKL  393

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  394   WIGTVAHNHIATIPYP  409



>gb|ACG38465.1| strictosidine synthase 1 precursor [Zea mays]
Length=413

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/376 (65%), Positives = 298/376 (79%), Gaps = 0/376 (0%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF LSP+    +RPVK+++APY EVM  W  DN SRL  G LEFV EVFGPES+EFD  
Sbjct  35    DPFGLSPLAEVDYRPVKHELAPYGEVMGSWPRDNASRLRRGRLEFVGEVFGPESIEFDLQ  94

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY GLADGR+VRWMG+ AGW+TFA++ P+WSE++C  GV+STT KQ + E  CGRPL
Sbjct  95    GRGPYAGLADGRVVRWMGEEAGWDTFAVMNPDWSEEVCANGVNSTTRKQHEKEEFCGRPL  154

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRF  +TG+LY+ADAYYGL+VVG  GG+A+ +A   +G PI FANDLD+H+NGS+FFTD
Sbjct  155   GLRFHGETGELYVADAYYGLMVVGQSGGVASSVAREADGDPIRFANDLDVHRNGSVFFTD  214

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             TS +Y+R +H  I+LEGE TGRLLRYDP T   HVVL  L FPNGVQ SEDH FLLF+ET
Sbjct  215   TSMRYSRKDHLNILLEGEGTGRLLRYDPETSGVHVVLKGLVFPNGVQISEDHQFLLFSET  274

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
             TNCR+M+YW+EGP++G  EV ANLPGFPDNVR+N +GQ+WVAIDCCRT  QEV    PW 
Sbjct  275   TNCRIMRYWLEGPRAGEVEVFANLPGFPDNVRSNGRGQFWVAIDCCRTPAQEVFAKRPWL  334

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R++YF+ PL ++ L   A  +M+TV++L D  G V++VLED+  +VMKLVSEVREV  KL
Sbjct  335   RTLYFKFPLSLKVLTWKAARRMHTVLALLDGEGRVVEVLEDRGHEVMKLVSEVREVGSKL  394

Query  1297  WIGTVAHNHIATLPYP  1344
             WIGTVAHNHIAT+PYP
Sbjct  395   WIGTVAHNHIATIPYP  410



>ref|XP_006442992.1| hypothetical protein CICLE_v10021444mg [Citrus clementina]
 gb|ESR56232.1| hypothetical protein CICLE_v10021444mg [Citrus clementina]
Length=294

 Score =   496 bits (1278),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 230/292 (79%), Positives = 258/292 (88%), Gaps = 0/292 (0%)
 Frame = +1

Query  469   TFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVG  648
             TFA+VT NWSEK+C  GVDSTT KQWK E  CGRPLGLRF+K TGDLYIADAYYGLLVVG
Sbjct  3     TFAIVTSNWSEKLCARGVDSTTAKQWKHEKWCGRPLGLRFNKDTGDLYIADAYYGLLVVG  62

Query  649   PDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLL  828
               GG+ATPLAT   GKPILFANDLD+HKNGSIFFTDTS++YNRV+HF I+LEGE+TGRLL
Sbjct  63    SKGGLATPLATQAGGKPILFANDLDVHKNGSIFFTDTSKRYNRVDHFFILLEGESTGRLL  122

Query  829   RYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANL  1008
             RYDPPT  TH+VLD LAFPNGVQ S+DHSFLLFTETTNCRLMKYW+EGPK+G  E++ANL
Sbjct  123   RYDPPTKATHIVLDGLAFPNGVQLSKDHSFLLFTETTNCRLMKYWLEGPKTGTVELVANL  182

Query  1009  PGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYT  1188
             PGFPDNVR NE+GQ+WVAIDCCRT  QEVL ++PW RS+YFRLP+ M +LAR  GMKMYT
Sbjct  183   PGFPDNVRINERGQFWVAIDCCRTAAQEVLSHNPWIRSIYFRLPIRMSFLARVMGMKMYT  242

Query  1189  VISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
             VISLF++NGE+L+VLED  G VMKLVSEV+E  GKLWIGTVAHNHIATLPYP
Sbjct  243   VISLFNENGEILEVLEDPRGVVMKLVSEVKEAQGKLWIGTVAHNHIATLPYP  294



>ref|XP_002979343.1| hypothetical protein SELMODRAFT_110258 [Selaginella moellendorffii]
 gb|EFJ19751.1| hypothetical protein SELMODRAFT_110258 [Selaginella moellendorffii]
Length=405

 Score =   447 bits (1149),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 271/370 (73%), Gaps = 3/370 (1%)
 Frame = +1

Query  235   PVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYG  414
             P+GG K+ PVK+ IAP K V+ +W   N S L   ++EF D +FGPES+EFD  G GPY 
Sbjct  39    PLGGLKYYPVKHQIAPLKSVLPKWPSRNDSLLQFASIEFQDRLFGPESIEFDPQGNGPYT  98

Query  415   GLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDK  594
             GL DGRIVRWM D  GWETFAL + NW+ + C  G D    ++ + E  CGRPLGLRFD 
Sbjct  99    GLGDGRIVRWMPDR-GWETFALSSINWNREECDNGDDPR--RRVRNEHVCGRPLGLRFDP  155

Query  595   KTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYN  774
             ++GDLYIAD+YYGLLVVGP GGIA PL + VEG PI FANDLD+H NGS++FTDTS ++N
Sbjct  156   RSGDLYIADSYYGLLVVGPKGGIARPLVSEVEGIPIKFANDLDVHPNGSVYFTDTSTRWN  215

Query  775   RVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLM  954
             R  H ++++EGE TGRLLRYDP TG   VVL  LAF NGVQ + D SFLL  ETTNCR++
Sbjct  216   RRLHHMVIVEGENTGRLLRYDPNTGNAVVVLRGLAFANGVQLASDQSFLLVVETTNCRVL  275

Query  955   KYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFR  1134
             K W++G  +G  EV A+LPG+PDNVR N+KGQ+WVAIDCCR RIQE++ + PW +S+ FR
Sbjct  276   KLWLKGNLTGTLEVFADLPGYPDNVRINDKGQFWVAIDCCRNRIQEIMSSTPWLKSLVFR  335

Query  1135  LPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVA  1314
             +P+P+ ++    G KMY+V +LFD+ G +L  LED+   ++KL+SEV E DGK+W GTV 
Sbjct  336   VPVPLSWIMYVVGEKMYSVAALFDKRGRLLRRLEDREARIVKLISEVYEKDGKIWFGTVV  395

Query  1315  HNHIATLPYP  1344
             H+ I +   P
Sbjct  396   HDQITSFILP  405



>ref|XP_002992336.1| hypothetical protein SELMODRAFT_135098 [Selaginella moellendorffii]
 gb|EFJ06612.1| hypothetical protein SELMODRAFT_135098 [Selaginella moellendorffii]
Length=405

 Score =   446 bits (1148),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 271/370 (73%), Gaps = 3/370 (1%)
 Frame = +1

Query  235   PVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYG  414
             P+GG K+ PVK+ IAP K V+ +W   N S L   ++EF D +FGPES+EFD  G GPY 
Sbjct  39    PLGGLKYYPVKHQIAPLKSVLPKWPSRNDSLLQFASIEFQDRLFGPESIEFDPQGNGPYT  98

Query  415   GLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDK  594
             GL DGRIVRWM D  GWETFAL + NW+ + C  G D    ++ + E  CGRPLGLRFD 
Sbjct  99    GLGDGRIVRWMPDR-GWETFALSSINWNREECDNGDDPR--RRVRNEHVCGRPLGLRFDP  155

Query  595   KTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYN  774
             ++GDLYIAD+YYGLLVVGP GGIA PL + VEG PI FANDLD+H NGS++FTDTS ++N
Sbjct  156   RSGDLYIADSYYGLLVVGPKGGIARPLVSEVEGIPIKFANDLDVHPNGSVYFTDTSTRWN  215

Query  775   RVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLM  954
             R  H ++++EGE TGRLLRYDP TG   VVL  LAF NGVQ + D SFLL  ETTNCR++
Sbjct  216   RRLHHMVIVEGENTGRLLRYDPNTGNAVVVLRGLAFANGVQLASDQSFLLVVETTNCRVL  275

Query  955   KYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFR  1134
             K W++G  +G  EV A+LPG+PDNVR N+KGQ+WVAIDCCR RIQE++ + PW +S+ FR
Sbjct  276   KLWLKGNLTGTLEVFADLPGYPDNVRINDKGQFWVAIDCCRNRIQEIMSSTPWLKSLVFR  335

Query  1135  LPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVA  1314
             +P+P+ ++    G KMY+V +LFD+ G +L  LED+   ++KL+SEV E DGK+W GTV 
Sbjct  336   VPVPLSWIMYVVGEKMYSVAALFDKRGRLLRRLEDREARIVKLISEVYEKDGKIWFGTVV  395

Query  1315  HNHIATLPYP  1344
             H+ I +   P
Sbjct  396   HDQITSFILP  405



>gb|KDO42881.1| hypothetical protein CISIN_1g039124mg [Citrus sinensis]
Length=259

 Score =   355 bits (912),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 190/228 (83%), Gaps = 0/228 (0%)
 Frame = +1

Query  199  IGIMIGDPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPES  378
            +G +I DP ++ P+GG +FRPVK+DIAPY++VM+ W  DN SRL  G LEFVDEVFGPES
Sbjct  25   LGFLIMDPLQMGPLGGHEFRPVKHDIAPYRQVMQSWPRDNLSRLVTGKLEFVDEVFGPES  84

Query  379  LEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFES  558
            LEFD LGRGPY GLADGRIVRWMG+N GWETFA+VT NWSEK+C  GVDSTT KQWK E 
Sbjct  85   LEFDGLGRGPYTGLADGRIVRWMGENVGWETFAIVTSNWSEKLCARGVDSTTAKQWKHEK  144

Query  559  QCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNG  738
             CGRPLGLRF+K TGDLYIADAYYGLLVVG  GG+ATPLAT   GKPILFANDLD+HKNG
Sbjct  145  WCGRPLGLRFNKDTGDLYIADAYYGLLVVGSKGGLATPLATQAGGKPILFANDLDVHKNG  204

Query  739  SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAF  882
            SIFFTDTS++YNRV+HF I+LEGE+TGRLLRYDPPT      +  L F
Sbjct  205  SIFFTDTSKRYNRVDHFFILLEGESTGRLLRYDPPTKSNSYCVRWLGF  252



>gb|ABK24858.1| unknown [Picea sitchensis]
Length=423

 Score =   339 bits (870),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 242/374 (65%), Gaps = 7/374 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  SP+     F+    +  P+ E    +  D+ +RL   +L+ ++ V GPESL FD 
Sbjct  52    DPFHHSPIADFPDFKAHTIECPPWAE-FSIFPTDSNNRLQKADLKSLNGVSGPESLAFDP  110

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
               +GPY G ADGRI+RW G N GW  FA  +PN SE IC     S+     K E  CGRP
Sbjct  111   ENKGPYTGTADGRILRWDGPNLGWSQFAYTSPNRSE-ICDKAHKSSL-AYVKHEHICGRP  168

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF+  TGDLYIADAY+GLLVVGP GG+ATPLAT  EG P  F NDLDI  +G+++FT
Sbjct  169   LGLRFNNITGDLYIADAYFGLLVVGPQGGLATPLATEAEGVPFKFTNDLDIDMDGNVYFT  228

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S  Y R N  +++   E +GR+L++DP TG+T V+   +  PNG+  S+D SF +FTE
Sbjct  229   DSSTIYQRKNFIVLVFSAEDSGRVLKFDPRTGQTQVLARGIRLPNGLSLSKDQSFFVFTE  288

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             +   RL++YW++GPKSG  ++ A LP +PDNVR N+KG++WVAI      +   L +HP 
Sbjct  289   SVTGRLLRYWLKGPKSGEIDLFAMLPAYPDNVRINDKGEFWVAIHGRHNYLAFFLASHPR  348

Query  1114  TRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R    RLP+P  +QY+  + G +++ ++  +   GE+L+VLEDK G V++ VSEV E +
Sbjct  349   IRMFLLRLPIPARIQYIV-YLGGRLHAMVVKYSPEGELLEVLEDKTGKVVQSVSEVEERE  407

Query  1288  GKLWIGTVAHNHIA  1329
             G LW+G+V  N+IA
Sbjct  408   GTLWLGSVLSNYIA  421



>gb|AGU43759.1| strictosidine synthase, partial [Pinus massoniana]
Length=390

 Score =   337 bits (863),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 245/374 (66%), Gaps = 7/374 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  SP+    +F+    +  P+ E   ++  D+ +RL   +L+ +DEV  PESL FD 
Sbjct  19    DPFHHSPIADFPEFKAHYIECPPWAE-FSKFPTDSNNRLQKADLKSLDEVSAPESLAFDP  77

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
               RGPY G ADGRI+RW G   GW  FA  +PN SE IC     S      K E  CGRP
Sbjct  78    ENRGPYTGTADGRILRWDGPKLGWSQFAYTSPNRSE-ICDKAHKSPL-GYVKHEHICGRP  135

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF+K TGDLYIADAY+GLLVVGP GG+AT L+T  EG P  F NDLDI  +G+++FT
Sbjct  136   LGLRFNKITGDLYIADAYFGLLVVGPQGGLATQLSTEAEGVPFKFTNDLDIDMDGNVYFT  195

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S  Y R N   ++   E +GR+L++DP T +T V++  + FPNG+  ++DHSF +FTE
Sbjct  196   DSSTIYQRKNFIQLVFSAEDSGRVLKFDPRTRQTQVLVRGIRFPNGLSLNKDHSFFVFTE  255

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             +   RL +YW++GP +G+ ++ A +P +PDN+R N+KG++WVA+      +   L +HP 
Sbjct  256   SVTGRLFRYWLKGPNTGKVDIFAMMPAYPDNIRINDKGEFWVALHGRHNYLAFFLASHPR  315

Query  1114  TRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R+   R+P+P  +QY+  + G ++++++  +   G++L+VLEDK G V+K VSEV E +
Sbjct  316   VRTFLLRIPIPARIQYII-YLGGRLHSMVVKYSPEGKLLEVLEDKTGKVVKSVSEVEERE  374

Query  1288  GKLWIGTVAHNHIA  1329
             G+LW+G+V  N+IA
Sbjct  375   GRLWMGSVLSNYIA  388



>ref|XP_004981761.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Setaria italica]
Length=398

 Score =   336 bits (861),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 230/345 (67%), Gaps = 6/345 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  EV GPES+ FD  GRGPY G+ADGR+V W G+   W  FA  +
Sbjct  52    HADARERLRSAEVRFRGEVQGPESVAFDPRGRGPYTGVADGRVVFWDGER--WAHFATAS  109

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W++++CG G  ++  +    E  CGRPLGLRFDK+TGDLYIADAY+GLL VGP+GG+A
Sbjct  110   PRWTQELCG-GPRASPLEYLPNEHICGRPLGLRFDKRTGDLYIADAYFGLLKVGPEGGLA  168

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG  + F NDLD+   G+++FTD+S  Y R N   ++  G+ +GRLL+Y+P T
Sbjct  169   TPLATEAEGVRLNFTNDLDLDDEGNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQT  228

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  229   KETTVLHRNLQFPNGVSMSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  288

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR NEKG++WVAI C R+    ++  H   R     LP+P +  YL++  G +++ VI  
Sbjct  289   VRTNEKGEFWVAIHCRRSLYARLMSRHVKLRKFLLSLPIPAKYHYLSQIGG-RLHAVIIK  347

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
             +  +GEVLD+LED  G+V++ VSEV E DGKLWIG+V    IA  
Sbjct  348   YSPDGEVLDILEDTKGEVVRAVSEVEEKDGKLWIGSVLMPFIAVF  392



>ref|XP_002463871.1| hypothetical protein SORBIDRAFT_01g007960 [Sorghum bicolor]
 gb|EER90869.1| hypothetical protein SORBIDRAFT_01g007960 [Sorghum bicolor]
Length=398

 Score =   335 bits (859),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/345 (49%), Positives = 229/345 (66%), Gaps = 6/345 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  EV GPES+ FD  GRGPY G+ADGR+V W G+   W  FA  +
Sbjct  52    HADERERLRGAEVRFRGEVQGPESVAFDPQGRGPYTGVADGRVVFWDGER--WVPFATAS  109

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W++++CG G  ++  +    E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+A
Sbjct  110   PRWTQELCG-GPKASPLEYLPNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLA  168

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG  + F NDLD+   G+++FTD+S  Y R N   ++  G+ +GRLL+Y+P T
Sbjct  169   TPLATEAEGVRLNFTNDLDLDDEGNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQT  228

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  229   KETTVLHRNLQFPNGVSMSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  288

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR NEKG++WVAI C R+    ++  +   R  +  LP+P +  YL +  G K++ VI  
Sbjct  289   VRTNEKGEFWVAIHCRRSLYARLMSRYVKMRKFFLSLPIPAKYHYLMQIGG-KLHAVIIK  347

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
             +   G+VLD+LED  G+V++ VSEV E DGKLWIG+V    IA  
Sbjct  348   YSPEGQVLDILEDTKGEVVRAVSEVEEKDGKLWIGSVLMPFIAVF  392



>ref|XP_008677622.1| PREDICTED: strictosidine synthase isoform X1 [Zea mays]
 gb|ACG42017.1| strictosidine synthase precursor [Zea mays]
 gb|ACR34130.1| unknown [Zea mays]
 tpg|DAA51393.1| TPA: strictosidine synthase [Zea mays]
Length=398

 Score =   333 bits (854),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 228/345 (66%), Gaps = 6/345 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  +V GPES+ FD  GRGPY G+ADGR+V W G+   W  FA  +
Sbjct  52    HADERERLRGAEVRFRGDVQGPESVAFDPQGRGPYTGVADGRVVFWDGER--WVPFATAS  109

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W++++CG G  ++  +    E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+A
Sbjct  110   PRWTQELCG-GPKASPVEYLPNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLA  168

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG  + F NDLD+   G+++FTD+S  Y R N   ++  G+ +GRLL+Y+P T
Sbjct  169   TPLATEAEGVRLNFTNDLDLDDEGNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQT  228

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  229   KETTVLHRNLQFPNGVSMSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  288

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR NEKG++WVAI C R+    ++  H   R     LP+P +  YL +  G +++ VI  
Sbjct  289   VRTNEKGEFWVAIHCRRSLYARLMSRHVKLRKFLLSLPIPAKYHYLMQIGG-RLHAVIIK  347

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
             +   G+VLD+LED  G+V++ VSEV E DGKLWIG+V    IA  
Sbjct  348   YSPEGQVLDILEDTKGEVVRAVSEVEEKDGKLWIGSVLMPFIAVF  392



>ref|XP_009394278.1| PREDICTED: strictosidine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   332 bits (850),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 169/341 (50%), Positives = 228/341 (67%), Gaps = 6/341 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D + RL    + F+++V GPES+ FD  GRGPY G+ADGR++ W G++  W  FA  +PN
Sbjct  53    DPEDRLRGAEVRFLNQVQGPESIAFDPRGRGPYTGVADGRVLFWNGES--WVDFAYTSPN  110

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              SE IC L  + +     K E  CGRPLGLRFDK+TGDLYIADAY+GLL VGP GG+A P
Sbjct  111   RSE-ICNL--NPSLFSYLKNEHICGRPLGLRFDKRTGDLYIADAYFGLLKVGPQGGLAAP  167

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             L T  EG P  F NDLDI + G+++FTD+S  Y R N   ++  GE +GRLL+Y+P T +
Sbjct  168   LTTEAEGVPFNFTNDLDIDEEGNVYFTDSSTNYQRRNFMQLIFSGEPSGRLLKYNPVTKE  227

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
             T V+   L FPNGV  S+D SFLLF E +  RL ++W++G K+G  +V A LPGFPDNVR
Sbjct  228   TIVLHRGLQFPNGVTLSKDGSFLLFCEGSRLRLNRHWLKGEKAGTLDVFAYLPGFPDNVR  287

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQY-LARFAGMKMYTVISLFDQ  1209
              NEKG++WVAI C  +    ++ +H   R  + +LP+P++Y      G +++ +I  +  
Sbjct  288   TNEKGEFWVAIHCRHSTYAHLMADHSKLRKFFLKLPIPVKYHYFMLVGGRLHALIIKYGP  347

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             NG++L+ LEDK G V+K VSEV E DGKLWIG+V  + IA 
Sbjct  348   NGDLLETLEDKEGKVVKAVSEVEEKDGKLWIGSVLMSFIAV  388



>ref|XP_010932965.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=391

 Score =   331 bits (849),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 231/342 (68%), Gaps = 8/342 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D + RL    + F+ ++ GPES+ FD LGRGPY G+ADGR++ W G +  W  FA  +P 
Sbjct  55    DPEDRLQRAEVRFLGQIQGPESVAFDPLGRGPYTGVADGRVLFWNGHS--WSDFAYTSPI  112

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              SE +C     + +    + E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+ATP
Sbjct  113   RSE-LCDPKPSALS--YLRNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATP  169

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             L+T  EG P+ F NDLDI + G+I+FTD+S  Y R N   ++  GE +GRLL+Y+P T +
Sbjct  170   LSTEAEGVPLNFTNDLDIDEEGNIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTKE  229

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
             T V+L +L FPNGV  S+D SF +F E +  RL +YW++G K+G +E+ A LPGFPDNVR
Sbjct  230   TIVLLRNLQFPNGVSLSKDGSFFVFCEGSRGRLTRYWLKGEKAGTSEIFAILPGFPDNVR  289

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPM--QYLARFAGMKMYTVISLFD  1206
              NEKG++WVAI C RT    ++  +   R    +LP+P   QYL +  G +++ +I  + 
Sbjct  290   TNEKGEFWVAIHCRRTVYAHLMSQYTRLRKFLLKLPIPAKYQYLMQIGG-RLHALIIKYS  348

Query  1207  QNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +GE+L++LED+ G V++ VSEV E DGKLWIG+V    IA 
Sbjct  349   PDGELLEILEDRKGKVVRAVSEVEEKDGKLWIGSVLMPFIAV  390



>ref|XP_010031590.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Eucalyptus grandis]
 gb|KCW50952.1| hypothetical protein EUGRSUZ_J00590 [Eucalyptus grandis]
Length=393

 Score =   331 bits (848),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 244/377 (65%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVM-ERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S + G   F   + D+ P+ EV  ER   D+++ L    + F++++ GPES+ FD
Sbjct  23    DPFQHSALSGFPDFEAYRVDMPPWSEVPPER---DSRNLLRRSEVRFLNQIQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
              LGRGPY G+ADGR++ W  D   W  FA  +PN SE +C      ++P+ + K E  CG
Sbjct  80    PLGRGPYTGVADGRVLFW--DGQAWSDFAYTSPNRSE-LCD---PKSSPRSYLKNEHICG  133

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L T  EG P+ F NDLDI + G+++
Sbjct  134   RPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLTTEAEGIPLRFTNDLDIDEEGNVY  193

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S  Y R N   ++   E++GRLL+Y+P T +T V+  +L FPNGV  S+D SF +F
Sbjct  194   FTDSSSVYQRRNFLHLVFSAESSGRLLKYNPVTKETTVLERNLQFPNGVSLSKDRSFFVF  253

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E    RL KYW++G K+G +EV A LPGFPDNVR N+ G++WVA+ C RT    +  ++
Sbjct  254   CEGAIGRLRKYWLKGEKAGNSEVFAVLPGFPDNVRTNKDGEFWVAVHCRRTLYTYLCAHY  313

Query  1108  PWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R    +LP+   +QY+    G  ++ V+  + Q G+V+ +LED  G V+K VSE  E
Sbjct  314   PKIRKYILKLPISAEIQYVLHIGG-GLHGVVIKYSQEGKVMRILEDSQGKVVKAVSEAEE  372

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLW+G+V    IA 
Sbjct  373   KDGKLWMGSVLMPFIAV  389



>ref|XP_002966382.1| hypothetical protein SELMODRAFT_230896 [Selaginella moellendorffii]
 gb|EFJ32409.1| hypothetical protein SELMODRAFT_230896 [Selaginella moellendorffii]
Length=378

 Score =   330 bits (846),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 225/343 (66%), Gaps = 8/343 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D  +RL    L F +E  GPES+ FD+ GRGPY G++DGR++ W G   GW  FA  + N
Sbjct  33    DPSNRLLGAMLRFENEFLGPESIAFDSKGRGPYTGVSDGRVLLWQGSEVGWREFATTSAN  92

Query  493   WSEKICGLGVDSTTPK--QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
              + +      D   P    +K E  CGRPLGLRF+K +  LYIADAY GL+VVG +GG A
Sbjct  93    RTRE-----CDPRNPPIVYFKQEHICGRPLGLRFNKSSSKLYIADAYMGLMVVGSEGGQA  147

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
               LA  V G+ I FAND+D    G ++FTDTS +Y R  + + +LEG+ TGRLLRYDP +
Sbjct  148   QVLANEVNGQKIKFANDVDFDDKGFVYFTDTSTRYQRRQYLVSVLEGDNTGRLLRYDPQS  207

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              KT VVLD L FPNG+  + D SF+L  E+   RL++YW++GPK+G T+V   LPG PDN
Sbjct  208   KKTIVVLDKLRFPNGIAVNNDSSFILIAESITARLLRYWLKGPKAGTTDVFTTLPGNPDN  267

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFD  1206
             VR NE+G++WVA+    +R+ E L +HP  +++  R+P+P++Y   +   + Y +++ + 
Sbjct  268   VRLNERGEFWVAMYSRSSRM-EFLASHPRLKTLLLRIPIPLEYTFYYLMGRSYGMVARYS  326

Query  1207  QNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
               GE+L++LED+ G V+K VSEV E DGKLW+G+V   HIA L
Sbjct  327   AQGELLEILEDREGKVVKHVSEVEERDGKLWLGSVILPHIAVL  369



>ref|XP_003596929.1| Adipocyte plasma membrane-associated protein [Medicago truncatula]
Length=393

 Score =   330 bits (847),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 236/375 (63%), Gaps = 9/375 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ SP+ G   F   K ++  + EV      DN   L    L FV++V GPES+ FD+
Sbjct  21    DPFKQSPIQGFPDFEVHKINLPSWSEVPLDHDKDN--LLLKSELMFVNQVQGPESIAFDS  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
              GRGPY G+ADGRI+ W G    W  FA  +PN SE +C L   +T     + E  CGRP
Sbjct  79    HGRGPYTGVADGRILFWNG--LSWIDFAYTSPNRSE-LCNLKASATPLSYVETEDICGRP  135

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDKKTGDLYIADAY+GL+ VGP GG AT LAT  EG P  F ND+DI   G+++FT
Sbjct  136   LGLRFDKKTGDLYIADAYFGLMKVGPQGGFATSLATEAEGVPFRFTNDVDIDTEGNVYFT  195

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S KY R N   ++L G+ +GR+L+Y+  T +T V++ ++ FPNG+  S+D SF +F+E
Sbjct  196   DSSTKYQRRNFIQLILSGDNSGRVLKYNSATKETTVLVRNIQFPNGISLSKDGSFFVFSE  255

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
                 RL KYW++G K+G  E++A LPGF DNVR NE G +WVAI C R     +   +P 
Sbjct  256   GVIGRLCKYWLKGDKAGTLEILAILPGFADNVRVNENGDFWVAIHCRRYMYSYINALYPK  315

Query  1114  TRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R    +LP+P  +QYL    G KM+  +  +  +G++L +LED  G V+K VSEV E D
Sbjct  316   IRKAILKLPIPTRIQYLLHIGG-KMHAAVVKYSPDGKLLQILEDNEGKVVKAVSEVEEKD  374

Query  1288  GKLWIGTVAHNHIAT  1332
             GKLWIG+V    IA 
Sbjct  375   GKLWIGSVLMPFIAV  389



>ref|NP_001150008.1| strictosidine synthase precursor [Zea mays]
 gb|ACG37487.1| strictosidine synthase precursor [Zea mays]
Length=398

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 227/345 (66%), Gaps = 6/345 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  +V GPES+ FD  GRGPY G+ADGR+V W G+   W  FA  +
Sbjct  52    HADERERLRGAEVRFRGDVQGPESVAFDPQGRGPYTGVADGRVVFWDGER--WVPFATAS  109

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W++++CG G  ++  +    E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+A
Sbjct  110   PRWTQELCG-GPKASPVEYLPNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLA  168

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG  + F NDLD+   G+++FTD+S  Y R N   ++  G+ +GRLL+Y+P T
Sbjct  169   TPLATEAEGVRLNFTNDLDLDDEGNVYFTDSSIHYQRRNFMQLVFSGDPSGRLLKYNPQT  228

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  229   KETTVLHRNLQFPNGVSMSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  288

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR NEKG++WVAI C R     ++  H   R     LP+P +  YL +  G +++ +I  
Sbjct  289   VRTNEKGEFWVAIHCRRGLYARLMSRHVKLRKFLLSLPIPAKYHYLMQIGG-RLHALIIK  347

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
             +   G+VLD+LED  G+V++ VSEV E DGKLWIG+V    IA  
Sbjct  348   YSPEGQVLDILEDTKGEVVRAVSEVEEKDGKLWIGSVLMPFIAVF  392



>gb|AES67180.2| strictosidine synthase family protein [Medicago truncatula]
Length=396

 Score =   330 bits (846),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/375 (47%), Positives = 236/375 (63%), Gaps = 9/375 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ SP+ G   F   K ++  + EV      DN   L    L FV++V GPES+ FD+
Sbjct  24    DPFKQSPIQGFPDFEVHKINLPSWSEVPLDHDKDN--LLLKSELMFVNQVQGPESIAFDS  81

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
              GRGPY G+ADGRI+ W G    W  FA  +PN SE +C L   +T     + E  CGRP
Sbjct  82    HGRGPYTGVADGRILFWNG--LSWIDFAYTSPNRSE-LCNLKASATPLSYVETEDICGRP  138

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDKKTGDLYIADAY+GL+ VGP GG AT LAT  EG P  F ND+DI   G+++FT
Sbjct  139   LGLRFDKKTGDLYIADAYFGLMKVGPQGGFATSLATEAEGVPFRFTNDVDIDTEGNVYFT  198

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S KY R N   ++L G+ +GR+L+Y+  T +T V++ ++ FPNG+  S+D SF +F+E
Sbjct  199   DSSTKYQRRNFIQLILSGDNSGRVLKYNSATKETTVLVRNIQFPNGISLSKDGSFFVFSE  258

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
                 RL KYW++G K+G  E++A LPGF DNVR NE G +WVAI C R     +   +P 
Sbjct  259   GVIGRLCKYWLKGDKAGTLEILAILPGFADNVRVNENGDFWVAIHCRRYMYSYINALYPK  318

Query  1114  TRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R    +LP+P  +QYL    G KM+  +  +  +G++L +LED  G V+K VSEV E D
Sbjct  319   IRKAILKLPIPTRIQYLLHIGG-KMHAAVVKYSPDGKLLQILEDNEGKVVKAVSEVEEKD  377

Query  1288  GKLWIGTVAHNHIAT  1332
             GKLWIG+V    IA 
Sbjct  378   GKLWIGSVLMPFIAV  392



>ref|XP_010031589.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Eucalyptus grandis]
 gb|KCW50951.1| hypothetical protein EUGRSUZ_J00588 [Eucalyptus grandis]
Length=393

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 242/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVM-ERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S + G   F   + D+ P+ E+  ER   D+++ L    + F++++ GPES+ FD
Sbjct  23    DPFQHSALSGFPDFEAYRADVPPWSEIPPER---DSRNLLQRSEVRFLNQIQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGR++ W  D   W  FA  +PN SE +C     S +    K E  CGR
Sbjct  80    PLGRGPYTGVADGRVLFW--DGQAWSDFAYTSPNRSE-LCNPKPSSLS--YLKNEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L T  EG P+ F NDLDI   G+++F
Sbjct  135   PLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLTTEAEGIPLRFTNDLDIDDEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++   E++GRLL+Y+P T +T V+  +L FPNGV  S+D SF +F 
Sbjct  195   TDSSSVYQRRNFLHLVFSAESSGRLLKYNPVTKETTVLERNLQFPNGVSLSKDRSFFVFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G +EV A LPGFPDNVR N+ G++WVA+   RT    +  ++P
Sbjct  255   EGAIGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNKDGEFWVAVHSRRTPYTYLCAHYP  314

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P  +Q+L    G +++ V+  + Q G+V+ +LED  G V++ VSE  E 
Sbjct  315   KIRKFTLKLPIPAKIQFLLHIGG-RLHGVVVKYSQEGKVVRILEDSQGKVVRAVSEAEEK  373

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V  + IA 
Sbjct  374   DGKLWMGSVLMSFIAV  389



>gb|ABR18211.1| unknown [Picea sitchensis]
Length=393

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/374 (44%), Positives = 241/374 (64%), Gaps = 8/374 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF LSP+     F+    D  P+ ++      D+++RL    ++F+++V GPES+ FD 
Sbjct  25    DPFHLSPIARFPNFKSYAVDSPPWSQL--PLPKDDQNRLQKSEIKFLNQVQGPESIAFDP  82

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
              GRGPY G+ADGRI+ W G    W  F+  +PN SE++C  G +       K+E  CGRP
Sbjct  83    QGRGPYTGVADGRIMFWNGGQ--WSEFSFTSPNRSEELCKPGTNPMA--NIKYEHICGRP  138

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF+K TGDLYIADAY+GLLVVGP GG AT L + VEG P+ F NDLDI + G ++FT
Sbjct  139   LGLRFNKGTGDLYIADAYFGLLVVGPQGGQATRLVSEVEGIPLKFTNDLDIDEQGIVYFT  198

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S  Y R N   +    E +GR+L+Y+P T +  +++ ++  PNG+  S+D SF +F++
Sbjct  199   DSSVVYQRRNFIQLAFSAEPSGRVLKYNPQTKEASLLVGNIQLPNGLSLSKDGSFFVFSD  258

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             T   RL ++W++GPK+G T+V A LPG PDNVR NEKG++WVA+ C       +L  +P 
Sbjct  259   TCVGRLKRHWLKGPKTGTTDVFAILPGHPDNVRTNEKGEFWVALHCRHNLYSHLLGMYPG  318

Query  1114  TRSVYFRLPLPMQY-LARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDG  1290
              R    +LP+P +Y  + F G +++  +  +  +GE++++LED+ G V++ VSEV E DG
Sbjct  319   VRKAILKLPIPAKYQYSAFVGGRLHGSVVKYSPDGELIEILEDREGKVVRAVSEVEEKDG  378

Query  1291  KLWIGTVAHNHIAT  1332
             KLW+G+V    +A 
Sbjct  379   KLWMGSVLMPFVAV  392



>ref|XP_011088992.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11 [Sesamum indicum]
Length=391

 Score =   329 bits (844),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 247/377 (66%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F  VK ++ P+  + +E+   D ++ L    ++F+++V GPES+ FD
Sbjct  21    DPFNHSAMSEFPDFEAVKVEVPPWSAIPVEK---DPENLLQKSEIKFLNQVQGPESMAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGRI+ W G+   W  FA  + N S    GL     +P  + K E  CG
Sbjct  78    PAGRGPYTGVADGRIIFWNGEK--WTDFAYTSANRS----GLCDPQPSPMSYLKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TG+LYIADAY+GL+ VGP+GG+AT L T  EG P+ F NDLDI   G+++
Sbjct  132   RPLGLRFDKRTGELYIADAYFGLMKVGPEGGLATSLTTEAEGVPLGFTNDLDIDNEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N   ++  GE +GR+L+Y+P T +T V+  +L FPNG+  S+D SF +F
Sbjct  192   FTDSSTKYKRRNFLQLIFSGEDSGRVLKYNPNTKETTVLFRNLQFPNGLSLSKDGSFFVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E +  RL KYW++G K+G +E++A LPGFPDNVR NEKG++WVAI C RT    +L  +
Sbjct  252   CEGSIGRLRKYWLKGEKAGTSEIMAVLPGFPDNVRTNEKGEFWVAIHCRRTVYAYILALY  311

Query  1108  PWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R ++ +LP+P  + YL +  G +++ V+  +   G++L +LED+ G V+K VSEV E
Sbjct  312   PKVRKLWLKLPIPAKIHYLMQIGG-RVHAVVLKYSPEGKLLQILEDRQGKVVKAVSEVEE  370

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLW+G+V    +A 
Sbjct  371   KDGKLWMGSVLMPFVAV  387



>ref|XP_002991340.1| hypothetical protein SELMODRAFT_448383 [Selaginella moellendorffii]
 gb|EFJ07638.1| hypothetical protein SELMODRAFT_448383 [Selaginella moellendorffii]
Length=386

 Score =   329 bits (843),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 223/339 (66%), Gaps = 16/339 (5%)
 Frame = +1

Query  235   PVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYG  414
             P+GG K+ PVK+ IAP K ++ +W   N S L   ++EF D +FGPES+EF+  G GPY 
Sbjct  39    PLGGLKYYPVKHQIAPLKSILPKWPSRNDSLLQFASIEFQDRLFGPESIEFNPQGNGPYT  98

Query  415   GLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFD  591
             GL DGRIVRWM D  GWETFAL + NW+ + C    +   P++  + E   GRPLG RFD
Sbjct  99    GLGDGRIVRWMPDR-GWETFALSSINWNREECD---NRDNPRRRVRNEHVSGRPLGFRFD  154

Query  592   KKTGDLYIADAYYGLLVVGPDGGIATPL------ATHVEGKPILFANDLDIHKNGSIFFT  753
              + GDLYIAD+YYGLLVVGP GGIA PL      +  V  +    +      +  +    
Sbjct  155   PRPGDLYIADSYYGLLVVGPKGGIARPLVRGGRDSYQVCQRSRCSSQSTLPTQARAGIAV  214

Query  754   DTSQKYNR-----VNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSF  918
             D     +R     + H ++++EGE TGRLL+YDP TG   VVL  LAF NGVQ + D SF
Sbjct  215   DLPCSLSRSFLPEMLHHMVIVEGENTGRLLQYDPNTGNAVVVLRGLAFANGVQLASDQSF  274

Query  919   LLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVL  1098
             LL  ETTNCR++K W++G  +G  EV A+LPG+PDNVR N+KGQ+WVAIDCCR RIQE++
Sbjct  275   LLVVETTNCRVLKLWLKGNLTGTLEVFADLPGYPDNVRINDKGQFWVAIDCCRNRIQEIM  334

Query  1099  INHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNG  1215
              + PW +S+ FR+P+P+ ++    G KMY+V++LFD+ G
Sbjct  335   TSTPWLKSLVFRVPVPLSWIMYVVGEKMYSVVALFDKRG  373



>ref|XP_002978184.1| hypothetical protein SELMODRAFT_108020 [Selaginella moellendorffii]
 gb|EFJ20841.1| hypothetical protein SELMODRAFT_108020 [Selaginella moellendorffii]
Length=404

 Score =   328 bits (842),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 162/343 (47%), Positives = 224/343 (65%), Gaps = 8/343 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D  +RL    L F +E  GPES+ FD+ GRGPY G++DGR++ W G   GW  FA  + N
Sbjct  59    DPSNRLLGAMLRFENEFLGPESIAFDSKGRGPYTGVSDGRVLLWQGSEVGWREFATTSAN  118

Query  493   WSEKICGLGVDSTTPK--QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
                    +  D   P    +K E  CGRPLGLRF+K +  LYIADAY GL+VVG +GG A
Sbjct  119   RY-----VECDPRNPPIVYFKQEHICGRPLGLRFNKSSSKLYIADAYMGLMVVGSEGGQA  173

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
               LA  V G+ I FAND+D    G ++FTDTS +Y R  + + +LEG+ TGRLLRYDP +
Sbjct  174   QVLANEVNGQKIKFANDVDFDDKGFVYFTDTSTRYQRRQYLVSVLEGDNTGRLLRYDPQS  233

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              KT VVLD L FPNG+  + D SF+L  E+   RL++YW++GPK+G T+V   LPG PDN
Sbjct  234   KKTIVVLDKLRFPNGIAVNNDSSFILIAESITARLLRYWLKGPKAGTTDVFTTLPGNPDN  293

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFD  1206
             VR NE+G++WVA+    +R+ E L +HP  +++  R+P+P++Y   +   + Y +++ + 
Sbjct  294   VRLNERGEFWVAMYSRSSRM-EFLASHPRLKTLLLRIPIPLEYTFYYLMGRSYGMVARYS  352

Query  1207  QNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATL  1335
               GE+L++LED+ G V+K VSEV E DGKLW+G+V   HIA L
Sbjct  353   AQGELLEILEDREGKVVKHVSEVEERDGKLWLGSVILPHIAVL  395



>ref|XP_009412315.1| PREDICTED: strictosidine synthase 3-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   328 bits (840),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 178/376 (47%), Positives = 241/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  SP+     F     ++  + E+      D + RL    ++F+++V GPES+ FD 
Sbjct  22    DPFGHSPMAAFPGFEAYPIEVPSWSELPT--ARDAEDRLQRAEIKFLNQVQGPESVAFDP  79

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
              GRGPY G+ADGR+V W G++  W  FA  +PN SE IC       +P  + K E  CGR
Sbjct  80    QGRGPYTGVADGRVVFWDGES--WSDFAYTSPNRSE-ICN---PKPSPLSYLKNEHICGR  133

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTG+LYIADAY+GLL VGP+GG+ATP+ T  EG P+ F NDLDI ++GSI+F
Sbjct  134   PLGLRFDKKTGELYIADAYFGLLKVGPEGGLATPVTTEAEGIPLKFTNDLDIDEDGSIYF  193

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE +GRLL+Y+P   +T V+L  L FPNGV  S+D SF LF 
Sbjct  194   TDSSTNYQRRNFMQLVFTGEPSGRLLKYNPVMKETTVLLRGLQFPNGVTLSKDGSFFLFC  253

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL +YW++G K+G ++V A LPGFPDNVR NEKG++WVAI C  +    +   + 
Sbjct  254   EGSRGRLSRYWLKGEKAGTSDVFAVLPGFPDNVRTNEKGEFWVAIHCRLSMYTHLTSRYF  313

Query  1111  WTRSVYFRLPLPMQY--LARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P +Y  L +  G + + VI  +  +GE+L++LED  G V++ VSEV E 
Sbjct  314   RLRKFLLKLPIPAKYHFLLQIGG-RPHAVIIKYSPDGELLEILEDSQGKVVRAVSEVEEK  372

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLWIG+V    IA 
Sbjct  373   DGKLWIGSVLMPFIAV  388



>ref|XP_010247897.1| PREDICTED: strictosidine synthase 3-like [Nelumbo nucifera]
Length=391

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 176/377 (47%), Positives = 244/377 (65%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F   K D+ P+ E+ +ER   D ++ L    ++F+++V GPES+ FD
Sbjct  21    DPFKHSAISSFPDFVAHKIDLPPWSEIPVER---DTQNLLQKAEIKFLNQVQGPESVAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
              LGRGPY G+ADGRI+ W G++  W +FA  +PN SE +C       +P  + K E  CG
Sbjct  78    PLGRGPYTGVADGRILFWNGNS--WTSFAYTSPNRSE-LCS---PKPSPLSYVKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTGDLYIADAY+GL+ VG +GG+ATPL T  EG P+ F NDLDI   G+++
Sbjct  132   RPLGLRFDKKTGDLYIADAYFGLMKVGAEGGLATPLVTQAEGVPLRFTNDLDIDDEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N   ++  GE  GRLL+Y+  TG+T V+L +L FPNGV  S+D SF +F
Sbjct  192   FTDSSIKYQRRNFMHLVFSGEDDGRLLKYNQVTGETTVLLRNLQFPNGVSMSKDGSFFVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
             +E +   L +YW++G K+  +E+ A L G PDNVR NE G++WVAI C R+    +   +
Sbjct  252   SECSVGTLTRYWLKGEKARSSEIFATLHGAPDNVRTNENGEFWVAIHCRRSMYAYITGLY  311

Query  1108  PWTRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             PW R    +LP+ ++  YL +  G K + V+  +   G++L +LED  G V+K VSEV E
Sbjct  312   PWLRKFMLKLPISVKSHYLLQIGG-KQHAVVVKYSAEGKILQILEDSEGKVVKAVSEVEE  370

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLWIG+V    +A 
Sbjct  371   KDGKLWIGSVLMPFMAV  387



>ref|XP_008776219.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Phoenix dactylifera]
Length=389

 Score =   327 bits (837),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 230/343 (67%), Gaps = 10/343 (3%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D + RL    + FV ++ GPES+ FD LGRGPY G+ADGR++ W G +  W  FA  +P 
Sbjct  53    DPEDRLQRAEIRFVGQIQGPESVAFDPLGRGPYTGVADGRVLFWNGHS--WSDFAYTSPI  110

Query  493   WSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIAT  669
              SE +C       +P  + K E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+AT
Sbjct  111   RSE-LCD---PKPSPLSYLKNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLAT  166

Query  670   PLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTG  849
             PL T  EG  + F NDLDI + G+I+FTD+S  Y R N   ++  GE +GRLL+Y+P T 
Sbjct  167   PLTTEAEGVQLNFTNDLDIDEEGNIYFTDSSTNYQRRNFMQLVFSGEPSGRLLKYNPVTN  226

Query  850   KTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNV  1029
             +T V+L +L FPNGV  S+D SF +F E +  RL +YW++G K+G +++ A LPGFPDNV
Sbjct  227   ETTVLLRNLQFPNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTSDIFAILPGFPDNV  286

Query  1030  RANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPM--QYLARFAGMKMYTVISLF  1203
             R NEKG++WVAI C RT    ++  +   R    +LP+P   QYL +  G +++ +I  +
Sbjct  287   RTNEKGEFWVAIHCRRTVYAHLMGRYTRLRKFLLKLPIPAKYQYLMQIGG-RLHALIIKY  345

Query  1204  DQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
               +G++L++LED+ G V++ VSEV E DGKLWIG+V    IA 
Sbjct  346   SPDGKLLEILEDRKGKVVRAVSEVEEKDGKLWIGSVLMPFIAV  388



>ref|XP_010263076.1| PREDICTED: adipocyte plasma membrane-associated protein [Nelumbo 
nucifera]
Length=391

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 248/377 (66%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F   K D+ P+ ++ +ER   D+++ L    ++F+++V GPES+ FD
Sbjct  21    DPFKHSAIYDFPDFVAHKIDLPPWSDIPVER---DSQNLLQKAEIKFLNQVQGPESVAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
             +LGRGPY G+ADGRI+ W G++  W  FA  +PN SE +C       +P  + K E  CG
Sbjct  78    SLGRGPYTGVADGRILFWNGES--WTDFAYTSPNRSE-LCS---PKPSPMSYLKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTG+LYIADAY+GL+ VGP+GG+A  L T VEG P+ F NDLDI   G+++
Sbjct  132   RPLGLRFDKKTGELYIADAYFGLMKVGPEGGLAKSLVTEVEGVPLRFTNDLDIDDEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N   ++  GE  GRLL+Y+P T +T V++ +L FPNGV  S+D SF +F
Sbjct  192   FTDSSIKYQRRNFIQLVFSGEDDGRLLKYNPLTKETSVLMRNLQFPNGVSMSKDKSFFVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
             ++ +  RL +YW++G K+G +++ A LPGFPDNVR NE+G++WVAI C R+    +   +
Sbjct  252   SDGSCGRLRRYWLKGEKAGTSDIFAILPGFPDNVRTNERGEFWVAIHCRRSMYAYISSLY  311

Query  1108  PWTRSVYFRLPL--PMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R    +LP+    QYL +  G + + V+  +   G++L +LED  G V++ VSEV E
Sbjct  312   PKLRKFLLKLPVLAKFQYLLQIGG-RQHAVVVKYSPEGKILQILEDSQGKVVRAVSEVEE  370

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLWIG+V    +A 
Sbjct  371   KDGKLWIGSVLMPFMAV  387



>emb|CDP21347.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   325 bits (833),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 172/362 (48%), Positives = 232/362 (64%), Gaps = 15/362 (4%)
 Frame = +1

Query  271   DIAPYKEVMERW-----HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   +K  M  W       D ++ L    ++F++++ GPES+ FD  GRGPY G+ADGRI
Sbjct  33    DFVAHKVEMPAWSEIPVEKDAQNLLQKSEIKFLNQIQGPESIAFDPQGRGPYTGIADGRI  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLY  612
             V W G+   W  FA  + N S    GL     +P  + K E  CGRPLGLRFDKKTGDLY
Sbjct  93    VFWDGEK--WIDFAYTSANRS----GLCDPKPSPFSYLKNEHICGRPLGLRFDKKTGDLY  146

Query  613   IADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFL  792
             IADAY+GL+ VGP+GG+AT L T  EG P+ F NDLDI   G+I+FTD+S KY R N  L
Sbjct  147   IADAYFGLMKVGPEGGLATSLTTEAEGVPLGFTNDLDIDDEGNIYFTDSSTKYQRRNFLL  206

Query  793   IMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEG  972
             ++  G+ +GRLL+Y+P T +T V++  L FPNGV  S+D SF +F E +  RL KYW++G
Sbjct  207   LVFSGDDSGRLLKYNPETKETTVLVRGLQFPNGVSMSKDRSFFVFCEGSIGRLRKYWLKG  266

Query  973   PKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--  1146
              K+G +EV+A LPGFPDN+R NEKG++WVA+ C RT    +   +P  R    +LP+P  
Sbjct  267   DKAGTSEVMAVLPGFPDNIRTNEKGEFWVAVHCRRTVYAYINALYPNVRKFLLKLPIPAK  326

Query  1147  MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             + YL +  G + + VI  +   G++L +LED+ G V+K  SEV E DGKLWIG+V    +
Sbjct  327   IHYLLQIGG-RPHAVIVKYSPEGKILQILEDRQGKVVKAASEVEEKDGKLWIGSVLMPFV  385

Query  1327  AT  1332
             A 
Sbjct  386   AV  387



>gb|EAZ28597.1| hypothetical protein OsJ_12584 [Oryza sativa Japonica Group]
Length=349

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 228/348 (66%), Gaps = 9/348 (3%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  EV GPES+ FD LGRGPY G+ADGR+VRW  D A W  FA  +
Sbjct  4     HADTRERLRGAEIRFRGEVQGPESVAFDPLGRGPYTGVADGRVVRW--DGARWVYFAHSS  61

Query  487   PNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             PNW+ ++CG      +P  + K E  CGR LGLRFD++TGDLYIADAY+GLL VGPDGG+
Sbjct  62    PNWTAELCG---HKASPLDYLKDEHICGRALGLRFDRRTGDLYIADAYFGLLKVGPDGGL  118

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPLAT  EG    F NDLD+  +G+++FTD+S  Y R +   ++  G+ +GRLL+YDP 
Sbjct  119   ATPLATEAEGVRFNFTNDLDLDDDGNVYFTDSSIHYQRRHFMQLVFSGDPSGRLLKYDPN  178

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
             T K  V+  ++ FPNGV  S+D  F +F E +  RL +YW++G K+G  ++ A LPGFPD
Sbjct  179   TKKATVLHRNIQFPNGVSMSKDGLFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPD  238

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVIS  1197
             NVR N+KG++WVAI C R+    ++  +   R     LP+P +  YL +  G K++ +I 
Sbjct  239   NVRTNDKGEFWVAIHCRRSIYARMVSRNVRLRKFLLSLPIPAKYHYLMQIGG-KLHALII  297

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
              ++  GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  298   KYNPEGEVLDILEDTTGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  345



>ref|XP_007132511.1| hypothetical protein PHAVU_011G100400g [Phaseolus vulgaris]
 gb|ESW04505.1| hypothetical protein PHAVU_011G100400g [Phaseolus vulgaris]
Length=394

 Score =   323 bits (827),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 241/377 (64%), Gaps = 12/377 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  SP+     F+  + D+ P+ E       D  + L    ++F +EV GPES+ FD 
Sbjct  21    DPFHHSPIAHLPDFQATRVDLPPWSEFPT--DQDKHNLLQKSEIKFANEVQGPESIAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY GLADGRIV W  ++  W  FA  +PN SE IC   + S TP  + K E  CGR
Sbjct  79    LGRGPYTGLADGRIVFW--NSHSWVDFAYTSPNRSE-ICN-PIASATPFSYVKTEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDL+IADAY+GLL VGP+GG+AT L T  EG P+ F ND+D+   G+++F
Sbjct  135   PLGLRFDKKTGDLFIADAYFGLLKVGPEGGLATSLVTEAEGIPLKFTNDVDVDGEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             T++S  Y R N F ++L G+ +G++LRY+  T +T V+L ++ FPNG+  S+D SF +F 
Sbjct  195   TESSSHYPRRNFFQLVLSGDDSGKVLRYNLATKETTVLLRNIQFPNGITLSKDGSFFVFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G +E++A LPG+PDNVR NE G +WVA+ C R +      N P
Sbjct  255   EGVVGRLRKYWLKGEKAGTSEILAVLPGYPDNVRVNEDGDFWVALHCRRYKYGYYSANAP  314

Query  1111  W-TRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
                R +  +LP+P++  YL    G +++ ++  +   G +L +LED  G V+K VSEV E
Sbjct  315   SGIRKIILKLPIPIKFHYLLHIGG-RLHALVIKYSPEGRILQILEDSEGKVVKAVSEVEE  373

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLW+G+V    +A 
Sbjct  374   KDGKLWMGSVLMPFVAV  390



>ref|XP_004487437.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=393

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 174/375 (46%), Positives = 234/375 (62%), Gaps = 9/375 (2%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ SP+ G   F   K ++  + EV      DN   L    L FV++V GPES+ FD 
Sbjct  21    DPFKHSPIQGFPDFEAHKINLPSWSEVPMDQDKDN--LLQKSELMFVNQVQGPESIAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LG GPY G+ADG+I+ W G    W  FA  +PN SE +C     ++     + E  CGRP
Sbjct  79    LGHGPYTGVADGKILFWNG--LSWIDFAYTSPNRSE-LCNSKESASPLSYAETEHICGRP  135

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDKKTGDLYIADAY+GL+ VGP GG+AT LAT  EG P+ F ND+DI   G+++FT
Sbjct  136   LGLRFDKKTGDLYIADAYFGLMKVGPQGGLATSLATEAEGVPLRFTNDVDIDAEGNVYFT  195

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S K+ R N   ++  GE +GR+LRY   T +T V++ ++ FPNG+  S+D SF +F+E
Sbjct  196   DSSNKFQRRNFVHLVFSGEDSGRVLRYSSATKETVVLVRNIQFPNGISLSKDGSFFVFSE  255

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
                 RL KYW++G K+G +E++A LPGFPDNVR NE G +WV I C R     +   +P 
Sbjct  256   GITGRLRKYWLKGDKAGTSEILAILPGFPDNVRVNENGDFWVGIHCRRYMYGYLNALYPK  315

Query  1114  TRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R    +LP+P  + YL +  G + + VI  +   G++L +LED  G V+K VSEV E D
Sbjct  316   IRKFILKLPIPTRIHYLLQIGG-RFHAVIVKYSPEGKLLQILEDSEGKVVKAVSEVEEKD  374

Query  1288  GKLWIGTVAHNHIAT  1332
             GKLWIG+V    IA 
Sbjct  375   GKLWIGSVLMPFIAV  389



>gb|EPS65875.1| hypothetical protein M569_08902 [Genlisea aurea]
Length=391

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 166/375 (44%), Positives = 241/375 (64%), Gaps = 10/375 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  SP+     F   K ++  + E       D+++ L    ++F++++ GPESL FD 
Sbjct  21    DPFGHSPMSSFPGFDVFKVEMPAWSET--PIENDSENLLQKSEIKFLNQLQGPESLAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
              GRGPY G+ADGRI+ W G    W  FA  +PN S+ +C      +     K E  CGRP
Sbjct  79    SGRGPYTGVADGRILFWNG--VDWTDFAYTSPNRSDGLCD--PKPSILDYLKNEHICGRP  134

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFD+K GDLYIADAY+GL+ VG +GG+AT LAT  EG P+ F NDLD+   G+++FT
Sbjct  135   LGLRFDRKNGDLYIADAYFGLMKVGREGGLATSLATEAEGIPLGFTNDLDVDDEGNVYFT  194

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S +Y R N   ++   E +GRLL+YDP T +T V++ +L FPNGV  S+D SF+++ E
Sbjct  195   DSSTRYRRRNFLQLVFTAENSGRLLKYDPKTRETSVLVRNLQFPNGVSLSKDGSFIVYCE  254

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
             ++  RL KYW++G K G +EV+A LPGFPDNVR NE+G++WVA+ C RTR    +  H  
Sbjct  255   SSKGRLSKYWLKGKKGGTSEVMAVLPGFPDNVRTNEEGEFWVAVHCRRTRYAHFMGEHTK  314

Query  1114  TRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R  + +LP+P++  YL +  G + + V+  +   G+++ +LED+HG V++ VSEV E  
Sbjct  315   VRRFFLKLPIPLRIHYLLQIGG-RPHAVVVKYSPEGKLVKILEDQHGKVVRAVSEVEEKG  373

Query  1288  GKLWIGTVAHNHIAT  1332
             GKLW+G+V    ++ 
Sbjct  374   GKLWMGSVLMQFVSV  388



>ref|XP_009148103.1| PREDICTED: strictosidine synthase 3 [Brassica rapa]
Length=393

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/380 (46%), Positives = 241/380 (63%), Gaps = 13/380 (3%)
 Frame = +1

Query  217   DPFELSPVGGQ-KFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F+  K D+ P   +  ER   D+++ L    + FV+EV GPES+ FD
Sbjct  23    DPFKHSSISKYPDFQTHKIDMPPLSSLPKER---DHENLLQNSEIRFVNEVQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W  D   W  FA  + N SE +C     S+     K E  CGR
Sbjct  80    PLGRGPYTGVADGRILFW--DGTRWTDFAYTSNNRSE-LCD--TKSSLLAYLKNEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF K+TGDLYIADAY+G++ VGP+GG+AT L T  +G P+ F NDLD+ + G+++F
Sbjct  135   PLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R N   +++ GE TGR+L+Y+P T +T  +L +L FPNG+    D SF +F 
Sbjct  195   TDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRDGSFFIFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G KSG +EV+A L GFPDN+R N+ G +WVA+ C R     V+ +HP
Sbjct  255   EGSIGRLRKYWLKGEKSGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVMAHHP  314

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V   + ++G+VL VLEDK G V+K VSE+ E 
Sbjct  315   NVRKFFLKLPITVKFQYLLQVGGWP-HAVAVKYSEDGKVLKVLEDKQGKVVKAVSEIEEK  373

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  374   DGKLWMGSVLMSFIAVYDLP  393



>ref|XP_004506244.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cicer arietinum]
Length=403

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 242/376 (64%), Gaps = 12/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPFE SP+     F   K DI P+ EV      D ++ L    ++F+++V GPES+ FD 
Sbjct  33    DPFEHSPIAKFPDFEAKKVDIPPWSEVPN--DTDKQNLLQNSEIKFLNQVQGPESIVFDP  90

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY GLADGRI+ W G +  W  FA  +PN S  +C   +++ TP  + K E  CGR
Sbjct  91    LGRGPYTGLADGRILFWNGQS--WFDFAYTSPNRS--LC-TPIEAATPFSYVKTEHICGR  145

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTG+LYIADAY GL+ VGP+GG+AT LAT  EG P+ F ND+D+   G+++F
Sbjct  146   PLGLRFDKKTGELYIADAYLGLMKVGPEGGLATSLATEAEGVPLRFTNDVDVDTEGNVYF  205

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             T++S  Y R N   ++  G+ +G++L+Y+P T +T V++ ++ FPNG+  S+D SF +F 
Sbjct  206   TESSTIYQRRNFIQLVFSGDDSGKVLKYNPTTKETTVLVRNVQFPNGISLSKDGSFFVFC  265

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G +E++A LPG+PDNVR NE G +WVA+ C R     +   +P
Sbjct  266   EGAIGRLRKYWLKGEKAGTSEILAILPGYPDNVRVNENGDFWVALHCRRYMYAYLNGLYP  325

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P  +QYL +  G K   VI  +   G++L +LED  G V++ VSEV E 
Sbjct  326   RIRKAILKLPIPTKIQYLFQIGG-KQRGVIVKYSPEGKLLQILEDSEGKVVRAVSEVEEK  384

Query  1285  DGKLWIGTVAHNHIAT  1332
             DG+LWIG+V    IA 
Sbjct  385   DGQLWIGSVLMPFIAV  400



>ref|NP_001051286.2| Os03g0750700 [Oryza sativa Japonica Group]
 dbj|BAF13200.2| Os03g0750700 [Oryza sativa Japonica Group]
Length=399

 Score =   322 bits (825),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 228/348 (66%), Gaps = 9/348 (3%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  EV GPES+ FD LGRGPY G+ADGR+VRW  D A W  FA  +
Sbjct  54    HADTRERLRGAEIRFRGEVQGPESVAFDPLGRGPYTGVADGRVVRW--DGARWVYFAHSS  111

Query  487   PNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             PNW+ ++CG      +P  + K E  CGR LGLRFD++TGDLYIADAY+GLL VGPDGG+
Sbjct  112   PNWTAELCG---HKASPLDYLKDEHICGRALGLRFDRRTGDLYIADAYFGLLKVGPDGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPLAT  EG    F NDLD+  +G+++FTD+S  Y R +   ++  G+ +GRLL+YDP 
Sbjct  169   ATPLATEAEGVRFNFTNDLDLDDDGNVYFTDSSIHYQRRHFMQLVFSGDPSGRLLKYDPN  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
             T K  V+  ++ FPNGV  S+D  F +F E +  RL +YW++G K+G  ++ A LPGFPD
Sbjct  229   TKKATVLHRNIQFPNGVSMSKDGLFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVIS  1197
             NVR N+KG++WVAI C R+    ++  +   R     LP+P +  YL +  G K++ +I 
Sbjct  289   NVRTNDKGEFWVAIHCRRSIYARMVSRNVRLRKFLLSLPIPAKYHYLMQIGG-KLHALII  347

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
              ++  GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  348   KYNPEGEVLDILEDTTGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  395



>ref|XP_009378622.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=440

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 176/376 (47%), Positives = 237/376 (63%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSP-VGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S  V    F+  K D+ P+  V E    D ++ L    ++F+++V GPES+ FD 
Sbjct  70    DPFKHSAIVEFPDFQAHKVDMPPWSLVPE--DKDTENLLQKSEIKFLNQVQGPESVTFDP  127

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGR++ W G    W  FA  +P+ S+ IC       +P  + K E  CGR
Sbjct  128   LGRGPYTGVADGRVLFWNGQ--AWTDFAYTSPHRSD-ICS---PKPSPLSYLKNEHICGR  181

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY GLL VGP+GG+AT L T  EG P+ F NDLDI + G+I+F
Sbjct  182   PLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLTTEAEGVPLRFTNDLDIDEEGNIYF  241

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE TGR+L+Y+P T +T V+  ++ FPNG+  S+D SF LF 
Sbjct  242   TDSSTMYQRRNFMQLVFSGEDTGRVLKYNPTTNETTVLQRNIRFPNGLSLSKDGSFFLFC  301

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++  K+G +EV A LPGFPDNVR NE G++WVA+ C R     +    P
Sbjct  302   EGAVGRLRKYWLKSEKAGTSEVFAVLPGFPDNVRTNENGEFWVALHCRRNLYTHICAAFP  361

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P  +Q+L    G +++ V+  +   G++L +LED  G V+K VSEV E 
Sbjct  362   QLRKFLLKLPVPSRIQFLLHIGG-RLHAVVVKYSPEGKILQILEDSEGKVVKAVSEVEEK  420

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  421   DGKLWMGSVLMPFIAV  436



>ref|XP_010525478.1| PREDICTED: strictosidine synthase 1-like [Tarenaya hassleriana]
Length=373

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 212/317 (67%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL F+  G GPY G+ADGRI+RW GD+ GW  FA  + N  E         + P   
Sbjct  55    GPESLAFNPAGEGPYTGVADGRILRWRGDSLGWTDFAYTSHNRQE--------CSRPFAP  106

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFD KTGDLYIADAY+GLLVVGP GG+A PL T ++G+P+ F NDLDI
Sbjct  107   EMEHVCGRPLGLRFDNKTGDLYIADAYFGLLVVGPTGGLARPLVTEIDGQPLRFTNDLDI  166

Query  727   H-KNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
             H + G+I+FTDTS ++ R    L +L  + TGRL++++  TGK  V+L  LAF NGV  S
Sbjct  167   HDQAGAIYFTDTSTRFQRRQFLLSVLNLDKTGRLIKFEKSTGKVTVLLQGLAFANGVALS  226

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D S+LL  ETT CR+++ W++GPK+G  +V A LPGFPDNVR N +G++WVA+   + R
Sbjct  227   KDQSYLLVAETTTCRILRLWLDGPKAGSHDVFAELPGFPDNVRRNPEGEFWVALHAKKGR  286

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
             +  + ++H W R++  +LP+  Q L + F G + +       + GEVL+VLED     + 
Sbjct  287   VARLALSHSWFRNLLLKLPVSPQRLHSIFIGGEPHATAMKLSETGEVLEVLEDTEAKRLS  346

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLW+G+V
Sbjct  347   FISEVEEKDGKLWMGSV  363



>dbj|BAJ89445.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   322 bits (826),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 223/347 (64%), Gaps = 6/347 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D   RL    + F  EV GPES+ FD  GRGPY G+ADGR++ W  D A W  FA  +
Sbjct  84    HADAGERLRGAEIRFRGEVQGPESVAFDPRGRGPYTGVADGRVLVW--DGARWAYFAHAS  141

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W+   CG G  ++  +  + E  CGR LG+RFDK+TGDLYIADAY+GL  VGP+GG+A
Sbjct  142   PAWTADRCG-GPKASPTEYLRDEHVCGRALGIRFDKRTGDLYIADAYFGLSKVGPEGGLA  200

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG    F NDLD+  +G+++FTD+S  Y R +   ++  G+A+GRLL+Y+P T
Sbjct  201   TPLATEAEGVRFNFTNDLDLDADGNVYFTDSSVLYQRRHFMQLVFSGDASGRLLKYNPQT  260

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  261   KETTVLHRNLQFPNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  320

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR N+KG++WVAI C R+    +L +    R     LP+P +  YL +  G  ++ +I  
Sbjct  321   VRTNDKGEFWVAIHCRRSAYARLLSHRVQLRKFLLSLPIPAKYHYLMQIGG-NLHALIIK  379

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
             +   GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  380   YSPEGEVLDILEDTKGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  426



>dbj|BAJ91613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   322 bits (826),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 165/347 (48%), Positives = 223/347 (64%), Gaps = 6/347 (2%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D   RL    + F  EV GPES+ FD  GRGPY G+ADGR++ W  D A W  FA  +
Sbjct  84    HADAGERLRGAEIRFRGEVQGPESVAFDPRGRGPYTGVADGRVLVW--DGARWAYFAHAS  141

Query  487   PNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIA  666
             P W+   CG G  ++  +  + E  CGR LG+RFDK+TGDLYIADAY+GL  VGP+GG+A
Sbjct  142   PAWTADRCG-GPKASPTEYLRDEHVCGRALGIRFDKRTGDLYIADAYFGLSKVGPEGGLA  200

Query  667   TPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPT  846
             TPLAT  EG    F NDLD+  +G+++FTD+S  Y R +   ++  G+A+GRLL+Y+P T
Sbjct  201   TPLATEAEGVRFNFTNDLDLDADGNVYFTDSSVLYQRRHFMQLVFSGDASGRLLKYNPQT  260

Query  847   GKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDN  1026
              +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPDN
Sbjct  261   KETTVLHRNLQFPNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPDN  320

Query  1027  VRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISL  1200
             VR N+KG++WVAI C R+    +L +    R     LP+P +  YL +  G  ++ +I  
Sbjct  321   VRTNDKGEFWVAIHCRRSAYARLLSHRVQLRKFLLSLPIPAKYHYLMQIGG-NLHALIIK  379

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
             +   GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  380   YSPEGEVLDILEDTKGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  426



>emb|CDX93560.1| BnaA06g04880D [Brassica napus]
Length=393

 Score =   321 bits (822),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 172/380 (45%), Positives = 241/380 (63%), Gaps = 13/380 (3%)
 Frame = +1

Query  217   DPFELSPVGGQ-KFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F+  K D+ P   +  ER   D+++ L    + FV+EV GPES+ FD
Sbjct  23    DPFKHSSISKYPDFQTHKIDMPPLASLPKER---DHENLLQNSEIRFVNEVQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W  D   W  FA  + N SE +C     S+     K E  CGR
Sbjct  80    PLGRGPYTGVADGRILFW--DGTRWTDFAYTSNNRSE-LCD--TKSSLLAYLKNEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF K+TGDLYIADAY+G++ VGP+GG+AT L T  +G P+ F NDLD+ + G+++F
Sbjct  135   PLGLRFHKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R N   +++ GE TGR+L+Y+P T +T  +L +L FPNG+    D SF +F 
Sbjct  195   TDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGRDGSFFIFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+ C R     V+ +HP
Sbjct  255   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVMAHHP  314

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V   + ++G+VL VLEDK G V+K VSE+ E 
Sbjct  315   NVRKFFLKLPITVKFQYLLQVGGWP-HAVAVKYSEDGKVLKVLEDKQGKVVKAVSEIEEK  373

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  374   DGKLWMGSVLMSFIAVYDLP  393



>ref|XP_002984195.1| hypothetical protein SELMODRAFT_156492 [Selaginella moellendorffii]
 gb|EFJ14705.1| hypothetical protein SELMODRAFT_156492 [Selaginella moellendorffii]
Length=390

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 227/372 (61%), Gaps = 10/372 (3%)
 Frame = +1

Query  217   DPFELSP-VGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFD  390
             DP  + P VG   FR +  +  P    +  + GD  +RL     + F  +V GPES+ FD
Sbjct  22    DPLRIGPTVGFPDFRAIHVE-QPSPAQLGDFQGDPHNRLAARAEVRFSGQVCGPESIAFD  80

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ DGR++RW  +   W  FA+ + N S   C    D   P     E  CGR
Sbjct  81    PQGRGPYTGICDGRVLRWDEEQQAWIEFAVTSSNRSA--CA-PKDPPRPNLAN-EHICGR  136

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF K + +LYIADAY GLLVVG  GG+A+PL T VEG+P+LF NDLD+ ++G ++F
Sbjct  137   PLGLRFKKSSSELYIADAYKGLLVVGSQGGLASPLVTEVEGQPLLFTNDLDLDEDGCVYF  196

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             T TS KY R N  L +LEG+ TG LL+YDP T +  V+L  L FPNGV  S+D+SFL+F 
Sbjct  197   TVTSSKYQRRNFILPILEGDDTGLLLKYDPSTKQVSVLLRGLQFPNGVSMSKDYSFLVFA  256

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             ETTN +L +YW++GPK+G  E+ A LPG PDNVR NE G++WVAI   R  +   L   P
Sbjct  257   ETTNGKLTRYWLKGPKAGTPELFAILPGHPDNVRTNENGEFWVAIHALRKPVMRFLGPRP  316

Query  1111  WTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDG  1290
               R    +LP+P + +    G   Y +I  +D +G+++D LED  G V   VSE  E DG
Sbjct  317   RLRDFLVKLPIPAKMI---TGGGPYALILKYDADGKLIDALEDHKGQVASYVSEAEEHDG  373

Query  1291  KLWIGTVAHNHI  1326
              LW+GTV  N I
Sbjct  374   HLWLGTVLLNKI  385



>ref|XP_002298158.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEE82963.2| strictosidine synthase family protein [Populus trichocarpa]
Length=391

 Score =   321 bits (822),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 240/369 (65%), Gaps = 13/369 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DP++ S + G   F+  K ++ P+  + +    D ++ L    ++F++++ GPES+ FD 
Sbjct  21    DPWKQSAISGFPDFKSYKVEMPPWSLLPK--EKDEENLLQRSEIKFLNQIQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRI+ +  D   W  FA  + N SE IC       +P  + K E  CGR
Sbjct  79    LGRGPYTGVADGRILFY--DGQKWTDFAYTSSNRSE-ICN---PQPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L+   EG P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE +GR+L+Y+P T +T V++ +L FPNGV  S+D SF +F 
Sbjct  193   TDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A LPGFPDNVR NE+G +WVAI C R+    +   +P
Sbjct  253   EGSIGRLRKYWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAIHCRRSFYTHINAQYP  312

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R+   +LP+PM  QYL +  G     V+  +   G++L +LED  G V+K +SEV E 
Sbjct  313   NLRTFLLKLPIPMKIQYLLQIGGWPHGLVVK-YSPEGKLLQILEDSQGKVVKAISEVEEK  371

Query  1285  DGKLWIGTV  1311
             DGKLW+G+V
Sbjct  372   DGKLWMGSV  380



>ref|XP_008382118.1| PREDICTED: strictosidine synthase 3 [Malus domestica]
Length=450

 Score =   323 bits (827),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 176/376 (47%), Positives = 237/376 (63%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSP-VGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S  V    F+  K ++ P+  V E    D ++ L    + F+++V GPES+ FD 
Sbjct  80    DPFKHSAIVEFPDFQAHKVEMPPWSLVPE--DKDTENLLQKSEIRFLNQVQGPESVTFDP  137

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGR++ W G    W  FA  +P+ S+ IC       +P  + K E  CGR
Sbjct  138   LGRGPYTGVADGRVLFWNGQ--AWTDFAYTSPHRSD-ICS---PKPSPLSYLKNEHICGR  191

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY GLL VGP+GG+AT L T  EG P+ F NDLDI + G+I+F
Sbjct  192   PLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLTTEAEGVPLRFTNDLDIDEEGNIYF  251

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE TGR+L+Y+P T +T V+  ++ FPNG+  S+D SF LF 
Sbjct  252   TDSSTMYQRRNFMQLVFSGEDTGRVLKYNPTTKETTVLQRNIRFPNGLSLSKDGSFFLFC  311

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G +EV A LPGFPDNVR NE G++WVA+ C R     +    P
Sbjct  312   EGAVGRLRKYWLKGEKAGTSEVFAVLPGFPDNVRTNENGEFWVALHCRRNLYTHICAAFP  371

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P  +Q+L    G +++ V+  +   G++L +LED  G V+K VSEV E 
Sbjct  372   QLRKFLLKLPVPSRIQFLLHIGG-RLHAVVVKYSPEGKILQILEDSEGKVVKAVSEVEEK  430

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  431   DGKLWMGSVLMPFIAV  446



>ref|XP_009765833.1| PREDICTED: strictosidine synthase 3 [Nicotiana sylvestris]
Length=391

 Score =   320 bits (821),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 164/362 (45%), Positives = 234/362 (65%), Gaps = 15/362 (4%)
 Frame = +1

Query  271   DIAPYKEVMERW-----HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   +K  M  W       D+++ L    ++F++++ GPES+ FD  GRGPY G+ADGR+
Sbjct  33    DFESFKVEMPAWSEFPVEKDSQNLLQKSEIKFLNQIQGPESIAFDPQGRGPYTGIADGRV  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLY  612
             V W G+   W  FA  + N S    GL     +P  + K E  CGRPLGLRFDK+TGDLY
Sbjct  93    VFWDGEK--WNDFAYTSANRS----GLCDPKPSPMSYLKNEHICGRPLGLRFDKRTGDLY  146

Query  613   IADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFL  792
             IADAY+GL+ VGP+GG+A  L T  EG P+ F NDLD+   G+++FTD+S KY R N   
Sbjct  147   IADAYFGLVKVGPEGGLAESLTTEAEGVPLGFTNDLDVDNEGNVYFTDSSTKYQRRNFMQ  206

Query  793   IMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEG  972
             ++   E +GR+L+Y+P T +T V++ +L FPNG+  S+D SF +F E +  RL KYW++G
Sbjct  207   LVFSAEDSGRVLKYNPRTKETTVLIHNLQFPNGLSLSKDGSFFIFCEGSKGRLRKYWLKG  266

Query  973   PKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--  1146
              K+G +EVIA LPG+PDNVRANE+ ++WVAI C RT    +   +P  R    +LP+P  
Sbjct  267   EKAGTSEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYINAIYPPLRQFLLKLPVPAK  326

Query  1147  MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             +QYL    G +++ V+  +   G++L +LED+ G V+K VSEV E +GKLW+G+V  + I
Sbjct  327   LQYLMHIGG-RLHAVVVKYSPEGKLLQILEDRQGKVVKAVSEVEEREGKLWMGSVLMSFI  385

Query  1327  AT  1332
             + 
Sbjct  386   SV  387



>ref|XP_010535734.1| PREDICTED: adipocyte plasma membrane-associated protein [Tarenaya 
hassleriana]
Length=395

 Score =   321 bits (822),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 224/345 (65%), Gaps = 6/345 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D ++ L   ++ F+++V GPES+ FD LGRGPY G+ADGR++ W G+   W  FA  + N
Sbjct  56    DAQNSLQRSDIMFLNQVQGPESIVFDRLGRGPYTGVADGRVLLWNGEK--WVGFAYTSSN  113

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              SE IC      +T    K E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+A P
Sbjct  114   RSE-ICD--PKPSTLSYVKNEHICGRPLGLRFDKRTGDLYIADAYLGLLRVGPEGGLAMP  170

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             L T  EG P+ F NDLDI  +G+++FTD+S KY R N   ++  G+ +GR+L+YDP T K
Sbjct  171   LVTEAEGVPLRFTNDLDIDDDGNVYFTDSSTKYQRRNFMQLVFSGDDSGRVLKYDPKTNK  230

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V++ ++ FPNG   S+D SFL+F E    RL +YW++G K+G +EV A LPGFPDNVR
Sbjct  231   VDVLVRNVQFPNGASLSKDGSFLIFCEGAIGRLRRYWLKGEKAGASEVFAILPGFPDNVR  290

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARF-AGMKMYTVISLFDQ  1209
              N+ G++WVA+ C R    EV+  +P  R    +LP+  +    F  G++ +  +  +  
Sbjct  291   TNKDGEFWVALHCRRNYFAEVMAKYPKFRKFLLKLPISARTQFGFHIGLRPHAAVVKYSP  350

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
              G++L +LED  G V++ VSEV E DGKLWIG+V  N IA    P
Sbjct  351   EGKLLQILEDSEGRVVRSVSEVEEKDGKLWIGSVLMNFIALYHLP  395



>ref|XP_003559512.1| PREDICTED: strictosidine synthase-like [Brachypodium distachyon]
Length=397

 Score =   320 bits (821),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 222/348 (64%), Gaps = 9/348 (3%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D   RL    + F  EV GPES+ FD  GRGPY G+ADGR++ W  D A W  FA  +
Sbjct  52    HADAGERLRGAEIRFRGEVQGPESVAFDPQGRGPYTGVADGRVLFW--DGARWVYFAHAS  109

Query  487   PNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             PNW+ ++CG      +P  + + E  CGR LG+RFDK+TG+LYIADAY+GL  VGP+GG+
Sbjct  110   PNWTAELCG---PKASPLDFLRDEHICGRALGIRFDKRTGNLYIADAYFGLFKVGPEGGL  166

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPLAT  EG    F NDLD+   G+++FTD+S  Y R N   ++  G+ +GRLL+Y+P 
Sbjct  167   ATPLATEAEGVRFNFTNDLDLDAEGNVYFTDSSIYYQRRNFMQLVFSGDPSGRLLKYNPQ  226

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
             T +T V+  +L FPNGV  S+D SF +F E +  RL +YW++G K+G  ++ A LPGFPD
Sbjct  227   TKETTVLHRNLQFPNGVSLSKDGSFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPD  286

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVIS  1197
             NVR NEKG++WVAI C R+    +       R     LP+P +  YL +  G  ++ +I 
Sbjct  287   NVRTNEKGEFWVAIHCRRSAYARLTSRRVQLRKFLLSLPIPAKYHYLMQIGG-NLHALII  345

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
              +  +GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  346   KYSPDGEVLDILEDTKGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  393



>ref|XP_002278088.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
Length=391

 Score =   320 bits (820),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 172/376 (46%), Positives = 241/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DP + S +    +F     ++ P+ EV      D+++ L    ++F+++V GPES+ FD 
Sbjct  21    DPLKHSSIANFPEFEAHLVEMPPWSEVPA--AKDDRNLLQKAEIKFLNQVQGPESVAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRI+ W G+   W  FA  +PN SE +C       +P  + K E  CGR
Sbjct  79    LGRGPYTGVADGRILFWNGE--AWSDFAYTSPNRSE-LCD---PKPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF+K+TGDLYIAD+Y GL+ VGP+GG+AT L T  +G P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFNKRTGDLYIADSYLGLMKVGPEGGLATSLVTEADGVPLRFTNDLDIDDAGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S KY R N   ++   E +GRLL+YDP T +T V+L  L FPNGV  S+D SFL+  
Sbjct  193   TDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTKETTVLLRGLQFPNGVSLSKDGSFLVLC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL+KYW++G K+G +EV A LPG+PDNVR NEKG++WVAI C RT    +   +P
Sbjct  253   EGSPGRLVKYWLKGDKAGTSEVFAILPGYPDNVRTNEKGEFWVAIHCRRTMYSYLCGLYP  312

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+P   QYL    G +++ V+  +   G+++ +LED  G V++ VSEV E 
Sbjct  313   KLRMFLLKLPIPTRYQYLLHIGG-RLHAVVVKYSPEGKLVKILEDSEGKVVRAVSEVEER  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             +GKLW+G+V    +A 
Sbjct  372   EGKLWMGSVLMPFVAV  387



>ref|XP_006340314.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=391

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/377 (45%), Positives = 242/377 (64%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F   K ++  + E+ +E+   D+++ L    ++F+D++ GPES+ FD
Sbjct  21    DPFKHSAISEFPNFESFKVEMPAWSEIPVEK---DSQNLLQKSEIKFLDQIQGPESIVFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGR+V W G+   W  FA  + N S    GL     +P  + K E  CG
Sbjct  78    PQGRGPYTGIADGRVVFWDGEK--WNDFAYTSANRS----GLCDPKPSPLSYMKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TGDLYIADAY GL+ VGP+GG+A  L T  EG PI FANDLD+   G+++
Sbjct  132   RPLGLRFDKRTGDLYIADAYLGLMKVGPEGGLAESLTTEAEGIPIGFANDLDVDDEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N   ++   E +G++L+Y+P T +T V++ +L FPNG+  S+D SF +F
Sbjct  192   FTDSSTKYQRRNFVQLVFSAEDSGKVLKYNPRTKETTVLIRNLQFPNGLSLSKDGSFFIF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E +  RL KYW++G K+G +EVIA LPG+PDNVRANE+ ++WVAI C RT    +   +
Sbjct  252   CEGSKGRLRKYWLKGEKAGTSEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYINAIY  311

Query  1108  PWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R    +LP+   +QYL    G +   V+  +   G++L +LED+ G V++ VSEV E
Sbjct  312   PQLRQFLLKLPISAKLQYLIHIGG-RFTAVVVRYSSEGKLLQILEDRQGKVVRAVSEVEE  370

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLW+G+V  + I+ 
Sbjct  371   RDGKLWMGSVLMSFISV  387



>ref|XP_007205319.1| hypothetical protein PRUPE_ppa006884mg [Prunus persica]
 gb|EMJ06518.1| hypothetical protein PRUPE_ppa006884mg [Prunus persica]
Length=391

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/361 (47%), Positives = 228/361 (63%), Gaps = 15/361 (4%)
 Frame = +1

Query  271   DIAPYKEVMERWHG-----DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   YK  M  W       D ++ L    ++F+++V GPES+ FD LGRGPY G+ADGR+
Sbjct  33    DFEAYKVDMPSWSSVPTERDPENLLQKSEIKFLNQVQGPESVAFDPLGRGPYAGVADGRV  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLY  612
             + W G +  W  FA  +P+ S+ IC       +P  + K E  CGRPLGLRFDKKTGDLY
Sbjct  93    LFWNGQS--WTDFAYTSPHRSD-ICS---PKPSPLSYLKNEHICGRPLGLRFDKKTGDLY  146

Query  613   IADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFL  792
             IADAY+GLL VGP+GG+ATPL T  EG P+ F NDLDI + G+++FTD+S  Y R N   
Sbjct  147   IADAYFGLLKVGPEGGLATPLTTEAEGVPLRFTNDLDIDEEGNVYFTDSSTTYQRRNFMQ  206

Query  793   IMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEG  972
             ++   E TGR+L+Y+P T +T V+  +L FPNG+  S+D SF +F E +  RL KYW++G
Sbjct  207   LVFSAEDTGRVLKYNPTTKETTVLEKNLQFPNGLSLSKDGSFFVFCEGSIGRLRKYWLKG  266

Query  973   PKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--  1146
              K+G +EV A LPGFPDNVR NE G +WVA+ C R     +    P  R    +LP+   
Sbjct  267   EKAGTSEVFAVLPGFPDNVRTNENGDFWVAVHCRRNMYTHLCALFPQIRKFLLKLPISAK  326

Query  1147  MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             +Q+L    G + + V+  +   G++L +LED  G V+K VSEV E DGKLW+G+V    I
Sbjct  327   IQFLIHIGG-RPHAVVVKYSPEGKILQILEDSQGKVVKAVSEVEEKDGKLWMGSVLMPFI  385

Query  1327  A  1329
             A
Sbjct  386   A  386



>ref|XP_006417683.1| hypothetical protein EUTSA_v10007865mg [Eutrema salsugineum]
 gb|ESQ36036.1| hypothetical protein EUTSA_v10007865mg [Eutrema salsugineum]
Length=390

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 172/382 (45%), Positives = 237/382 (62%), Gaps = 17/382 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF  S +     F+  K D+ P   + +    DN   L    + F++EV GPES+ FD 
Sbjct  20    DPFNHSSISKFPDFKTYKIDMPPLSALPKERDRDN--LLQNSEIRFLNEVQGPESIAFDP  77

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF---ESQC  564
             LGRGPY G+ADGRI+ W G    W  FA  + N SE +C      T P    +   E  C
Sbjct  78    LGRGPYTGVADGRILFWNGTR--WTDFAYTSNNRSE-LC-----DTKPSLLDYLKDEHIC  129

Query  565   GRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSI  744
             GRPLGLRFDK+TGDLYIADAY+G++ VGP+GG+AT L T  +G P+ F NDLD+   G++
Sbjct  130   GRPLGLRFDKRTGDLYIADAYFGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDDQGNV  189

Query  745   FFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLL  924
             +FTD+S  + R    L+++ GE +GR+L+Y+P T +T  +L +L FPNG+   +D SF +
Sbjct  190   YFTDSSSVFQRRKFMLLIVSGEDSGRVLKYNPVTKETSTLLRNLQFPNGLSLGKDGSFFI  249

Query  925   FTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLIN  1104
             F E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVAI C R     V+ +
Sbjct  250   FCEGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAIHCHRNIFTHVMAH  309

Query  1105  HPWTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
             HP  R  + +LP+ +  QYL +  G   + V   + + G+VL VLEDK G V+K VSEV 
Sbjct  310   HPIVRRFFLKLPITVKFQYLLQVGGWP-HAVAVKYSEEGKVLKVLEDKQGKVVKAVSEVE  368

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E DGKLW+G+V  + IA    P
Sbjct  369   EKDGKLWMGSVLMSFIAVYDLP  390



>ref|XP_006487831.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Citrus sinensis]
Length=391

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 223/342 (65%), Gaps = 8/342 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D+K+ L    ++F++++ GPES+ FD LGRGPY G+ADGRI+ W  D   W  FA  + N
Sbjct  52    DDKNLLQNSEIKFLNQIQGPESMAFDPLGRGPYTGVADGRILFW--DGLKWTDFAFTSNN  109

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              SE +C     +T+    K E  CGRPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT 
Sbjct  110   RSE-LCNPKPIATS--YLKNEHICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGVATS  166

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             LAT  EG P+ F NDLDI   G+++FTD+S  Y R N   ++   E TGR+L+YDP T +
Sbjct  167   LATEAEGVPLRFTNDLDIDDEGNVYFTDSSTNYQRRNFMQLVFSAEDTGRVLKYDPTTKQ  226

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
             T V+L +L FPNG+  S+D SF +F E +  RL KYW+ G K+G  E  A LPG+PDNVR
Sbjct  227   TTVLLRNLQFPNGLSLSKDKSFFVFCEGSVGRLHKYWLIGEKAGNLEAFAILPGYPDNVR  286

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISLFD  1206
              NEKG++WVAI C R+    ++  +P  R    +LP+  +  YL    G +++ +   + 
Sbjct  287   TNEKGEFWVAIHCRRSLYSHLMALYPKIRHFLLKLPISAKTHYLIHVGG-RLHAMAVKYS  345

Query  1207  QNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
               G++L VLED  G V+K +SEV E DGKLW+G+V    +A 
Sbjct  346   PEGKILQVLEDSKGKVVKAISEVEEKDGKLWMGSVLMPFVAV  387



>gb|KDO48949.1| hypothetical protein CISIN_1g015463mg [Citrus sinensis]
Length=391

 Score =   318 bits (816),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 168/361 (47%), Positives = 228/361 (63%), Gaps = 13/361 (4%)
 Frame = +1

Query  271   DIAPYKEVMERWH-----GDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   +K  M  W       D+K+ L    ++F++++ GPES+ FD LGRGPY G+ADGRI
Sbjct  33    DFVSHKVDMPPWSLIPTVKDDKNLLQNSEIKFLNQIQGPESMAFDPLGRGPYTGVADGRI  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYI  615
             + W  D   W  FA  + N SE +C     +T+    K E  CGRPLGLRFDKKTGDLYI
Sbjct  93    LFW--DGLKWTDFAFTSNNRSE-LCNPKPIATS--YLKNEHICGRPLGLRFDKKTGDLYI  147

Query  616   ADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLI  795
             ADAY+GL+ VGP+GG+AT LAT  EG P+ F NDLDI   G+++FTD+S  Y R N   +
Sbjct  148   ADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDDEGNVYFTDSSTNYQRRNFMQL  207

Query  796   MLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGP  975
             +   E TGR+L+YDP T +T V+L +L FPNG+  S+D SF +F E +  RL KYW+ G 
Sbjct  208   VFSAEDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSFFVFCEGSVGRLHKYWLIGE  267

Query  976   KSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ-  1152
             K+G  E  A LPG+PDNVR NEKG++WVAI C R+    ++  +P  R    +LP+  + 
Sbjct  268   KAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLMALYPKIRHFLLKLPISAKT  327

Query  1153  -YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIA  1329
              YL    G +++ +   +   G++L VLED  G V+K +SEV E DGKLW+G+V    +A
Sbjct  328   HYLIHVGG-RLHAMAVKYSPEGKILQVLEDSKGKVVKAISEVEEKDGKLWMGSVLMPFVA  386

Query  1330  T  1332
              
Sbjct  387   V  387



>gb|AAR87254.1| putative strictosidine synthase [Oryza sativa Japonica Group]
 gb|ABF98899.1| Strictosidine synthase family protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAY91875.1| hypothetical protein OsI_13523 [Oryza sativa Indica Group]
Length=480

 Score =   321 bits (823),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/348 (49%), Positives = 228/348 (66%), Gaps = 9/348 (3%)
 Frame = +1

Query  307   HGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVT  486
             H D + RL    + F  EV GPES+ FD LGRGPY G+ADGR+VRW  D A W  FA  +
Sbjct  135   HADTRERLRGAEIRFRGEVQGPESVAFDPLGRGPYTGVADGRVVRW--DGARWVYFAHSS  192

Query  487   PNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             PNW+ ++CG      +P  + K E  CGR LGLRFD++TGDLYIADAY+GLL VGPDGG+
Sbjct  193   PNWTAELCG---HKASPLDYLKDEHICGRALGLRFDRRTGDLYIADAYFGLLKVGPDGGL  249

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPLAT  EG    F NDLD+  +G+++FTD+S  Y R +   ++  G+ +GRLL+YDP 
Sbjct  250   ATPLATEAEGVRFNFTNDLDLDDDGNVYFTDSSIHYQRRHFMQLVFSGDPSGRLLKYDPN  309

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
             T K  V+  ++ FPNGV  S+D  F +F E +  RL +YW++G K+G  ++ A LPGFPD
Sbjct  310   TKKATVLHRNIQFPNGVSMSKDGLFFVFCEGSRGRLSRYWLKGEKAGTVDLFAILPGFPD  369

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVIS  1197
             NVR N+KG++WVAI C R+    ++  +   R     LP+P +  YL +  G K++ +I 
Sbjct  370   NVRTNDKGEFWVAIHCRRSIYARMVSRNVRLRKFLLSLPIPAKYHYLMQIGG-KLHALII  428

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
              ++  GEVLD+LED  G V++ VSEV E DGKLWIG+V    IA   Y
Sbjct  429   KYNPEGEVLDILEDTTGQVVRAVSEVEEKDGKLWIGSVLMPFIAVFDY  476



>ref|XP_010544326.1| PREDICTED: strictosidine synthase 3 [Tarenaya hassleriana]
Length=394

 Score =   318 bits (814),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 240/377 (64%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYK-EVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  SP+    +F   K  + P      ER   D ++ L    + F++EV GPES+ FD
Sbjct  23    DPFNHSPISQFPEFETYKIQMPPLSAHPKER---DPENLLQRSEIRFLNEVQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
              LGRGPY G+ADGR+  W  D + W  FA  + N SE +C       +P  + K E  CG
Sbjct  80    PLGRGPYTGVADGRVRFW--DGSRWTDFAYTSSNRSE-LCD---PKPSPFAYLKNEHICG  133

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L T  +G P+ F NDLDI   G+++
Sbjct  134   RPLGLRFDKKTGDLYIADAYFGLMKVGPEGGVATSLTTEADGVPLRFTNDLDIDDEGNVY  193

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             F+D+S  Y R N   ++L GE +GR+L+Y+P T +T  ++ +L FPNGV  S+D SF +F
Sbjct  194   FSDSSSFYQRRNFMQLILAGENSGRILKYNPKTKETTTLVRNLQFPNGVTLSKDGSFFIF  253

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVAI C R  +  V+  +
Sbjct  254   CEGSIGRLRKYWLKGEKAGTSEVVAILHGFPDNIRTNKDGDFWVAIHCHRNILTHVMGLY  313

Query  1108  PWTRSVYFRLP--LPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R  + +LP  L  QYL +  G + + ++  +D +G+VL VLEDK G V+K VSEV E
Sbjct  314   PRLRKFFLKLPITLKFQYLLQVGG-RPHAMVVKYDGDGKVLKVLEDKQGKVVKAVSEVEE  372

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DGKLW+G+V    I+ 
Sbjct  373   KDGKLWMGSVLMPFISV  389



>ref|XP_002513740.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF48687.1| strictosidine synthase, putative [Ricinus communis]
Length=391

 Score =   317 bits (813),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 171/369 (46%), Positives = 236/369 (64%), Gaps = 13/369 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +     F+  K D+  +  V      DN + L    ++F++++ GPES+ FD 
Sbjct  21    DPFKHSAISEFPDFKAFKVDLPDWSLVPN--EKDNDNLLQRSEIKFLNQIQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRIV W  D   W  FA  +PN SE IC       +P  + K E  CGR
Sbjct  79    LGRGPYTGIADGRIVFW--DGLKWIDFAYTSPNRSE-ICE---RKPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF+KKTGDLYIADAY+GL+ VGP+GG+AT LAT  EG  + F NDLDI   G+I+F
Sbjct  133   PLGLRFNKKTGDLYIADAYFGLMKVGPEGGLATSLATEAEGIKLGFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S +Y R N   ++   E +GR+L+Y+P T  T V++ ++ FPNGV  S+D +F +F 
Sbjct  193   TDSSTQYQRRNFMQLVFSSEHSGRVLKYNPTTKGTTVLVRNVQFPNGVSLSKDGTFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G TEV+A LPGFPDNVR NE+G +WVA+ C RT    +   +P
Sbjct  253   EGSMGRLSKYWLKGEKAGTTEVLAILPGFPDNVRTNEEGNFWVAVHCRRTYYSYICALYP  312

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R+   +LP+   + YL    G +++ V   +   G++L +LED  G V+K +SEV E 
Sbjct  313   KLRTFLLKLPISAKIHYLFHIGG-RLHAVAVKYSPEGKLLQILEDSQGKVVKAISEVEER  371

Query  1285  DGKLWIGTV  1311
             DGKLW+G+V
Sbjct  372   DGKLWMGSV  380



>ref|XP_006424057.1| hypothetical protein CICLE_v10028617mg [Citrus clementina]
 gb|ESR37297.1| hypothetical protein CICLE_v10028617mg [Citrus clementina]
Length=391

 Score =   317 bits (812),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/361 (46%), Positives = 225/361 (62%), Gaps = 13/361 (4%)
 Frame = +1

Query  271   DIAPYKEVMERWH-----GDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   +K  M  W       D+K+ L    ++F++++ GPES+ FD LGRGPY G+ADGRI
Sbjct  33    DFVSHKVDMPPWSLIPTVKDDKNLLQNSEIKFLNQIQGPESMAFDPLGRGPYTGVADGRI  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYI  615
             + W  D   W  FA  + N SE +C            K E  CGRPLGLRFDKKTGDLYI
Sbjct  93    LFW--DGLKWTDFAFTSNNRSE-LCN--PKPIAMSYLKNEHICGRPLGLRFDKKTGDLYI  147

Query  616   ADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLI  795
             ADAY+GL+ VGP+GG+AT LAT  EG P+ F NDLDI   G+++FTD+S  Y R N   +
Sbjct  148   ADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDDEGNVYFTDSSTNYQRRNFMQL  207

Query  796   MLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGP  975
             +   E TGR+L+YDP T +T V+L +L FPNG+  S+D SF +F E +  RL KYW+ G 
Sbjct  208   VFSAEDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSFFVFCEGSVGRLHKYWLIGE  267

Query  976   KSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ-  1152
             K+G  E  A LPG+PDNVR NEKG++WVAI C R+    ++  +P  R    +LP+  + 
Sbjct  268   KAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLMALYPKIRHFVLKLPISAKT  327

Query  1153  -YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIA  1329
              YL    G +++ +   +   G++L VLED  G V+K +SEV E DGKLW+G+V    +A
Sbjct  328   HYLIHIGG-RLHAMAVKYSPEGKILQVLEDSKGKVVKAISEVEEKDGKLWMGSVLMPFVA  386

Query  1330  T  1332
              
Sbjct  387   V  387



>ref|XP_004172338.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
Length=402

 Score =   317 bits (813),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 174/380 (46%), Positives = 236/380 (62%), Gaps = 23/380 (6%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F     ++  + ++  ER   D ++ L    + F D+V GPES+ FD
Sbjct  32    DPFKHSAIANFPDFETYYVELPSWSQIPTER---DTENLLQKSTIMFKDQVQGPESVAFD  88

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF-----E  555
             +LGRGPY G+ADGR++ W G++  W  FA  +PN SE IC        PK   F     E
Sbjct  89    SLGRGPYTGVADGRVLFWNGES--WTDFAYTSPNRSE-IC-------DPKPSIFGYAKNE  138

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L+T  EG P  F NDLD+   
Sbjct  139   HICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDE  198

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             G+++FTD+S KY R N   ++   E TGRLL+Y+  TG+T V++  L FPNGV  S+D S
Sbjct  199   GNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPNGVSLSKDGS  258

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             F LF E    RL KYW++G K+G  E+ A LPGFPDNVR N+KG +WVA+    + +  +
Sbjct  259   FFLFCEGGKGRLRKYWLKGEKAGTNELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHL  318

Query  1096  LINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVS  1269
                +P  R +  +LP+   +Q+L    G + + V   +   G++L +LED  G V+K VS
Sbjct  319   EAKYPKLRKILLKLPISAKIQFLLHVGG-RPHAVAVKYSPEGKLLQILEDTQGKVVKAVS  377

Query  1270  EVREVDGKLWIGTVAHNHIA  1329
             EV E DGKLWIG+V  + IA
Sbjct  378   EVEEKDGKLWIGSVLMSFIA  397



>ref|XP_004137361.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Cucumis sativus]
 gb|KGN63897.1| hypothetical protein Csa_1G025790 [Cucumis sativus]
Length=402

 Score =   317 bits (813),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 174/380 (46%), Positives = 236/380 (62%), Gaps = 23/380 (6%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F     ++  + ++  ER   D ++ L    + F D+V GPES+ FD
Sbjct  32    DPFKHSAIANFPDFETYYVELPSWSQIPTER---DTENLLQKSTIMFKDQVQGPESVAFD  88

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF-----E  555
             +LGRGPY G+ADGR++ W G++  W  FA  +PN SE IC        PK   F     E
Sbjct  89    SLGRGPYTGVADGRVLFWNGES--WTDFAYTSPNRSE-IC-------DPKPSIFGYAKNE  138

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L+T  EG P  F NDLD+   
Sbjct  139   HICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDE  198

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             G+++FTD+S KY R N   ++   E TGRLL+Y+  TG+T V++  L FPNGV  S+D S
Sbjct  199   GNVYFTDSSTKYERRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLHFPNGVSLSKDGS  258

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             F LF E    RL KYW++G K+G  E+ A LPGFPDNVR N+KG +WVA+    + +  +
Sbjct  259   FFLFCEGGKGRLRKYWLKGEKAGTNELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHL  318

Query  1096  LINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVS  1269
                +P  R +  +LP+   +Q+L    G + + V   +   G++L +LED  G V+K VS
Sbjct  319   EAEYPKLRKILLKLPISAKIQFLLHVGG-RPHAVAVKYSPEGKLLQILEDTQGKVVKAVS  377

Query  1270  EVREVDGKLWIGTVAHNHIA  1329
             EV E DGKLWIG+V  + IA
Sbjct  378   EVEEKDGKLWIGSVLMSFIA  397



>ref|XP_008230556.1| PREDICTED: strictosidine synthase 3 [Prunus mume]
Length=391

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/362 (46%), Positives = 226/362 (62%), Gaps = 15/362 (4%)
 Frame = +1

Query  271   DIAPYKEVMERWHG-----DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   YK  M  W       D ++ L    ++F+++V GPES+ FD LGRGPY G+ADGR+
Sbjct  33    DFEAYKVDMPSWSSVPTERDPENLLQKSEIKFLNQVQGPESVAFDPLGRGPYAGVADGRV  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLY  612
             + W G +  W  FA  +P+ S+ IC       +P  + K E  CGRPLGLRFDKKTGDLY
Sbjct  93    LFWNGQS--WTDFAYTSPHRSD-ICS---PKPSPLSYLKNEHICGRPLGLRFDKKTGDLY  146

Query  613   IADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFL  792
             IADAY+GLL VGP+GG+AT L T  EG P+ F NDLDI + G+++FTD+S  Y R N   
Sbjct  147   IADAYFGLLKVGPEGGLATALTTEAEGVPLRFTNDLDIDEEGNVYFTDSSTTYQRRNFMQ  206

Query  793   IMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEG  972
             ++   E TGR+L+Y+P T +T V+  +L FPNG+  S+D SF +F E    RL KYW++G
Sbjct  207   LVFSAEDTGRVLKYNPTTKETTVLEKNLQFPNGLSLSKDGSFFVFCEGAIGRLRKYWLKG  266

Query  973   PKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--  1146
              K+G +EV A LPGFPDNVR NE G +WVA+ C R     +    P  R    +LP+   
Sbjct  267   EKAGTSEVFAVLPGFPDNVRTNENGDFWVAVHCRRNMYTHLCALFPQIRKFLLKLPISAK  326

Query  1147  MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             +Q+L    G + + V+  +   G++L +LED  G V+K VSEV E DGKLW+G+V    I
Sbjct  327   IQFLIHIGG-RPHAVVVKYSPEGKILQILEDSQGKVVKAVSEVEEKDGKLWMGSVLMPFI  385

Query  1327  AT  1332
             A 
Sbjct  386   AV  387



>ref|XP_010253308.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Nelumbo nucifera]
 ref|XP_010253309.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Nelumbo nucifera]
Length=391

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 236/381 (62%), Gaps = 23/381 (6%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S + G  +F   K D+ PY E+  ER   D ++ L   ++   ++V  PES+ FD
Sbjct  21    DPFKHSAISGFPEFEAHKVDLPPYSEIPAER---DRENLLQKSDIWSFNQVQAPESVVFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF-----E  555
             +LGRGPY G ADGRIV W G++  W  FA  +PN S        D   PK   F     E
Sbjct  78    SLGRGPYTGTADGRIVLWNGES--WTDFAFTSPNRS--------DLCNPKPSIFNYLNDE  127

Query  556   SQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN  735
               CGRPLGLRFDK+TGDLYIADAY+GL+ VGP+GG AT LAT VEG P  F NDLDI   
Sbjct  128   HICGRPLGLRFDKRTGDLYIADAYFGLMKVGPEGGQATLLATEVEGIPFGFTNDLDIDDE  187

Query  736   GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHS  915
             G+++FTD+S KY R N  L++  GE  GRLL+Y+P T +T V++ +L FPNGV  S+D S
Sbjct  188   GNVYFTDSSTKYQRRNFLLLVFSGEPDGRLLKYNPVTKETTVLVRNLQFPNGVSLSKDKS  247

Query  916   FLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEV  1095
             FL+F      +LM+YW++G K+G T+  A LPGFPDNVR+N+ G++WVAI   RT    V
Sbjct  248   FLVFCHGHPGKLMRYWLKGDKAGTTDAFAILPGFPDNVRSNDNGEFWVAIHSRRTMYGYV  307

Query  1096  LINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVS  1269
                +P  R  +  LP+   +QYL    G     VI  +   G+VL VLED  G ++K VS
Sbjct  308   NGLYPKLRKFFLNLPISAKLQYLLTVGGRPHAMVIK-YSFEGKVLLVLEDSQGKLVKAVS  366

Query  1270  EVREVDGKLWIGTVAHNHIAT  1332
              V E DGKLWIG++    IA 
Sbjct  367   GVEEKDGKLWIGSILMPFIAV  387



>ref|XP_004251214.1| PREDICTED: strictosidine synthase 3 [Solanum lycopersicum]
Length=410

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 243/376 (65%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F   K ++  + E+ +E+   D+++ L    ++F+D++ GPES+ FD
Sbjct  40    DPFKHSAISEFPNFESFKVEMPAWSEIPVEK---DSQNLLQKSEVKFLDQIQGPESIVFD  96

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ADGR+V W G+   W  FA  + N S  +C     + + +  K+E  CGR
Sbjct  97    PQGRGPYTGIADGRVVFWDGEK--WNDFAYTSANRS-GLCDPKPSALSYR--KYEHICGR  151

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDK+TGDLYIADAY GL+ VGP+GG+A  L T  EG PI FANDLD+   G+++F
Sbjct  152   PLGLRFDKRTGDLYIADAYLGLMKVGPEGGLAESLTTEAEGVPIGFANDLDVDDEGNVYF  211

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S KY R N   ++   E +G++L+Y+P T +T +++ +L FPNG+  S+D SF +F 
Sbjct  212   TDSSTKYQRRNFIQLVFSAEDSGKVLKYNPRTKETTILIRNLQFPNGLSLSKDGSFFIFC  271

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EVIA LPG+PDNVRANE+ ++WVAI C RT    +   +P
Sbjct  272   EGSKGRLRKYWLKGEKAGTSEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYINGIYP  331

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+   +QYL    G +   V+  +   G++L +LED+ G V++ VSEV E 
Sbjct  332   RLRQFLLKLPISAKLQYLIHIGG-RFTAVVVKYSPEGKLLQILEDRQGKVVRAVSEVEER  390

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V  + I+ 
Sbjct  391   DGKLWMGSVLMSFISV  406



>ref|XP_010475646.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 239/380 (63%), Gaps = 12/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F+  K D+ P   +  ER   D  + L    + F++EV GPES+ FD
Sbjct  22    DPFNHSSISKFPNFKTYKIDMPPLSSLPKER---DRLNLLQNSQIRFLNEVQGPESIAFD  78

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W G  + W  FA  + N S+++C L    +     K E  CGR
Sbjct  79    PLGRGPYTGVADGRILFWNG--SLWSDFAYTSINRSKELCDL--KPSLLDYLKDEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY G++ VGP+GG+AT L T  +G P+ F NDLD+ + G+++F
Sbjct  135   PLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSLTTEADGVPLRFTNDLDVDEEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE TGR+L+Y+P T +T  ++ +L FPNGV   +D SF +F 
Sbjct  195   TDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGVSLGKDGSFFIFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+   R     V+ ++P
Sbjct  255   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVMAHYP  314

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V+  + + G+VL VLED  G V+K VSEV E 
Sbjct  315   RVRKFFLKLPISVKFQYLLQVGGWP-HGVVVKYSEEGKVLKVLEDSQGKVVKAVSEVEEK  373

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  374   DGKLWMGSVLMSFIAVYDLP  393



>gb|KDP42972.1| hypothetical protein JCGZ_23914 [Jatropha curcas]
Length=391

 Score =   316 bits (809),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 235/369 (64%), Gaps = 13/369 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +    +F+ +K D+  +  V      DN   L    ++F+++V GPES+ FD 
Sbjct  21    DPFKHSAISDFPEFKAIKVDMPDWSLVPTDKDKDN--LLQRSEIKFLNQVQGPESIAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRIV W G    W  FA  + N SE IC       +P  + K E  CGR
Sbjct  79    LGRGPYTGIADGRIVFWNGQK--WTDFAYTSSNRSE-ICD---PKPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY GL+ VGP+GG AT L T  EG P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFDKKTGDLYIADAYLGLMKVGPEGGSATSLTTEAEGVPLRFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S +Y R N   ++   + +GR+L+Y+P T +T V++ +L FPNG+  S+D +F +F 
Sbjct  193   TDSSTQYQRRNFMQLVFSADDSGRVLKYNPTTKETTVLVRNLQFPNGLSLSKDGTFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A LPGFPDNVR NE+G +WVA+ C R+    +   +P
Sbjct  253   EGSIGRLRKYWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSLYTYICALYP  312

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+   +QYL    G +++ V   +   G++L +LED  G V+K +SEV E 
Sbjct  313   KLRMFMLKLPISAKIQYLLHIGG-RLHAVAVKYSPEGKILQILEDSQGKVVKAISEVEEK  371

Query  1285  DGKLWIGTV  1311
             DGKLW+G+V
Sbjct  372   DGKLWMGSV  380



>ref|XP_007015611.1| Strictosidine synthase-like 3 [Theobroma cacao]
 gb|EOY33230.1| Strictosidine synthase-like 3 [Theobroma cacao]
Length=391

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 173/382 (45%), Positives = 233/382 (61%), Gaps = 25/382 (7%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWH-----GDNKSRLGLGNLEFVDEVFGPESL  381
             DPF+ S + G        D   YK  M  W       D  + L    ++F++++ GPES+
Sbjct  21    DPFKHSAISGFP------DFEAYKVDMPSWELSPTVRDKDNLLQKSEIKFLNQIQGPESI  74

Query  382   EFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF---  552
              FD LGRGPY G+ADGRI+ W G+   W+ FA  + N SE +C     +  P    +   
Sbjct  75    AFDPLGRGPYTGVADGRILFWDGEK--WKEFAYTSSNRSE-LC-----NPKPSPLSYLPN  126

Query  553   ESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHK  732
             E  CGRPLGLRFDK TGDLYIADAY GL  VGP+GG+AT L T  EG P+ F NDLDI  
Sbjct  127   EHICGRPLGLRFDKNTGDLYIADAYLGLFKVGPEGGLATSLVTEAEGVPLRFTNDLDIDD  186

Query  733   NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDH  912
              G+I+FTD+S  Y R N   ++   E++GRLL+Y+P T +  V++ ++ FPNGV  S D 
Sbjct  187   EGNIYFTDSSSIYQRRNFMQLVFSSESSGRLLKYNPHTKEATVLVRNIQFPNGVSLSNDG  246

Query  913   SFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQE  1092
             SFL+F E    RL KYW++G K+G +EV A LPGFPDNVR N+ G++WVAI C R+    
Sbjct  247   SFLVFCEGCLGRLHKYWLKGEKAGTSEVFAILPGFPDNVRTNKDGEFWVAIHCRRSIYAH  306

Query  1093  VLINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLV  1266
             VL  +P  R    +LP+   +QYL    G K++ ++  +   G++L VLED  G V++ V
Sbjct  307   VLGLYPKLRKFLLKLPISSKIQYLLHVGG-KLHAIVVKYSPEGKLLQVLEDSEGKVVRAV  365

Query  1267  SEVREVDGKLWIGTVAHNHIAT  1332
             SEV E DGKLW+G+V    +A 
Sbjct  366   SEVEERDGKLWMGSVLMPFVAV  387



>gb|KEH29729.1| strictosidine synthase family protein [Medicago truncatula]
Length=391

 Score =   314 bits (805),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 168/375 (45%), Positives = 236/375 (63%), Gaps = 10/375 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +    +F   K D+  + EV +    D  + L    + F+++V GPES+ FD 
Sbjct  21    DPFKHSTIANFPEFEAKKVDMPDWSEVPK--DKDEHNLLQKSEIRFLNQVQGPESIVFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
             LGRGPY G+ADGRI+ W G    W  FA  +PN S  +C    ++T     K E  CGRP
Sbjct  79    LGRGPYTGVADGRILFWNG--LSWVDFAYTSPNRS--LCNPIANATPFSYVKTEHICGRP  134

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRFDKKTG+LYIADAY GLL VGP+GG+AT LAT  EG P+ F ND+D+   G+++FT
Sbjct  135   LGLRFDKKTGELYIADAYLGLLKVGPEGGLATSLATEAEGVPLRFTNDVDVDSEGNVYFT  194

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             ++S  Y R N   ++  G+ +G++L+Y+P T +T V++ ++ FPNG+  S+D SF +F E
Sbjct  195   ESSSIYQRRNFMQLVFSGDDSGKVLKYNPATKETTVLVRNVQFPNGISLSKDCSFFVFCE  254

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
              +  RL KYW++G K G +E++A LPG PDNVR NE G +WVA+ C R+        +P 
Sbjct  255   GSIGRLRKYWLKGEKDGTSEILAILPGAPDNVRVNEDGDFWVALHCRRSMFAYYTGLYPK  314

Query  1114  TRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
              R    +LP+P   QYL +  G K++ VI  +   G++L +LED  G V++ VSEV E D
Sbjct  315   IRKSILKLPIPTKNQYLFQIGG-KLHGVIVKYSPEGKLLQILEDSEGKVVRAVSEVEEKD  373

Query  1288  GKLWIGTVAHNHIAT  1332
             G+LWIG+V    IA 
Sbjct  374   GQLWIGSVLMPFIAV  388



>ref|XP_011037298.1| PREDICTED: strictosidine synthase 3-like [Populus euphratica]
Length=391

 Score =   314 bits (804),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/369 (45%), Positives = 240/369 (65%), Gaps = 13/369 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DP++ S + G  +F+  + ++ P+  + +    D ++ L    ++F++++ GPES+ FD 
Sbjct  21    DPWKQSAISGFPEFKSFEIEMPPWSLLPK--EKDEENLLQRSEIKFLNQIQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRI+ +  D   W  FA  + N SE IC       +P  + K E  CGR
Sbjct  79    LGRGPYTGVADGRILFY--DGQKWTDFAYTSSNRSE-ICN---PQPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L+   EG P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE +GR+L+Y+P T +T V++ +L FPNGV  S+D SF +F 
Sbjct  193   TDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL K+W++G K+G +EV+A LPGFPDNVR NE+G +WVA+ C R+    +   +P
Sbjct  253   EGSIGRLRKHWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSFYTHINAQYP  312

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R+   +LP+P  + YL +  G     V+  +   G++L +LED  G V+K +SEV E 
Sbjct  313   KLRTFLLKLPIPAKIHYLLQVGGWPHGLVVK-YSPEGKLLQILEDSQGKVVKAISEVEEK  371

Query  1285  DGKLWIGTV  1311
             DGKLW+G+V
Sbjct  372   DGKLWMGSV  380



>ref|XP_011090280.1| PREDICTED: protein STRICTOSIDINE SYNTHASE-LIKE 11-like [Sesamum 
indicum]
Length=449

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 172/377 (46%), Positives = 242/377 (64%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DP   S V G   F   K ++  + E+ +ER   D ++ L    ++F+++V GPES+ FD
Sbjct  79    DPLNHSAVSGFPNFETFKVEMPAWSEIPVER---DRENLLQKSEIKFLNQVQGPESVAFD  135

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+A G +V W G+N  W  FA  + N S    GL     +P  + K E  CG
Sbjct  136   PAGRGPYTGVAGGTVVFWDGEN--WTDFAYTSANRS----GLCDPKPSPVSYLKNEHICG  189

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TGDLYIADAY+GL+ VGP+GG+AT L T  EG P+ F NDLDI   G+++
Sbjct  190   RPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLATSLTTQAEGIPLGFTNDLDIDDEGNVY  249

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S  Y R N   ++  GE +GRLL+YDP T +T V++ +L FPNGV  S+D SF +F
Sbjct  250   FTDSSSNYRRRNFMQLLFSGEDSGRLLKYDPYTKETTVLVRNLQFPNGVSLSKDGSFFVF  309

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E +  RL KYW++G K+G +EV+A LPG+PDNVR NEKG++WVAI C R+    +   +
Sbjct  310   CEGSIGRLRKYWLKGEKAGTSEVMAVLPGYPDNVRTNEKGEFWVAIHCRRSIYSHLSGLY  369

Query  1108  PWTRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R +  +LP+P +  +L +  G + + +I  +   G+++ VLED+ G V+K VSEV E
Sbjct  370   PRVRKLLLKLPIPAKFHFLMQIGG-RPHGIIVKYSPEGKLVTVLEDRQGKVVKAVSEVEE  428

Query  1282  VDGKLWIGTVAHNHIAT  1332
              DG+LW+G+V    +A 
Sbjct  429   KDGELWMGSVLMPFLAV  445



>ref|XP_010685469.1| PREDICTED: strictosidine synthase 3-like [Beta vulgaris subsp. 
vulgaris]
Length=394

 Score =   313 bits (803),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 220/342 (64%), Gaps = 9/342 (3%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D ++ L   +++FV ++ GPESL FD LGRGPY G+ADGRIV W G N  W  FA  + N
Sbjct  52    DPQNLLQNSDVKFVGQIQGPESLAFDPLGRGPYTGIADGRIVFWDGHN--WTDFAFTSAN  109

Query  493   WSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIAT  669
              SE  C       +P  + K E  CGRPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT
Sbjct  110   RSE--CD---PQPSPLAYMKNEHICGRPLGLRFDKKTGDLYIADAYFGLMKVGPEGGVAT  164

Query  670   PLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTG  849
              LAT   G P++F NDLDI   G+++FTD+S +Y R N   +   GE  GR+L+YDP T 
Sbjct  165   SLATEAGGVPLIFTNDLDIDAEGNVYFTDSSAQYQRRNFMQLAFSGEDGGRVLKYDPVTK  224

Query  850   KTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNV  1029
             +T V+L+++ FPNG+  S+D SF L  E +  RL +YW++G K+G +EV A LPGFPDN+
Sbjct  225   QTTVLLNNIQFPNGITLSKDGSFFLVCEGSLGRLRRYWLKGEKAGTSEVFAILPGFPDNI  284

Query  1030  RANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQY-LARFAGMKMYTVISLFD  1206
             R N+ G +WVA+ C R     VL   P  R    RLP+  +Y    F G   +  I  + 
Sbjct  285   RTNKDGDFWVALHCRRNLANYVLATWPKFRDFVLRLPIKAKYQFLIFIGGWPHGAILKYS  344

Query  1207  QNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
               GE+L +LED+ G V+K VSEV E DG+LWIG+V    +A 
Sbjct  345   PEGELLQILEDRPGKVVKAVSEVEEHDGRLWIGSVLMPFVAV  386



>ref|XP_006361111.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Solanum tuberosum]
Length=391

 Score =   313 bits (802),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 239/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGGQK-FRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +   K F+  + D   + E+ +E+   D ++ L    ++F++++ GPES+ FD
Sbjct  21    DPFKHSAISEIKDFKAYRVDPPAWSEIPVEK---DTQNLLQKSEIKFLNQIQGPESIAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGRIV W G+   W  FA  + N S    GL     +P  + + E  CG
Sbjct  78    PKGRGPYTGIADGRIVWWDGEK--WTDFAYTSANRS----GLCDPKPSPLSYLENEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TGDLYIADAY+GL+ VGP+GG+A  L T  EG P+ F NDLDI   G+++
Sbjct  132   RPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLAETLTTEAEGVPLRFTNDLDIDDEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N+ L++   E +GR+L+Y+P T +T  ++ +L FPNG+  S+D SF +F
Sbjct  192   FTDSSTKYQRRNYMLLVYSAEDSGRVLKYNPNTKQTTALVRNLQFPNGLSLSKDGSFFVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E    RL KYW++G K+G  EV+A LPG+PDNV  NE+G++WVAI C RT    +   +
Sbjct  252   CEGAKGRLQKYWLKGEKAGTLEVMAVLPGYPDNVSTNERGEFWVAIHCRRTIYSYINSIY  311

Query  1108  PWTRSVYFRLPLPMQYLARF-AGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             P  R    +LP+P++  A    G K   ++  +   G++L +LED+ G V++ VSEV E 
Sbjct  312   PQLRLFLLKLPIPVKLRALLHLGGKQPAIVVKYSPEGKLLQILEDEEGKVVRAVSEVEEK  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  372   DGKLWMGSVLMPFIAV  387



>ref|XP_004241357.2| PREDICTED: strictosidine synthase 3-like, partial [Solanum lycopersicum]
Length=420

 Score =   314 bits (804),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/376 (44%), Positives = 242/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGGQK-FRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +   K F+  + D   + E+ +E+   D ++ L    ++F++++ GPES+ FD
Sbjct  50    DPFKHSAISEIKDFKAYRVDPPAWSEIPVEK---DTQNLLQKSEIKFLNQIQGPESIAFD  106

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGRIV W G+   W  FA  + N S    GL     +P  + + E  CG
Sbjct  107   PKGRGPYTGIADGRIVLWDGEK--WTDFAYTSANRS----GLCDPKPSPLSYLENEHICG  160

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTGDLYIADAY+GL+ VGP+GG+A  L T  EG P++F NDLD+   G+++
Sbjct  161   RPLGLRFDKKTGDLYIADAYFGLMKVGPEGGLAETLTTEAEGVPLVFTNDLDVDDEGNVY  220

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N+ L++   E +GR+L+Y+  T +T V++ +L FPNG+  S+D SF +F
Sbjct  221   FTDSSTKYQRRNYMLLVYSAEDSGRVLKYNSNTKQTTVLVRNLQFPNGLSLSKDGSFFVF  280

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E    RL KYW++G K+G  EV+A LPG+PDNV  NE+G++WVAI C RT    +   +
Sbjct  281   CEVAKGRLQKYWLKGEKAGTFEVMAVLPGYPDNVSTNERGEFWVAIHCRRTIYSYINSIY  340

Query  1108  PWTRSVYFRLPLPMQYLARF-AGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             P  R    +LP+P++  A    G K+  ++  ++  G++L +LED+ G V++ VS+V E 
Sbjct  341   PQLRLFLLKLPIPVKLRALLHLGGKLPAIVVKYNPEGKLLRILEDEEGKVVRAVSDVEEK  400

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  401   DGKLWMGSVLMPFIAV  416



>ref|XP_010488915.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   313 bits (801),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 170/380 (45%), Positives = 236/380 (62%), Gaps = 12/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F   K D+ P   +  ER   D  + L    + F++EV GPES+ FD
Sbjct  22    DPFNHSSISKFPDFETYKIDMPPLSSLPKER---DRLNLLQNSQIRFLNEVQGPESIAFD  78

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W G  + W  FA  + N S+++C      +     K E  CGR
Sbjct  79    PLGRGPYTGVADGRILFWNG--SLWTDFAYTSINRSKELCD--PKPSLLDYLKDEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY G++ VGP+GG+AT L T  +G P+ F NDLDI   G+++F
Sbjct  135   PLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSLTTEADGVPLRFTNDLDIDDEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE TGR+L+Y+P T +T  ++ +L FPNG+   +D SF +F 
Sbjct  195   TDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSFFIFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+   R     V+ +HP
Sbjct  255   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVMAHHP  314

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V+  + + G+VL VLED  G V+K VSEV E 
Sbjct  315   RVRKFFLKLPISVKFQYLLQVGGWP-HGVVVKYSEEGKVLKVLEDSQGKVVKAVSEVEEK  373

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  374   DGKLWMGSVLMSFIAVYDLP  393



>gb|KHG12177.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=403

 Score =   313 bits (801),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 241/388 (62%), Gaps = 25/388 (6%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +     F   K D+ P++ V      DN   L    ++F+++V GPES+ FD 
Sbjct  21    DPFKHSAISEFPDFESYKVDLPPWELVPTDRDKDN--LLQKSEIKFLNQVQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGR++ W G N  W+ FA  + N SE IC       +P+ +   E  CGR
Sbjct  79    LGRGPYTGVADGRVLFWDGQN--WKDFAYASSNRSE-ICN---PKPSPQSYLPNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDK TGDLYIADAY GL  VGP+GG+ATPL T V+G P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFDKNTGDLYIADAYLGLFKVGPEGGLATPLVTEVDGVPLRFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRV------------NHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             TD+S K+ R                 ++   E +GRLL+Y+  T +T V++ +L FPNGV
Sbjct  193   TDSSSKFQRSFETAGSVYWKEDVEISLVFSSENSGRLLKYNLYTKETAVLVRNLQFPNGV  252

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+D SFL+F E    RL+KYW++G K+G TEV A LPGFPDNVR N++G++WVAI C 
Sbjct  253   SLSKDGSFLIFCEGCPGRLLKYWLKGEKAGSTEVFAILPGFPDNVRTNKEGEFWVAIHCR  312

Query  1075  RTRIQEVLINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHG  1248
             R     ++  +P  R    +LP+   +QYL +  G K++ ++  +  +G++L VLED  G
Sbjct  313   RFTYAHIMGLYPKLRKFILKLPISAKIQYLLQIGG-KLHGIVVKYSPDGKLLQVLEDSEG  371

Query  1249  DVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              V+K VSEV E DGKLW+G+V    +A 
Sbjct  372   KVVKAVSEVEERDGKLWLGSVLMPFVAV  399



>ref|XP_006826427.1| hypothetical protein AMTR_s00004p00163660 [Amborella trichopoda]
 gb|ERM93664.1| hypothetical protein AMTR_s00004p00163660 [Amborella trichopoda]
Length=388

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 171/376 (45%), Positives = 233/376 (62%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF   P+    +F   + D  P  +V      D ++RL    ++F++++ GPESL FD 
Sbjct  21    DPFGHRPIKDFPEFEAYRVDFPPQSQVPNL--NDPENRLQKSEIKFLNKIQGPESLAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
              GRGPY G+ADGRI+ W G    W  FA+ +PN SE IC       +P  + K E  CGR
Sbjct  79    QGRGPYTGVADGRILFWNG--YSWTEFAVTSPNRSE-ICD---PKPSPLAYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF+KKTG+LYI DAY+GLL VGP+GG+ATPL + V G P+ F NDLDI ++G+++F
Sbjct  133   PLGLRFNKKTGELYICDAYFGLLKVGPEGGLATPLVSEVNGVPLKFTNDLDIDEDGNVYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++   E +GR+ +YD  T +  V+L  + F NG+  S+D SF +  
Sbjct  193   TDSSTTYQRRNFMQLIFSSEGSGRVFKYDAITKEVTVLLSGIQFANGLSLSKDGSFFVVC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL +YW++G K G ++++A LPGFPDNVR NEKG +WVA+ C RT        +P
Sbjct  253   ECVPGRLRRYWLKGKKVGTSDMLAVLPGFPDNVRTNEKGDFWVAMHCRRTFYAYFTGLYP  312

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R     LP+P   QYL +  G   + +I  +  NGEVL+VLED+ G V+K VSEV E 
Sbjct  313   KIRKFILNLPIPTKYQYLLQVGGWP-HAIIIKYSPNGEVLEVLEDRSGKVVKAVSEVEEH  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  372   DGKLWMGSVLMPFIAV  387



>ref|XP_009587970.1| PREDICTED: strictosidine synthase 3-like [Nicotiana tomentosiformis]
Length=391

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/376 (45%), Positives = 239/376 (64%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGGQK-FRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DP + S +   K F+  K +   + E+ +E+   D K+ L    ++F++++ GPES+ FD
Sbjct  21    DPLKQSAISESKDFKAYKVEAPVWSEIPVEK---DTKNLLQKSEIKFLNQIQGPESIAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGRIV W  D   W  FA  + N S    GL      P  + K E  CG
Sbjct  78    PKGRGPYTGIADGRIVFW--DGQKWTDFAYTSANRS----GLCDPKPLPLSYLKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK T DLYIADAY+G++ VGP+GG+A  L T  EG P+ F NDLDI   G+I+
Sbjct  132   RPLGLRFDKTTSDLYIADAYFGVMKVGPEGGLAETLTTEAEGVPLGFTNDLDIDDEGNIY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N  L++   E +GR+L+YDP T  T V++ +L FPNG+  S+D SFL+F
Sbjct  192   FTDSSTKYQRRNFMLLVYSAEDSGRVLKYDPSTKHTTVLIRNLQFPNGLSLSKDGSFLVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E    RL KYW++G K+G  EV+A LPG+PDN+RANE+G++WVAI C RT    +   +
Sbjct  252   CEGAKGRLQKYWLKGEKAGTLEVMAVLPGYPDNIRANERGEFWVAIHCRRTIYSYINSIY  311

Query  1108  PWTRSVYFRLPLPMQYLARFA-GMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             P  R +  +LP+P++  +    G +++ ++  +  +G++L +LED  G V++ VSEV E 
Sbjct  312   PKLRLLLLKLPIPVKLRSLLQIGGRLHAIVVKYSPDGKLLQILEDGEGKVVRAVSEVEER  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    IA 
Sbjct  372   DGKLWMGSVLMPFIAV  387



>ref|XP_009623916.1| PREDICTED: strictosidine synthase 3-like [Nicotiana tomentosiformis]
Length=391

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/377 (44%), Positives = 241/377 (64%), Gaps = 15/377 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +    +F   K ++  + E  +E+   D+++ L    ++F++++ GPES+ FD
Sbjct  21    DPFKHSAISEFPEFESFKVEMPAWSEFPVEK---DSQNLLQKSEIKFLNQIQGPESIAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGR+V W G+   W  FA  + N S    GL     +P  + K E  CG
Sbjct  78    PQGRGPYTGIADGRVVFWDGEK--WNDFAYTSANRS----GLCDPKPSPMSYLKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TGDLYIADAY+GL+ VGP+GG+A  L T  EG  + F NDLD+   G+++
Sbjct  132   RPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLAESLTTEAEGVRLGFTNDLDVDDEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S  Y R N   ++   E +GR+L+Y+P T +T V++ +L FPNG+  S+D SF +F
Sbjct  192   FTDSSTTYQRRNFMQLVFSAEDSGRVLKYNPRTKETTVLIHNLQFPNGLSLSKDGSFFIF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
              E +  RL KYW++G K+  TEVIA LPG+PDNVRANE+ ++WVAI C RT    +   +
Sbjct  252   CEGSKGRLRKYWLKGEKAATTEVIAILPGYPDNVRANERNEFWVAIHCRRTIYSYLNAIY  311

Query  1108  PWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVRE  1281
             P  R    +LP+   +QYL    G +++ V+  +   G++L +LED+ G V+K VSEV E
Sbjct  312   PPLRQFLLKLPVSAKLQYLMHIGG-RLHAVVVKYSPEGKLLQILEDRQGKVVKAVSEVEE  370

Query  1282  VDGKLWIGTVAHNHIAT  1332
              +GKLW+G+V  + I+ 
Sbjct  371   REGKLWMGSVLMSFISV  387



>ref|XP_011044611.1| PREDICTED: strictosidine synthase 3-like [Populus euphratica]
Length=391

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 239/369 (65%), Gaps = 13/369 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DP++ S + G   F+  + ++ P+  + +    D ++ L    ++F++++ GPES+ FD 
Sbjct  21    DPWKHSAISGFPDFKSFEIEMPPWSLLPK--EKDEENLLQGSEIKFLNQIQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY G+ADGRI+ +  D   W  FA  + N SE +C       +P  + K E  CGR
Sbjct  79    LGRGPYTGVADGRILFY--DGQKWTDFAYTSSNRSE-MCN---PQPSPLSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY+GL+ VGP+GG+AT L+   EG P+ F NDLDI   G+I+F
Sbjct  133   PLGLRFDKKTGDLYIADAYFGLMKVGPEGGLATSLSNEAEGIPLRFTNDLDIDDEGNIYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  Y R N   ++  GE +GR+L+Y+P T +T V++ +L FPNGV  S+D SF +F 
Sbjct  193   TDSSTTYQRRNFMQLVFSGENSGRVLKYNPTTKETTVLVRNLQFPNGVSLSKDGSFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL K+W++G K+G +EV+A LPGFPDNVR NE+G +WVA+ C R+    +   +P
Sbjct  253   EGSIGRLRKHWLKGEKAGTSEVLAILPGFPDNVRTNEEGNFWVAVHCRRSFYTHINAQYP  312

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R+   +LP+P  + YL +  G     V+  +   G++L +LED  G V+K +SEV E 
Sbjct  313   KLRTFLLKLPIPAKIHYLLQVGGWPHGLVVK-YSPEGKLLQILEDSQGKVVKAISEVEEK  371

Query  1285  DGKLWIGTV  1311
             DGKLW+G+V
Sbjct  372   DGKLWMGSV  380



>ref|XP_008453519.1| PREDICTED: strictosidine synthase 3 [Cucumis melo]
Length=402

 Score =   311 bits (796),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 172/375 (46%), Positives = 239/375 (64%), Gaps = 13/375 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F     ++  + ++  ER   D+++ L    + F D+V GPES+ FD
Sbjct  32    DPFKHSAIANFPDFETYYVELPSWSQIPTER---DSENLLQKSTIMFKDQVQGPESVAFD  88

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
             +LGRGPY G+ADGR++ W G++  W  FA  +PN SE IC      +     K E  CGR
Sbjct  89    SLGRGPYTGVADGRVLFWNGES--WTDFAYTSPNRSE-ICD--PKPSILGYAKNEHICGR  143

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTG+LYIADAY+GL+ VGP+GG+AT L+T  EG P  F NDLD+   G+++F
Sbjct  144   PLGLRFDKKTGNLYIADAYFGLMKVGPEGGLATSLSTEAEGVPFKFINDLDLDDEGNVYF  203

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S KY+R N   ++   E TGRLL+Y+  TG+T V++  L FPNGV  S+D SF LF 
Sbjct  204   TDSSTKYHRRNFIQVVFSAENTGRLLKYNAATGETTVLVRDLYFPNGVSLSKDGSFFLFC  263

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G TE+ A LPGFPDNVR N+KG +WVA+    + +  +   +P
Sbjct  264   EGGKGRLRKYWLKGEKAGTTELFAILPGFPDNVRTNDKGDFWVAVHSRHSTLAHLEAKYP  323

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R +  +LP+   +Q+L    G + + V+  +   G++L +LED  G V+K VSEV E 
Sbjct  324   KLRKLLLKLPISAKIQFLLHVGG-RPHAVVVKYSPEGKLLQILEDTEGKVVKAVSEVEEK  382

Query  1285  DGKLWIGTVAHNHIA  1329
             DGKLWIG+V  + IA
Sbjct  383   DGKLWIGSVLMSFIA  397



>ref|NP_680189.1| strictosidine synthase family protein [Arabidopsis thaliana]
 emb|CAC34495.1| putative strictosidine synthase-like [Arabidopsis thaliana]
 gb|AAT44971.1| At5g22020 [Arabidopsis thaliana]
 gb|ABF59040.1| At5g22020 [Arabidopsis thaliana]
 gb|AED92969.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=395

 Score =   310 bits (795),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 221/344 (64%), Gaps = 6/344 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F +++ GPES+ FD+LGRGPY G+ADGR++ W G+   W  FA  
Sbjct  54    WERDSQNSLQKSKILFFNQIQGPESVAFDSLGRGPYTGVADGRVLFWDGEK--WIDFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N SE IC     + +    + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSNRSE-ICDPKPSALS--YLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   ATPLVTEAEGVPLGFTNDLDIADDGTVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPV  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++ +L FPNGV  S D SF +F E     L +YW++G K+G T+V A LPG PD
Sbjct  229   AKKAVVLVSNLQFPNGVSISRDGSFFVFCEGDIGSLRRYWLKGEKAGTTDVFAYLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVISL  1200
             NVR N+KG++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + ++  
Sbjct  289   NVRTNQKGEFWVALHCRRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVK  348

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +   G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  349   YSPEGKLMHVLEDSEGKVVRSVSEVEEKDGKLWMGSVLMNFVAV  392



>dbj|BAD95409.1| putative strictosidine synthase - like [Arabidopsis thaliana]
Length=394

 Score =   310 bits (794),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 221/344 (64%), Gaps = 6/344 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F +++ GPES+ FD+LGRGPY G+ADGR++ W G+   W  FA  
Sbjct  53    WERDSQNSLQKSKILFFNQIQGPESVAFDSLGRGPYTGVADGRVLFWDGEK--WIDFAYT  110

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N SE IC     + +    + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  111   SSNRSE-ICDPKPSALS--YLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  167

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  168   ATPLVTEAEGVPLGFTNDLDIADDGTVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPV  227

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++ +L FPNGV  S D SF +F E     L +YW++G K+G T+V A LPG PD
Sbjct  228   AKKAVVLVSNLQFPNGVSISRDGSFFVFCEGDIGSLRRYWLKGEKAGTTDVFAYLPGHPD  287

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVISL  1200
             NVR N+KG++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + ++  
Sbjct  288   NVRTNQKGEFWVALHCRRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVK  347

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +   G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  348   YSPEGKLMHVLEDSEGKVVRSVSEVEEKDGKLWMGSVLMNFVAV  391



>ref|XP_010090518.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
 gb|EXB39667.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
Length=409

 Score =   310 bits (794),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 174/395 (44%), Positives = 244/395 (62%), Gaps = 33/395 (8%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F   K +++P+ ++  ER   D ++ L    ++F+++V GPES+ FD
Sbjct  21    DPFKHSAISDFPDFETYKIELSPWSDLPKER---DRENLLQRSEIKFLNQVQGPESVAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
              LGRGPY G+ADGRI+ W G +  W  FA  + N SE +C       +P  + K E  CG
Sbjct  78    PLGRGPYTGVADGRILFWNGRS--WTDFAYTSSNRSE-LCD---PKPSPLSYLKVEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDKKTGDLYIADAY GLL VGP+GG+AT LAT  EG P+ F NDLD+ + G+++
Sbjct  132   RPLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLATEAEGVPLRFTNDLDMDEEGNVY  191

Query  748   FTDTSQKYNRV------------------NHFLIMLEGEATGRLLRYDPPTGKTHVVLDS  873
             FTD+S KY R                   N   ++  GE +GR+L+Y+P T +T V++ +
Sbjct  192   FTDSSTKYQRSVSFYSSILPDIYAELSSRNFLQLVFSGEDSGRVLKYNPKTKETTVLVRN  251

Query  874   LAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQY  1053
             + F NG+  S+D SF LF E +  RL +YW++G K+G +EV A LPGFPDNVR NEKG++
Sbjct  252   VQFANGLSLSKDGSFFLFCEGSLGRLRRYWLKGEKAGTSEVFAILPGFPDNVRTNEKGEF  311

Query  1054  WVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLD  1227
             WVAI C RT    V   +P  R    + P+   +QYL    G + + VI+ +   G++L 
Sbjct  312   WVAIHCHRTMNNYVYALYPKLRKFLLKFPVSAKLQYLIHIGGWQ-HGVIAKYSPEGKLLQ  370

Query  1228  VLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +LED  G V++ +SEV E DGKLW+G+V    +A 
Sbjct  371   ILEDSQGKVVRAISEVEERDGKLWMGSVLMPFMAV  405



>ref|XP_002972283.1| hypothetical protein SELMODRAFT_231921 [Selaginella moellendorffii]
 gb|EFJ26369.1| hypothetical protein SELMODRAFT_231921 [Selaginella moellendorffii]
Length=380

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 172/373 (46%), Positives = 225/373 (60%), Gaps = 22/373 (6%)
 Frame = +1

Query  217   DPFELSP-VGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGL-GNLEFVDEVFGPESLEFD  390
             DP  + P VG   FR +  +  P    +  + GD  +RL     + F  ++ GPES+ FD
Sbjct  22    DPLRIGPTVGFTDFRAIHVE-QPSPAQLGDFQGDPHNRLAARAEVRFSGQICGPESIAFD  80

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ DGR++RW  +   W  FA+ + N S   C    D   P     E  CGR
Sbjct  81    PQGRGPYTGICDGRVLRWDEEQQAWIEFAVTSSNRSA--CA-PKDPPRPNLAN-EHICGR  136

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF K + +LYIADAY GLLVVG  GG+ATPL T VEG+P+LF NDLD+ ++G ++F
Sbjct  137   PLGLRFKKSSSELYIADAYKGLLVVGSQGGLATPLVTEVEGQPLLFTNDLDLDEDGRVYF  196

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             T TS KY R N  L +LEG+ TG LL+YDP T +  V+L  L FPNGV  S+D+SFL+F 
Sbjct  197   TVTSSKYQRRNFILPILEGDDTGLLLKYDPSTKQVSVLLRGLQFPNGVSMSKDYSFLVFA  256

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             ETTN +L +YW++GPK+G  E+ A LPG PDNVR NE G++WVAI   R           
Sbjct  257   ETTNGKLTRYWLKGPKAGTPELFAILPGHPDNVRTNENGEFWVAIHALRN----------  306

Query  1111  WTRSVYF-RLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVD  1287
               R V +  LP+P + +   AG   Y +I  +D +G+++D LED  G V    SE  E D
Sbjct  307   -PRCVSWGPLPIPAKMI---AGGSPYALILKYDADGKLIDALEDHKGQVASYASEAEEHD  362

Query  1288  GKLWIGTVAHNHI  1326
             G LW+GTV  N I
Sbjct  363   GHLWLGTVLLNKI  375



>ref|XP_009797832.1| PREDICTED: strictosidine synthase 3-like [Nicotiana sylvestris]
Length=391

 Score =   309 bits (792),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 236/378 (62%), Gaps = 17/378 (4%)
 Frame = +1

Query  217   DPFELSPVGGQK-FRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DP + S +   K F+  K ++  + E+ +E+   D  + L    ++F++++ GPES+ FD
Sbjct  21    DPLKQSAISEFKDFKTYKVEVPSWSEIPVEK---DTLNLLQKSEIKFLNQIQGPESIAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF---ESQ  561
               GRGPY G+ADGRIV W  D   W  FA  + N S      G     P    +   E  
Sbjct  78    PKGRGPYTGIADGRIVLW--DGQKWTDFAYTSANRS------GNCDPKPSPLSYLANEHI  129

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRFDK TGDLYIADAY+G++ VG +GG+A  L    EG P+ F NDLDI   G+
Sbjct  130   CGRPLGLRFDKTTGDLYIADAYFGVMKVGLEGGLAETLTNEAEGVPLGFTNDLDIDDEGN  189

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             I+FTD+S KY R N  L++   E +GR+L+YDP T +T V+L +L FPNG+  S+D SF 
Sbjct  190   IYFTDSSTKYQRRNFMLLVYSAEDSGRVLKYDPSTKQTTVLLRNLQFPNGLSLSKDRSFF  249

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             +F E    RL KYW++G K+G +EV+A LPG+PDN+RANE+G++WVAI C RT    +  
Sbjct  250   VFCEGAKGRLQKYWLKGDKAGTSEVMAILPGYPDNIRANERGEFWVAIHCRRTIYSYINS  309

Query  1102  NHPWTRSVYFRLPLPMQYLARF-AGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
              +P  R    +LP+P++  +    G +++ ++  +  +G++L +LED  G V++ +SEV 
Sbjct  310   IYPKLRLFLLKLPIPVKLRSLLHLGGRLHAIVVKYSPDGKLLQILEDGEGKVVRAISEVE  369

Query  1279  EVDGKLWIGTVAHNHIAT  1332
             E DGKLW+G+V    IA 
Sbjct  370   ERDGKLWMGSVLMPFIAV  387



>ref|XP_002874041.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50300.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=395

 Score =   309 bits (792),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 220/344 (64%), Gaps = 6/344 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F+++V GPES+ FD+LGRGPY G+ADGR++ W G    W  FA  
Sbjct  54    WERDSQNSLQKSKILFLNQVQGPESVAFDSLGRGPYTGVADGRVLFWNGQK--WIDFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N SE IC     + +    + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSNRSE-ICDPKPSALS--YLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             A PL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   AMPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPI  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++ +L FPNGV  S+D SF +F E     L +YW++G K+G T+V A LPG PD
Sbjct  229   AKKAVVLVSNLQFPNGVSISKDGSFFVFCEGDIGSLRRYWLKGEKAGTTDVFAFLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVISL  1200
             NVR NE G++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + ++  
Sbjct  289   NVRTNENGEFWVALHCRRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVVK  348

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +   G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  349   YSPEGKLMQVLEDSEGKVVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>ref|XP_002892459.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68718.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 234/380 (62%), Gaps = 13/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F+  K D+ P   +  ER   D ++ L    + F++EV GPES+ FD
Sbjct  20    DPFSHSSISKFPDFKTYKIDMPPLSSLPKER---DRENLLQNSEIRFLNEVQGPESIAFD  76

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ADGRI+ W G    W  FA  + N SE +C      +     K E  CGR
Sbjct  77    PQGRGPYTGVADGRILFWNGTR--WIDFAYTSNNRSE-LCD--PKPSLLDYLKDEDICGR  131

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY G++ VGP+GG+AT +    +G P+ F NDLDI   G+++F
Sbjct  132   PLGLRFDKKTGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDIDDQGNVYF  191

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE +GR+L+Y+P T +T  ++ +L FPNG+   +D SF +F 
Sbjct  192   TDSSSFFQRRKFMLLIVSGEDSGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSFFIFC  251

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+ C R     V+ +HP
Sbjct  252   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVMAHHP  311

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V   + + G+VL VLED  G V+K VSEV E 
Sbjct  312   RVRKFFLKLPISVKFQYLLQVGGWP-HAVAVKYSEEGKVLKVLEDSKGKVVKAVSEVEEK  370

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  371   DGKLWMGSVLMSFIAVYDLP  390



>ref|XP_007028511.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY09013.1| Calcium-dependent phosphotriesterase superfamily protein isoform 
1 [Theobroma cacao]
Length=369

 Score =   308 bits (788),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/322 (47%), Positives = 206/322 (64%), Gaps = 10/322 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             +D  FGPESL FD  G GPY G+ADGRI++W GD  GW  FA  + +          D  
Sbjct  46    LDSAFGPESLAFDANGDGPYSGVADGRILKWQGDAVGWTDFAFTSSHRE--------DCV  97

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
              P   + E  CGRPLGLRFDKKTGDLYIADAY+GL VVGP GG+AT L T  EG+P+ F 
Sbjct  98    RPFAPEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVGPAGGLATQLITEAEGQPLYFT  157

Query  712   NDLDIHK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             ND+DI + +  I+FTDTS  + R      +   + TGRLL+Y+  + +  V+L  LAF N
Sbjct  158   NDMDIDELDDVIYFTDTSTSFRRRQFLPSIFTTDKTGRLLKYNKSSKEVTVLLRGLAFAN  217

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D SF+L  ETT CR+++ W+ GP +G  EV + LPGFPDN+R N+KG++WVA+ 
Sbjct  218   GVALSKDSSFVLVAETTTCRILRLWLRGPNAGNVEVFSELPGFPDNIRRNKKGEFWVALH  277

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
               +  + ++ +++    +   +LPL  + L + F G K + +     +NGE+L+VLED  
Sbjct  278   AKKGLVAKLALSYSLFGNTVLKLPLSFKQLHSLFIGGKPHAIAVKLSENGEILEVLEDTE  337

Query  1246  GDVMKLVSEVREVDGKLWIGTV  1311
             G  M+ +SEV E DGKLWIG+V
Sbjct  338   GKTMRFISEVEEKDGKLWIGSV  359



>ref|XP_010458085.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=393

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 234/380 (62%), Gaps = 12/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F   K D+ P   +  ER   D  + L    + F++EV GPES+ FD
Sbjct  22    DPFNHSSISKFPDFETYKIDMPPLSSLPKER---DRLNLLQNSQIRFLNEVQGPESIAFD  78

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W G    W  FA  + N S+++C      +     K E  CGR
Sbjct  79    PLGRGPYTGVADGRILFWNGSR--WTDFAFTSINRSKELCD--PKPSLLDYLKDEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY G++ VGP+GG AT L T  +G P+ F NDLDI + G+++F
Sbjct  135   PLGLRFDKKTGDLYIADAYLGIMKVGPEGGFATSLTTEADGVPLRFTNDLDIDEEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE TGR+L+Y+P T +T  ++ +L FPNG+   +D SF +  
Sbjct  195   TDSSSVFQRRKFMLLIVSGEDTGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSFFICC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+   R     V+ ++P
Sbjct  255   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHGHRNIFTHVMAHYP  314

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V+  + + G+VL VLED  G V+K VSEV E 
Sbjct  315   RVRKFFLKLPISVKFQYLLQVGGWP-HGVVVKYSEEGKVLKVLEDSQGKVVKAVSEVEEK  373

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  374   DGKLWMGSVLMSFIAVYDLP  393



>ref|XP_003527512.1| PREDICTED: adipocyte plasma membrane-associated protein-like 
[Glycine max]
Length=441

 Score =   310 bits (794),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 170/376 (45%), Positives = 236/376 (63%), Gaps = 11/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ SP+     F   + D+  + EV      D  + L    ++F ++V GPES+ FD 
Sbjct  69    DPFQHSPIAHFPDFEVKRVDMPAWSEVPT--DQDKHNLLQKSEIKFANQVQGPESIAFDP  126

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
             LGRGPY GLADG IV W G +  W  FA  +PN SE IC   + S TP  + K E  CGR
Sbjct  127   LGRGPYTGLADGTIVFWNGHS--WLHFAYTSPNRSE-ICN-PIASATPFSYVKNEHICGR  182

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKKTGDLYIADAY+GLL VGP+GG+AT L T  EG P+ F ND+D+   G+++F
Sbjct  183   PLGLRFDKKTGDLYIADAYFGLLKVGPEGGLATSLVTEAEGIPLRFTNDVDVDTEGNVYF  242

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             T++S  Y R N   ++  G+ +GR+L+Y+  T +T V++ ++ FPNG+  S+D SF +F 
Sbjct  243   TESSALYPRRNFLQLVFSGDDSGRVLKYNLATKETTVLVRNIQFPNGISLSKDGSFFVFC  302

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E    RL KYW++G K+G +E++A LPG+PDNVR NE G +WVA+   R         +P
Sbjct  303   EGVVGRLRKYWLKGEKAGTSEILAILPGYPDNVRVNEDGDFWVALHSRRYMYAYYNGIYP  362

Query  1111  WTRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R +  +LP+P++  YL +  G +   VI  +   G++L +LED  G V+K VSEV E 
Sbjct  363   KMRKIILKLPIPIKIHYLLQIGGRQHAAVIR-YSPEGKLLQILEDSEGKVVKAVSEVEEK  421

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    +A 
Sbjct  422   DGKLWMGSVLMPFVAV  437



>emb|CDY16615.1| BnaC09g36580D [Brassica napus]
Length=395

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 221/344 (64%), Gaps = 6/344 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F ++V GPES+ FD LGRGPY G+ADGR++ W G+N  W  FA  
Sbjct  54    WERDSQNSLQGSKILFQNQVQGPESVAFDPLGRGPYTGVADGRVLFWNGEN--WTDFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N +E IC     + + +  + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSNRTE-ICDPKPSALSYQ--RNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   ATPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPI  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++  + FPNGV  S+D SF +F E     L +YW++G K+G ++V A LPG PD
Sbjct  229   AKKAVVLVSDVQFPNGVSISKDGSFFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVISL  1200
             NVR N+ G++WVA+ C R     ++  +P  R    RLP+  +    F  GMK + ++  
Sbjct  289   NVRTNKDGEFWVALHCRRNYYSYIMARNPKLRMFILRLPITARIHYMFQIGMKPHGLVVK  348

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +   G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  349   YSPEGKLVKVLEDSEGKVVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>ref|XP_009120693.1| PREDICTED: strictosidine synthase 3 [Brassica rapa]
Length=395

 Score =   308 bits (790),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/344 (46%), Positives = 220/344 (64%), Gaps = 6/344 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F D+V GPES+ FD LGRGPY G+ADGR++ W G+N  W  FA  
Sbjct  54    WERDSQNSLQGSKILFQDQVQGPESVAFDPLGRGPYTGVADGRVLFWNGEN--WTNFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N +E IC     + +    + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSNRTE-ICDPKPSALS--YLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             A PL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   AMPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSVSYQRRNFLQLVFSGDNTGRVLKYDPI  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++ ++ FPNGV  S+D SF +F E     L +YW++G K+G ++V A LPG PD
Sbjct  229   AKKAVVLVSNVQFPNGVSISKDGSFFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVISL  1200
             NVR N+ G++WVA+ C R     ++  +P  R    RLP+  +    F  GMK + ++  
Sbjct  289   NVRINKDGEFWVALHCRRNYYSYIMARNPKLRMFILRLPITARIHYMFQIGMKPHGLVVK  348

Query  1201  FDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             +   G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  349   YSPEGKLVKVLEDSEGKVVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>ref|XP_002308895.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
 gb|EEE92418.2| hypothetical protein POPTR_0006s03930g [Populus trichocarpa]
Length=387

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 213/326 (65%), Gaps = 22/326 (7%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
              FGPES  FD+LG+GPY  L+DGRIV+W G+  GW  FA+ +PN     C         K
Sbjct  67    AFGPESFAFDSLGKGPYASLSDGRIVKWQGNRKGWTDFAVASPN--RYAC---------K  115

Query  541   QWKF---ESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
             Q  F   E  CGRPLGL FD+  GDLYIADAY GLL VG  GG+AT + TH +G P+ F 
Sbjct  116   QQPFAHTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGTQGGLATKIVTHAQGIPLRFT  175

Query  712   NDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI   +G+I+FTD+S +Y R  +  ++L G+ +GRL++YDP   +  V+L +L FPN
Sbjct  176   NGLDIDQSSGAIYFTDSSSQYQRRQYLSVVLSGDKSGRLMKYDPVNKQVRVLLSNLTFPN  235

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D +F+L  ETT CR+++YW++  K+G  EV A L GFPDN++ + +G YWV ++
Sbjct  236   GVALSKDGNFILLAETTRCRILRYWIKTSKAGTVEVFAQLQGFPDNIKRSPRGGYWVGMN  295

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQY----LARFAGMKMYTVISLFDQNGEVLDVLE  1236
               R ++ E+L ++PW  +V  +LPL +      L+++ G  +   +S   +NG++L+V E
Sbjct  296   SRREKLSELLFSYPWIGNVLLKLPLDIAMLQSTLSKYRGSGLAVRLS---ENGDILEVFE  352

Query  1237  DKHGDVMKLVSEVREVDGKLWIGTVA  1314
             D  GD +K +SEV E DG+LWIG++A
Sbjct  353   DNDGDGLKSISEVMEKDGRLWIGSIA  378



>ref|XP_006305032.1| hypothetical protein CARUB_v10009397mg [Capsella rubella]
 gb|EOA37930.1| hypothetical protein CARUB_v10009397mg [Capsella rubella]
Length=390

 Score =   308 bits (788),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/380 (44%), Positives = 232/380 (61%), Gaps = 13/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F+  K D+ P   +  ER   D ++ L    + F++EV GPES+ FD
Sbjct  20    DPFHHSSISKFPDFQTYKIDMPPLSSLPKER---DRQNLLQNSEIRFLNEVQGPESIAFD  76

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ADGRI+ W G    W  FA  + N SE +C      +     K E  CGR
Sbjct  77    PQGRGPYTGVADGRILFWNGTR--WTDFAYTSNNRSE-LCD--PKPSLLDYLKDEHICGR  131

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDK TGDLYIADAY G++ VGP GG+AT L T  +G P+ F NDLDI   G+++F
Sbjct  132   PLGLRFDKNTGDLYIADAYLGIMKVGPQGGLATSLTTEADGLPLRFTNDLDIDDQGNVYF  191

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE +GR+L+Y+  T +T  ++ +L FPNG+   +D SF +F 
Sbjct  192   TDSSSFFQRRKFLLLIVSGEDSGRVLKYNAKTKETTTLVRNLQFPNGLSLGKDGSFFIFC  251

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+ C R     V+ +HP
Sbjct  252   EGSIGRLQKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVMAHHP  311

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V   + + G+VL VLED  G V+K VSEV E 
Sbjct  312   RVRKFFLKLPISVKFQYLLQVGGWP-HAVAVKYSEEGKVLKVLEDSQGKVVKAVSEVEEK  370

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  371   DGKLWMGSVLMSFIAVYDLP  390



>ref|XP_010427563.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=374

 Score =   307 bits (786),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 205/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N   ++C        P   
Sbjct  56    GPESIAFDPAGEGPYAGVSDGRVLKWRGESLGWTDFAFTSAN--REMC------VRPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKK+GDLYIADAY+GLL+VGP GG+A PL T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKSGDLYIADAYFGLLIVGPAGGLARPLVTEAEGQPFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               ++  I+FTDTS K+ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQDDVIYFTDTSAKFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTQDVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ ++ PW + +  RLP+    L + F G + +       ++GEVL+VLEDK G  ++
Sbjct  288   FAKLSLSQPWFKDLVLRLPISAPRLHSLFTGGRPHATAVKLSESGEVLEVLEDKEGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>gb|EYU22112.1| hypothetical protein MIMGU_mgv1a007437mg [Erythranthe guttata]
Length=407

 Score =   308 bits (789),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 236/376 (63%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +    +F  VK ++  +  +      D ++ L    ++F++++ GPES+ FD 
Sbjct  21    DPFDHSAISEFPEFESVKIEMPAWSSI--PVDKDPENMLQKSEIKFLNQIQGPESMAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGR  570
              GRGPY G+ADGRI+ W  D   W  FA  + N S    GL     +P  + K E  CGR
Sbjct  79    NGRGPYTGVADGRILFW--DGQKWTDFAYTSANRS----GLCDPKPSPMSYLKNEHICGR  132

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDK  GDLYIADAY GL+ VGP+GG+AT L+T  +G P+ F NDLDI  +G+++F
Sbjct  133   PLGLRFDKTNGDLYIADAYLGLMKVGPEGGLATSLSTEADGVPLGFTNDLDIDVDGNVYF  192

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S KY R N   ++  G+ +GRLL+YDP   +T V++ +L FPNGV  S+D SF +F 
Sbjct  193   TDSSIKYQRRNFLQLVFSGDDSGRLLKYDPSKKETTVLIRNLQFPNGVSLSKDGSFFVFC  252

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G TEV+A L G PDNVR N+ G +WVAI C R      L  +P
Sbjct  253   EGSLGRLSKYWLKGEKAGSTEVMAVLSGHPDNVRTNKDGDFWVAIHCRRYMYSHFLGLYP  312

Query  1111  WTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R V+ +LP+   + Y+ +  G +++ V+  ++  GE+L +LED  G V+K VSEV E 
Sbjct  313   KIRQVWLKLPISARLHYMMQIGG-RLHAVVVKYNAEGELLKILEDSSGKVVKAVSEVEEK  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             DG+LWIG+V    +A 
Sbjct  372   DGRLWIGSVLMPFLAV  387



>gb|KHN41250.1| Adipocyte plasma membrane-associated protein [Glycine soja]
Length=353

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/343 (47%), Positives = 222/343 (65%), Gaps = 8/343 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D  + L    ++F ++V GPES+ FD LGRGPY GLADG IV W G +  W  FA  +PN
Sbjct  12    DKHNLLQKSEIKFANQVQGPESIAFDPLGRGPYTGLADGTIVFWNGHS--WLHFAYTSPN  69

Query  493   WSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIAT  669
              SE IC   + S TP  + K E  CGRPLGLRFDKKTGDLYIADAY+GLL VGP+GG+AT
Sbjct  70    RSE-ICN-PIASATPFSYVKNEHICGRPLGLRFDKKTGDLYIADAYFGLLKVGPEGGLAT  127

Query  670   PLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTG  849
              L T  EG P+ F ND+D+   G+++FT++S  Y R N   ++  G+ +GR+L+Y+  T 
Sbjct  128   SLVTEAEGIPLRFTNDVDVDTEGNVYFTESSALYPRRNFLQLVFSGDDSGRVLKYNLATK  187

Query  850   KTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNV  1029
             +T V++ ++ FPNG+  S+D SF +F E    RL KYW++G K+G +E++A LPG+PDNV
Sbjct  188   ETTVLVRNIQFPNGISLSKDGSFFVFCEGVVGRLRKYWLKGEKAGTSEILAILPGYPDNV  247

Query  1030  RANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQ--YLARFAGMKMYTVISLF  1203
             R NE G +WVA+   R         +P  R +  +LP+P++  YL +  G +   VI  +
Sbjct  248   RVNEDGDFWVALHSRRYMYAYYNGIYPKMRKIILKLPIPIKIHYLLQIGGRQHAAVIR-Y  306

Query  1204  DQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
                G++L +LED  G V+K VSEV E DGKLW+G+V    +A 
Sbjct  307   SPEGKLLQILEDSEGKVVKAVSEVEEKDGKLWMGSVLMPFVAV  349



>ref|XP_010420991.1| PREDICTED: adipocyte plasma membrane-associated protein [Camelina 
sativa]
Length=395

 Score =   306 bits (785),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/345 (46%), Positives = 220/345 (64%), Gaps = 6/345 (2%)
 Frame = +1

Query  301   RWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFAL  480
             +W  D+++ L    + F+++V GPES+ FD LGRGPY G+ADGR++ W GD   W  FA 
Sbjct  53    QWERDSQNSLQKSKILFLNQVQGPESVAFDPLGRGPYTGVADGRVLFWNGDE--WIDFAY  110

Query  481   VTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGG  660
              + N S  IC     + +    + E  CGRPLGLRFDK+ GDLYIADAY GLL VGP+GG
Sbjct  111   TSSNRS-VICDPKPSALS--YLRNEHICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGG  167

Query  661   IATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDP  840
             +A PL T  EG P+ F NDLDI  +GS++FTD+S  Y R N   ++  G+ +GR+L+YDP
Sbjct  168   LAMPLVTEAEGVPLGFTNDLDIDDDGSVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDP  227

Query  841   PTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFP  1020
                K  V++ ++ FPNGV  S+D SF LF E    RL +YW++G K+G T+V A LPG P
Sbjct  228   IAKKAVVLVPNVQFPNGVSISKDGSFFLFCEGDVGRLRRYWLKGEKAGTTDVFAVLPGHP  287

Query  1021  DNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVIS  1197
             DNVR N+KG++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + ++ 
Sbjct  288   DNVRTNQKGEFWVALHCKRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVV  347

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +   G+++ VLED  G  ++ VSEV E DGKLW+G+V  N +A 
Sbjct  348   KYSPEGKLMQVLEDSEGKFVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>gb|KHG24912.1| Adipocyte plasma membrane-associated [Gossypium arboreum]
Length=391

 Score =   306 bits (785),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 172/378 (46%), Positives = 232/378 (61%), Gaps = 17/378 (4%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DPF+ S +     F   K D+ P++ V      DN   L    ++F+++V GPES+ FD 
Sbjct  21    DPFKHSAISEFPDFEAYKVDMPPWEMVPTVRDKDN--LLQKSEIKFLNQVQGPESIAFDP  78

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKF---ESQC  564
             LGRGPY G+ADGRIV W G+   W  FA  + N SE +C     +  P    +   E  C
Sbjct  79    LGRGPYTGVADGRIVFWDGEK--WNDFAHTSSNRSE-LC-----NPKPSPLSYLPNEHIC  130

Query  565   GRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSI  744
             GRPLGLRFDKKTGDLYIADAY GLL VGP+GG+AT L T   G P+ F NDLDI   G +
Sbjct  131   GRPLGLRFDKKTGDLYIADAYLGLLKVGPEGGLATSLVTEANGVPLRFTNDLDIDDEGIV  190

Query  745   FFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLL  924
             +FTD+S KY R N   ++   E  GRL++Y+P T +T +++ +L FPNGV  S+D +FL+
Sbjct  191   YFTDSSSKYQRRNFKQLIFSSENGGRLIKYNPHTKETTILMTNLQFPNGVSLSKDGTFLV  250

Query  925   FTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLIN  1104
               E    RL+KYW++G K+G  EV A LPGFPDN+R N  G++WVAI+  R++   +L  
Sbjct  251   CCEGCPGRLLKYWLKGEKAGTWEVFAILPGFPDNIRTNRDGEFWVAINSRRSKYAHILGL  310

Query  1105  HPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
             HP  R    +LP+   +Q L    G K++  +  +   G++L +LED  G V+K VSEV 
Sbjct  311   HPKVRKFILKLPISTKVQVLLHVGG-KLHAQVVKYSPEGKLLRILEDSEGKVVKAVSEVD  369

Query  1279  EVDGKLWIGTVAHNHIAT  1332
             E DGKLW+G+V    IA 
Sbjct  370   ERDGKLWLGSVLMPFIAV  387



>emb|CBI24410.3| unnamed protein product [Vitis vinifera]
Length=328

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 219/341 (64%), Gaps = 29/341 (9%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D+++ L    ++F+++V GPES+ FD LGRGPY G+ADGRI+ W G+   W  FA  +PN
Sbjct  12    DDRNLLQKAEIKFLNQVQGPESVAFDPLGRGPYTGVADGRILFWNGE--AWSDFAYTSPN  69

Query  493   WSEKICGLGVDSTTPKQW-KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIAT  669
              SE +C       +P  + K E  CGRPLGLRF+K+TGDLYIAD+Y GL+ VGP+GG+AT
Sbjct  70    RSE-LCD---PKPSPLSYLKNEHICGRPLGLRFNKRTGDLYIADSYLGLMKVGPEGGLAT  125

Query  670   PLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTG  849
              L T  +G P+ F NDLDI   G+I+FTD+S KY R N   ++   E +GRLL+YDP T 
Sbjct  126   SLVTEADGVPLRFTNDLDIDDAGNIYFTDSSSKYQRRNFMQLVFSSEDSGRLLKYDPLTK  185

Query  850   KTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNV  1029
             +T V+L  L FPNGV  S+D SFL+  E +  RL+KYW++G K+G +EV A LPG+PDNV
Sbjct  186   ETTVLLRGLQFPNGVSLSKDGSFLVLCEGSPGRLVKYWLKGDKAGTSEVFAILPGYPDNV  245

Query  1030  RANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQ  1209
             R NEKG++WVAI C RT                       QYL    G +++ V+  +  
Sbjct  246   RTNEKGEFWVAIHCRRTM---------------------YQYLLHIGG-RLHAVVVKYSP  283

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              G+++ +LED  G V++ VSEV E +GKLW+G+V    +A 
Sbjct  284   EGKLVKILEDSEGKVVRAVSEVEEREGKLWMGSVLMPFVAV  324



>ref|XP_010045161.1| PREDICTED: strictosidine synthase 3-like [Eucalyptus grandis]
 gb|KCW87315.1| hypothetical protein EUGRSUZ_B03802 [Eucalyptus grandis]
Length=391

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 165/376 (44%), Positives = 238/376 (63%), Gaps = 13/376 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DP   S V     F   K D+ P+ +V  ER   D ++ L    ++F++++ GPES+ FD
Sbjct  21    DPLGRSAVANFPDFEAYKVDMPPWSDVPTER---DAENLLQRSEIKFLNQIQGPESIAFD  77

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCG  567
               GRGPY G+ADGR++ W G++  W+ FA  + N S    GL     +P  + K E  CG
Sbjct  78    PAGRGPYAGVADGRVLFWDGES--WKDFAYTSGNRS----GLCDPKPSPLSYLKNEHICG  131

Query  568   RPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIF  747
             RPLGLRFDK+TGDLYIADAY+GL+ VGP+GG+AT LAT  EG P+ F NDLDI + G+++
Sbjct  132   RPLGLRFDKRTGDLYIADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDEEGNVY  191

Query  748   FTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLF  927
             FTD+S KY R N   ++   E +GRLL+Y+P T +T +++ +L FPNGV  S+D SFL+F
Sbjct  192   FTDSSTKYQRRNFPQLVFSAEDSGRLLKYNPTTKETTILIRNLQFPNGVSLSKDGSFLVF  251

Query  928   TETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINH  1107
             +E    RL K+W++  K+G +EV A LPGFPDNVR N  G +WVAI C R+        +
Sbjct  252   SEGAIGRLRKFWLKVEKAGTSEVFAVLPGFPDNVRTNTDGDFWVAIHCRRSMYSYYSGLY  311

Query  1108  PWTRSVYFRLPLPMQYLARFA-GMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
             P  R ++ +LP+ ++   +   G + + V+  +   G+++ +LED  G  ++ VSEV E 
Sbjct  312   PKLRKLWLKLPISVKTQFQLQIGGQPHAVVVKYSPEGKLVQILEDSEGKTVRSVSEVEEK  371

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    +A 
Sbjct  372   DGKLWMGSVLMPFVAV  387



>ref|XP_006287902.1| hypothetical protein CARUB_v10001136mg [Capsella rubella]
 gb|EOA20800.1| hypothetical protein CARUB_v10001136mg [Capsella rubella]
Length=395

 Score =   306 bits (783),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/373 (43%), Positives = 230/373 (62%), Gaps = 7/373 (2%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF    + G         ++P  + ++ W  D+++ L    + F+++V GPES+ FD  
Sbjct  26    DPFNHCAISGFPNFVTHEVVSPRPDEVQ-WERDSQNSLQKSKILFLNQVQGPESVAFDPQ  84

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY G+ADGR++ W G+   W  FA  + N SE IC     + +    + E  CGRPL
Sbjct  85    GRGPYTGVADGRVLFWNGEK--WIDFAYTSSNRSE-ICDPKPSALS--YLRNEHICGRPL  139

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK+TGDLYIADAY GLL VGP+GG+A PL T  EG P+ F NDLDI  +G+++FTD
Sbjct  140   GLRFDKRTGDLYIADAYMGLLKVGPEGGLAMPLVTEAEGVPLGFTNDLDIDDDGTVYFTD  199

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             +S  Y R N   ++  G+ TGR+L+YDP + K  V++ ++ FPNGV  S+D SF +F E 
Sbjct  200   SSINYQRRNFLQLVFSGDNTGRVLKYDPISKKAVVLVSNVQFPNGVSISKDGSFFVFCEG  259

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
                 L +YW++G K+G T+V A LPG PDNVR N+ G++WVA+ C R     ++  +P  
Sbjct  260   DIGSLRRYWLKGEKAGTTDVFAMLPGHPDNVRTNQNGEFWVALHCRRNYYSYLMARYPKL  319

Query  1117  RSVYFRLPLPMQYLARFA-GMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
             R    RLP+  +    F  G++ + V+  +   G+++ VLED  G  ++ VSEV E DGK
Sbjct  320   RMFILRLPITARTHYSFQIGLRPHGVVVKYSPEGKLIQVLEDSEGKFVRSVSEVEEKDGK  379

Query  1294  LWIGTVAHNHIAT  1332
             LW+G+V  N +A 
Sbjct  380   LWMGSVLMNFVAV  392



>gb|EPS66876.1| hypothetical protein M569_07898, partial [Genlisea aurea]
Length=383

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 156/339 (46%), Positives = 218/339 (64%), Gaps = 7/339 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D+++ L    ++F+D+V GPESL FD +GRGPY G+ADGRI+ W  D   W  FA  +PN
Sbjct  47    DSQNLLQRSEIKFLDQVQGPESLAFDPIGRGPYTGVADGRILFW--DGQKWTHFAHTSPN  104

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              S+ +C      T       E  CGRPLGLRFDK+ GDLYIADAY GL+ VGP GG+AT 
Sbjct  105   RSQGLCDPKPSITDYSD--NEHICGRPLGLRFDKRNGDLYIADAYLGLMKVGPRGGLATS  162

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             LAT  EG P+ F NDLDI ++G+++F+D+S  Y R N+  ++   + TGRL++YDP T +
Sbjct  163   LATEAEGIPLGFTNDLDIDEHGNVYFSDSSTNYRRRNYMQLIYTADNTGRLIKYDPTTKQ  222

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
             T V++ +L FPNGV  S+D SF  + E +  RL KYW++G K+G TE++A LPG+PDNVR
Sbjct  223   TRVLVRNLQFPNGVSLSKDGSFFAYCEFSRARLSKYWLKGEKAGTTEIMAALPGYPDNVR  282

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              NE+G++WVA+   R    + L  HP   S+          + R     +  ++  +   
Sbjct  283   TNEEGEFWVAVPTRRMWYADFLGRHP---SLRKLRLKLPLPIMRRKSSPLNAMVIKYSPE  339

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIA  1329
             G++L +LED+ G V++ VSEV E DG+LW+GTV  N IA
Sbjct  340   GKILKILEDEPGKVVRAVSEVDEKDGRLWMGTVILNSIA  378



>ref|XP_010493259.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=395

 Score =   305 bits (781),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 220/345 (64%), Gaps = 6/345 (2%)
 Frame = +1

Query  301   RWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFAL  480
             +W  D+++ L    + F+++V GPES+ FD LGRGPY G+ADGR++ W GD   W  FA 
Sbjct  53    QWERDSQNSLQKSKILFLNQVQGPESVAFDPLGRGPYTGVADGRVLFWNGDE--WIDFAY  110

Query  481   VTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGG  660
              + N S  IC     + +    + E  CGRPLGLRFDK+ GDLYIADAY GLL VGP+GG
Sbjct  111   TSSNRS-VICDPKPSALS--YLRNEHICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGG  167

Query  661   IATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDP  840
             +A PL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ +GR+L+YDP
Sbjct  168   LAMPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDP  227

Query  841   PTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFP  1020
                K  V++ ++ FPNGV  S+D SF LF E    RL +YW++G K+G T+V A LPG P
Sbjct  228   IAKKAVVLVSNVQFPNGVSISKDGSFFLFCEGDVGRLGRYWLKGEKAGTTDVFAVLPGHP  287

Query  1021  DNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVIS  1197
             DNVR N+ G++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + +++
Sbjct  288   DNVRTNQNGEFWVALHCKRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVA  347

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +   G+++ VLED  G  ++ VSEV E DGKLW+G+V  N +A 
Sbjct  348   KYSPEGKLMQVLEDSEGKFVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>gb|KFK26348.1| hypothetical protein AALP_AA8G236100 [Arabis alpina]
Length=395

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 228/373 (61%), Gaps = 7/373 (2%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DPF L  +           I P  + +  W  D+++ L    + F ++V GPES+ FD L
Sbjct  26    DPFNLCAISDFPNFIAHKVITPRPDEIP-WERDSQNSLQKSKILFQNQVQGPESVAFDPL  84

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             GRGPY G+ADGR++ W G+   W  FA  + N SE IC     + +    K E  CGRPL
Sbjct  85    GRGPYTGVADGRVLFWNGEK--WIDFAYTSSNRSE-ICDPKPSALS--YLKNEHICGRPL  139

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK+TGDLYIADAY GLL VGP+GG+A  L T  EG P+ F NDLDI  +G+++FTD
Sbjct  140   GLRFDKRTGDLYIADAYMGLLKVGPEGGLAMSLVTEAEGVPLGFTNDLDIDDDGTVYFTD  199

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             +S  Y R N   ++  G+ +GR+L+YDP   K  V++ ++ FPNGV  S+D SF LF + 
Sbjct  200   SSTNYQRRNFLQLVFSGDNSGRVLKYDPIAKKAVVLVSNVQFPNGVSISKDGSFFLFCDG  259

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
                 L +YW++G K+G ++V A LPG PDNVR NEKG++WVA+ C R     ++  +P  
Sbjct  260   DVGSLRRYWLKGEKAGTSDVFAMLPGHPDNVRTNEKGEFWVALHCKRNYYAYIMAKYPKL  319

Query  1117  RSVYFRLPLPMQYLARFA-GMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
             R    +LP+  +    F  GM+ + ++  +   G+++ VLED  G V++ VSEV E DGK
Sbjct  320   RMFILKLPITAKTHYLFQIGMRPHGLVVKYSPEGKLVKVLEDSEGKVVRSVSEVEEKDGK  379

Query  1294  LWIGTVAHNHIAT  1332
             LW+G+V  N +A 
Sbjct  380   LWMGSVLMNFVAV  392



>gb|KFK43153.1| hypothetical protein AALP_AA1G086800 [Arabis alpina]
Length=392

 Score =   305 bits (781),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 166/378 (44%), Positives = 235/378 (62%), Gaps = 19/378 (5%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F     D+ P   +  ER   D+++ L    ++FV+EV GPES+ FD
Sbjct  22    DPFNHSSISKFPNFETHYIDMPPLSSLPKER---DHENLLQNSEIKFVNEVQGPESVAFD  78

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK---QWKFESQ  561
               GRGPY G+ADGR++ W  D   W  FA  + N SE +C      T P      K E  
Sbjct  79    PQGRGPYTGVADGRVIFW--DGTRWNDFAYTSNNRSE-LC-----DTKPSLLDYLKNEHI  130

Query  562   CGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGS  741
             CGRPLGLRF KKTG+LYIADAY+G++ VGP+GG+AT +    +G P+ F NDLD+ + G+
Sbjct  131   CGRPLGLRFHKKTGELYIADAYFGIMKVGPEGGLATSVTNEADGVPLRFTNDLDVDEEGN  190

Query  742   IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFL  921
             ++FTD+S  + R N   +++ GE TGR+L+Y+P T +T  ++ +L FPNG+   +D SF 
Sbjct  191   VYFTDSSTVFQRRNFMQLIVSGEDTGRVLKYNPETKETTTLVRNLQFPNGLSLGKDESFF  250

Query  922   LFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLI  1101
             +F E T  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVAI C R      + 
Sbjct  251   IFCEGTIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAIHCHRNIFTHEMA  310

Query  1102  NHPWTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEV  1275
             +H   R  + +LP+ +  QYL +  G   + V   + ++G+VL VLEDK G V+K VSE+
Sbjct  311   HHTSIRKFFLKLPITVKFQYLLQVGGWP-HAVAVKYSEDGKVLKVLEDKQGKVVKAVSEI  369

Query  1276  REVDGKLWIGTVAHNHIA  1329
              E DGKLW+G+V  + IA
Sbjct  370   EEKDGKLWMGSVLMSFIA  387



>ref|NP_563818.1| strictosidine synthase-like 3 [Arabidopsis thaliana]
 sp|Q8VWF6.1|SSL3_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 3; Short=AtSSL3; 
AltName: Full=Strictosidine synthase 9; Short=AtSS9; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL31926.1|AF419594_1 At1g08470/T27G7_9 [Arabidopsis thaliana]
 gb|AAL36403.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51389.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28296.1| strictosidine synthase-like 3 [Arabidopsis thaliana]
Length=390

 Score =   304 bits (779),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/380 (43%), Positives = 233/380 (61%), Gaps = 13/380 (3%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F+  K D+ P   +  ER   D ++ L    + F++EV GPES+ FD
Sbjct  20    DPFSHSSISKFPDFKTYKIDMPPLSSLPKER---DRQNLLQNSEIRFLNEVQGPESIAFD  76

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ADGRI+ W G    W  FA  + N SE +C      +     K E  CGR
Sbjct  77    PQGRGPYTGVADGRILFWNGTR--WTDFAYTSNNRSE-LCD--PKPSLLDYLKDEDICGR  131

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKK GDLYIADAY G++ VGP+GG+AT +    +G P+ F NDLDI   G+++F
Sbjct  132   PLGLRFDKKNGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDIDDEGNVYF  191

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE +GR+L+Y+P T +T  ++ +L FPNG+   +D SF +F 
Sbjct  192   TDSSSFFQRRKFMLLIVSGEDSGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSFFIFC  251

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+ C R     ++ ++P
Sbjct  252   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHLMAHYP  311

Query  1111  WTRSVYFRLPLPM--QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R  + +LP+ +  QYL +  G   + V   + + G+VL VLED  G V+K VSEV E 
Sbjct  312   RVRKFFLKLPISVKFQYLLQVGGWP-HAVAVKYSEEGKVLKVLEDSKGKVVKAVSEVEEK  370

Query  1285  DGKLWIGTVAHNHIATLPYP  1344
             DGKLW+G+V  + IA    P
Sbjct  371   DGKLWMGSVLMSFIAVYDLP  390



>ref|XP_006400707.1| hypothetical protein EUTSA_v10013741mg [Eutrema salsugineum]
 gb|ESQ42160.1| hypothetical protein EUTSA_v10013741mg [Eutrema salsugineum]
Length=395

 Score =   304 bits (778),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 220/345 (64%), Gaps = 8/345 (2%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+ + L    + F+++V GPES+ FD LGRGPY G+ADGR++ W GD   W  FA  
Sbjct  54    WERDSHNSLQKSEILFLNQVQGPESVAFDPLGRGPYTGVADGRVLFWNGDK--WTDFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             + N SE IC     + +    + E  CGRPLGLRF K+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSNRSE-ICDPKPSALS--YLRNEHICGRPLGLRFGKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             A PL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   AMPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSINYQRRNFLQLVFSGDNTGRVLKYDPI  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++ ++ FPNGV  S+D SF +F E     L +YW++G K+G ++V A LPG PD
Sbjct  229   AKKAVVLVSNVQFPNGVSISKDGSFFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVIS  1197
             NVR N+ G++WVA+ C R     ++  +P  R    +LP+   + YL +  GM+ + V+ 
Sbjct  289   NVRTNKDGEFWVALHCKRNYYSYIMARYPKLRMFILKLPITARIHYLFQI-GMRPHGVVV  347

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +   G+++ +LED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  348   KYSPEGKLVKILEDSEGKVVRSVSEVEEKDGKLWMGSVLMNFVAV  392



>ref|XP_010516308.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=374

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 206/317 (65%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES++FD  G GPY G++DGR+++W G++ GW  FA  + N   ++C        P   
Sbjct  56    GPESIDFDPSGEGPYVGVSDGRVLKWRGESLGWTDFAYTSAN--REMC------VRPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKK+GDLYIADAY+GLL+VGP GG+A PL T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKSGDLYIADAYFGLLIVGPAGGLARPLVTEAEGQPFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               ++  I+FTDTS K+ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQDDVIYFTDTSAKFQRRQFLATVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R+N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTQDVFAELPGFPDNIRSNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ ++  W + +  RLP+    L + F G + +       ++GEVL+VLEDK G  ++
Sbjct  288   FAKLSLSQTWFKDLVLRLPISAPRLHSLFTGGRPHATAVKLSESGEVLEVLEDKEGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>ref|XP_011027270.1| PREDICTED: strictosidine synthase 3-like isoform X1 [Populus 
euphratica]
Length=389

 Score =   303 bits (777),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 213/323 (66%), Gaps = 15/323 (5%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
              FGPES  FD+LG+GPY  L+DGRI++W G+  GW  FA+ +PN     CG   D     
Sbjct  68    AFGPESFAFDSLGQGPYTSLSDGRIIKWQGNRKGWTDFAVASPN--RDGCGGPQD-----  120

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLGL FD+  GDLYIADAY GLL VG  GG+AT + TH +G P+ F N L
Sbjct  121   HQQTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGAQGGLATKIVTHAQGIPLSFTNGL  180

Query  721   DI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQ  897
             DI   NG+I+FTD+S +Y R ++  ++L G+ +GRL++YDP   +  V+L +L FPNGV 
Sbjct  181   DIDQSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPNGVA  240

Query  898   FSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCR  1077
              S+D +F+L  ETT CR+++YW++  K+G  EV A L GFPDN++ + +G YWV ++  R
Sbjct  241   LSKDGTFILLAETTRCRILRYWIKTSKAGTVEVFAQLQGFPDNIKRSPRGGYWVGLNSRR  300

Query  1078  TRIQEVLINHPWTRSVYFRLPLPMQY----LARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
              ++ E+L ++PW  +V  +LPL +      L+++ G  +   +S   +NG++L+V ED+ 
Sbjct  301   EKLSELLFSYPWIGNVLLKLPLDISMLESTLSKYRGSGLAVRLS---ENGDILEVFEDED  357

Query  1246  GDVMKLVSEVREVDGKLWIGTVA  1314
             G+ ++ VSEV E D  LWIG++A
Sbjct  358   GNRLQSVSEVMEKDEILWIGSIA  380



>ref|NP_191262.2| calcium-dependent phosphotriesterase superfamily protein [Arabidopsis 
thaliana]
 sp|Q4V3D9.1|SSL10_ARATH RecName: Full=Protein STRICTOSIDINE SYNTHASE-LIKE 10; Short=AtSSL10; 
AltName: Full=Strictosidine synthase 8; Short=AtSS8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAY56408.1| At3g57030 [Arabidopsis thaliana]
 gb|ABH04571.1| At3g57030 [Arabidopsis thaliana]
 gb|AEE79601.1| strictosidine synthase family protein [Arabidopsis thaliana]
Length=374

 Score =   303 bits (775),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 201/318 (63%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGRI++W G+  GW  FA  + N  E  C        P   
Sbjct  56    GPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQE--CA------RPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GLLVVGP GG+A PL T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTHQVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
               ++ +   W R +  RLP+  Q L      G+   T I L  ++G+VL+VLEDK G  +
Sbjct  288   FAKLSLTQTWFRDLVLRLPISPQRLHSLFTGGIPHATAIKL-SESGKVLEVLEDKEGKTL  346

Query  1258  KLVSEVREVDGKLWIGTV  1311
             + +SEV E DGKLWIG+V
Sbjct  347   RFISEVEEKDGKLWIGSV  364



>emb|CAB72173.1| putative protein [Arabidopsis thaliana]
Length=372

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 201/318 (63%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGRI++W G+  GW  FA  + N  E  C        P   
Sbjct  54    GPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQE--CA------RPFAP  105

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GLLVVGP GG+A PL T  EG+P  F NDLDI
Sbjct  106   ELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDI  165

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  166   DEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  225

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  226   KDRSFVLVVETTTCKILRLWLSGPNAGTHQVFAELPGFPDNIRRNSNGEFWVALHSKKGL  285

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
               ++ +   W R +  RLP+  Q L      G+   T I L  ++G+VL+VLEDK G  +
Sbjct  286   FAKLSLTQTWFRDLVLRLPISPQRLHSLFTGGIPHATAIKL-SESGKVLEVLEDKEGKTL  344

Query  1258  KLVSEVREVDGKLWIGTV  1311
             + +SEV E DGKLWIG+V
Sbjct  345   RFISEVEEKDGKLWIGSV  362



>gb|EPS68312.1| hypothetical protein M569_06455, partial [Genlisea aurea]
Length=394

 Score =   303 bits (776),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/343 (46%), Positives = 227/343 (66%), Gaps = 7/343 (2%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             D+++RL    ++F+ EV GPESL FD +GRGPY G+ADGRI+ W G    W  FA  + N
Sbjct  52    DSENRLQKSEIKFLKEVQGPESLAFDPMGRGPYTGVADGRILFWNGQK--WSDFAYTSAN  109

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              S   C     S    + + E  CGRPLGLRFDK+ GDLYIADAY+GL+ VGP+GG+A  
Sbjct  110   RSGANCDERKASIAEYRER-EHICGRPLGLRFDKRNGDLYIADAYFGLMKVGPEGGLAAS  168

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             L T  EG P+ F NDLDI + G+++FTD+S  Y R N+  ++L G+A+GR+L+YDP T +
Sbjct  169   LVTEAEGVPLGFTNDLDIDRQGNVYFTDSSSNYRRRNYLQLLLSGDASGRVLKYDPQTNE  228

Query  853   THVVLDSLAFPNGVQFSEDH-SFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNV  1029
             T V++ +L FPNG+  S+D  SF ++ E +  RL KYW+EG ++G  +V+A LPG+PDNV
Sbjct  229   TRVLVRNLQFPNGISLSKDSASFFVYCELSRGRLSKYWLEGDRAGTWQVMAVLPGYPDNV  288

Query  1030  RANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP--MQYLARFAGMKMYTVISLF  1203
             R NE+G +WVA+   R+     +  HP  R ++ +LP+P  + Y     G    TV+  +
Sbjct  289   RTNERGNFWVALHYRRSWYTGFIERHPELRKLWLKLPIPGGIHYYLLLGGRMSATVVQ-Y  347

Query  1204  DQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             D  GE+++++ED  G V+++VSEV E DGKLW+G+V  + +A 
Sbjct  348   DPQGEIVEIVEDGEGKVVRVVSEVEERDGKLWMGSVLMDFVAV  390



>ref|XP_002878128.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54387.1| strictosidine synthase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 201/317 (63%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W  ++ GW  FA  + N  E +         P   
Sbjct  56    GPESIAFDPAGEGPYVGVSDGRVLKWRSESLGWSDFAYTSSNRQECV--------RPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GLLVVGP GG+A PL T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  EV A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTHEVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ ++  W R +  RLP+  Q L + F G + +       ++G+VL+VLED  G  ++
Sbjct  288   FAKLSLSQTWFRDLVLRLPISPQRLHSLFTGGRPHATAIKLSESGKVLEVLEDNEGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>ref|XP_004493426.1| PREDICTED: strictosidine synthase 1-like [Cicer arietinum]
Length=369

 Score =   301 bits (772),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 206/333 (62%), Gaps = 10/333 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K  L    +  V    GPESL FD  G+GPY G+ADGRI++W G+  GW  FAL T N 
Sbjct  36    SKDDLHAARILHVSGAVGPESLAFDGNGQGPYTGVADGRILKWEGEERGWTQFALTTSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        D   P   + E  CGRPLGL+FDKK GDLYIADAY+GL VVGP+GG+AT +
Sbjct  96    S--------DCVRPIALELEHVCGRPLGLKFDKKNGDLYIADAYFGLNVVGPEGGLATQV  147

Query  676   ATHVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
              T  EG+P  F ND+DI ++   I+FTD+S  + R    L +L G+ TGRL++YD  T +
Sbjct  148   VTEAEGQPFRFTNDMDISEDEDVIYFTDSSTVFQRRQFMLALLSGDKTGRLMKYDKSTKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V+L  LAF NGV  S+D SF+L  ET+  R+++ W+ GP SG+ +  A LPGFPDN+R
Sbjct  208   VKVLLRGLAFANGVALSKDGSFILVAETSTFRILRLWLRGPNSGQVDTFAVLPGFPDNIR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              N +GQ+WVA+    T   +++ ++PW      +L    Q  A  A       I L ++ 
Sbjct  268   RNSEGQFWVALHAKETPFAKLIASNPWAGKALLKLGNFKQLHASLAKKPHAAAIKLSNE-  326

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             GE+L+VLED  G+ +K +SEV E DGKLWI +V
Sbjct  327   GEILEVLEDCEGNTLKFISEVEEKDGKLWIASV  359



>ref|XP_006651825.1| PREDICTED: adipocyte plasma membrane-associated protein-like, 
partial [Oryza brachyantha]
Length=312

 Score =   299 bits (766),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 156/314 (50%), Positives = 207/314 (66%), Gaps = 9/314 (3%)
 Frame = +1

Query  409   YGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW-KFESQCGRPLGLR  585
             Y G+ADGR+V W  D A W  FA  +PNW+ ++CG      +P  + K E  CGR LGLR
Sbjct  1     YTGVADGRVVFW--DGARWVYFAHSSPNWTAELCG---PKASPLDYLKDEHICGRALGLR  55

Query  586   FDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQ  765
             FDK+TGDLYIADAY+GLL VGPDGG+ATPLAT  EG    F NDLD+   G+++FTD+S 
Sbjct  56    FDKRTGDLYIADAYFGLLKVGPDGGLATPLATEAEGVRFNFTNDLDLDDEGNVYFTDSSI  115

Query  766   KYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNC  945
              Y R +   ++  G+ +GRLL+YDP T KT V+  +L FPNGV  S+D SFL+F E +  
Sbjct  116   HYQRRHFMQLVFSGDPSGRLLKYDPNTKKTTVLHRNLQFPNGVSLSKDGSFLVFCEGSRG  175

Query  946   RLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSV  1125
             RL +YW++G K+G  ++ A LPGFPDNVR NEKG++WVAI C R+    ++  +   R  
Sbjct  176   RLSRYWLKGEKAGTVDLFAILPGFPDNVRTNEKGEFWVAIHCRRSIYARMVSRNVRLRKF  235

Query  1126  YFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLW  1299
                LP+P +  YL +  G K++ +I  +  +GEV D+LED  G V++ VSEV E DGKLW
Sbjct  236   LLSLPIPAKYHYLMQIGG-KLHALIIKYSPDGEVADILEDTTGKVVRAVSEVEEKDGKLW  294

Query  1300  IGTVAHNHIATLPY  1341
             IG+V    IA   Y
Sbjct  295   IGSVLMPFIAVFDY  308



>gb|KDO48948.1| hypothetical protein CISIN_1g015463mg [Citrus sinensis]
Length=406

 Score =   302 bits (774),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 167/376 (44%), Positives = 228/376 (61%), Gaps = 28/376 (7%)
 Frame = +1

Query  271   DIAPYKEVMERWH-----GDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRI  435
             D   +K  M  W       D+K+ L    ++F++++ GPES+ FD LGRGPY G+ADGRI
Sbjct  33    DFVSHKVDMPPWSLIPTVKDDKNLLQNSEIKFLNQIQGPESMAFDPLGRGPYTGVADGRI  92

Query  436   VRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYI  615
             + W  D   W  FA  + N SE +C     +T+    K E  CGRPLGLRFDKKTGDLYI
Sbjct  93    LFW--DGLKWTDFAFTSNNRSE-LCNPKPIATS--YLKNEHICGRPLGLRFDKKTGDLYI  147

Query  616   ADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNR------  777
             ADAY+GL+ VGP+GG+AT LAT  EG P+ F NDLDI   G+++FTD+S  Y R      
Sbjct  148   ADAYFGLMKVGPEGGLATSLATEAEGVPLRFTNDLDIDDEGNVYFTDSSTNYQRRQMQKE  207

Query  778   ---------VNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
                      +N    +   + TGR+L+YDP T +T V+L +L FPNG+  S+D SF +F 
Sbjct  208   NIPLQLCSSLNDPSPIKITKDTGRVLKYDPTTKQTTVLLRNLQFPNGLSLSKDKSFFVFC  267

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW+ G K+G  E  A LPG+PDNVR NEKG++WVAI C R+    ++  +P
Sbjct  268   EGSVGRLHKYWLIGEKAGNLEAFAILPGYPDNVRTNEKGEFWVAIHCRRSLYSHLMALYP  327

Query  1111  WTRSVYFRLPLPMQ--YLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREV  1284
               R    +LP+  +  YL    G +++ +   +   G++L VLED  G V+K +SEV E 
Sbjct  328   KIRHFLLKLPISAKTHYLIHVGG-RLHAMAVKYSPEGKILQVLEDSKGKVVKAISEVEEK  386

Query  1285  DGKLWIGTVAHNHIAT  1332
             DGKLW+G+V    +A 
Sbjct  387   DGKLWMGSVLMPFVAV  402



>ref|XP_002323253.2| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05014.2| strictosidine synthase family protein [Populus trichocarpa]
Length=349

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 210/322 (65%), Gaps = 15/322 (5%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPES  FD+LG GPY  L+DGRI++W GD   W  FA+ +PN     CG   D     
Sbjct  28    AIGPESFAFDSLGEGPYTSLSDGRIIKWQGDKKRWIDFAVTSPN--RDGCGGPHD-----  80

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLG  FD+  GDLYIADAY GL  VGP+GG+AT +ATH +G P  F N L
Sbjct  81    HHQMEHVCGRPLGSCFDETHGDLYIADAYMGLFRVGPEGGLATKIATHAQGIPFRFTNSL  140

Query  721   DI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQ  897
             DI   +G+I+FTD+S +Y R ++  ++L G+ +GRL++YD  + +  V+L +L FPNGV 
Sbjct  141   DIDQSSGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDTASKQVTVLLKNLTFPNGVA  200

Query  898   FSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCR  1077
              S D SF+L  ETT+CR+++YW++  K+G  EV A L GFPDN++ + +G YWV I+  R
Sbjct  201   LSTDGSFVLLAETTSCRILRYWIKTSKAGALEVFAQLQGFPDNIKRSPRGGYWVGINSKR  260

Query  1078  TRIQEVLINHPWTRSVYFRLPLPM----QYLARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
              ++ E+L ++PW   V  +LPL +      LA++ G  +   +S   +NG++++V ED+ 
Sbjct  261   EKLSELLFSYPWIGKVLLKLPLDITKFQTALAKYRGGGLAVRLS---ENGDIVEVFEDRD  317

Query  1246  GDVMKLVSEVREVDGKLWIGTV  1311
             G+ +K +SEV E DGKLWIG++
Sbjct  318   GNRLKSISEVMEKDGKLWIGSI  339



>ref|XP_003554139.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
 gb|KHN14916.1| Strictosidine synthase 1 [Glycine soja]
Length=371

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 206/334 (62%), Gaps = 10/334 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K  L    L  V    GPESL FD  G GPY G+ADGRI++W G+  GW  FA+ + N 
Sbjct  36    SKDHLHAARLLHVTGAVGPESLVFDADGGGPYTGVADGRILKWEGEERGWTEFAVTSSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        D   P   + E  CGRPLGLRFDKK GDLYIADAY GL VVG  GG+AT +
Sbjct  96    S--------DCVRPFAPELEHICGRPLGLRFDKKNGDLYIADAYLGLKVVGSAGGLATEV  147

Query  676   ATHVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
              T VEG+P+ F ND+DI ++   I+FTD++  + R    L++L G+ TGRL++Y+  T +
Sbjct  148   VTEVEGQPLQFTNDMDISEDEEVIYFTDSTTIFQRRQFMLVLLSGDKTGRLMKYNKSTKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V+L  LAFPNGV  S+D SF+L  ETT CR+++ W+ GPK+G  +  A LPGFPDNVR
Sbjct  208   VTVLLRGLAFPNGVALSKDGSFVLVAETTTCRILQLWLRGPKAGHVDTFAVLPGFPDNVR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQ  1209
              N +G +WVA+    +R  + + ++PW      ++    + L + FAG K +        
Sbjct  268   RNSQGHFWVALHAKGSRFAKWVSSNPWAGKALLKIGFNFKQLHSSFAGWKPHAAAVKLSD  327

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
              GE+L+VLED  G  +K +SEV E DGKLWI +V
Sbjct  328   KGEILEVLEDCDGKTLKFISEVEEKDGKLWIASV  361



>ref|XP_010108508.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
 gb|EXC19608.1| Adipocyte plasma membrane-associated protein [Morus notabilis]
Length=482

 Score =   303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 202/322 (63%), Gaps = 10/322 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             V    GPES+ FD+ GRGPY G+ADGRI+RW GD  GW  FA+ T    E I        
Sbjct  158   VTGALGPESIAFDSDGRGPYAGVADGRILRWEGDGRGWSEFAVTTSQRKECI--------  209

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
              P   + E  CGRPLGLRF KKTG+LYIADAY GL VVGPDGG+AT L + VEG+P+ F 
Sbjct  210   RPFAPEMEHVCGRPLGLRFHKKTGELYIADAYLGLKVVGPDGGLATDLVSEVEGQPLRFT  269

Query  712   NDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             ND+DI ++   I+FTDTS  + R      +L G+ TGRLL+Y+    +  ++L+ LAF N
Sbjct  270   NDMDIDEDKDVIYFTDTSMSFQRRQFMSSILSGDKTGRLLKYNISNKEVTILLEGLAFAN  329

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D SF+L  ETT CR+++ W+ GP  G+ +V A LPGFPDNVR N KG++WVA+ 
Sbjct  330   GVALSKDRSFVLVAETTTCRILRLWLHGPNVGKVDVFAELPGFPDNVRRNPKGEFWVALH  389

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
               +  +    +++ W      +LP   + L +   G K +       ++G VL+VLED  
Sbjct  390   SKKGPLSHFAVSNTWVGKTLLKLPFSFKQLHSLLVGGKAHATAIKLSEDGAVLEVLEDCE  449

Query  1246  GDVMKLVSEVREVDGKLWIGTV  1311
             G  +K +SEV E DGKLWIG+V
Sbjct  450   GKNLKFISEVEEKDGKLWIGSV  471



>dbj|BAE99809.1| hypothetical protein [Arabidopsis thaliana]
Length=374

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 200/318 (63%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGRI++W G+  GW  FA  + N  E  C        P   
Sbjct  56    GPESIAFDPAGEGPYVGVSDGRILKWRGEPLGWSDFAHTSSNRQE--CA------RPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GLLVVGP GG+A PL T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEAEGQPFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQEDVIYFTDTSARFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTHQVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
               ++ +   W R +  RLP+  Q L      G+   T I L  ++G+VL+VL DK G  +
Sbjct  288   FAKLSLTQTWFRDLVLRLPISPQRLHSLFTGGIPHATAIKL-SESGKVLEVLGDKEGKTL  346

Query  1258  KLVSEVREVDGKLWIGTV  1311
             + +SEV E DGKLWIG+V
Sbjct  347   RFISEVEEKDGKLWIGSV  364



>emb|CDX95058.1| BnaC05g06130D [Brassica napus]
Length=374

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 164/382 (43%), Positives = 232/382 (61%), Gaps = 36/382 (9%)
 Frame = +1

Query  217   DPFELSPVGGQK-FRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF+ S +     F+  K D+ P   +  ER   D+++ L    ++F++EV GPES+ FD
Sbjct  23    DPFKHSSISKYPVFQTYKIDMPPLSSLPKER---DHENLLQNSEIKFLNEVQGPESIAFD  79

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
              LGRGPY G+ADGRI+ W  D   W  FA  + N SE +C     S+     K E  CGR
Sbjct  80    PLGRGPYTGVADGRILFW--DGTRWTDFAYTSNNRSE-LCD--TKSSLLAYLKNEHICGR  134

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRF K+TGDLY+ADAY+G++ VGP+GG+AT L T  +G P+ F NDLD+   G+++F
Sbjct  135   PLGLRFHKRTGDLYVADAYFGIMKVGPEGGLATSLTTEGDGVPLRFTNDLDVDDEGNVYF  194

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R N   +++ GE TGR+L+Y+P T +T  +L +L FPNG+   +D SF +F 
Sbjct  195   TDSSSVFQRRNFMHLIVSGEDTGRVLKYNPETKETTTLLRNLQFPNGLSLGKDGSFFIFC  254

Query  931   ETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHP  1110
             E +  RL KYW++G K+G +EV+A L GFPDN+R N+ G +WVA+ C R     V+ +HP
Sbjct  255   EGSIGRLRKYWLKGEKAGTSEVVALLHGFPDNIRTNKDGDFWVAVHCHRNIFTHVMAHHP  314

Query  1111  ----WTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVR  1278
                 W  +V  +                      + ++G+VL VLEDK G V+K VSE+ 
Sbjct  315   NVGGWPHAVAVK----------------------YSKDGKVLKVLEDKQGKVVKAVSEIE  352

Query  1279  EVDGKLWIGTVAHNHIATLPYP  1344
             E DGKLW+G+V  + IA    P
Sbjct  353   EKDGKLWMGSVLMSFIAVYDLP  374



>gb|KFK34942.1| hypothetical protein AALP_AA5G213900 [Arabis alpina]
Length=373

 Score =   299 bits (766),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N  + +         P   
Sbjct  55    GPESVAFDPSGEGPYVGVSDGRVLKWRGESLGWIDFAHTSTNREKCV--------RPFAP  106

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GLLVVGP GG+A PL T  +G P  F NDLDI
Sbjct  107   ELEHVCGRPLGLRFDKKTGDLYIADAYFGLLVVGPAGGLAKPLVTEADGVPFRFTNDLDI  166

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      +L  + TGRL++YD  + K  V+L  +AF NGV  S
Sbjct  167   DEEEDVIYFTDTSTRFQRRQFLAAVLNFDKTGRLMKYDRSSKKVTVLLQGIAFANGVALS  226

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDNVR N  G++WVA+   +  
Sbjct  227   KDRSFVLVAETTTCKILRLWLSGPNAGTQDVFAELPGFPDNVRKNSNGEFWVALHSKKGL  286

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ +  PW R +  RLP+    L + F G + +       ++GEVL+VLEDK G  ++
Sbjct  287   FAKLSLTQPWFRDLVLRLPISGPRLHSVFIGGRPHATAMKLSESGEVLEVLEDKEGKRLR  346

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  347   FISEVEEKDGKLWIGSV  363



>ref|XP_001762553.1| predicted protein [Physcomitrella patens]
 gb|EDQ72676.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/355 (43%), Positives = 221/355 (62%), Gaps = 3/355 (1%)
 Frame = +1

Query  280   PYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNA  459
             P   +++ +  DN+++L  G +++  E+ GPESL FD  GRGPY G++DGRI+R+ G   
Sbjct  43    PPASLLKDFPRDNENKLKNGEIKWQGELLGPESLTFDAQGRGPYTGVSDGRILRYDGPEL  102

Query  460   GWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLL  639
             GW TFA  + N S         S        E  CGRPLG+RF K+TGDL+IADAY G++
Sbjct  103   GWTTFAYTSTNRS---YACAPKSPLAFNLALEHVCGRPLGIRFHKETGDLWIADAYLGIM  159

Query  640   VVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATG  819
              VGP+GG A  +   ++G P+ F NDLD    G+++FTD+S ++ R    L +LEG+ TG
Sbjct  160   KVGPEGGQAELVLNEIDGVPMKFMNDLDFDDEGNMYFTDSSTRWQRRQFLLSLLEGDDTG  219

Query  820   RLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVI  999
             R ++Y+  T +T V++D L F NGV  S+D +F+L  E    RL +YW++G K+G  E+ 
Sbjct  220   RFIKYNLATKQTTVLIDHLRFSNGVTVSKDGTFVLIAECRMGRLWRYWLKGSKAGTHELF  279

Query  1000  ANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMK  1179
             A+LPG PDNVR NE G +WVA+ C R   +E L  +PW R++  RLP+P++ +      K
Sbjct  280   ADLPGLPDNVRRNEAGDFWVALHCRRRSAEEFLSKNPWIRTLIIRLPIPLKLVYVLLAGK  339

Query  1180  MYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
              + VI  +  +G + ++LED+ G V K+VSEV E DGKL++G+V    I     P
Sbjct  340   PHGVILRYGPDGTMREILEDQTGKVAKMVSEVEEHDGKLYLGSVLLPQIVVYTLP  394



>ref|XP_006494390.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
Length=381

 Score =   299 bits (766),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/322 (46%), Positives = 201/322 (62%), Gaps = 10/322 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             V    GPES+ FD  G GPY G+ADGRI++W GD  GW  FA+ T    E +     D  
Sbjct  55    VTGALGPESIAFDPNGDGPYTGVADGRILKWQGDELGWTEFAVTTSQRKECVRPFAPD--  112

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                    E  CGRPLG+RFDKKTGDLYIADAY G  VVGP+GG+AT L T   G+P+ F 
Sbjct  113   ------IEHICGRPLGIRFDKKTGDLYIADAYLGFQVVGPEGGLATQLVTEAAGQPLRFT  166

Query  712   NDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             NDLDI ++ G I+FTD+S  + R      +L G+ TGRLL+Y+  T +  ++L  LAF N
Sbjct  167   NDLDIDEHKGVIYFTDSSTSFQRRQFMSSILSGDKTGRLLKYEKTTKEVTILLQGLAFAN  226

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S D +F+L  ET+NCR++++W+ GP SG+ +V A LPGFPDNVR+N  G++WVA+ 
Sbjct  227   GVALSRDRTFILIAETSNCRILRFWLHGPNSGKQDVFAELPGFPDNVRSNSNGEFWVALH  286

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
               +    ++++ + W      +LPL  + L +   G K +       + GEVL+VLED  
Sbjct  287   AKKGLFGKLILLNSWLGKTLLKLPLSFRQLHSLLVGGKPHATAIKLSEKGEVLEVLEDCE  346

Query  1246  GDVMKLVSEVREVDGKLWIGTV  1311
             G  +  +SEV E DG+LW+G+V
Sbjct  347   GKTLSFISEVEEKDGQLWMGSV  368



>ref|XP_010454464.1| PREDICTED: strictosidine synthase 3-like [Camelina sativa]
Length=395

 Score =   300 bits (767),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 153/345 (44%), Positives = 218/345 (63%), Gaps = 6/345 (2%)
 Frame = +1

Query  301   RWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFAL  480
             +W  D+++ L    + F+++V GPES+ FD LGRGPY G+ADGR++ W G+   W  FA 
Sbjct  53    QWERDSQNSLQKSKILFLNQVQGPESVAFDPLGRGPYTGVADGRVLFWNGER--WIDFAY  110

Query  481   VTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGG  660
              + N S  IC     + +    + E  CGRPLGLRFDK+ GDLYIADAY GLL VGP+GG
Sbjct  111   TSSNRS-VICDPKPSALS--YLRNEHICGRPLGLRFDKRNGDLYIADAYMGLLKVGPEGG  167

Query  661   IATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDP  840
             +A PL T   G P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ +GR+L+YDP
Sbjct  168   LAMPLVTEAGGVPLGFTNDLDIDDDGTVYFTDSSINYQRRNFLQLVFSGDNSGRVLKYDP  227

Query  841   PTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFP  1020
                K  V++ ++ FPNGV  S+D SF LF E    RL +YW++G K+G T+V A LPG P
Sbjct  228   VAKKAVVLVSNVQFPNGVSISKDGSFFLFCEGDVGRLRRYWLKGKKAGTTDVFALLPGHP  287

Query  1021  DNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFA-GMKMYTVIS  1197
             DNVR N+ G++WVA+ C R     ++  +P  R    RLP+  +    F  G++ + ++ 
Sbjct  288   DNVRTNQNGEFWVALHCRRNYYSYLMARYPKLRMFILRLPITARTHYSFQIGLRPHGLVV  347

Query  1198  LFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +   G+++ VLED  G  ++ VSEV E DGKLW+G+V  N +A 
Sbjct  348   KYSPEGKLMQVLEDSEGKFVRSVSEVEEKDGKLWLGSVLMNFVAV  392



>ref|XP_002273764.1| PREDICTED: strictosidine synthase 1 [Vitis vinifera]
Length=370

 Score =   298 bits (764),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 206/321 (64%), Gaps = 9/321 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             V   FGPES+ FD  G GPY G+ADGR+++W GD  GW  FA+ T    E +        
Sbjct  47    VTGAFGPESIAFDPKGEGPYTGVADGRVLKWEGDGRGWTDFAVTTSERKECV--------  98

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
              P   + E  CGRPLGLRFDKKTGDLYIADAY+GL VV P+GG+ATPL T VEG+ +LF 
Sbjct  99    RPFAPEMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVEPNGGLATPLVTEVEGRRLLFT  158

Query  712   NDLDIHK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             ND+DI +    I+FTDTS  ++R      +L G+ TGRL++YD  + +  V+L  LAF N
Sbjct  159   NDMDIDEVEDVIYFTDTSTDFHRRQFMAALLSGDNTGRLMKYDKSSKEVTVLLRGLAFAN  218

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D SF+L  ETT  ++++YW++GP +G+++V A +PG+PDNVR N KG++WVA+ 
Sbjct  219   GVAMSKDRSFVLVAETTTGKIIRYWLKGPNAGKSDVFAEVPGYPDNVRRNSKGEFWVALH  278

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHG  1248
               +      + ++ W      +LPL  + L +   ++ +       + G+VL+VLED  G
Sbjct  279   AKKGPHANWITSNSWVGKTLLKLPLTFKQLHKLIVVEAHATAIKLSEEGQVLEVLEDCEG  338

Query  1249  DVMKLVSEVREVDGKLWIGTV  1311
               M+ +SEV E +GKLW+G+V
Sbjct  339   KSMRFISEVEEHNGKLWLGSV  359



>ref|XP_010504622.1| PREDICTED: strictosidine synthase 1-like [Camelina sativa]
Length=374

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 204/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N   ++C        P   
Sbjct  56    GPESIAFDPAGEGPYVGVSDGRVLKWRGESLGWTDFAYTSAN--REMC------VRPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKK+GDLYIADAY+GLL+VGP GG+A  L T  EG+P+ F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKSGDLYIADAYFGLLIVGPTGGLARLLVTEAEGQPLRFTNDLDI  167

Query  727   HKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              ++   I+FTDTS K+ R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEHDDVIYFTDTSAKFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTQDVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ ++  W + +  RLP+    L + F G + +       ++GEVL+VLEDK G  ++
Sbjct  288   FAKLSLSQTWFKDLVLRLPISAPRLHSLFTGGRPHATAVKLSESGEVLEVLEDKEGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>ref|XP_002532594.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF29791.1| strictosidine synthase, putative [Ricinus communis]
Length=372

 Score =   298 bits (763),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 203/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W GD+ GW  FA  T N  E I         P   
Sbjct  54    GPESLVFDPNGEGPYTGVADGRILKWQGDSLGWTDFAFTTSNRKECI--------RPFAP  105

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY GL VVGP+GG+ATP+ + VEG P+ F ND+DI
Sbjct  106   ELEHVCGRPLGLRFDKKTGDLYIADAYLGLQVVGPNGGLATPVVSEVEGHPLRFTNDMDI  165

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +N  I+FTDTS+ + R      +L  + TGRLL+YD  + +  ++L+ L+F NGV  S
Sbjct  166   DEQNDVIYFTDTSKIFQRRQFMASILHKDKTGRLLKYDKSSKEVTILLEGLSFANGVALS  225

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ET+ C++ ++W+ GP +G+ +V A LPGFPDN+R N KG++WVA+      
Sbjct  226   KDRSFVLVAETSTCQISRFWLHGPNAGKVDVFAKLPGFPDNIRRNSKGEFWVALHAKEGF  285

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
             + ++ +++ W      + PL  + L +   G K +        +G+++ VLED  G  ++
Sbjct  286   LAKLALSNSWIGKTLLKFPLSFKQLHSLLVGGKPHATAIKLSGDGKIVQVLEDCDGKRLR  345

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  346   FISEVEEKDGKLWIGSV  362



>ref|XP_004249227.1| PREDICTED: strictosidine synthase 1 [Solanum lycopersicum]
Length=372

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 204/318 (64%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G+ADGRI++W GD+ GW  FA+ +    E +         P   
Sbjct  53    GPESIAFDPNGEGPYTGVADGRILKWNGDSDGWVDFAVTSSQRKECV--------HPFAP  104

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFD +TGDLYIADAY GL VVGP GG+ATPL T VEG+P+ F NDLDI
Sbjct  105   QMEHVCGRPLGLRFDTRTGDLYIADAYLGLHVVGPSGGLATPLVTEVEGQPLRFTNDLDI  164

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      ++ G+ TGRL++YD  T    V+L  LAF NGV  S
Sbjct  165   DEQEDVIYFTDTSTQFQRRQFVASVVSGDKTGRLMKYDKSTKSVTVLLRGLAFANGVALS  224

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ET+ CR++++W++GP +G+ +  A+LPG+PDN+R N +G++WV +   R+ 
Sbjct  225   KDKSFVLVAETSTCRVVRHWLKGPHAGKHDTFADLPGYPDNIRRNSRGEFWVGLHSKRSL  284

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
             + +++ ++ W      +LP   Q L      G    T I L  ++G+VLDVLED     +
Sbjct  285   LAKLVTSYSWFGKTTLKLPFTFQQLHFLLVGGQPHATAIKL-SEDGQVLDVLEDLESKTL  343

Query  1258  KLVSEVREVDGKLWIGTV  1311
             K +SEV E +GKLWIG+V
Sbjct  344   KFISEVEEKNGKLWIGSV  361



>ref|XP_007162124.1| hypothetical protein PHAVU_001G125900g [Phaseolus vulgaris]
 gb|ESW34118.1| hypothetical protein PHAVU_001G125900g [Phaseolus vulgaris]
Length=371

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 208/334 (62%), Gaps = 10/334 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K  L    +  +    GPESL FD  G GPY G+ADGRI++W G+  GW  FA  + N 
Sbjct  36    SKDHLHAAQIIHLAGAVGPESLVFDAHGGGPYTGVADGRILKWEGEKQGWTEFAFTSSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        D   P   + E  CGRPLGL+FDKK+GDLYIADAY GL VVG  GG+AT +
Sbjct  96    S--------DCVRPFAPELEHVCGRPLGLKFDKKSGDLYIADAYLGLKVVGSAGGLATGV  147

Query  676   ATHVEGKPILFANDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
              T VEG+P+ F ND+DI  +   I+FT++S    R    +++L G+ TGRL++YD  T +
Sbjct  148   VTEVEGQPLRFTNDMDISEEEDVIYFTESSTISQRRQFMVVLLSGDRTGRLMKYDKSTKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V+L  LAFPNGV  S+D SF+L  ETT C++++ W+ GPK+G+ ++ A LPGFPDN+R
Sbjct  208   VKVLLRDLAFPNGVALSKDGSFVLVAETTTCKILQLWLRGPKAGQVDIFAELPGFPDNIR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQ  1209
              N +G +WVA+    +   + + ++PW   V  ++    + L + FAG K + V     +
Sbjct  268   RNSEGHFWVALHAKGSPFGKWVSSNPWAGKVMIKIGFNFKQLHSSFAGWKPHAVAVKLSE  327

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
              GE+L+VLED  G  +K +SEV E DGKLWI +V
Sbjct  328   RGEILEVLEDSEGKTLKFISEVEEKDGKLWIASV  361



>ref|XP_006291321.1| hypothetical protein CARUB_v10017454mg [Capsella rubella]
 gb|EOA24219.1| hypothetical protein CARUB_v10017454mg [Capsella rubella]
Length=374

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N   ++C        P   
Sbjct  56    GPESIAFDPSGEGPYVGVSDGRVLKWRGESLGWTDFAYTSAN--REMC------VRPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKK+GDLYIADAY+GLLV GP GG+A PL T  EG+   F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDKKSGDLYIADAYFGLLVAGPAGGLAKPLVTEAEGQTFRFTNDLDI  167

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               ++  I+FTDTS  + R      +L  + TGR ++YD  + K  V+L  LAF NGV  S
Sbjct  168   DEQDDVIYFTDTSAIFQRRQFLAAVLNVDKTGRFIKYDRSSKKATVLLQGLAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N KG++WVA+   +  
Sbjct  228   KDRSFVLVVETTTCKILRLWLSGPNAGTQDVFAELPGFPDNIRRNSKGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPL-PMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ +   W + +  RLP+ P +  + F G + +       ++GEVL+VLEDK G  ++
Sbjct  288   FAKLSLTQTWFKDLVLRLPISPPRLHSLFTGGRPHATAVKLSESGEVLEVLEDKEGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>ref|XP_003521146.1| PREDICTED: strictosidine synthase 1-like [Glycine max]
Length=371

 Score =   296 bits (757),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/334 (45%), Positives = 205/334 (61%), Gaps = 10/334 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K  L    L  V    GPESL FD  G GPY G+ADGRI++W G+  GW  FA+ + N 
Sbjct  36    SKDHLHAARLLHVTGAVGPESLVFDADGGGPYTGVADGRILKWEGEERGWTEFAVTSSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        D   P   + E  CGRPLGLRFDKK+GDLYIADAY GL VVG  GG+AT +
Sbjct  96    S--------DCVRPFAPELEHICGRPLGLRFDKKSGDLYIADAYLGLKVVGSTGGLATEV  147

Query  676   ATHVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
              T VEG+P+ F ND+DI ++   I+FTD++  + R    L++L G+ TGRL++Y   T +
Sbjct  148   VTEVEGQPLQFTNDMDISEDADVIYFTDSTTIFQRRQFMLVLLGGDKTGRLMKYHKSTKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               ++L  LAFPNGV  S+D SF+L  ET  CR+++ W+ GPK+G+ +  A LPGFPDN+R
Sbjct  208   VTILLRDLAFPNGVALSKDGSFVLVAETATCRILQLWLGGPKAGQVDTFAVLPGFPDNIR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQ  1209
              N +G +WVA+   R+   + + ++PW      ++    + L   FAG K +        
Sbjct  268   RNSEGHFWVALHAKRSPFAKWVSSNPWVGKALLKIGFNFKQLHTSFAGWKPHAAAVKLSD  327

Query  1210  NGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
              GE+L+VLED  G  +K +SEV E DGKLWI +V
Sbjct  328   KGEILEVLEDCDGKTLKFISEVEEKDGKLWIASV  361



>gb|KEH23602.1| strictosidine synthase family protein [Medicago truncatula]
Length=369

 Score =   295 bits (756),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/338 (45%), Positives = 208/338 (62%), Gaps = 10/338 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K+ L    L  V    GPESL FD+ G GPY G+ADGRI++W G+  GW  FA+ + N 
Sbjct  36    SKNNLHAAKLLNVTGAVGPESLVFDSNGDGPYTGVADGRILKWEGEERGWTQFAVTSSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        +   P   + E  CGRPLGL+FDKK+GDLYIADAY GL VVGP GG+AT +
Sbjct  96    S--------NCVHPFAPELEHVCGRPLGLKFDKKSGDLYIADAYLGLKVVGPAGGLATQV  147

Query  676   ATHVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             AT  EG+P  F ND+DI ++   I+FTD+S  Y R    L++L G+ TGRL++YD  T +
Sbjct  148   ATEAEGQPFHFTNDMDISEDEDVIYFTDSSTVYRRRQFMLVLLSGDKTGRLMKYDKSTKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V+L  LAFPNGV  S+D SFLL  ET+ C++++ W+ GP +G+ +  A LPGFPDNVR
Sbjct  208   VKVLLSGLAFPNGVALSKDGSFLLVAETSTCKILRLWLRGPNAGQVDTFAVLPGFPDNVR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              N +GQ+WVA+    T   + + ++ W      +L    ++L     MK +         
Sbjct  268   RNSEGQFWVALHAKETPFAKWMSSNLWAGKALSKLG-NFKWLHASLAMKPHAAAIKLSDE  326

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             GE+L+VLED  G  +K +SE+ E DGKLW+ +V   +I
Sbjct  327   GEILEVLEDCEGKTLKFISEIEEKDGKLWMASVLMPYI  364



>ref|XP_002323255.1| strictosidine synthase family protein [Populus trichocarpa]
 gb|EEF05016.1| strictosidine synthase family protein [Populus trichocarpa]
Length=375

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 149/332 (45%), Positives = 206/332 (62%), Gaps = 13/332 (4%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAG---WETFALVTPNWSEKICGLGV  522
             V    GPESL FD  G GPY G+ADGR+++W+  + G   W  FA  + N +E +     
Sbjct  49    VSGAVGPESLVFDPNGEGPYTGVADGRVLKWIAGDDGSGSWTDFATTSSNRNECV-----  103

Query  523   DSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPI  702
                 P   + E  CGRPLGLRFDKKTG+LYIADAY GL VVGP GG+ATP+ T +EG+P+
Sbjct  104   ---RPFAPEMEHVCGRPLGLRFDKKTGNLYIADAYLGLQVVGPTGGLATPVVTELEGQPM  160

Query  703   LFANDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLA  879
              F NDLDI  +   I+FTDTS  + R    L +L  + TGRLL+YD  + +  V+   LA
Sbjct  161   RFTNDLDIDEQEDVIYFTDTSMVFQRRQFILSLLTKDKTGRLLKYDKSSKEVTVLARGLA  220

Query  880   FPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWV  1059
             F NGV  S+D +FLL  ETT CR++++W+ GP +G+++V   LPGFPDN+R N KG++WV
Sbjct  221   FANGVALSKDSTFLLVAETTTCRILRFWLHGPNAGKSDVFTELPGFPDNIRRNSKGEFWV  280

Query  1060  AIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLE  1236
             A+   +    +V++++ W      + PL  + L +   G K +       + G+VLDVLE
Sbjct  281   ALHSKKGLFAKVVLSNSWIGKTLLKFPLSFKQLHSLLVGGKAHATAIKLSEEGKVLDVLE  340

Query  1237  DKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             D  G  ++ +SEV E DGKLWIG+V    + T
Sbjct  341   DCDGKTLRFISEVEEKDGKLWIGSVLMPFLGT  372



>ref|XP_010269382.1| PREDICTED: strictosidine synthase 1-like [Nelumbo nucifera]
Length=371

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 199/317 (63%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W G+  GW  FA+ +P           D   P+  
Sbjct  52    GPESLAFDPNGEGPYTGVADGRILKWQGEGQGWTEFAVTSPQRK--------DCVQPQAP  103

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
               E  CGRPLG+RF   TGDLYIAD+Y G   VGP GG+AT L T  EG+P+ F NDLDI
Sbjct  104   HMEHVCGRPLGIRFHPTTGDLYIADSYLGFHRVGPAGGLATRLITEAEGEPLTFTNDLDI  163

Query  727   HKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              ++   I+FTDTS K+ R     ++L G+ TGRL++YD    +  V+L  LAF NGV  S
Sbjct  164   DEHEDVIYFTDTSTKFQRRQFISVILSGDKTGRLMKYDRSRNEVKVLLRGLAFANGVALS  223

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETTNCR++++W++GPK+G  +V A LPGFPDN+R N KG++WVA+   +  
Sbjct  224   KDRSFVLVAETTNCRVLRFWLQGPKAGTHDVFAELPGFPDNIRRNSKGEFWVALHSKKGL  283

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLAR-FAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
             +    +++ W      +LPL  + L     G K++      D+ G V++VLED  G  ++
Sbjct  284   LSGWAVSNCWVGKALLKLPLSFRKLHLVLIGWKVHATAIKLDEEGRVVEVLEDSQGRTLR  343

Query  1261  LVSEVREVDGKLWIGTV  1311
             L+SEV E DG LWIG+V
Sbjct  344   LISEVEEKDGNLWIGSV  360



>ref|XP_001769001.1| predicted protein [Physcomitrella patens]
 gb|EDQ66199.1| predicted protein [Physcomitrella patens]
Length=397

 Score =   296 bits (757),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/366 (42%), Positives = 229/366 (63%), Gaps = 5/366 (1%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDT  393
             DP E+S   G  +F P      P  +  + +  D +++L  G +++  +  GPESL FD+
Sbjct  22    DPLEVSMGRGIVEFDPQHVPPPPMHQ-FKNFPRDTQNKLQKGEVKWQGQFLGPESLTFDS  80

Query  394   LGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRP  573
              GRGPY G++DGRIVR+ G  AGW TFA  + NWSE    L +  TTP     E  CGRP
Sbjct  81    QGRGPYTGVSDGRIVRYNGPQAGWSTFAYTSRNWSEACTPLSL--TTPNH-ALEHVCGRP  137

Query  574   LGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFT  753
             LGLRF K TG+L+IADAY G++ VG  GG A  + + ++G P+ F NDLD   +G+++FT
Sbjct  138   LGLRFHKGTGELWIADAYLGIMKVGAQGGQAEVVLSEIDGVPMKFVNDLDFDNDGNLYFT  197

Query  754   DTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTE  933
             D+S  + R    L ++E + TGR ++Y+P T +T +++D L F NGV  S+D  F+L  E
Sbjct  198   DSSTHWQRRQFLLCLMEADDTGRFIKYNPTTKETEILIDKLRFSNGVAVSKDGMFVLVAE  257

Query  934   TTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPW  1113
                 RL++YWV+G K+G  EV A+LPG+PDNVR NE G +W+A  C R +++ +L  +P 
Sbjct  258   GRLGRLLRYWVKGGKAGTYEVFADLPGWPDNVRRNEAGDFWIAFHCPRRKLEMILSRYPL  317

Query  1114  TRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGK  1293
              R++  RLP+  + +      K + ++  +  +G+  ++LED+ G V K++SE  E DGK
Sbjct  318   LRTLIIRLPISSKNVYWMLAGKPHGMLMRYGPDGDFKEILEDQEGKVAKMLSEAEEHDGK  377

Query  1294  LWIGTV  1311
             L++G+V
Sbjct  378   LYLGSV  383



>ref|XP_010056166.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
 gb|KCW90056.1| hypothetical protein EUGRSUZ_A02258 [Eucalyptus grandis]
Length=372

 Score =   295 bits (754),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 205/333 (62%), Gaps = 10/333 (3%)
 Frame = +1

Query  319   KSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWS  498
             + RL    +  V   FGPESL FD  G GPY G+ADGRI++W GD  GW  FA  +    
Sbjct  37    RDRLHASRVVPVAGAFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSQRK  96

Query  499   EKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLA  678
             E I         P   + E  CGRPLGLRFDKKTGDLYIADAY+GL+VVGPDGG+AT +A
Sbjct  97    ECI--------RPFAPELEHICGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVA  148

Query  679   THVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKT  855
                EG+P  F NDLDI ++   I+FTD+S  ++R       L G+ TGRL++YD  + + 
Sbjct  149   NEAEGEPFWFTNDLDIDESEDVIYFTDSSTNFHRRQFMNSCLSGDKTGRLMKYDKSSKEL  208

Query  856   HVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRA  1035
              V+L  +AF NGV  S+D  FLL  ET  CR++++W++GP +G+ ++ A LPG+PDN+R 
Sbjct  209   KVLLRGIAFANGVALSKDGMFLLMAETATCRILRFWLKGPNAGKFDIFAELPGYPDNIRR  268

Query  1036  NEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQN  1212
             N +G++WV +   R  +   L+++    +   RLP+  Q L + F G K           
Sbjct  269   NSRGEFWVGLHAKRGPVARFLLSNSLIGNFALRLPISFQQLHSLFVGGKADATAVKLGTE  328

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             GE+L+VLED+ G  ++ +SEV E D KLWI +V
Sbjct  329   GEILEVLEDREGKTLQFISEVEERDNKLWIASV  361



>gb|KDP37825.1| hypothetical protein JCGZ_06727 [Jatropha curcas]
Length=373

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 210/331 (63%), Gaps = 10/331 (3%)
 Frame = +1

Query  325   RLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEK  504
             RL    +  V    GPESL FD  G GPY G+ADGR+++W+GD  GW  FA  T +  E 
Sbjct  40    RLHYAEVVHVTGAVGPESLVFDPNGEGPYTGVADGRVLKWLGDGRGWLDFATTTSDRREC  99

Query  505   ICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATH  684
             I         P   + E  CGRPLGLRFDKKTGDLYIADAY GL VVGP+GG+A P+ T 
Sbjct  100   I--------RPFAPEMEHVCGRPLGLRFDKKTGDLYIADAYLGLQVVGPNGGLARPVVTE  151

Query  685   VEGKPILFANDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHV  861
             V+G P+ F ND+DI  +   I+FTDTS+ + R      +L  + TGRLL++D  + +  +
Sbjct  152   VKGHPLRFTNDMDIDEQEDVIYFTDTSKVFQRRQFIASVLSNDKTGRLLKFDKSSKEVTI  211

Query  862   VLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANE  1041
             +L+ LAF NGV  S+D+SF+L  ETT C+++++W+ GP +G+ +V A LPGFPDN+R N 
Sbjct  212   LLEGLAFANGVALSKDNSFVLVAETTTCQVLRFWLHGPDAGKVDVFAVLPGFPDNIRRNS  271

Query  1042  KGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGE  1218
             KG++WVA+   +    ++++++ W      +LPL  + L +   G K +       ++G+
Sbjct  272   KGEFWVALHAKKGLFAKLVLSNSWIGKTLLKLPLSFKQLHSLLVGGKPHATAIKLSEDGK  331

Query  1219  VLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             +L+VLED  G  ++ +SEV E DGKL IG+V
Sbjct  332   ILEVLEDCEGKKLRFISEVEEKDGKLLIGSV  362



>ref|XP_009116408.1| PREDICTED: strictosidine synthase 1 [Brassica rapa]
Length=374

 Score =   293 bits (751),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N  + +         P   
Sbjct  56    GPESIAFDPSGEGPYVGVSDGRVLKWRGESLGWSDFAYTSANREKCV--------RPFAP  107

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFD+KTGDLYIADAY+GL++VGP GG+A  L T  EG+P  F NDLDI
Sbjct  108   ELEHVCGRPLGLRFDEKTGDLYIADAYFGLMIVGPAGGLAKSLVTEAEGQPFRFTNDLDI  167

Query  727   HKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              ++   I+FTDTS ++ R      +L  + TGRL++YD  + K  V++  +AF NGV  S
Sbjct  168   DEHQDVIYFTDTSTRFQRRQFLAAVLNVDKTGRLIKYDRTSKKVTVLVQGIAFANGVALS  227

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++WVA+   +  
Sbjct  228   KDRSFVLVAETTTCKILRLWLSGPNAGAQDVFAELPGFPDNIRRNSNGEFWVALHSKKGL  287

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               ++ ++  W R +  R P+    L + F G + +       ++GEVL+VLED+ G  ++
Sbjct  288   FAKLSLSQAWFRDLLLRFPISGPRLHSLFTGGRPHATAMKLSESGEVLEVLEDREGKRLR  347

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLWIG+V
Sbjct  348   FISEVEEKDGKLWIGSV  364



>ref|XP_011000438.1| PREDICTED: strictosidine synthase 1 [Populus euphratica]
Length=375

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 208/332 (63%), Gaps = 13/332 (4%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAG---WETFALVTPNWSEKICGLGV  522
             V    GPESL FD  G GPY G+ADGR+++W+  + G   W  FA  + N ++ +     
Sbjct  49    VSGAVGPESLVFDPNGEGPYTGVADGRVLKWIAGDDGSGSWTDFATTSSNRNKCV-----  103

Query  523   DSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPI  702
                 P   + E  CGRPLGLRFDKKTG+LYIADAY GL VVGP GG+ATP+ T +EG+P+
Sbjct  104   ---RPFAPEMEHVCGRPLGLRFDKKTGNLYIADAYLGLQVVGPTGGLATPVVTELEGQPM  160

Query  703   LFANDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLA  879
              F NDLDI  +   I+FTDTS  + R    L +L  + TGRLL+YD  + +  V+   LA
Sbjct  161   RFTNDLDIDEQEDVIYFTDTSMVFQRRQFMLSLLTKDKTGRLLKYDRSSKEVTVLARGLA  220

Query  880   FPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWV  1059
             F NGV  S+D +FLL  ETT+CR++++W+ GP +G+++V + LPGFPDN+R N KG++WV
Sbjct  221   FANGVALSKDSTFLLVAETTSCRILRFWLHGPNAGKSDVFSELPGFPDNIRRNSKGEFWV  280

Query  1060  AIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLE  1236
             A+   +    +V++++ W      + PL  + L +   G K +       + G++LDVLE
Sbjct  281   ALHSKKGLFAKVVLSNSWIGRTLLKFPLSFKQLHSLLVGGKAHATAIKLSEEGKILDVLE  340

Query  1237  DKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
             D  G  ++ +SEV E DGKLWIG+V    + T
Sbjct  341   DCDGKTLRFISEVEEKDGKLWIGSVLMPFLGT  372



>ref|XP_009797408.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=372

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 200/318 (63%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W GD+ GW  FA+ +    E +         P   
Sbjct  53    GPESLAFDPNGEGPYTGVADGRILKWQGDSQGWVDFAVTSSQRKECV--------RPFAP  104

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
               E  CGRPLGLRFD +TGDLYIADAY GL VVGP GG+ATPL T VEG+P+ F ND+D+
Sbjct  105   HMEHVCGRPLGLRFDTRTGDLYIADAYLGLQVVGPSGGLATPLVTEVEGQPLRFTNDMDL  164

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      ++ G+ TGRL++YD  T    V+L  LAF NGV  S
Sbjct  165   DEQEDIIYFTDTSTQFQRRQFIASVVIGDKTGRLMKYDKSTKAVTVLLRGLAFANGVALS  224

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ET+  R++KYW++GP +G+    A+LPG+PDN+R N +G++WVA+   R+ 
Sbjct  225   KDKSFVLVAETSTGRIVKYWLKGPDAGKHATFADLPGYPDNIRRNSRGEFWVALHSKRSL  284

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
             +  ++ ++ W      +LP   Q L      G    T I L  + G+VL+VLED     +
Sbjct  285   LARLVTSNSWLGRTLLKLPFTFQQLHYLLVGGQPHATAIKL-SEEGQVLEVLEDVESKTL  343

Query  1258  KLVSEVREVDGKLWIGTV  1311
             K +SEV E +GKLWIG+V
Sbjct  344   KFLSEVEEKNGKLWIGSV  361



>ref|XP_010672984.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 210/324 (65%), Gaps = 11/324 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             +D  FGPESL FD  G GPY G++DGRI++W+     W  FA  +P    ++C       
Sbjct  48    IDGAFGPESLAFDAAGDGPYAGISDGRIIKWLPHQRRWVDFAFTSP--LREVC-----EK  100

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                  + E +CGRPLGL F+ KTG+LYIADAY GLLVVGP+GG+A  +AT VEG P+ F 
Sbjct  101   QSNHEQMEHKCGRPLGLSFNDKTGELYIADAYLGLLVVGPNGGLARSVATEVEGIPLGFT  160

Query  712   NDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI  ++G ++FT +S +Y R ++  ++L  + TGRLL+YDP T +   +LD+L FPN
Sbjct  161   NGLDIDQQSGDVYFTSSSTRYPRRSYMSLILSNDKTGRLLKYDPETKQVTKLLDNLTFPN  220

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEG-PKSGRTEVIANLPGFPDNVRANEKGQYWVAI  1065
             GV  S++  FLL  ETT+C++++YW++  PKSG  EV+A LPG+PDN++ N KGQYWV I
Sbjct  221   GVSLSKNRKFLLLIETTSCQILRYWLKNTPKSGTVEVLAELPGYPDNIKMNSKGQYWVGI  280

Query  1066  DCCRTRIQEVLINHPWTRSVYFRLPL-PMQYLARFAGMKMYTVISLFDQNGEVLDVLEDK  1242
                R ++ + L+++ W  +   +LP   ++ +  F  ++   +    D+N  VL +LEDK
Sbjct  281   YSKRGKVLKWLLSYHWVGNTIVKLPFNAVELVKLFVRLRAIGLAVKLDENCNVLQMLEDK  340

Query  1243  HGDVMKLVSEVREVDGKLWIGTVA  1314
              G ++K VSEV E DG LW G+V 
Sbjct  341   SG-MLKFVSEVVEKDGNLWFGSVV  363



>ref|XP_001783886.1| predicted protein [Physcomitrella patens]
 gb|EDQ51283.1| predicted protein [Physcomitrella patens]
Length=386

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 213/333 (64%), Gaps = 3/333 (1%)
 Frame = +1

Query  313   DNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPN  492
             DN+++L  G +    +  GPESL FD  GRGPY G++DGRI+R+ G   GW TFA  + N
Sbjct  27    DNQNKLQNGEIVGRGQFLGPESLTFDAQGRGPYTGVSDGRILRYDGPERGWTTFAYTSKN  86

Query  493   WSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATP  672
              SE +C     ++    + FE  CGRPLGLRF K+TGDL+IADAY G+L VGP+GG A  
Sbjct  87    RSE-VCA--PKTSLAPNFAFEHVCGRPLGLRFHKETGDLWIADAYLGILKVGPEGGHAEV  143

Query  673   LATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             +   +EG P+ F NDLD    G+++FTD+S ++ R      ++E + T R ++Y+  T +
Sbjct  144   VLNEIEGVPMKFLNDLDFDDEGNLYFTDSSTRWQRRQFLHSVMEADDTARFIKYNLATKE  203

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V++D L F NGV  S+D +F++  E     L +YW++G K+G  E+ A+LPG+PDNVR
Sbjct  204   ATVLIDHLRFSNGVAVSKDGTFVVVAECRTGILWRYWLKGSKAGTHELFADLPGWPDNVR  263

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              NE G +WVA+   R   +E L  HPW R +  RLP+P+QY+ +    K   +I  +  +
Sbjct  264   CNEAGDFWVALHARRCWSEEFLTKHPWIRYLIIRLPVPVQYVYKLLTGKPSGMILRYGPD  323

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             G V +VLED+ G V+K+VSEV E DGKL+IG+V
Sbjct  324   GAVKEVLEDQEGKVVKMVSEVEEHDGKLYIGSV  356



>ref|XP_009627580.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=372

 Score =   292 bits (747),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 203/318 (64%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W GD+ GW  FA+ +    E  C   V    P   
Sbjct  53    GPESLAFDPNGEGPYTGVADGRILKWQGDSEGWVDFAVTSSQRKE--C---VRHFAPH--  105

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
               E  CGRPLGLRFD +TGDLYIADAY GL VVGP GG+ATPL T VEG+P+ F ND+D+
Sbjct  106   -MEHVCGRPLGLRFDTRTGDLYIADAYLGLQVVGPSGGLATPLVTEVEGQPLHFTNDMDL  164

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      ++ G+ TGRL++YD  T    V+L  LAF NGV  S
Sbjct  165   DEQEDIIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDKSTKAVTVLLRGLAFANGVALS  224

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ET+  R+++YW++GP +G+ +  A+LPG+PDN+R N +G++WVA+   R+ 
Sbjct  225   KDKSFVLVAETSTGRIVRYWLKGPDAGKHDTFADLPGYPDNIRRNSRGEFWVALHSKRSL  284

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
             + +++ ++ W      +LP   Q L      G    T I L  + G+VL+VLED     +
Sbjct  285   LAQLVTSNSWLGRTLLKLPFTFQQLHYLLVGGQPHATAIKL-SEEGQVLEVLEDVESKTL  343

Query  1258  KLVSEVREVDGKLWIGTV  1311
             K +SEV E +G+LWIG+V
Sbjct  344   KFLSEVEEKNGRLWIGSV  361



>ref|XP_008443273.1| PREDICTED: strictosidine synthase 1 [Cucumis melo]
Length=378

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 148/322 (46%), Positives = 203/322 (63%), Gaps = 10/322 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             V    GPESL FD  G GPY G+ADGRI++W GD  GW  FA+ + + SE +        
Sbjct  54    VTGAVGPESLIFDPNGEGPYTGVADGRILKWTGDGRGWTDFAVTSSDRSECV--------  105

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
              P   + E  CGRPLGLRFDK TGDLYIADAY GL VVGP GG+AT L +  EGKP+ F 
Sbjct  106   RPFAPELEHVCGRPLGLRFDKTTGDLYIADAYLGLHVVGPGGGLATKLVSEFEGKPLRFT  165

Query  712   NDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             NDLDI  +N  I+FTD+S  + R      +L G++TGRL +Y   + +  V+L  LAF N
Sbjct  166   NDLDIDEENDIIYFTDSSTVFQRRQFMASILSGDSTGRLFKYHRASKQVTVLLQGLAFAN  225

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+DHS++L  E+T+ R++++W++G ++G  +V+A LPGFPDN+R N KG+YWVA+ 
Sbjct  226   GVALSKDHSYVLVVESTSGRILRFWLQGTEAGNFDVLARLPGFPDNIRRNPKGEYWVALH  285

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
               +  I  ++ +  W   +  +LP+  + L     G K +       + GEVL++LED  
Sbjct  286   SKKGIIGNLVTSTSWFGKLLLKLPIDFKRLHGLLVGGKAHATAVRLSEEGEVLEILEDCE  345

Query  1246  GDVMKLVSEVREVDGKLWIGTV  1311
             G  +K +SEV E DGKLW G+V
Sbjct  346   GKTLKFISEVEEKDGKLWFGSV  367



>ref|XP_010108510.1| Strictosidine synthase 1 [Morus notabilis]
 gb|EXC19610.1| Strictosidine synthase 1 [Morus notabilis]
Length=386

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 149/330 (45%), Positives = 209/330 (63%), Gaps = 11/330 (3%)
 Frame = +1

Query  334   LGNLEFVDEV--FGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKI  507
              G+ EF+  V   GPES  FD+LG GPY G++DGRI++W  D   W  FA+ +PN S   
Sbjct  50    FGHFEFLPIVGALGPESYAFDSLGDGPYTGVSDGRIIKWQEDQRRWIDFAVTSPNRSS--  107

Query  508   CGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHV  687
             C    D         E  CGRPLGL F K +GDLYIADAY GLLVVG +GG+AT + T  
Sbjct  108   CEGSHDHHLT-----EHICGRPLGLSFHKTSGDLYIADAYMGLLVVGAEGGLATRVVTQA  162

Query  688   EGKPILFANDLDIH-KNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVV  864
             +G P  F N LDI+ +NG ++FTD+S +Y R N+  ++L G+ TGRL+ YDP + +  V+
Sbjct  163   QGVPFAFPNGLDINDENGLVYFTDSSSRYQRRNYLSVILSGDTTGRLMSYDPQSKQVDVL  222

Query  865   LDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEK  1044
             L++L+FPNGV  S++  FLL  ETT+CR+M+YW+  PK+G  EV + LPGFPDN++ + +
Sbjct  223   LENLSFPNGVALSQNGDFLLIAETTSCRIMRYWLRTPKAGTFEVFSQLPGFPDNIKGSPR  282

Query  1045  GQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP-MQYLARFAGMKMYTVISLFDQNGEV  1221
             G +WVAI   R ++ E+++++P       +LP   M+        +   ++    + G +
Sbjct  283   GGFWVAIHSERKKVFELILSYPSIAKAILQLPFDVMKAYTSLGKWRGRGLMIRLSEEGVL  342

Query  1222  LDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             LDVLEDK G   K VSEV E DG LWIG++
Sbjct  343   LDVLEDKSGVKWKAVSEVEERDGNLWIGSI  372



>ref|XP_010672985.1| PREDICTED: strictosidine synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/323 (46%), Positives = 208/323 (64%), Gaps = 11/323 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             +   FGPESL FD  G GPY G+ADGRI++W  D+  W  FA  T + S K C      T
Sbjct  52    LQAAFGPESLAFDPSGGGPYTGVADGRILKWDPDSNSWLDFAF-TSSSSRKEC------T  104

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                  + E  CGRPLGLRF++K+GDLYIADAY+GL  VGP+GG+A+ +AT  EG P+ F 
Sbjct  105   RAFAPELEHVCGRPLGLRFEQKSGDLYIADAYFGLQRVGPEGGLASNVATQAEGVPLYFT  164

Query  712   NDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             ND+DI  +N  I+FTDTS K+ R +    +L G+ TGR ++Y+  T +  V+L  LAF N
Sbjct  165   NDMDIDEENDIIYFTDTSTKFRRRHFMPSILSGDQTGRFIKYNKLTKEVTVLLRGLAFAN  224

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D SF+L  ET+ CR+++YW++GP +G+ E    LPGFPDN+R N KG++WVA+ 
Sbjct  225   GVALSKDRSFVLVAETSTCRILRYWLQGPNAGQVETFVVLPGFPDNIRRNSKGEFWVALH  284

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPL--PMQYLARFAGMKMYTVISLFDQNGEVLDVLEDK  1242
               +TR+ + L+ + W  +V  +LPL    +  A F G      + L ++ G+ ++VLED 
Sbjct  285   AKKTRLADWLLKNSWVGNVLLKLPLSSAQRLHALFMGGHHAIAVKL-NEEGKTVEVLEDA  343

Query  1243  HGDVMKLVSEVREVDGKLWIGTV  1311
              G  ++  SEV E +GKLWIG+V
Sbjct  344   QGKQVRYASEVEERNGKLWIGSV  366



>ref|XP_006421116.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
 gb|ESR34356.1| hypothetical protein CICLE_v10005245mg [Citrus clementina]
Length=360

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 206/328 (63%), Gaps = 18/328 (5%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             ++   GPES  FD LG GPY G++DGRI++W  D   W  FAL +PN          D  
Sbjct  31    IEGAIGPESFAFDALGEGPYTGVSDGRIIKWHQDQRRWLHFALTSPNRDGCEGAYEYDHA  90

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                    E  CGRPLGL F+K  GDLYIADAY+GLL VGP+GG+AT +AT  EG P  F 
Sbjct  91    AK-----EHICGRPLGLCFNKTNGDLYIADAYFGLLKVGPEGGLATAVATQSEGIPFRFC  145

Query  712   NDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI ++ G ++FTD+S ++ R NH  ++L G+ TGRL++YDP T +  V+L +L+FPN
Sbjct  146   NSLDIDQSTGIVYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVLLGNLSFPN  205

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  SED +++L  ETT+CR+++YW++  K+G  E++A LPGFPDNV+ + +G +WV I 
Sbjct  206   GVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNVKRSPRGGFWVGIH  265

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPL-------PMQYLARFAGMKMYTVISLFDQNGEVLD  1227
               R  I +++++ PW  +V  +LP+        +  L+   GM M        + G VL+
Sbjct  266   SRRKGISKLVLSFPWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMR-----ISEQGNVLE  320

Query  1228  VLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             +LE+    + + +SEV E DG LWIG+V
Sbjct  321   ILEEIGTKMWRSISEVEEKDGNLWIGSV  348



>gb|AES81258.2| strictosidine synthase family protein [Medicago truncatula]
Length=369

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 205/338 (61%), Gaps = 10/338 (3%)
 Frame = +1

Query  316   NKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNW  495
             +K+ L    L  +    GPESL FD+ G GPY G+ADGRI++W G+  GW  FA+ + N 
Sbjct  36    SKNSLHAAKLLDLTGAVGPESLVFDSNGDGPYTGVADGRILKWEGEERGWTEFAVTSSNR  95

Query  496   SEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPL  675
             S        D   P   + E  CGRPLGL+FDKK GDLY+ADAY GL VVGP GG+AT +
Sbjct  96    S--------DCVRPFAPELEHVCGRPLGLKFDKKNGDLYMADAYLGLNVVGPAGGLATQV  147

Query  676   ATHVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGK  852
             AT  EG P  F NDLDI ++   I+FTD+S  Y R  H L+ L G+ TGRL++YD  + +
Sbjct  148   ATEAEGLPFHFTNDLDISEDEDVIYFTDSSSVYQRRQHMLVTLSGDKTGRLMKYDKSSKE  207

Query  853   THVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVR  1032
               V+L  L FPNGV  S+D SFLL  ET+  R+++ W+ GP  G+ +  A LPGFPDN+R
Sbjct  208   VKVLLSGLFFPNGVALSKDGSFLLVAETSISRILRLWLNGPNVGQIDTFAVLPGFPDNIR  267

Query  1033  ANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQN  1212
              N +G +WVA+   +T   + + ++ W R    +L    +  A  A       I L D+ 
Sbjct  268   RNSEGHFWVALHSKKTPFTKWISSNLWARKALLKLRNFKRLQALLATKPHAAAIKLSDE-  326

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             GE+++ LED+ G  +K +SEV E DGKLW+ +V   +I
Sbjct  327   GEIIESLEDREGKTLKFISEVEEKDGKLWMASVLMPYI  364



>ref|XP_006351273.1| PREDICTED: strictosidine synthase 1-like [Solanum tuberosum]
Length=372

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/318 (46%), Positives = 202/318 (64%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G+ADGRI++W GD+ GW  FA+ +     K C        P   
Sbjct  53    GPESVAFDPNGEGPYTGVADGRILKWNGDSDGWVDFAVTSSQ--RKQC------VHPFAP  104

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFD +TGDLY+ADAY GL VVGP GG+AT L T VEG+ + F NDLDI
Sbjct  105   QMEHVCGRPLGLRFDTRTGDLYVADAYLGLHVVGPSGGLATSLVTEVEGQHLRFTNDLDI  164

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +   I+FTDTS ++ R      ++ G+ TGRL++YD  T    V+L  LAF NGV  S
Sbjct  165   DEQEDVIYFTDTSTQFQRRQFIASVVSGDKTGRLMKYDISTKAVTVLLRGLAFANGVALS  224

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETT CR++++W++GP +G+ +  A+LPG+PDN+R N +G++WV +   R+ 
Sbjct  225   KDKSFVLVAETTTCRVVRHWLKGPHAGKHDTFADLPGYPDNIRRNSRGEFWVGLHSKRSL  284

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
             + +++ ++ W      +LP   Q L      G    T I L  ++G+VL+VLED     +
Sbjct  285   LAKLVTSNSWLGKTILKLPFTFQQLHFLLVGGQPHATAIKL-SEDGQVLEVLEDLESKTL  343

Query  1258  KLVSEVREVDGKLWIGTV  1311
             K +SEV E +GKLWIG+V
Sbjct  344   KFISEVEEKNGKLWIGSV  361



>ref|XP_006494389.1| PREDICTED: strictosidine synthase 1-like [Citrus sinensis]
 gb|KDO41713.1| hypothetical protein CISIN_1g018242mg [Citrus sinensis]
Length=359

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 206/328 (63%), Gaps = 18/328 (5%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             ++   GPESL FD LG GPY G++DGRI++W  D   W  FA  +PN          D  
Sbjct  30    IEGAIGPESLAFDALGEGPYTGVSDGRIIKWHQDQRRWLHFARTSPNRDGCEGAYEYDHA  89

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                    E  CGRPLGL F+K  GDLYIADAY+GLL VGP+GG+AT +AT  EG P  F 
Sbjct  90    AK-----EHICGRPLGLCFNKTNGDLYIADAYFGLLKVGPEGGLATAVATQSEGIPFRFC  144

Query  712   NDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI ++ G I+FTD+S ++ R NH  ++L G+ TGRL++YDP T +  V+L +L+FPN
Sbjct  145   NSLDIDQSTGIIYFTDSSSQFQRRNHISVILSGDKTGRLMKYDPATKQVTVLLGNLSFPN  204

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  SED +++L  ETT+CR+++YW++  K+G  E++A LPGFPDN++ + +G +WV I 
Sbjct  205   GVALSEDGNYILLAETTSCRILRYWLKTSKAGTIEIVAQLPGFPDNIKRSPRGGFWVGIH  264

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPL-------PMQYLARFAGMKMYTVISLFDQNGEVLD  1227
               R  I +++++ PW  +V  +LP+        +  L+   GM M        + G VL+
Sbjct  265   SRRKGISKLVLSFPWIGNVLIKLPIDIVKIHSSLVKLSGNGGMAMR-----ISEQGNVLE  319

Query  1228  VLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             +LE+    + + +SEV E DG LWIG+V
Sbjct  320   ILEEIGRKMWRSISEVEEKDGNLWIGSV  347



>ref|XP_004307669.1| PREDICTED: strictosidine synthase 1-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=364

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 200/317 (63%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W  ++  W  FA+ T    E +         P   
Sbjct  46    GPESLAFDPNGDGPYTGVADGRILKWDPNHHRWTDFAVTTSQRKECV--------RPFAP  97

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRF+KKTGDLYIADAY GL VVGP GG+A+ +   VEG+ + F ND+DI
Sbjct  98    ELEHVCGRPLGLRFNKKTGDLYIADAYLGLQVVGPAGGLASQVVKEVEGQQLHFTNDIDI  157

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               K   I+FTD+S  ++R      +L G+ TGRLL+Y+  + +  V+L  LAF NGV  S
Sbjct  158   DEKKDVIYFTDSSTVFHRRQFMSSILNGDKTGRLLKYNISSQEVVVLLQGLAFANGVALS  217

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +DHSF+L  ETTNCR++++W+ GP +G T++   LPGFPDN+R N KG++WVA+   +  
Sbjct  218   KDHSFVLVAETTNCRILRHWLYGPNAGDTDIFTKLPGFPDNIRRNSKGEFWVALHAKKGL  277

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
               + L+++ W      +LPL  + L +   G K Y       + G+VL VLED  G  M+
Sbjct  278   FAKWLVSNTWAGKSLLKLPLGFKRLHSLLVGGKAYATAIKLSEKGDVLQVLEDCEGKSMR  337

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLW+G+V
Sbjct  338   FISEVEEKDGKLWMGSV  354



>ref|XP_001759191.1| predicted protein [Physcomitrella patens]
 gb|EDQ75875.1| predicted protein [Physcomitrella patens]
Length=429

 Score =   290 bits (742),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 157/397 (40%), Positives = 230/397 (58%), Gaps = 12/397 (3%)
 Frame = +1

Query  160   VFQQllylllpvlIGIMIG-DPFELSPVGGQKFRPV---KNDIAPYKEVMERWHGDNKSR  327
               QQ        ++ +M+  DP  + P+ G  F       +DI P   + E W  D  ++
Sbjct  32    AMQQRTLGFAAGVVVLMLAWDPPLIGPLAGLNFDWSNWNSSDIRPMLGINE-WPCDPDNK  90

Query  328   LGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKI  507
             L       + +  GPESL FD+ G GPY G++DGRI+RW GD A W TF  VT +   ++
Sbjct  91    LLQAQKLILQDASGPESLAFDSTGAGPYTGVSDGRILRWDGDEARWHTFG-VTSSIRTEV  149

Query  508   CGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHV  687
             C +      P   + E  CGRPLGLRFDK   +LYIADAY+GLLV+GP GG+A P++T  
Sbjct  150   CDV-----HPPLVRNEPVCGRPLGLRFDKHD-NLYIADAYFGLLVMGPQGGVAKPVSTQA  203

Query  688   EGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVL  867
             EG P  F NDLD+ +NG+++FTD+S +  R    ++  E + +GR+LRYDP T +T V+ 
Sbjct  204   EGVPFRFVNDLDLDENGTVYFTDSSSRRPRSQCNIVTFEQDRSGRVLRYDPKTQQTTVLA  263

Query  868   DSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKG  1047
               L +PNG+  S D SF+L + T+  R+ KYW++GPK G  E  A +PGFPDN+R  ++G
Sbjct  264   RELFYPNGIAVSLDSSFMLLSHTSKSRIGKYWLKGPKLGTLEEFAEVPGFPDNIRRTKEG  323

Query  1048  QYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLD  1227
              +WVA+    T++Q  L NH +   + + LPL   +++         ++  F+ NGE ++
Sbjct  324   DFWVALHSRVTKLQNFLANHWYLLRILYSLPLRFDFISWLTTGTPDAMVIKFNPNGEAIE  383

Query  1228  VLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLP  1338
               ED+ G   +L+S   E DG LW+ +V    I TLP
Sbjct  384   AFEDRKGQNARLLSFADERDGVLWMSSVFMPSIWTLP  420



>gb|KDO41714.1| hypothetical protein CISIN_1g046018mg, partial [Citrus sinensis]
Length=310

 Score =   286 bits (731),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 192/305 (63%), Gaps = 10/305 (3%)
 Frame = +1

Query  403   GPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGL  582
             GPY G+ADGRI++W GD  GW  FA+ T    E +     D         E  CGRPLG+
Sbjct  1     GPYTGVADGRILKWQGDELGWTEFAVTTSQRKECVRPFAPD--------IEHICGRPLGI  52

Query  583   RFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN-GSIFFTDT  759
             RFDKKTGDLYIADAY G  VVGP+GG+AT L T   G+P+ F NDLDI ++ G I+FTD+
Sbjct  53    RFDKKTGDLYIADAYLGFQVVGPEGGLATQLVTEAAGQPLRFTNDLDIDEHKGVIYFTDS  112

Query  760   SQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETT  939
             S  + R      +L G+ TGRLL+Y+  T +  ++L  LAF NGV  S D +F+L  ET+
Sbjct  113   STSFQRRQFMSSILSGDKTGRLLKYEKTTKEVTILLQGLAFANGVALSRDRTFILIAETS  172

Query  940   NCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTR  1119
             NCR++++W+ GP SG+ +V A LPGFPDNVR+N  G++WVA+   +    ++++ + W  
Sbjct  173   NCRILRFWLHGPNSGKQDVFAELPGFPDNVRSNSNGEFWVALHAKKGLFGKLILLNSWLG  232

Query  1120  SVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
                 +LPL  + L +   G K +       + GEVL+VLED  G  +  +SEV E DG+L
Sbjct  233   KTLLKLPLSFRQLHSLLVGGKPHATAIKLSEKGEVLEVLEDCEGKTLSFISEVEEKDGQL  292

Query  1297  WIGTV  1311
             W+G+V
Sbjct  293   WMGSV  297



>emb|CDX92388.1| BnaA10g14270D [Brassica napus]
Length=366

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 208/343 (61%), Gaps = 33/343 (10%)
 Frame = +1

Query  304   WHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV  483
             W  D+++ L    + F D+V GPES+ FD LGRGPY G+ADGR++ W G+N  W  FA  
Sbjct  54    WERDSQNSLQGSKILFQDQVQGPESVAFDPLGRGPYTGVADGRVLFWNGEN--WTNFAYT  111

Query  484   TPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGI  663
             +   +E IC     + +    + E  CGRPLGLRFDK+TGDLYIADAY GLL VGP+GG+
Sbjct  112   SSKRTE-ICDPKPSALS--YLRNEHICGRPLGLRFDKRTGDLYIADAYMGLLKVGPEGGL  168

Query  664   ATPLATHVEGKPILFANDLDIHKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPP  843
             ATPL T  EG P+ F NDLDI  +G+++FTD+S  Y R N   ++  G+ TGR+L+YDP 
Sbjct  169   ATPLVTEAEGVPLGFTNDLDIDDDGTVYFTDSSISYQRRNFLQLVFSGDNTGRVLKYDPI  228

Query  844   TGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPD  1023
               K  V++  + FPNGV  S+D SF +F E     L +YW++G K+G ++V A LPG PD
Sbjct  229   AKKAAVLVSDVQFPNGVSISKDGSFFVFCEGDIGSLRRYWLKGEKAGTSDVFAMLPGHPD  288

Query  1024  NVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLF  1203
             NVR N+ G++WVA+ C R     ++  +P       R+P                     
Sbjct  289   NVRTNKDGEFWVALHCRRNYYSYIMARNP-----KLRIP---------------------  322

Query  1204  DQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
                G+++ VLED  G V++ VSEV E DGKLW+G+V  N +A 
Sbjct  323   --EGKLVKVLEDSEGKVVRSVSEVEEKDGKLWLGSVLMNFVAV  363



>ref|XP_010023798.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
 gb|KCW90055.1| hypothetical protein EUGRSUZ_A02257 [Eucalyptus grandis]
Length=372

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 148/339 (44%), Positives = 201/339 (59%), Gaps = 10/339 (3%)
 Frame = +1

Query  319   KSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWS  498
             + RL    +  V   FGPESL FD  G GPY G+ADGRI++W GD  GW  FA  +    
Sbjct  37    RDRLHASRVVPVTGAFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRRK  96

Query  499   EKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLA  678
                     D   P   + E  CGRPLGLRFDKKTGDLYIADAY+GL+VVGPDGG+AT +A
Sbjct  97    --------DCIRPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVA  148

Query  679   THVEGKPILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKT  855
             +  EGKP    NDLDI ++   I+FTD+S  + R       L G+ TGRL++YD  + + 
Sbjct  149   SEAEGKPFRLTNDLDIDESEDVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKEL  208

Query  856   HVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRA  1035
              V+L  L FPNGV  S+D  FLL  ET   R+++ W++GP +G+ ++ A LPGFPDN+R 
Sbjct  209   KVLLRGLTFPNGVALSKDGLFLLVVETATYRILRLWLKGPNAGKLDIFAELPGFPDNIRR  268

Query  1036  NEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQN  1212
             N +G++WVA+   +       ++     +   RLP+  Q L +   G K   +     + 
Sbjct  269   NSRGEFWVALHSKKGPASRFFLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEE  328

Query  1213  GEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIA  1329
             GE+L+V+ED  G  ++ +SEV E D KLWI +V    IA
Sbjct  329   GEILEVVEDAEGKTVQFLSEVEERDDKLWIASVMRPFIA  367



>ref|XP_010042385.1| PREDICTED: strictosidine synthase 1-like [Eucalyptus grandis]
Length=372

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/328 (45%), Positives = 197/328 (60%), Gaps = 10/328 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             V   FGPESL FD  G GPY G+ADGRI++W GD  GW  FA  +            D  
Sbjct  48    VTGAFGPESLAFDPSGGGPYTGVADGRILKWEGDERGWVDFAFTSSRRK--------DCI  99

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
              P   + E  CGRPLGLRFDKKTGDLYIADAY+GL+VVGPDGG+AT +A+  EGKP    
Sbjct  100   RPFAPELEHVCGRPLGLRFDKKTGDLYIADAYFGLMVVGPDGGLATLVASEAEGKPFRLT  159

Query  712   NDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             NDLDI ++   I+FTD+S  + R       L G+ TGRL++YD  + +  V+L  L FPN
Sbjct  160   NDLDIDESEDVIYFTDSSTTFQRRQFLSACLSGDKTGRLMKYDKSSKELKVLLRGLTFPN  219

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D  FLL  ET   R+++ W++GP +G+ ++ A LPGFPDN+R N +G++WVA+ 
Sbjct  220   GVALSKDGLFLLVVETATYRILRLWLKGPNAGKLDIFAELPGFPDNIRRNSRGEFWVALH  279

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKH  1245
               +       ++     +   RLP+  Q L +   G K   +     + GE+L+V+ED  
Sbjct  280   SKKGPASRFFLSSSLIGNFALRLPISFQQLHSLVVGGKADAIAIKLGEEGEILEVVEDAE  339

Query  1246  GDVMKLVSEVREVDGKLWIGTVAHNHIA  1329
             G  ++ +SEV E D KLWI +V    IA
Sbjct  340   GKTVQFLSEVEERDDKLWIASVMRPFIA  367



>ref|XP_001783026.1| predicted protein [Physcomitrella patens]
 gb|EDQ52150.1| predicted protein [Physcomitrella patens]
Length=397

 Score =   288 bits (737),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 224/371 (60%), Gaps = 3/371 (1%)
 Frame = +1

Query  217   DPFELSPVGGQKFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTL  396
             DP ELS + G +    +    P    +     D +S+L    +    E+FGPESL FD  
Sbjct  22    DPLELSSLSGIEDFQAQYVAPPPYNPLSGISRDVESKLQAAEILGQGEIFGPESLAFDAQ  81

Query  397   GRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPL  576
             G GP+ GL+DGRIVR+ G   GW +FA  + N S  IC    +     +  +E  CGRPL
Sbjct  82    GNGPFTGLSDGRIVRYDGPELGWTSFATTSKNRS-AICD--YNHIPEAKLDYEHICGRPL  138

Query  577   GLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFFTD  756
             GLRFDK+TG+LYIADAY G+L VGP GG+A P+ T   G+     NDLD  ++G+++FT 
Sbjct  139   GLRFDKRTGELYIADAYLGILKVGPQGGLAEPVVTGFNGESFKLCNDLDFDEDGNLYFTV  198

Query  757   TSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTET  936
             +S KY R   FL  LE + TGR  +YDP + +T V++  L FPNGV  S+D +F++  E+
Sbjct  199   SSTKYQRRQFFLSRLELDNTGRFFKYDPVSKETTVLIQGLRFPNGVAVSKDGTFVVIAES  258

Query  937   TNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWT  1116
                RL++YW++GPK+   EV  +LPG PDNVR NE G +WVA    RT ++      PW 
Sbjct  259   NMARLLRYWLKGPKASTWEVWMDLPGVPDNVRRNENGDFWVAFHNKRTFMEMYTGALPWL  318

Query  1117  RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKL  1296
             R +  +LP+P +YL      K + +I  +   G++L+ LED+ G V+K+VSEV E DGKL
Sbjct  319   RHLVAKLPIPSKYLYAMLAPKPHALILRYSSEGQLLETLEDQPGKVVKVVSEVEEHDGKL  378

Query  1297  WIGTVAHNHIA  1329
             +IGTV    +A
Sbjct  379   YIGTVLFPQVA  389



>ref|XP_008244844.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=389

 Score =   287 bits (735),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/373 (42%), Positives = 234/373 (63%), Gaps = 23/373 (6%)
 Frame = +1

Query  250   KFRPVKNDIAPYKEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADG  429
             KF  +KN+ A   E +E+     +S+  +  +  V+   GPES  FD LG GPY G++DG
Sbjct  25    KFCSIKNNAA--AEDVEKLSNHEESKFEV--VPIVEGAVGPESFAFDPLGGGPYTGVSDG  80

Query  430   RIVRWMGDNAGWETFALVTPNWSEKIC----GLGVDSTTPKQWKFESQCGRPLGLRFDKK  597
             RIV+W  D   W  FA+ +PN S  +C      G    + +  K E  CGRPLGL F++ 
Sbjct  81    RIVKWDQDKHHWINFAVTSPN-SASLCNPIPSRGGCEGSHEHDKTEHICGRPLGLCFNQT  139

Query  598   TGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKN-GSIFFTDTSQKYN  774
             +GDLYIADAY GLL+VGP GG+AT + T   G P  F N LDI +  G+++FTD+S +Y 
Sbjct  140   SGDLYIADAYMGLLIVGPQGGLATEVVTRAHGIPFGFTNALDIDQELGAVYFTDSSSQYQ  199

Query  775   RVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLM  954
             R N+  ++L G+ TGRL++YDP + +  V+L++L+FPNGV  S++  F+L  ETT+CR+M
Sbjct  200   RRNYISVILSGDKTGRLMKYDPESKQVQVLLENLSFPNGVALSKNGDFILLVETTHCRIM  259

Query  955   KYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFR  1134
             +YW++ PK+G  +V A LPGFPDN++ + +G +WV I   R  I ++++++P   +   +
Sbjct  260   RYWLKTPKAGTFQVFAQLPGFPDNIKRSPRGGFWVGIHSRRLWILKLVLSYPSLGNALLK  319

Query  1135  LPLPM----QYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWI  1302
             LPL +     Y+A++ G  +  +I L +Q G +L++ ED  G+  K +SEV E D  LWI
Sbjct  320   LPLDITKAYSYVAKWTGNGL--IIRLSEQ-GVILEMFEDTSGNRWKSISEVVEKDETLWI  376

Query  1303  GTVAHNHIATLPY  1341
             G+V      T+P+
Sbjct  377   GSV------TMPF  383



>emb|CDP09527.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/318 (46%), Positives = 197/318 (62%), Gaps = 12/318 (4%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W G   GW  FA+ +            D   P   
Sbjct  55    GPESLAFDPNGEGPYTGVADGRILKWQGHQLGWVDFAVTSSQRK--------DCFHPFAP  106

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
               E  CGRPLGLRFD+K GDLYIADAY GL VVGP GG+ATPL T VEG  + F ND+DI
Sbjct  107   HMEHICGRPLGLRFDRKNGDLYIADAYLGLQVVGPTGGLATPLVTEVEGAVLRFTNDMDI  166

Query  727   HKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              ++  +I+FTD+S  + R      +L  + TGRL++YD  + +  ++L  LAF NGV  S
Sbjct  167   DEHEDTIYFTDSSTVFLRRQFISSVLSADRTGRLMKYDKSSKEVSILLRGLAFANGVSLS  226

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  E+T CR++++W+ GP +G+ +    LPGFPDN+R N KG++WVA+      
Sbjct  227   KDQSFVLVAESTTCRIVRFWLRGPNAGKHDTFTELPGFPDNIRRNSKGEFWVALHAKTGL  286

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARF--AGMKMYTVISLFDQNGEVLDVLEDKHGDVM  1257
             + + +I + W+     +LPL  + L  F   G    T I L  + GEVLDVLED  G  +
Sbjct  287   LIKWVIANSWSGKTLLKLPLSFKQLHHFLVGGQAHATAIKL-SEEGEVLDVLEDLDGKTL  345

Query  1258  KLVSEVREVDGKLWIGTV  1311
             + +SEV E +GKLWIG+V
Sbjct  346   RFISEVEERNGKLWIGSV  363



>ref|XP_009339573.1| PREDICTED: strictosidine synthase 3-like [Pyrus x bretschneideri]
Length=375

 Score =   286 bits (733),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 199/320 (62%), Gaps = 12/320 (4%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPESL FD  G GPY G+ADGR+++W  +N  W  FA+ T    E +         P 
Sbjct  55    ALGPESLAFDPTGDGPYTGVADGRVLKWDRNNRRWTDFAVTTSQRKECV--------RPF  106

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLGL+FDKK GDLYIADAY GL VVGP GG+A+ +   VEG+P+LF NDL
Sbjct  107   APEMEHVCGRPLGLKFDKKNGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLLFTNDL  166

Query  721   DI--HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             DI  HK+  I+FTD+S  + R      +  G+ TGRLL+Y+  + +  V+L  LAF NGV
Sbjct  167   DIDEHKD-VIYFTDSSTIFQRRQFMSSVFNGDRTGRLLKYNKSSKEVTVLLRGLAFANGV  225

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+D SF+L  E+T CR+++ W++GP +G T+V A LPGFPDN+R N  G++WVA+   
Sbjct  226   ALSKDRSFVLVAESTTCRILRVWLDGPNAGNTDVFAELPGFPDNIRRNSNGEFWVALHAK  285

Query  1075  RTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGD  1251
                + + + ++ W      +LPL  + L +   G K +       +NGEVL VLED  G 
Sbjct  286   SGFVSKFITSNTWVGKSMLKLPLDFKRLHSLLVGGKAHATAVKLSENGEVLQVLEDCEGK  345

Query  1252  VMKLVSEVREVDGKLWIGTV  1311
              MK +SE+ E DG+LW+G+V
Sbjct  346   TMKFISELEEKDGELWMGSV  365



>ref|XP_008392402.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
 ref|XP_008360679.1| PREDICTED: strictosidine synthase 1-like [Malus domestica]
Length=375

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 200/320 (63%), Gaps = 12/320 (4%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPESL FD  G GPY G+ADGR+++W  ++  W  FA+ T    E +         P 
Sbjct  55    ALGPESLAFDPTGDGPYTGVADGRVLKWDRNDRRWTDFAVTTSQRKECV--------RPF  106

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLGL+FDKK GDLYIADAY GL VVGP GG+A+ +   VEG+P+ F ND+
Sbjct  107   APEMEHVCGRPLGLKFDKKNGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDM  166

Query  721   DI--HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             DI  HK+  I+FTD+S  + R      +L G+ TGRLL+YD  + +  V+L  LAF NGV
Sbjct  167   DIDEHKD-VIYFTDSSTIFQRRQFMSSVLNGDRTGRLLKYDKSSKEVTVLLRGLAFANGV  225

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+D SF+L  ETT CR+++ W++GP +G T+V A LPGFPDN+R N  G++WVA+   
Sbjct  226   ALSKDRSFVLVAETTTCRILRIWLDGPNAGNTDVFAELPGFPDNIRRNSNGEFWVALHAK  285

Query  1075  RTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGD  1251
                + + + ++ W   +  +LPL  + L +   G K +       +NGEVL VLED  G 
Sbjct  286   SGFVSKFITSNTWVGKLMLKLPLGFKRLHSLLVGGKAHATAVKLSENGEVLQVLEDCEGK  345

Query  1252  VMKLVSEVREVDGKLWIGTV  1311
              +K +SE+ E DG+LWIG+V
Sbjct  346   TIKFISELEEKDGELWIGSV  365



>ref|XP_009799719.1| PREDICTED: strictosidine synthase 1-like [Nicotiana sylvestris]
Length=337

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 198/326 (61%), Gaps = 50/326 (15%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G+ADGRI++W      W  FA+ +   SE+      + T P   
Sbjct  54    GPESIAFDPNGEGPYTGVADGRILKWQEQAQTWANFAVTS---SER-----NNCTRPSAP  105

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDKKTGDLYIADAY+GL VVGP GG+ATPL    EGKP++F ND+DI
Sbjct  106   EMEHICGRPLGLRFDKKTGDLYIADAYFGLQVVGPKGGLATPLVHEFEGKPLIFTNDMDI  165

Query  727   H-KNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +N  I+FTD+S KY R  +F   + G+ TGRL++YD  T K  V+L  LAF NGV  +
Sbjct  166   DDQNNVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDKSTKKVTVLLRGLAFANGVALN  225

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SFLL +ET NCR+++YW++GP  GR ++ A++PGFPDN+R N +G++WVA++   + 
Sbjct  226   KDQSFLLVSETANCRIIRYWIKGPYKGRHDIFADVPGFPDNIRINSRGEFWVALNAKTSA  285

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKL  1263
                                               T I L    G++L+VLED+ G  ++ 
Sbjct  286   ----------------------------------TAIKL-SAEGQMLEVLEDEEGKTLRY  310

Query  1264  VSEVREVDGKLWIGTVAHNHIATLPY  1341
             +S+V E  GKLW G+V      T+P+
Sbjct  311   ISQVEEKHGKLWFGSV------TMPF  330



>emb|CDY06143.1| BnaA09g36370D [Brassica napus]
Length=384

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 202/327 (62%), Gaps = 20/327 (6%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G++ GW  FA  + N  + +         P   
Sbjct  56    GPESIAFDPSGEGPYVGVSDGRVLKWRGESLGWSDFAYTSANREKCV--------RPFAP  107

Query  547   KFESQCGRPLG----------LRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGK  696
             + E  CGR LG          LRFD+KTGDLYIADAY+GL++VGP GG+A PL T  EG+
Sbjct  108   ELEHVCGRSLGSGANPGCPHRLRFDEKTGDLYIADAYFGLMIVGPAGGLAKPLVTEAEGQ  167

Query  697   PILFANDLDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDS  873
             P  F NDLDI ++   I+FTDTS ++ R      +L  + TGRL++YD  + K  V++  
Sbjct  168   PFRFTNDLDIDEHQDVIYFTDTSTRFQRRQFLAAVLNVDKTGRLIKYDRSSKKVTVLVQG  227

Query  874   LAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQY  1053
             +AF NGV  S+D SF+L  ETT C++++ W+ GP +G  +V A LPGFPDN+R N  G++
Sbjct  228   IAFANGVALSKDRSFVLVAETTTCKILRLWLSGPNAGTQDVFAELPGFPDNIRRNSNGEF  287

Query  1054  WVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDV  1230
             WVA+   +    ++ ++  W R +  R P+    L + F G + +       ++GEVL+V
Sbjct  288   WVALHSKKGLFAKLSLSQAWFRDLLLRFPISGPRLHSLFTGGRPHATAMKLSESGEVLEV  347

Query  1231  LEDKHGDVMKLVSEVREVDGKLWIGTV  1311
             LED+ G  ++ +SEV E DGKLWIG+V
Sbjct  348   LEDREGKRLRFISEVEEKDGKLWIGSV  374



>ref|XP_009631158.1| PREDICTED: strictosidine synthase 1-like [Nicotiana tomentosiformis]
Length=337

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 193/316 (61%), Gaps = 44/316 (14%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G+ADGRI++W      W  FA+ +   SE+      + T P   
Sbjct  54    GPESIAFDPNGEGPYTGVADGRILKWQEQAQTWADFAVTS---SER-----NNCTQPSAP  105

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLG+RFDKKTGDLYIADAY GL VVGP GG+ TPL    EGKP++F ND+DI
Sbjct  106   EMEHICGRPLGIRFDKKTGDLYIADAYLGLQVVGPKGGLTTPLVQKFEGKPLIFTNDMDI  165

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              ++N  I+FTD+S KY R  +F   + G+ TGRL++YD  T K  VVL  LAF NGV  +
Sbjct  166   DNQNNVIYFTDSSTKYQRRQYFAAFVSGDTTGRLMKYDKSTKKVTVVLRGLAFANGVALN  225

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ET NCR+++YW++GP +GR ++ A++PGFPDN+R N +G++WVA+      
Sbjct  226   KDRSFVLVAETANCRIIRYWIKGPYAGRHDIFADVPGFPDNIRINSRGEFWVAL------  279

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKL  1263
                    H  T +   +L                        NG +L+VLED+ G  ++ 
Sbjct  280   -------HAKTSATAIKL----------------------SANGRMLEVLEDEDGKTLRY  310

Query  1264  VSEVREVDGKLWIGTV  1311
             +SEV E  GKLW G+V
Sbjct  311   ISEVEEKHGKLWFGSV  326



>gb|AAF22901.1|AC006932_18 T27G7.16 [Arabidopsis thaliana]
Length=421

 Score =   286 bits (732),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 163/411 (40%), Positives = 233/411 (57%), Gaps = 44/411 (11%)
 Frame = +1

Query  217   DPFELSPVGG-QKFRPVKNDIAPYKEV-MERWHGDNKSRLGLGNLEFVDEVFGPESLEFD  390
             DPF  S +     F+  K D+ P   +  ER   D ++ L    + F++EV GPES+ FD
Sbjct  20    DPFSHSSISKFPDFKTYKIDMPPLSSLPKER---DRQNLLQNSEIRFLNEVQGPESIAFD  76

Query  391   TLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGR  570
               GRGPY G+ADGRI+ W G    W  FA  + N SE +C      +     K E  CGR
Sbjct  77    PQGRGPYTGVADGRILFWNGTR--WTDFAYTSNNRSE-LCD--PKPSLLDYLKDEDICGR  131

Query  571   PLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDIHKNGSIFF  750
             PLGLRFDKK GDLYIADAY G++ VGP+GG+AT +    +G P+ F NDLDI   G+++F
Sbjct  132   PLGLRFDKKNGDLYIADAYLGIMKVGPEGGLATSVTNEADGVPLRFTNDLDIDDEGNVYF  191

Query  751   TDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFT  930
             TD+S  + R    L+++ GE +GR+L+Y+P T +T  ++ +L FPNG+   +D SF +F 
Sbjct  192   TDSSSFFQRRKFMLLIVSGEDSGRVLKYNPKTKETTTLVRNLQFPNGLSLGKDGSFFIFC  251

Query  931   ETTNCRLM-------------------------------KYWVEGPKSGRTEVIANLPGF  1017
             E +   ++                               KYW++G K+G +EV+A L GF
Sbjct  252   EGSIGSMLFPYRFNDSARNKLQYCEQNLSHFLLLLFRLRKYWLKGEKAGTSEVVALLHGF  311

Query  1018  PDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPM--QYLARFAGMKMYTV  1191
             PDN+R N+ G +WVA+ C R     ++ ++P  R  + +LP+ +  QYL +  G   + V
Sbjct  312   PDNIRTNKDGDFWVAVHCHRNIFTHLMAHYPRVRKFFLKLPISVKFQYLLQVGGWP-HAV  370

Query  1192  ISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPYP  1344
                + + G+VL VLED  G V+K VSEV E DGKLW+G+V  + IA    P
Sbjct  371   AVKYSEEGKVLKVLEDSKGKVVKAVSEVEEKDGKLWMGSVLMSFIAVYDLP  421



>gb|KEH23600.1| strictosidine synthase family protein [Medicago truncatula]
Length=325

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 189/331 (57%), Gaps = 48/331 (15%)
 Frame = +1

Query  337   GNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGL  516
               L  V    GPESL FD+ G GPY G+ADGRI++W G   GW  FA+ + N S+ +   
Sbjct  37    ARLLHVTRAIGPESLVFDSHGGGPYTGVADGRILKWKGKKRGWTEFAVTSSNRSQCV---  93

Query  517   GVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGK  696
                   P   K E  CGRPLGLRFDKK GDLYIADAY GL VVG  GG+AT +AT  EG 
Sbjct  94    -----RPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGLKVVGAAGGLATQVATEAEGH  148

Query  697   PILFANDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDS  873
             P  F NDLDI +N G I+FTD+S  Y R  + L+++ G+ TGRL++YD  T +  V+L  
Sbjct  149   PFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGDKTGRLMKYDKSTKEVKVLLRG  208

Query  874   LAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQY  1053
             LAFPNGV  S+D SFLL  ET+NCR+++ W+ GPK+G+     +LPGFPDN+R N  GQ+
Sbjct  209   LAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKVSTFVDLPGFPDNIRRNSYGQF  268

Query  1054  WVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVL  1233
             WVA                                       +Y+        GE+L+ L
Sbjct  269   WVA---------------------------------------LYSSAVKLSDEGEILETL  289

Query  1234  EDKHGDVMKLVSEVREVDGKLWIGTVAHNHI  1326
             ED     MK +SEV E DGKLWI ++   +I
Sbjct  290   EDFERKTMKNISEVEEKDGKLWIASIVTPYI  320



>ref|XP_008244837.1| PREDICTED: strictosidine synthase 1 [Prunus mume]
Length=375

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/320 (46%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPESL FD  G GPY G+ADGRI++W  ++  W  FA+ +    E I         P 
Sbjct  55    ALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQRKECI--------RPF  106

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLGL+FD KTGDLYIADAY GL VVGP GG+A+ +   VEG+P+ F ND+
Sbjct  107   APELEHVCGRPLGLKFDTKTGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDM  166

Query  721   DI--HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             DI  HK+  I+FTD+S  ++R      +L G+ TGRLL+Y+    +  V+L  LAF NGV
Sbjct  167   DIDEHKD-VIYFTDSSTIFHRRQFMSSVLNGDRTGRLLKYNKSNKEVTVLLRGLAFANGV  225

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+DHSF+L  ETT CR+++ W+ GP +G T+  A LPGFPDN+R N KG++WVA+   
Sbjct  226   ALSKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAELPGFPDNIRRNSKGEFWVALHAK  285

Query  1075  RTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGD  1251
             R    +  +++        +LPL  + L +   G K +       + GE+L+VLED  G 
Sbjct  286   RGFFAKWFVSNKLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSERGEILEVLEDCEGK  345

Query  1252  VMKLVSEVREVDGKLWIGTV  1311
              M+ +SEV E DGKLWIG+V
Sbjct  346   NMRFISEVEEKDGKLWIGSV  365



>ref|XP_011027271.1| PREDICTED: strictosidine synthase 3-like isoform X2 [Populus 
euphratica]
Length=373

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 206/326 (63%), Gaps = 15/326 (5%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             ++   GPES  FD L  GPY G++DGR+V+W      W  F+  +       CG   D  
Sbjct  49    LEGAIGPESFAFDPLAGGPYAGISDGRVVKWEERERRWINFSFASQE--RDGCGGPQD--  104

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                  + E  CGRPLGL FD+  GDLYIADAY GLL VG  GG+AT + TH +G P+ F 
Sbjct  105   ---HQQTEHICGRPLGLCFDETHGDLYIADAYMGLLRVGAQGGLATKIVTHAQGIPLSFT  161

Query  712   NDLDI-HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI   NG+I+FTD+S +Y R ++  ++L G+ +GRL++YDP   +  V+L +L FPN
Sbjct  162   NGLDIDQSNGAIYFTDSSSQYQRRHYLSVVLSGDKSGRLMKYDPVNKQVSVLLSNLTFPN  221

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D +F+L  ETT CR+++YW++  K+G  EV A L GFPDN++ + +G YWV ++
Sbjct  222   GVALSKDGTFILLAETTRCRILRYWIKTSKAGTVEVFAQLQGFPDNIKRSPRGGYWVGLN  281

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPMQY----LARFAGMKMYTVISLFDQNGEVLDVLE  1236
               R ++ E+L ++PW  +V  +LPL +      L+++ G  +   +S   +NG++L+V E
Sbjct  282   SRREKLSELLFSYPWIGNVLLKLPLDISMLESTLSKYRGSGLAVRLS---ENGDILEVFE  338

Query  1237  DKHGDVMKLVSEVREVDGKLWIGTVA  1314
             D+ G+ ++ VSEV E D  LWIG++A
Sbjct  339   DEDGNRLQSVSEVMEKDEILWIGSIA  364



>ref|XP_010922155.1| PREDICTED: strictosidine synthase 3-like [Elaeis guineensis]
Length=370

 Score =   282 bits (721),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 202/324 (62%), Gaps = 10/324 (3%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALV-TPNWSEKICGLGVDS  528
             +D   GPES+ FD  G GPY G++DGRI++W G   GW  +A V  P+   K  G    S
Sbjct  41    LDAATGPESIAFDAKGEGPYTGISDGRILKWQGKEHGWLEYAAVHAPHLLSKCRG----S  96

Query  529   TTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILF  708
               P     E  CGRPLGLRF  KTG+L++ADAY GLLVVGPD   ATP+A   +G     
Sbjct  97    QDPN---LEHVCGRPLGLRFSDKTGELFVADAYLGLLVVGPDDKFATPIAKQAQGVEFHV  153

Query  709   ANDLDIH-KNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFP  885
              N LDI   +G+++FTD+S ++ R  +   ++ G+ TGRL++YDP + +  V+LDSL+FP
Sbjct  154   TNGLDIDPDSGAVYFTDSSMRFQRRQYISAVIAGDKTGRLMKYDPQSKEVQVLLDSLSFP  213

Query  886   NGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAI  1065
             NGV  S+D S LL  ET  CR+++YW+  PK+   EVIA LPGFPDN++ + +G +WVA+
Sbjct  214   NGVALSQDGSHLLIVETITCRILRYWLRTPKANTVEVIAQLPGFPDNIKRSPRGGFWVAL  273

Query  1066  DCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISL-FDQNGEVLDVLEDK  1242
                RT+  E +++ PW   V     + +Q ++ F   +     +L   ++G+VL+VLE  
Sbjct  274   HSKRTKFVERVLSDPWLCDVLLNSSIDLQRVSSFVNRRSGKASALRLSEDGQVLEVLEGF  333

Query  1243  HGDVMKLVSEVREVDGKLWIGTVA  1314
              G  M+ +SEV E  G+LWIG++A
Sbjct  334   GGGTMRAISEVEERYGRLWIGSIA  357



>ref|XP_006847661.1| hypothetical protein AMTR_s00149p00021810 [Amborella trichopoda]
 gb|ERN09242.1| hypothetical protein AMTR_s00149p00021810 [Amborella trichopoda]
Length=370

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 215/358 (60%), Gaps = 24/358 (7%)
 Frame = +1

Query  286   KEVMERWHGDNKSRLGLGNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDN-AG  462
             K V  R H +      L   E +  V GPESL FD  GRGPY GLADGRIVR        
Sbjct  13    KRVRARDHANR-----LVKAELLHGVVGPESLAFDVEGRGPYTGLADGRIVRLHPPPFTS  67

Query  463   WETFALVTPNWSEKICGLGVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLV  642
             +  FA+ +P+WS++ C       +  + + E  CGRPLGLRF  +TG+LYIADAYYGLLV
Sbjct  68    FSDFAVTSPHWSKERC-------SGAKKEDEEVCGRPLGLRFHNRTGELYIADAYYGLLV  120

Query  643   VGPDGGIATPLATHVE-GKPILFANDLDIHKNGSI-FFTDTSQKYNRVNHFLIMLEGEAT  816
             VGP+GG+A  ++T  + G P+ F NDLDI+    I +FTD+S K+ R N+  +++  E +
Sbjct  121   VGPEGGLARQISTLPDDGIPLRFTNDLDINPQTDIVYFTDSSSKFRRKNYMQVVVSTEDS  180

Query  817   GRLLRYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEV  996
             GRLL+YDP T KT+V+L+ L FPNG+  S D SFL+F ETT   L +YW+EG K+G  EV
Sbjct  181   GRLLKYDPTTKKTNVLLNHLHFPNGLSLSHDASFLVFAETTKAMLSRYWLEGEKAGSKEV  240

Query  997   IANLPGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLP------MQYL  1158
                LPG PDNVRANEKG+ WVAI    + +   L  H   R +  R P+P        Y 
Sbjct  241   FVRLPGLPDNVRANEKGELWVAIHRRCSLLIYFLAKHVRLRRLLLRFPVPPLFQRWFIYN  300

Query  1159  ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTVAHNHIAT  1332
              +F G  M      +  +GE+ +VLED  G  +  +SE  E DGKLWIG+V   H+A 
Sbjct  301   NKFGGGGMAVK---YSPHGELKEVLEDGGGKRVASISEAHERDGKLWIGSVLSTHVAV  355



>ref|XP_007204530.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
 gb|EMJ05729.1| hypothetical protein PRUPE_ppa017675mg, partial [Prunus persica]
Length=340

 Score =   280 bits (717),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPESL FD  G GPY G+ADGRI++W  ++  W  FA+ +    E I         P 
Sbjct  20    ALGPESLAFDPNGGGPYTGVADGRILKWDQNDRRWTDFAVTSSQRKECI--------RPF  71

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
               + E  CGRPLGL+FD +TGDLYIADAY GL VVGP GG+A+ +   VEG+P+ F ND+
Sbjct  72    APELEHVCGRPLGLKFDTETGDLYIADAYLGLQVVGPAGGLASQVVREVEGQPLRFTNDM  131

Query  721   DI--HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             DI  HK+  I+FTD+S  ++R      +L G+ TGRLL+Y+    +  V+L  LAF NGV
Sbjct  132   DIDEHKD-VIYFTDSSTVFHRRQFMSSILNGDRTGRLLKYNKSNKEVTVLLRGLAFANGV  190

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+DHSF+L  ETT CR+++ W+ GP +G T+  A LPGFPDN+R N KG++WVA+   
Sbjct  191   ALSKDHSFVLVAETTTCRILRLWLHGPNAGNTDTFAELPGFPDNIRRNSKGEFWVALHAK  250

Query  1075  RTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGD  1251
             R    +  +++        +LPL  + L +   G K +       + GE+L+VLED  G 
Sbjct  251   RGFFAKWFVSNRLVGKSLLKLPLDFKQLHSLLVGGKAHATAIKLSETGEILEVLEDCEGK  310

Query  1252  VMKLVSEVREVDGKLWIGTV  1311
              M+ +SEV E DGKLWIG+V
Sbjct  311   NMRFISEVEEKDGKLWIGSV  330



>ref|XP_002532597.1| strictosidine synthase, putative [Ricinus communis]
 gb|EEF29794.1| strictosidine synthase, putative [Ricinus communis]
Length=375

 Score =   281 bits (719),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 145/318 (46%), Positives = 206/318 (65%), Gaps = 11/318 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES  FD LGRGPY G++DGRI+RW      W  FA VT  + +   G  VD     Q+
Sbjct  55    GPESFAFDGLGRGPYTGISDGRIIRWEEHEQRWIDFA-VTSLYRDGCEGPHVD-----QY  108

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGK-PILFANDLD  723
             + E  CGRPLGL F++  GDLY+ADAY GLL VG DGG+AT +ATH +   P  F N LD
Sbjct  109   QMEHICGRPLGLCFNESNGDLYVADAYMGLLKVGRDGGLATTIATHGDDDIPFNFTNSLD  168

Query  724   IHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQF  900
             +  + S ++FTD+S +Y R  +   +L G+ +GRLLRYDP   K  ++L +L+FPNGV  
Sbjct  169   VDPSSSALYFTDSSSRYQRREYIYAILSGDKSGRLLRYDPEDKKVRILLGNLSFPNGVAL  228

Query  901   SEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRT  1080
             S+D +F+L  ETT CR++KYW++  K+G  EV A +PGFPDN++ + +G YWVAI+  R 
Sbjct  229   SKDGNFILIAETTTCRVLKYWIKTSKAGILEVFAQVPGFPDNIKRSPRGGYWVAINSRRD  288

Query  1081  RIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISL-FDQNGEVLDVLEDKHGDVM  1257
             +  E +++HPW  +   +LP  +  +    G    T +++  D+NG++L+V ED+  +  
Sbjct  289   KFLEWVLSHPWIGNSLIKLPFDLMKIYSILGKYRGTGMAVRLDENGDILEVFEDR--NRF  346

Query  1258  KLVSEVREVDGKLWIGTV  1311
             K +SEV E DGKLWIG++
Sbjct  347   KTLSEVMEKDGKLWIGSI  364



>ref|XP_007202861.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
 gb|EMJ04060.1| hypothetical protein PRUPE_ppa015510mg, partial [Prunus persica]
Length=334

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/327 (44%), Positives = 212/327 (65%), Gaps = 15/327 (5%)
 Frame = +1

Query  349   FVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDS  528
              V++  GPES  FD LG GPY G++DGRIV+W  D   W  FA+ +PN        G + 
Sbjct  9     IVEDAVGPESFVFDPLGGGPYTGISDGRIVKWDQDKHHWINFAVTSPNRD------GCEG  62

Query  529   TTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILF  708
             +     K E  CGRPLGL F++ +GDLY+ADAY GLL+VGP GG+AT + T   G P  F
Sbjct  63    SHEHD-KTEHICGRPLGLCFNETSGDLYVADAYMGLLIVGPQGGLATEVVTRAHGIPFGF  121

Query  709   ANDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFP  885
              N LDI +  G+++FTD+S +Y R N+  ++L G+ TGRL++YDP + +  V+L +L+FP
Sbjct  122   TNALDIDQEPGAVYFTDSSSQYQRRNYISVILSGDKTGRLMKYDPESKQVQVLLGNLSFP  181

Query  886   NGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAI  1065
             NGV  S++  F+L  ETT+CR+M+YW++ PK+G  +V A LPGFPDN++ + +G +WV I
Sbjct  182   NGVALSKNGDFILLAETTHCRIMRYWLKTPKAGTFQVFAQLPGFPDNIKRSPRGGFWVGI  241

Query  1066  DCCRTRIQEVLINHPWTRSVYFRLPLPM----QYLARFAGMKMYTVISLFDQNGEVLDVL  1233
                R  I ++++++P   +   +LPL +     Y+A++ G  +  +I L +Q G +L++L
Sbjct  242   HSRRLWILKLVLSYPSLGNALLKLPLDITKAYSYVAKWTGNGL--IIRLSEQ-GVILEML  298

Query  1234  EDKHGDVMKLVSEVREVDGKLWIGTVA  1314
             ED  G+  K +SEV E D  LWIG+V 
Sbjct  299   EDTSGNRWKSISEVVEKDETLWIGSVT  325



>emb|CDP09528.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   280 bits (717),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 213/336 (63%), Gaps = 27/336 (8%)
 Frame = +1

Query  367   GPESLEFDTLGRG------PYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDS  528
             GPESL F   G G      PY G++DGRI++W G+ + W  FA+ TP+ +      G D 
Sbjct  67    GPESLAFKKDGTGAAAATGPYAGVSDGRIIQWRGNESRWVNFAITTPDRT------GCDG  120

Query  529   TTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILF  708
             +     + ES+CGRPLGL F++K+GDLYIADAY GLL+VG  GG+AT LA   +G P  F
Sbjct  121   SH-DHVEAESRCGRPLGLSFNEKSGDLYIADAYMGLLLVGSSGGLATCLAKEAQGIPFKF  179

Query  709   ANDLDIHK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFP  885
              N + + + +G ++FTD+S K+ R  +  ++L G+++GRL+++DP T K  V+LD L FP
Sbjct  180   TNGVVVDQTSGIVYFTDSSTKFQRREYISVILRGDSSGRLMKFDPVTYKVTVLLDGLMFP  239

Query  886   NGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAI  1065
             NGV  S++  FLL  ETTNCR++KYW+E  ++G+ E  A LPGFPDN++ N+KG++WVAI
Sbjct  240   NGVALSKNGDFLLVAETTNCRILKYWLEASRAGKVEPFAELPGFPDNIKRNQKGEFWVAI  299

Query  1066  DCCRTRIQEVLINHPWTRSVYFRLPLPM----QYLARFAGMKMYTVISLFDQNGEVLDVL  1233
             +  R  +   ++++PW R+    LP         LA + G  +   +S   +NG+++ +L
Sbjct  300   NSRREGVFNWILSNPWLRNFLAILPFDFTRAHSLLADYRGHGLAVKLS---ENGDIIQIL  356

Query  1234  EDKHGDVMKLVSEVREVDGKLWIGTVAHNHIATLPY  1341
             EDK G+  K  SE+ E +G LWIG+V       LPY
Sbjct  357   EDKSGETWKCSSEIAEENGYLWIGSV------KLPY  386



>ref|XP_002267323.1| PREDICTED: strictosidine synthase 3 [Vitis vinifera]
Length=378

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 133/320 (42%), Positives = 205/320 (64%), Gaps = 9/320 (3%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
               GPESL FD++G GPY G++DGRI++W  +   W  FA  +   S++    G     P 
Sbjct  55    AIGPESLAFDSVGGGPYTGVSDGRIIKWEENEERWVDFATTS---SKREGCRGSRDHVP-  110

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
                 E  CGRPLGL F + TG+LYIADAY GLLVVGP+GG+A+ +A+  +G P  F+N +
Sbjct  111   ---LEHICGRPLGLSFSELTGELYIADAYMGLLVVGPNGGLASTVASEAQGTPFGFSNGV  167

Query  721   DIHK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQ  897
             DIH+ NG+++F+D+S +Y R N    ++ G+ TGRL++Y+P + +  V+L SL FPNGV 
Sbjct  168   DIHQTNGAVYFSDSSSRYQRRNFVAAIISGDNTGRLMKYEPESKQVTVLLRSLGFPNGVA  227

Query  898   FSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCR  1077
              S++  F+L +ET+ CR++++W++  K+G  EV   LPGFPDN++ N KG++WV +   +
Sbjct  228   LSKNGDFILLSETSRCRILRFWLQTSKAGTVEVFTLLPGFPDNIKRNSKGEFWVGMHSRK  287

Query  1078  TRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDV-  1254
              ++ E  +++PW      +LP P  +L+ F+  +         + GEVL++ E K+G+  
Sbjct  288   GKLVEWFLSYPWIGRTLLKLPFPHGFLSFFSKWRKTGFAVRLSEEGEVLEIFEPKNGNGW  347

Query  1255  MKLVSEVREVDGKLWIGTVA  1314
             +  +SEV E DG LWIG+V 
Sbjct  348   ISSISEVYERDGSLWIGSVT  367



>ref|XP_004307668.1| PREDICTED: strictosidine synthase 1-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=389

 Score =   278 bits (712),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/342 (44%), Positives = 204/342 (60%), Gaps = 35/342 (10%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W  ++  W  FA+ T    E +         P   
Sbjct  46    GPESLAFDPNGDGPYTGVADGRILKWDPNHHRWTDFAVTTSQRKECV--------RPFAP  97

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRF+KKTGDLYIADAY GL VVGP GG+A+ +   VEG+ + F ND+DI
Sbjct  98    ELEHVCGRPLGLRFNKKTGDLYIADAYLGLQVVGPAGGLASQVVKEVEGQQLHFTNDIDI  157

Query  727   -HKNGSIFFTDTSQKYNRVN---HFLIM----------------------LEGEATGRLL  828
               K   I+FTD+S  ++R N   H+ I+                      L G+ TGRLL
Sbjct  158   DEKKDVIYFTDSSTVFHRRNSASHWKIIELYKTAGASMITVISKQFMSSILNGDKTGRLL  217

Query  829   RYDPPTGKTHVVLDSLAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANL  1008
             +Y+  + +  V+L  LAF NGV  S+DHSF+L  ETTNCR++++W+ GP +G T++   L
Sbjct  218   KYNISSQEVVVLLQGLAFANGVALSKDHSFVLVAETTNCRILRHWLYGPNAGDTDIFTKL  277

Query  1009  PGFPDNVRANEKGQYWVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMY  1185
             PGFPDN+R N KG++WVA+   +    + L+++ W      +LPL  + L +   G K Y
Sbjct  278   PGFPDNIRRNSKGEFWVALHAKKGLFAKWLVSNTWAGKSLLKLPLGFKRLHSLLVGGKAY  337

Query  1186  TVISLFDQNGEVLDVLEDKHGDVMKLVSEVREVDGKLWIGTV  1311
                    + G+VL VLED  G  M+ +SEV E DGKLW+G+V
Sbjct  338   ATAIKLSEKGDVLQVLEDCEGKSMRFISEVEEKDGKLWMGSV  379



>ref|XP_011000464.1| PREDICTED: strictosidine synthase 3-like, partial [Populus euphratica]
Length=352

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 203/315 (64%), Gaps = 15/315 (5%)
 Frame = +1

Query  352   VDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDST  531
             +D   GPES  FD LG+GPY G++DGRI++W      W  FA+     S+K  G G    
Sbjct  48    LDGATGPESFAFDPLGQGPYAGISDGRIIKWEEHERRWINFAIT----SQKRDGCG---G  100

Query  532   TPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFA  711
                  + E  CGRPLG  FD+  GDLYIADAY GLL VGP GG+AT +ATH +G P  F 
Sbjct  101   PHDHHRMEHVCGRPLGSCFDETRGDLYIADAYMGLLRVGPQGGLATKIATHAQGIPFRFT  160

Query  712   NDLDIHKNG-SIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPN  888
             N LDI ++G +I+FTD+S +Y R ++  ++L G+ +GRL++YD  + +  V+L +L FPN
Sbjct  161   NSLDIDQSGGAIYFTDSSTQYQRRDYLSVVLSGDKSGRLMKYDAASKQVTVLLKNLTFPN  220

Query  889   GVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAID  1068
             GV  S+D SF+L  ETT+CR+++YW++  K+G  EV A L GFPDN++ + +G YWV I+
Sbjct  221   GVALSKDGSFVLLAETTSCRILRYWIKTSKAGALEVFAQLQGFPDNIKRSPRGGYWVGIN  280

Query  1069  CCRTRIQEVLINHPWTRSVYFRLPLPM----QYLARFAGMKMYTVISLFDQNGEVLDVLE  1236
               R ++ E+L ++PW   V  +LPL +      LA++ G  +   +S   +NG++++V E
Sbjct  281   SKREKLSELLFSYPWIGKVLLKLPLDITKFQTALAKYRGGGLAVRLS---ENGDIVEVFE  337

Query  1237  DKHGDVMKLVSEVRE  1281
             D+ G+ +K +SEV E
Sbjct  338   DRDGNRLKSISEVTE  352



>ref|XP_006291448.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
 gb|EOA24346.1| hypothetical protein CARUB_v10017585mg [Capsella rubella]
Length=339

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 195/315 (62%), Gaps = 39/315 (12%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPES+ FD  G GPY G++DGR+++W G   GW  FA    N   K+C   V S  P+  
Sbjct  52    GPESIAFDPSGGGPYVGVSDGRVLKWRGKKLGWTDFAYTAAN--RKMC---VRSFAPE--  104

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
               E  CGRPLGLRF KKTGDLYIADAY+GLLVVGP GG+A PL T  EGKPI F NDLDI
Sbjct  105   -LEHVCGRPLGLRFHKKTGDLYIADAYFGLLVVGPAGGVAKPLVTEAEGKPIRFTNDLDI  163

Query  727   -HKNGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
               +N  I+FTD+S ++ R ++F   +  + TGR ++YD  + K  V+L  L+FPNGV  S
Sbjct  164   DEQNDVIYFTDSSSRFQRWDYFGSFMTVDKTGRFIKYDRSSKKATVLLHGLSFPNGVTLS  223

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +D SF+L  ETTN ++++ W+ GPK+G  +V A LPG+PDN+R N  G++WVAI+     
Sbjct  224   KDRSFVLVDETTNFKILRLWLSGPKAGTQDVFAVLPGYPDNIRRNSNGEFWVAIN-----  278

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMKL  1263
                                      + F G + +T      ++GEVL+VLEDK G  ++ 
Sbjct  279   ------------------------YSIFNGERPHTKAVKLSESGEVLEVLEDK-GKRLRY  313

Query  1264  VSEVREVDGKLWIGT  1308
             +SEV E DGKLWIG+
Sbjct  314   ISEVEEKDGKLWIGS  328



>gb|AFK33536.1| unknown [Medicago truncatula]
Length=310

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 183/321 (57%), Gaps = 48/321 (15%)
 Frame = +1

Query  337   GNLEFVDEVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGL  516
               L  V    GPESL FD+ G GPY G+ADGRI++W G   GW  FA+ + N S+ +   
Sbjct  37    ARLLHVTRAIGPESLVFDSHGGGPYTGVADGRILKWKGKKRGWTEFAVTSSNRSQCV---  93

Query  517   GVDSTTPKQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGK  696
                   P   K E  CGRPLGLRFDKK GDLYIADAY GL VVG  GG+AT +AT  EG 
Sbjct  94    -----RPFAPKLEHICGRPLGLRFDKKNGDLYIADAYLGLKVVGAAGGLATQVATEAEGH  148

Query  697   PILFANDLDIHKN-GSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDS  873
             P  F NDLDI +N G I+FTD+S  Y R  + L+++ G+ TGRL++YD  T +  V+L  
Sbjct  149   PFHFTNDLDIDENEGVIYFTDSSTVYERTQYTLLLVSGDKTGRLMKYDKSTKEVKVLLRG  208

Query  874   LAFPNGVQFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQY  1053
             LAFPNGV  S+D SFLL  ET+NCR+++ W+ GPK+G+     +LPGFPDN+R N  GQ+
Sbjct  209   LAFPNGVALSKDGSFLLVAETSNCRILRLWLHGPKAGKVSTFVDLPGFPDNIRRNSYGQF  268

Query  1054  WVAIDCCRTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVL  1233
             WVA                                       +Y+        GE+L+ L
Sbjct  269   WVA---------------------------------------LYSSAVKLSDEGEILETL  289

Query  1234  EDKHGDVMKLVSEVREVDGKL  1296
             ED     MK +SEV E DGKL
Sbjct  290   EDFERKTMKNISEVEEKDGKL  310



>ref|XP_004164012.1| PREDICTED: strictosidine synthase 1-like [Cucumis sativus]
Length=376

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W GD  GW  FA+ +   SE +         P   
Sbjct  59    GPESLIFDQNGEGPYTGVADGRILKWQGDGRGWTDFAVTSSQRSECV--------RPFAP  110

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDK TGDLYIADAY GL VVGP GG+AT L +  EGKP+ F NDLDI
Sbjct  111   ELEHVCGRPLGLRFDKTTGDLYIADAYLGLHVVGPSGGLATKLVSEFEGKPLRFTNDLDI  170

Query  727   HK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              + N  I+FTD+S  + R      +L G++TGRL +Y   + +  V+L  LAF NG+  S
Sbjct  171   DEDNDIIYFTDSSTVFQRRQFMASILSGDSTGRLFKYHRASKQVTVLLQGLAFANGIALS  230

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +DHS++L  E+T+ R++++W++G ++G  +V+A LPGFPDN+R N KG+YWVA+   +  
Sbjct  231   KDHSYVLVVESTSGRILRFWLQGTEAGNFDVVARLPGFPDNIRRNPKGEYWVALHSKKGI  290

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
             I  ++ +  W   +  +LP+  + L     G K +       + GEVL+VLED  G+ +K
Sbjct  291   IGNLVTSTSWFGKLLLKLPIDFKRLHGLLVGGKAHATAIRLSEEGEVLEVLEDCEGNTLK  350

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLW G+V
Sbjct  351   FISEVEEKDGKLWFGSV  367



>ref|XP_004136643.1| PREDICTED: strictosidine synthase 1-like [Cucumis sativus]
 gb|KGN59457.1| hypothetical protein Csa_3G821600 [Cucumis sativus]
Length=376

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 202/317 (64%), Gaps = 10/317 (3%)
 Frame = +1

Query  367   GPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPKQW  546
             GPESL FD  G GPY G+ADGRI++W GD  GW  FA+ +   SE +         P   
Sbjct  59    GPESLIFDQNGEGPYTGVADGRILKWQGDGRGWTDFAVTSSQRSECV--------RPFAP  110

Query  547   KFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDLDI  726
             + E  CGRPLGLRFDK TGDLYIADAY GL VVGP GG+AT L +  EGKP+ F NDLDI
Sbjct  111   ELEHVCGRPLGLRFDKTTGDLYIADAYLGLHVVGPSGGLATKLVSEFEGKPLRFTNDLDI  170

Query  727   HK-NGSIFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQFS  903
              + N  I+FTD+S  + R      +L G++TGRL +Y   + +  V+L  LAF NG+  S
Sbjct  171   DEDNDIIYFTDSSTVFQRRQFMASILSGDSTGRLFKYHRASKQVTVLLQGLAFANGIALS  230

Query  904   EDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCRTR  1083
             +DHS++L  E+T+ R++++W++G ++G  +V+A LPGFPDN+R N KG+YWVA+   +  
Sbjct  231   KDHSYVLVVESTSGRILRFWLQGTEAGNFDVLARLPGFPDNIRRNPKGEYWVALHSKKGI  290

Query  1084  IQEVLINHPWTRSVYFRLPLPMQYL-ARFAGMKMYTVISLFDQNGEVLDVLEDKHGDVMK  1260
             I  ++ +  W   +  +LP+  + L     G K +       + GEVL+VLED  G+ +K
Sbjct  291   IGNLVTSTSWFGKLLLKLPIDFKRLHGLLVGGKAHATAIRLSEEGEVLEVLEDCEGNTLK  350

Query  1261  LVSEVREVDGKLWIGTV  1311
              +SEV E DGKLW G+V
Sbjct  351   FISEVEEKDGKLWFGSV  367



>ref|XP_004237337.1| PREDICTED: strictosidine synthase 3-like [Solanum lycopersicum]
Length=377

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/320 (44%), Positives = 194/320 (61%), Gaps = 10/320 (3%)
 Frame = +1

Query  358   EVFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTP  537
             + FG ES+ FD  G GPY G+ADGRI++W+  N  W  FA VT +  E       + T  
Sbjct  55    DAFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFA-VTSSQRE-------NCTRA  106

Query  538   KQWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFAND  717
                + E  CGRPLGLRFD +TGDLYIADAY GL VVGP+GG+ATPL  H E +P+LF ND
Sbjct  107   SAPEMEHVCGRPLGLRFDHQTGDLYIADAYLGLQVVGPNGGLATPLVQHFEDQPLLFTND  166

Query  718   LDIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGV  894
             LDI  +   I+FTD+S  Y R         G+ TGRL++YD  T +  ++L  L+F NGV
Sbjct  167   LDIDDHDHVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILLQGLSFANGV  226

Query  895   QFSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCC  1074
               S+D +F+L +ET+ CR+ +YW++GP  G  +  A LPGFPDNVR N +G++WVA+   
Sbjct  227   ALSKDRTFVLVSETSACRITRYWLKGPNVGTHDTFAQLPGFPDNVRMNSRGEFWVALHAK  286

Query  1075  RTRIQEVLINHPWTRSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDV  1254
              + +  ++ ++ W      R     Q      G K +       ++G +L+VLED  G  
Sbjct  287   ASPLARLITSNSWLGKALLRKFNFQQMHNLLVGGKPHATAIKLSEDGGILEVLEDVEGKK  346

Query  1255  MKLVSEVREVD-GKLWIGTV  1311
             ++ +SEV E + GKLWIG+V
Sbjct  347   LRFISEVHEEENGKLWIGSV  366



>ref|XP_006340100.1| PREDICTED: strictosidine synthase 1-like isoform X1 [Solanum 
tuberosum]
Length=381

 Score =   273 bits (699),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 141/320 (44%), Positives = 198/320 (62%), Gaps = 12/320 (4%)
 Frame = +1

Query  361   VFGPESLEFDTLGRGPYGGLADGRIVRWMGDNAGWETFALVTPNWSEKICGLGVDSTTPK  540
              FG ES+ FD  G GPY G+ADGRI++W+  N  W  FA VT +  E        ++ P+
Sbjct  60    AFGAESVVFDPNGEGPYTGVADGRIIKWLQHNQTWVDFA-VTSSQRENCS----RTSAPE  114

Query  541   QWKFESQCGRPLGLRFDKKTGDLYIADAYYGLLVVGPDGGIATPLATHVEGKPILFANDL  720
                 E  CGRPLGLRFD++TGDLYIADAY GL VVGP GG+ATPL  H E  P+LF NDL
Sbjct  115   ---MEHVCGRPLGLRFDQETGDLYIADAYLGLQVVGPTGGLATPLVQHFEDHPLLFTNDL  171

Query  721   DIHKNGS-IFFTDTSQKYNRVNHFLIMLEGEATGRLLRYDPPTGKTHVVLDSLAFPNGVQ  897
             DI+ +   I+FTD+S  Y R         G+ TGRL++YD  T +  ++L  L+F NGV 
Sbjct  172   DINDHDHVIYFTDSSTIYQRRQFVNATASGDKTGRLMKYDKSTKQVTILLQGLSFANGVA  231

Query  898   FSEDHSFLLFTETTNCRLMKYWVEGPKSGRTEVIANLPGFPDNVRANEKGQYWVAIDCCR  1077
              S+D +F+L  ET+ CR+ +YW++GP  G  ++ A LPGFPDN+R N KG++WVA+    
Sbjct  232   LSKDRTFVLVAETSACRITRYWLKGPNVGTHDIFAQLPGFPDNIRMNSKGEFWVALHAKA  291

Query  1078  TRIQEVLINHPWT-RSVYFRLPLPMQYLARFAGMKMYTVISLFDQNGEVLDVLEDKHGDV  1254
             + +  ++ ++ W  +++  +      +     G    T I L ++ G +L+VLED  G  
Sbjct  292   SPLARLITSNSWLGKALLRKFNFQQMHNLLVGGQPHATAIKLSEEGG-ILEVLEDVEGKK  350

Query  1255  MKLVSEVR-EVDGKLWIGTV  1311
             ++ +SEV  E DGKLWIG+V
Sbjct  351   LRFISEVHEEEDGKLWIGSV  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4113523704564