BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81379_g1_i1 len=572 path=[1:0-571]

Length=572
                                                                      Score     E

gb|EYU32153.1|  hypothetical protein MIMGU_mgv1a000520mg                362   1e-114   
ref|XP_007051744.1|  Quinoprotein amine dehydrogenase, beta chain...    354   1e-113   
ref|XP_007051742.1|  Quinoprotein amine dehydrogenase, beta chain...    356   5e-112   
ref|XP_011092768.1|  PREDICTED: RAB6A-GEF complex partner protein 1     355   8e-112   
emb|CDP08777.1|  unnamed protein product                                353   5e-111   
ref|XP_006339612.1|  PREDICTED: protein RIC1 homolog isoform X2         349   5e-111   
ref|XP_010326571.1|  PREDICTED: RAB6A-GEF complex partner protein...    349   5e-111   
ref|XP_002511895.1|  conserved hypothetical protein                     353   6e-111   Ricinus communis
ref|XP_010661834.1|  PREDICTED: RAB6A-GEF complex partner protein...    349   8e-111   
emb|CAN81454.1|  hypothetical protein VITISV_010293                     351   3e-110   Vitis vinifera
ref|XP_006339611.1|  PREDICTED: protein RIC1 homolog isoform X1         351   3e-110   
ref|XP_010326569.1|  PREDICTED: RAB6A-GEF complex partner protein...    351   4e-110   
emb|CBI40433.3|  unnamed protein product                                350   5e-110   
ref|XP_003633961.1|  PREDICTED: RAB6A-GEF complex partner protein...    350   5e-110   
ref|XP_009800597.1|  PREDICTED: protein RIC1 homolog                    350   1e-109   
ref|XP_009621942.1|  PREDICTED: protein RIC1 homolog                    349   2e-109   
ref|XP_007220289.1|  hypothetical protein PRUPE_ppa000597mg             348   2e-109   
gb|KHG03882.1|  Protein RIC1                                            348   5e-109   
gb|KDP28594.1|  hypothetical protein JCGZ_14365                         347   1e-108   
ref|XP_008233006.1|  PREDICTED: protein RIC1 homolog                    346   2e-108   
ref|XP_002320151.2|  hypothetical protein POPTR_0014s08380g             345   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_004301497.1|  PREDICTED: protein RIC1 homolog                    345   3e-108   
ref|XP_010275696.1|  PREDICTED: RAB6A-GEF complex partner protein...    345   7e-108   
gb|KHM99350.1|  Protein RIC1 like                                       340   1e-107   
ref|XP_011036838.1|  PREDICTED: RAB6A-GEF complex partner protein...    344   1e-107   
ref|XP_010112948.1|  hypothetical protein L484_021469                   344   2e-107   
ref|XP_003534547.1|  PREDICTED: protein RIC1 homolog isoformX1          342   5e-107   
gb|KHN29329.1|  Protein RIC1 like                                       342   1e-106   
ref|XP_003552406.1|  PREDICTED: protein RIC1 homolog isoform 1          341   1e-106   
ref|XP_009378501.1|  PREDICTED: protein RIC1 homolog                    341   2e-106   
ref|XP_010055098.1|  PREDICTED: protein RIC1 homolog                    340   4e-106   
ref|XP_011023294.1|  PREDICTED: RAB6A-GEF complex partner protein...    336   5e-106   
ref|XP_004492773.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...    339   8e-106   
gb|ABD28704.1|  WD40-like                                               338   1e-105   Medicago truncatula
ref|XP_002301368.2|  hypothetical protein POPTR_0002s16350g             337   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_004169372.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...    327   1e-104   
ref|XP_011023293.1|  PREDICTED: RAB6A-GEF complex partner protein...    335   2e-104   
ref|XP_010669998.1|  PREDICTED: RAB6A-GEF complex partner protein...    333   9e-104   
ref|XP_010669989.1|  PREDICTED: RAB6A-GEF complex partner protein...    333   1e-103   
ref|XP_007139804.1|  hypothetical protein PHAVU_008G060200g             333   1e-103   
ref|XP_008458179.1|  PREDICTED: protein RIC1 homolog                    332   4e-103   
ref|XP_003624005.1|  RIC1-like protein                                  332   5e-103   
gb|KGN45685.1|  hypothetical protein Csa_6G006710                       331   9e-103   
ref|XP_004138580.1|  PREDICTED: protein RIC1 homolog                    331   1e-102   
gb|EPS67848.1|  hypothetical protein M569_06924                         325   1e-102   
ref|XP_008785301.1|  PREDICTED: protein RIC1 homolog                    328   1e-101   
ref|XP_010513767.1|  PREDICTED: RAB6A-GEF complex partner protein...    317   2e-101   
ref|XP_009387773.1|  PREDICTED: protein RIC1 homolog                    327   3e-101   
gb|AEL30346.1|  WD40-like protein                                       327   3e-101   
gb|KDO86263.1|  hypothetical protein CISIN_1g001165mg                   318   4e-101   
ref|XP_010544754.1|  PREDICTED: RAB6A-GEF complex partner protein...    326   7e-101   
ref|XP_008386128.1|  PREDICTED: protein RIC1 homolog                    325   9e-101   
gb|KDO86262.1|  hypothetical protein CISIN_1g001165mg                   318   7e-100   
ref|XP_006491161.1|  PREDICTED: protein RIC1 homolog isoform X5         320   8e-100   
ref|XP_006829039.1|  hypothetical protein AMTR_s00001p00254210          322   1e-99    
gb|KDO86261.1|  hypothetical protein CISIN_1g001165mg                   318   2e-99    
ref|XP_006444985.1|  hypothetical protein CICLE_v10018597mg             318   3e-99    
ref|XP_010934365.1|  PREDICTED: RAB6A-GEF complex partner protein...    322   3e-99    
gb|KDO86260.1|  hypothetical protein CISIN_1g001165mg                   318   4e-99    
ref|XP_006491159.1|  PREDICTED: protein RIC1 homolog isoform X3         319   4e-99    
ref|XP_010934364.1|  PREDICTED: RAB6A-GEF complex partner protein...    321   5e-99    
gb|KDO86259.1|  hypothetical protein CISIN_1g001165mg                   319   8e-99    
ref|XP_006491160.1|  PREDICTED: protein RIC1 homolog isoform X4         318   1e-98    
gb|KDO86256.1|  hypothetical protein CISIN_1g001165mg                   319   2e-98    
ref|XP_006444983.1|  hypothetical protein CICLE_v10018597mg             319   2e-98    
ref|XP_010413394.1|  PREDICTED: RAB6A-GEF complex partner protein...    316   5e-98    
ref|XP_010413393.1|  PREDICTED: RAB6A-GEF complex partner protein...    317   2e-97    
ref|XP_010469083.1|  PREDICTED: RAB6A-GEF complex partner protein...    317   2e-97    
ref|XP_002876617.1|  hypothetical protein ARALYDRAFT_486626             315   8e-97    
ref|NP_191707.3|  beta-chain like quinoprotein amine dehydrogenase      314   1e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CAB71078.1|  putative protein                                       314   1e-96    Arabidopsis thaliana [mouse-ear cress]
gb|KFK35333.1|  hypothetical protein AALP_AA5G271500                    314   1e-96    
gb|KFK35334.1|  hypothetical protein AALP_AA5G271500                    314   2e-96    
ref|NP_974846.2|  Quinoprotein amine dehydrogenase, beta chain-li...    313   3e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402476.1|  hypothetical protein EUTSA_v10005756mg             313   3e-96    
ref|NP_568507.3|  Quinoprotein amine dehydrogenase, beta chain-li...    313   4e-96    Arabidopsis thaliana [mouse-ear cress]
gb|EEC74137.1|  hypothetical protein OsI_09207                          305   5e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_006649109.1|  PREDICTED: protein RIC1 homolog                    304   1e-92    
gb|EEE57940.1|  hypothetical protein OsJ_08650                          302   5e-92    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89601.1|  predicted protein                                      299   4e-91    
emb|CDY48914.1|  BnaA09g39230D                                          298   1e-90    
ref|XP_004954159.1|  PREDICTED: protein RIC1 homolog                    298   2e-90    
ref|XP_009116813.1|  PREDICTED: protein RIC1 homolog isoform X2         297   2e-90    
ref|XP_009116812.1|  PREDICTED: protein RIC1 homolog isoform X1         297   2e-90    
ref|XP_006292424.1|  hypothetical protein CARUB_v10018639mg             296   2e-90    
emb|CDY65354.1|  BnaC08g48990D                                          296   3e-90    
ref|XP_008679243.1|  PREDICTED: protein RIC1 homolog isoform X4         294   1e-89    
ref|XP_010236164.1|  PREDICTED: guanine nucleotide exchange facto...    295   1e-89    
ref|XP_008679242.1|  PREDICTED: protein RIC1 homolog isoform X3         294   3e-89    
ref|XP_008679240.1|  PREDICTED: protein RIC1 homolog isoform X1         294   4e-89    
ref|XP_008646366.1|  PREDICTED: protein RIC1 homolog isoform X3         289   6e-88    
ref|XP_008646365.1|  PREDICTED: protein RIC1 homolog isoform X2         289   1e-87    
ref|XP_008646364.1|  PREDICTED: protein RIC1 homolog isoform X1         289   2e-87    
ref|XP_008679241.1|  PREDICTED: protein RIC1 homolog isoform X2         277   4e-83    
gb|AAF88009.1|  contains similarity to Drosophila melanogaster Bc...    255   1e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002452938.1|  hypothetical protein SORBIDRAFT_04g035280          227   3e-65    Sorghum bicolor [broomcorn]
ref|XP_001753139.1|  predicted protein                                  208   1e-58    
ref|XP_002960230.1|  hypothetical protein SELMODRAFT_75259              199   3e-55    
ref|XP_002967485.1|  hypothetical protein SELMODRAFT_439971             199   6e-55    
ref|XP_001758923.1|  predicted protein                                  197   2e-54    
gb|EMT13436.1|  hypothetical protein F775_21841                         184   5e-50    
ref|XP_003285309.1|  hypothetical protein DICPUDRAFT_149161             124   6e-29    
ref|XP_005647066.1|  hypothetical protein COCSUDRAFT_83479              119   4e-27    
dbj|GAM24943.1|  hypothetical protein SAMD00019534_081180               118   7e-27    
ref|XP_005710408.1|  unnamed protein product                            115   7e-26    
ref|XP_004356075.1|  hypothetical protein DFA_08587                     110   3e-24    
ref|XP_002507935.1|  predicted protein                                  107   3e-23    Micromonas commoda
ref|XP_002683438.1|  WD40 domain-containing protein                     102   2e-21    Naegleria gruberi strain NEG-M
gb|ESA10341.1|  hypothetical protein GLOINDRAFT_197566                98.2    6e-20    
gb|EXX77082.1|  hypothetical protein RirG_027190                      97.8    8e-20    
ref|XP_641650.1|  hypothetical protein DDB_G0279477                   94.7    1e-18    Dictyostelium discoideum AX4
ref|XP_006675340.1|  hypothetical protein BATDEDRAFT_21645            87.8    2e-16    
emb|CEI86573.1|  hypothetical protein RMCBS344292_01010               85.5    8e-16    
ref|XP_005705101.1|  hypothetical protein Gasu_39580                  85.9    8e-16    
ref|XP_004356522.1|  RIC1 protein                                     85.5    1e-15    
ref|XP_007265866.1|  RIC1-domain-containing protein                   84.7    2e-15    
gb|EPB91624.1|  hypothetical protein HMPREF1544_01546                 84.7    2e-15    
emb|CEG65932.1|  hypothetical protein RMATCC62417_02604               84.7    2e-15    
emb|CBN76586.1|  conserved unknown protein                            84.7    3e-15    
emb|CEG82973.1|  hypothetical protein RMATCC62417_16958               83.2    5e-15    
ref|XP_005848243.1|  hypothetical protein CHLNCDRAFT_144800           84.0    5e-15    
ref|XP_002912152.1|  hypothetical protein CC1G_13684                  82.4    1e-14    
ref|XP_001352891.1|  GA21512                                          81.3    3e-14    Drosophila pseudoobscura pseudoobscura
gb|KDR85280.1|  hypothetical protein GALMADRAFT_83897                 80.9    4e-14    
ref|XP_007336256.1|  RIC1-domain-containing protein                   79.7    1e-13    
ref|XP_001419080.1|  predicted protein                                79.3    1e-13    Ostreococcus lucimarinus CCE9901
ref|XP_002061620.1|  GK17088                                          78.6    2e-13    Drosophila willistoni
gb|KFM27402.1|  RIC1-like protein                                     78.2    2e-13    
emb|CDO70231.1|  hypothetical protein BN946_scf184942.g31             77.4    5e-13    
ref|XP_003080654.1|  WD40 repeat protein (ISS)                        77.4    5e-13    
emb|CEG01378.1|  WD40/YVTN repeat-like-containing domain              77.4    6e-13    
ref|XP_007230663.1|  PREDICTED: protein RIC1 homolog                  76.6    1e-12    
ref|XP_006454604.1|  hypothetical protein AGABI2DRAFT_114349          76.3    1e-12    
ref|XP_007378315.1|  RIC1-domain-containing protein                   76.3    1e-12    
ref|XP_007359996.1|  RIC1-domain-containing protein                   75.5    2e-12    
ref|XP_007314619.1|  hypothetical protein SERLADRAFT_445869           75.1    3e-12    
ref|XP_007763267.1|  RIC1-domain-containing protein                   74.7    4e-12    
ref|XP_003037446.1|  hypothetical protein SCHCODRAFT_80930            74.7    4e-12    
gb|EPS99074.1|  hypothetical protein FOMPIDRAFT_1125058               74.7    4e-12    
gb|KDQ20395.1|  hypothetical protein BOTBODRAFT_26402                 74.7    5e-12    
ref|XP_008032971.1|  RIC1-domain-containing protein                   74.3    5e-12    
gb|EJT51573.1|  hypothetical protein A1Q1_07204                       74.3    6e-12    
gb|EKD02925.1|  hypothetical protein A1Q2_02756                       74.3    6e-12    
ref|XP_001873933.1|  predicted protein                                74.3    6e-12    Laccaria bicolor S238N-H82
gb|KDQ30439.1|  hypothetical protein PLEOSDRAFT_1062460               73.9    8e-12    
ref|XP_007325489.1|  hypothetical protein AGABI1DRAFT_123933          73.9    8e-12    
gb|EUC67168.1|  RIC1-domain protein                                   73.9    8e-12    
gb|EGO02717.1|  hypothetical protein SERLA73DRAFT_119756              73.6    9e-12    
ref|XP_001958491.1|  GF23489                                          73.9    1e-11    Drosophila ananassae
ref|XP_001973722.1|  GG13186                                          73.6    1e-11    Drosophila erecta
emb|CCM01611.1|  predicted protein                                    72.8    1e-11    
ref|XP_007307452.1|  RIC1-domain-containing protein                   73.2    1e-11    
ref|XP_002008966.1|  GI11518                                          73.2    2e-11    Drosophila mojavensis
emb|CDQ80175.1|  unnamed protein product                              72.8    2e-11    
gb|KFH70163.1|  hypothetical protein MVEG_04965                       72.8    2e-11    
ref|XP_002040902.1|  GM22097                                          72.8    2e-11    Drosophila sechellia
ref|XP_007904716.1|  PREDICTED: protein RIC1 homolog                  72.4    3e-11    
ref|XP_002095799.1|  GE19511                                          72.4    3e-11    Drosophila yakuba
emb|CEI98379.1|  hypothetical protein RMCBS344292_12488               72.4    3e-11    
ref|XP_001628242.1|  predicted protein                                72.0    3e-11    Nematostella vectensis
gb|KEI40736.1|  hypothetical protein L969DRAFT_59649                  72.0    4e-11    
dbj|GAA98116.1|  hypothetical protein E5Q_04799                       72.0    4e-11    
ref|XP_009541502.1|  hypothetical protein HETIRDRAFT_154043           72.0    4e-11    
ref|XP_002027218.1|  GL25449                                          72.0    4e-11    Drosophila persimilis
gb|KGL78978.1|  Protein RIC1                                          71.6    4e-11    
gb|EMP30478.1|  Protein RIC1 like protein                             71.2    7e-11    
gb|EMD41642.1|  hypothetical protein CERSUDRAFT_128592                70.9    8e-11    
ref|XP_007390251.1|  hypothetical protein PHACADRAFT_246956           70.5    1e-10    
emb|CCA67809.1|  hypothetical protein PIIN_01633                      70.5    1e-10    
ref|NP_649385.1|  RIC1 homolog                                        70.5    1e-10    Drosophila melanogaster
gb|KDQ54856.1|  hypothetical protein JAAARDRAFT_37967                 70.1    1e-10    
gb|EJU04689.1|  RIC1-domain-containing protein                        70.1    2e-10    
ref|XP_004345658.1|  conserved hypothetical protein                   69.3    2e-10    
emb|CBY20780.1|  unnamed protein product                              69.3    3e-10    
ref|XP_009636476.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  69.3    3e-10    
emb|CBY34225.1|  unnamed protein product                              68.9    3e-10    
ref|XP_007065685.1|  PREDICTED: protein RIC1 homolog                  68.9    4e-10    
ref|XP_002047711.1|  GJ11773                                          68.9    4e-10    Drosophila virilis
ref|XP_005819546.1|  hypothetical protein GUITHDRAFT_121275           68.2    4e-10    
emb|CCD81511.1|  hypothetical protein Smp_125550                      68.6    5e-10    
gb|KGB41158.1|  Protein RIC1-like protein                             68.2    5e-10    
emb|CCX30388.1|  Similar to Protein ric1; acc. no. O42656             68.2    5e-10    
ref|XP_001985143.1|  GH16901                                          68.6    5e-10    Drosophila grimshawi
ref|XP_007842499.1|  duf1339 domain protein                           68.2    6e-10    
ref|XP_002427318.1|  conserved hypothetical protein                   68.2    7e-10    Pediculus humanus corporis [human body lice]
gb|EIE89489.1|  hypothetical protein RO3G_14200                       67.4    7e-10    
ref|XP_006627063.1|  PREDICTED: protein RIC1 homolog isoform X1       68.2    7e-10    
ref|XP_009507925.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  68.2    7e-10    
gb|EKC36120.1|  RIC1-like protein                                     68.2    7e-10    
ref|XP_005941604.1|  PREDICTED: protein RIC1 homolog isoform X1       67.8    8e-10    
gb|KDE04043.1|  hypothetical protein MVLG_05482                       67.8    8e-10    
ref|XP_774156.1|  hypothetical protein CNBG4560                       67.4    9e-10    Cryptococcus neoformans var. neoformans B-3501A
emb|CDH56343.1|  ric1-domain-containing protein                       67.4    9e-10    
ref|XP_005941605.1|  PREDICTED: protein RIC1 homolog isoform X2       67.8    9e-10    
ref|XP_571747.1|  hypothetical protein                                67.4    9e-10    Cryptococcus neoformans var. neoformans JEC21
gb|ETN62247.1|  connexin43-interacting protein of 150 kDa             67.4    1e-09    
ref|XP_009473244.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  67.0    1e-09    
ref|XP_002836720.1|  hypothetical protein                             67.0    1e-09    Tuber melanosporum Mel28
gb|KDR12929.1|  RIC1-like protein                                     67.0    1e-09    
ref|XP_005803826.1|  PREDICTED: protein RIC1 homolog                  66.6    2e-09    
ref|XP_007428187.1|  PREDICTED: protein RIC1 homolog                  66.6    2e-09    
ref|XP_007513762.1|  predicted protein                                66.6    2e-09    
emb|CDS11790.1|  hypothetical protein LRAMOSA11434                    66.2    2e-09    
ref|XP_008298405.1|  PREDICTED: protein RIC1 homolog                  66.2    2e-09    
ref|XP_005185602.1|  PREDICTED: protein RIC1 homolog                  66.2    3e-09    
ref|XP_319216.4|  AGAP010061-PA                                       66.2    3e-09    Anopheles gambiae str. PEST
gb|AFR96809.2|  hypothetical protein CNAG_03587                       65.9    3e-09    
ref|XP_007861344.1|  RIC1-domain-containing protein                   65.9    3e-09    
ref|XP_010079562.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  65.5    3e-09    
dbj|GAC76506.1|  predicted K+/H+-antiporter                           65.9    3e-09    
ref|XP_009934331.1|  PREDICTED: protein RIC1 homolog isoform X1       65.5    4e-09    
ref|XP_009310110.1|  hypothetical protein DQ04_02391050               65.5    4e-09    
ref|XP_009817911.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  65.5    4e-09    
ref|XP_005352178.1|  PREDICTED: protein RIC1 homolog                  65.5    5e-09    
ref|XP_007568814.1|  PREDICTED: protein RIC1 homolog isoform X2       65.5    5e-09    
ref|XP_007568807.1|  PREDICTED: protein RIC1 homolog isoform X1       65.5    5e-09    
ref|XP_003195472.1|  hypothetical protein CGB_G6490C                  65.1    5e-09    
dbj|GAK63381.1|  RIC1-domain-containing protein                       65.5    5e-09    
ref|XP_008422505.1|  PREDICTED: protein RIC1 homolog isoform X1       65.5    5e-09    
gb|KFR11846.1|  Protein RIC1                                          65.5    5e-09    
ref|XP_003328520.2|  hypothetical protein PGTG_10479                  65.1    5e-09    
ref|XP_008422506.1|  PREDICTED: protein RIC1 homolog isoform X2       65.5    5e-09    
emb|CDS25415.1|  protein RIC1                                         65.1    6e-09    
ref|XP_003889645.1|  hypothetical protein, variant                    64.7    6e-09    
ref|XP_006817611.1|  PREDICTED: protein RIC1 homolog                  65.1    6e-09    
ref|XP_009985198.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  65.1    6e-09    
gb|KFO06535.1|  Protein RIC1                                          65.1    7e-09    
ref|XP_010309900.1|  PREDICTED: RAB6A-GEF complex partner protein...  64.7    7e-09    
ref|XP_003762183.1|  PREDICTED: protein RIC1 homolog                  64.7    7e-09    
ref|XP_009487214.1|  PREDICTED: protein RIC1 homolog                  64.3    7e-09    
ref|XP_006004695.1|  PREDICTED: protein RIC1 homolog isoform X1       64.7    8e-09    
ref|XP_010391175.1|  PREDICTED: RAB6A-GEF complex partner protein...  64.7    8e-09    
gb|KEF56034.1|  hypothetical protein A1O9_07615                       64.7    8e-09    
ref|XP_010391176.1|  PREDICTED: RAB6A-GEF complex partner protein...  64.7    8e-09    
ref|XP_010391173.1|  PREDICTED: RAB6A-GEF complex partner protein...  64.7    8e-09    
ref|XP_004526095.1|  PREDICTED: protein RIC1 homolog                  64.7    9e-09    
gb|KGB76204.1|  hypothetical protein CNBG_2042                        64.3    9e-09    
gb|EPX73063.1|  guanyl-nucleotide exchange factor                     64.3    9e-09    
ref|XP_007411246.1|  hypothetical protein MELLADRAFT_107549           64.3    9e-09    
gb|ETS62781.1|  hypothetical protein PaG_02525                        64.3    9e-09    
ref|XP_009998943.1|  PREDICTED: protein RIC1 homolog isoform X1       64.3    9e-09    
ref|XP_006863817.1|  PREDICTED: protein RIC1 homolog isoform X1       64.3    9e-09    
ref|XP_009953308.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  64.3    9e-09    
ref|XP_003742426.1|  PREDICTED: protein RIC1 homolog                  64.3    9e-09    
ref|XP_008101552.1|  PREDICTED: protein RIC1 homolog isoform X2       64.3    1e-08    
ref|XP_003216611.1|  PREDICTED: protein RIC1 homolog isoform X1       64.3    1e-08    
gb|KDN49477.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...  64.3    1e-08    
ref|XP_008494447.1|  PREDICTED: protein RIC1 homolog isoform X1       64.3    1e-08    
ref|XP_010215452.1|  PREDICTED: LOW QUALITY PROTEIN: RAB6A-GEF co...  64.3    1e-08    
gb|EMF16857.1|  RIC1-domain-containing protein                        64.3    1e-08    
gb|EPY52351.1|  guanyl-nucleotide exchange factor                     63.9    1e-08    
gb|ADF30403.1|  CG9063                                                58.9    1e-08    
ref|XP_008630772.1|  PREDICTED: protein RIC1 homolog isoform X1       64.3    1e-08    
ref|XP_003384917.1|  PREDICTED: protein RIC1 homolog                  64.3    1e-08    
ref|XP_005735233.1|  PREDICTED: protein RIC1 homolog isoform X2       64.3    1e-08    
ref|XP_005060902.1|  PREDICTED: protein RIC1 homolog isoform X1       63.9    1e-08    
ref|XP_005735232.1|  PREDICTED: protein RIC1 homolog isoform X1       63.9    1e-08    
ref|XP_009667391.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  63.9    1e-08    
ref|XP_004538112.1|  PREDICTED: protein RIC1 homolog isoform X2       63.9    1e-08    
ref|XP_004538111.1|  PREDICTED: protein RIC1 homolog isoform X1       63.9    1e-08    
gb|ETE64095.1|  Protein RIC1-like protein                             63.9    1e-08    
ref|XP_009864170.1|  PREDICTED: protein RIC1 homolog                  63.9    1e-08    
ref|XP_010126692.1|  PREDICTED: protein RIC1 homolog                  63.9    1e-08    
ref|XP_007005710.1|  hypothetical protein TREMEDRAFT_44723            63.9    1e-08    
ref|XP_006788987.1|  PREDICTED: protein RIC1 homolog                  63.9    2e-08    
ref|XP_009083094.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  63.5    2e-08    
ref|XP_006223745.1|  PREDICTED: protein RIC1 homolog isoform X1       63.5    2e-08    
ref|XP_798434.3|  PREDICTED: protein RIC1 homolog                     63.9    2e-08    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006223746.1|  PREDICTED: protein RIC1 homolog isoform X2       63.5    2e-08    
ref|XP_219778.5|  PREDICTED: protein RIC1 homolog isoform X3          63.5    2e-08    Rattus norvegicus [brown rat]
ref|XP_005013131.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  63.5    2e-08    
gb|KFQ27341.1|  Protein RIC1                                          63.5    2e-08    
ref|XP_008936040.1|  PREDICTED: protein RIC1 homolog                  63.5    2e-08    
ref|XP_009569911.1|  PREDICTED: protein RIC1 homolog isoform X1       63.5    2e-08    
ref|XP_009569913.1|  PREDICTED: protein RIC1 homolog isoform X3       63.5    2e-08    
ref|XP_005522742.1|  PREDICTED: protein RIC1 homolog isoform X1       63.5    2e-08    
ref|XP_010584348.1|  PREDICTED: RAB6A-GEF complex partner protein...  63.5    2e-08    
ref|XP_002163301.2|  PREDICTED: protein RIC1 homolog                  63.2    2e-08    
ref|XP_010584347.1|  PREDICTED: RAB6A-GEF complex partner protein...  63.2    2e-08    
ref|XP_005434813.1|  PREDICTED: protein RIC1 homolog isoform X1       63.2    2e-08    
ref|XP_009694387.1|  PREDICTED: protein RIC1 homolog                  63.2    2e-08    
ref|XP_008919882.1|  PREDICTED: protein RIC1 homolog isoform X1       63.2    2e-08    
ref|XP_005241658.1|  PREDICTED: protein RIC1 homolog isoform X1       63.2    2e-08    
ref|XP_010584345.1|  PREDICTED: RAB6A-GEF complex partner protein...  63.2    2e-08    
ref|XP_009914943.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  63.2    2e-08    
ref|XP_010584346.1|  PREDICTED: RAB6A-GEF complex partner protein...  63.2    2e-08    
ref|XP_010168093.1|  PREDICTED: protein RIC1 homolog isoform X1       63.2    2e-08    
ref|XP_009331823.1|  PREDICTED: protein RIC1 homolog                  63.2    2e-08    
ref|XP_003072185.1|  hypothetical protein CPC735_013580               62.8    3e-08    
ref|XP_009581860.1|  PREDICTED: protein RIC1 homolog                  62.8    3e-08    
ref|XP_004457445.1|  PREDICTED: protein RIC1 homolog isoform 3        62.8    3e-08    
ref|XP_005499829.1|  PREDICTED: protein RIC1 homolog isoform X1       62.8    3e-08    
ref|XP_003643048.1|  PREDICTED: protein RIC1 homolog isoformX1        62.8    3e-08    
ref|XP_004457443.1|  PREDICTED: protein RIC1 homolog isoform 1        62.8    3e-08    
ref|XP_004949123.1|  PREDICTED: protein RIC1 homolog isoform X3       62.8    3e-08    
ref|XP_004457446.1|  PREDICTED: protein RIC1 homolog isoform 4        62.8    3e-08    
ref|XP_004457444.1|  PREDICTED: protein RIC1 homolog isoform 2        62.8    3e-08    
ref|XP_004457447.1|  PREDICTED: protein RIC1 homolog isoform 5        62.8    3e-08    
gb|KFV76005.1|  Protein RIC1                                          62.8    3e-08    
ref|XP_009888960.1|  PREDICTED: protein RIC1 homolog isoform X1       62.8    3e-08    
ref|XP_009272537.1|  PREDICTED: protein RIC1 homolog isoform X1       62.8    3e-08    
ref|XP_009272538.1|  PREDICTED: protein RIC1 homolog isoform X2       62.8    3e-08    
ref|XP_009907276.1|  PREDICTED: protein RIC1 homolog isoform X1       62.8    3e-08    
gb|KFM04142.1|  Protein RIC1                                          62.8    3e-08    
ref|XP_001865528.1|  connexin43-interacting protein of 150 kDa        62.8    4e-08    
ref|XP_010286021.1|  PREDICTED: LOW QUALITY PROTEIN: RAB6A-GEF co...  62.8    4e-08    
gb|EWM21827.1|  quinoprotein amine beta chain-like ric1-like guan...  62.8    4e-08    
ref|XP_005155056.1|  PREDICTED: protein RIC1 homolog isoform X1       62.4    4e-08    
gb|EAT36871.2|  AAEL011084-PA                                         62.4    4e-08    
ref|XP_757692.1|  hypothetical protein UM01545.1                      62.4    4e-08    
ref|XP_005296859.1|  PREDICTED: protein RIC1 homolog isoform X2       62.4    5e-08    
ref|XP_005296858.1|  PREDICTED: protein RIC1 homolog isoform X1       62.4    5e-08    
gb|ESL06989.1|  hypothetical protein TRSC58_05329                     62.0    5e-08    
ref|XP_009966125.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  62.0    5e-08    
ref|XP_001661401.1|  hypothetical protein AaeL_AAEL011084             62.0    5e-08    
gb|KFO34703.1|  Protein RIC1 like protein                             62.0    5e-08    
ref|XP_010619129.1|  PREDICTED: RAB6A-GEF complex partner protein...  62.0    6e-08    
gb|EFW19159.1|  hypothetical protein CPSG_04705                       62.0    6e-08    
ref|XP_001239253.1|  hypothetical protein CIMG_10275                  62.0    6e-08    
ref|XP_010619130.1|  PREDICTED: RAB6A-GEF complex partner protein...  62.0    6e-08    
ref|XP_004600197.1|  PREDICTED: protein RIC1 homolog isoform X1       62.0    6e-08    
gb|EST07524.1|  hypothetical protein PSEUBRA_SCAF2g02628              61.6    6e-08    
ref|XP_001924949.4|  PREDICTED: protein RIC1 homolog isoformX1        62.0    6e-08    
ref|XP_005425634.1|  PREDICTED: protein RIC1 homolog isoform X1       61.6    6e-08    
ref|XP_005660186.1|  PREDICTED: protein RIC1 homolog isoform X3       61.6    7e-08    
ref|XP_002195183.1|  PREDICTED: protein RIC1 homolog                  61.6    7e-08    
ref|XP_010785512.1|  PREDICTED: RAB6A-GEF complex partner protein 1   61.6    7e-08    
ref|XP_007803689.1|  hypothetical protein EPUS_02497                  61.6    7e-08    
ref|XP_006115213.1|  PREDICTED: protein RIC1 homolog                  61.6    7e-08    
ref|XP_007649809.1|  PREDICTED: protein RIC1 homolog                  61.6    8e-08    
emb|CBQ71761.1|  conserved hypothetical protein                       61.6    8e-08    
dbj|GAC96408.1|  hypothetical protein PHSY_003988                     61.6    8e-08    
ref|XP_010135422.1|  PREDICTED: protein RIC1 homolog                  61.6    8e-08    
ref|XP_009097234.1|  PREDICTED: protein RIC1 homolog isoform X1       61.6    8e-08    
gb|KFP45758.1|  Protein RIC1                                          61.2    9e-08    
gb|KFP85457.1|  Protein RIC1                                          61.2    9e-08    
ref|XP_003777428.1|  PREDICTED: protein RIC1 homolog isoform X1       61.2    9e-08    
emb|CDR36603.1|  RHTO0S02e04346g1_1                                   61.2    9e-08    
ref|XP_009242736.1|  PREDICTED: protein RIC1 homolog isoform X3       61.2    1e-07    
ref|XP_005470396.1|  PREDICTED: protein RIC1 homolog isoform X1       61.2    1e-07    
ref|XP_007182257.1|  PREDICTED: protein RIC1 homolog isoform X4       61.2    1e-07    
ref|XP_005470397.1|  PREDICTED: protein RIC1 homolog isoform X2       61.2    1e-07    
ref|XP_005470398.1|  PREDICTED: protein RIC1 homolog isoform X3       61.2    1e-07    
ref|XP_007182256.1|  PREDICTED: protein RIC1 homolog isoform X3       61.2    1e-07    
ref|XP_007182254.1|  PREDICTED: protein RIC1 homolog isoform X1       61.2    1e-07    
gb|EMS21963.1|  ribosome control protein 1 domain containing protein  61.2    1e-07    
ref|XP_007944517.1|  PREDICTED: protein RIC1 homolog isoform X1       61.2    1e-07    
ref|XP_007182258.1|  PREDICTED: protein RIC1 homolog isoform X5       61.2    1e-07    
gb|AAI67737.1|  LOC100170625 protein                                  61.2    1e-07    
ref|XP_004910851.1|  PREDICTED: protein RIC1 homolog isoform X4       60.8    1e-07    
ref|XP_004910850.1|  PREDICTED: protein RIC1 homolog isoform X3       60.8    1e-07    
ref|XP_002934219.1|  PREDICTED: protein RIC1 homolog isoform X1       60.8    1e-07    
ref|XP_004910849.1|  PREDICTED: protein RIC1 homolog isoform X2       60.8    1e-07    
ref|XP_003142566.1|  hypothetical protein LOAG_06984                  60.8    1e-07    
ref|XP_005488217.1|  PREDICTED: protein RIC1 homolog isoform X2       60.8    1e-07    
ref|XP_005488216.1|  PREDICTED: protein RIC1 homolog isoform X1       60.8    1e-07    
gb|KFP63008.1|  Protein RIC1                                          60.8    1e-07    
ref|XP_006903641.1|  PREDICTED: LOW QUALITY PROTEIN: KIAA1432 ort...  60.8    1e-07    
gb|EJD74199.1|  hypothetical protein LOAG_18449                       60.8    1e-07    
ref|XP_009023019.1|  hypothetical protein HELRODRAFT_189001           60.8    1e-07    
ref|XP_006268956.1|  PREDICTED: protein RIC1 homolog isoform X2       60.5    2e-07    
ref|XP_004373537.1|  PREDICTED: protein RIC1 homolog isoform 1        60.5    2e-07    
gb|KFV94942.1|  Protein RIC1                                          60.5    2e-07    
gb|KFZ47481.1|  Protein RIC1                                          60.5    2e-07    
ref|XP_008143217.1|  PREDICTED: protein RIC1 homolog isoform X1       60.5    2e-07    
ref|XP_006268958.1|  PREDICTED: protein RIC1 homolog isoform X4       60.5    2e-07    
gb|KDN39153.1|  RIC1-domain-containing protein                        60.5    2e-07    
ref|XP_003487078.1|  PREDICTED: protein RIC1 homolog                  60.5    2e-07    
ref|XP_003396814.1|  PREDICTED: protein RIC1 homolog                  60.5    2e-07    
ref|XP_006268955.1|  PREDICTED: protein RIC1 homolog isoform X1       60.5    2e-07    
ref|XP_002602704.1|  hypothetical protein BRAFLDRAFT_120211           60.5    2e-07    
ref|XP_010737355.1|  PREDICTED: RAB6A-GEF complex partner protein 1   60.1    2e-07    
ref|XP_010197004.1|  PREDICTED: LOW QUALITY PROTEIN: RAB6A-GEF co...  59.7    2e-07    
gb|EFA06481.1|  hypothetical protein TcasGA2_TC009376                 60.1    2e-07    
ref|XP_006268957.1|  PREDICTED: protein RIC1 homolog isoform X3       60.1    2e-07    
gb|EFZ18303.1|  hypothetical protein SINV_01917                       60.1    2e-07    
ref|XP_006152563.1|  PREDICTED: protein RIC1 homolog                  60.1    2e-07    
gb|ELW63067.1|  Protein RIC1 like protein                             60.1    2e-07    
ref|XP_008195123.1|  PREDICTED: protein RIC1 homolog                  60.1    2e-07    
ref|XP_002121996.3|  PREDICTED: protein RIC1 homolog                  60.1    2e-07    
ref|XP_006761671.1|  PREDICTED: protein RIC1 homolog isoform X1       60.1    2e-07    
ref|XP_003782944.1|  PREDICTED: protein RIC1 homolog isoform 1        60.1    2e-07    
gb|ELK31879.1|  Protein RIC1 like protein                             60.1    2e-07    
ref|XP_008994867.1|  PREDICTED: protein RIC1 homolog isoform X3       60.1    2e-07    
ref|XP_002742958.1|  PREDICTED: protein RIC1 homolog isoform X1       60.1    3e-07    
ref|XP_008994862.1|  PREDICTED: protein RIC1 homolog isoform X2       60.1    3e-07    
gb|EGI67160.1|  Protein RIC1-like protein                             59.7    3e-07    
ref|XP_010891153.1|  PREDICTED: RAB6A-GEF complex partner protein 1   59.7    3e-07    
ref|XP_011117672.1|  hypothetical protein AOL_s00006g61               59.7    3e-07    
ref|XP_005063764.1|  PREDICTED: protein RIC1 homolog isoform X1       59.7    3e-07    
ref|XP_006761672.1|  PREDICTED: protein RIC1 homolog isoform X2       59.7    3e-07    
ref|XP_011051773.1|  PREDICTED: guanine nucleotide exchange facto...  59.7    3e-07    
ref|XP_003965610.1|  PREDICTED: protein RIC1 homolog                  59.7    3e-07    
ref|XP_008324134.1|  PREDICTED: protein RIC1 homolog                  59.7    3e-07    
ref|XP_011051772.1|  PREDICTED: guanine nucleotide exchange facto...  59.7    3e-07    
gb|EFN81450.1|  Protein RIC1-like protein                             59.7    3e-07    
ref|XP_003273873.1|  PREDICTED: protein RIC1 homolog isoform 1        59.7    3e-07    
ref|XP_006018437.1|  PREDICTED: protein RIC1 homolog isoform X1       59.7    3e-07    
ref|XP_002114344.1|  hypothetical protein TRIADDRAFT_58051            59.7    3e-07    
ref|XP_007653786.1|  PREDICTED: protein RIC1 homolog                  59.7    3e-07    
ref|XP_008849412.1|  PREDICTED: protein RIC1 homolog                  59.7    3e-07    
gb|EPQ04668.1|  Protein RIC1 like protein                             59.3    4e-07    
ref|XP_004706658.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  59.3    4e-07    
ref|XP_006918435.1|  PREDICTED: protein RIC1 homolog isoform X1       59.3    4e-07    
ref|XP_005861409.1|  PREDICTED: protein RIC1 homolog                  59.3    4e-07    
gb|EFB13835.1|  hypothetical protein PANDA_012914                     59.3    4e-07    
ref|XP_007499991.1|  PREDICTED: protein RIC1 homolog                  59.3    4e-07    
gb|EQB57693.1|  hypothetical protein CGLO_02137                       59.3    4e-07    
ref|XP_006918436.1|  PREDICTED: protein RIC1 homolog isoform X2       59.3    4e-07    
ref|XP_008710939.1|  hypothetical protein HMPREF1541_00411            59.3    4e-07    
ref|XP_004329273.1|  PREDICTED: protein RIC1 homolog                  58.9    4e-07    
ref|XP_003928228.1|  PREDICTED: RAB6A-GEF complex partner protein 1   59.3    4e-07    
ref|XP_004637250.1|  PREDICTED: protein RIC1 homolog isoform X1       59.3    4e-07    
ref|XP_009156024.1|  hypothetical protein HMPREF1120_03695            59.3    4e-07    
sp|Q69ZJ7.2|RIC1_MOUSE  RecName: Full=RAB6A-GEF complex partner p...  59.3    4e-07    
ref|XP_008539210.1|  PREDICTED: protein RIC1 homolog                  59.3    4e-07    
dbj|BAD32449.1|  mKIAA1432 protein                                    59.3    4e-07    
ref|NP_001074788.1|  RAB6A-GEF complex partner protein 1              59.3    4e-07    
ref|XP_006527052.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    4e-07    
ref|XP_010757094.1|  hypothetical protein PADG_01851                  58.9    4e-07    
ref|XP_002543942.1|  conserved hypothetical protein                   58.9    5e-07    
ref|XP_003428173.1|  PREDICTED: protein RIC1 homolog                  58.9    5e-07    
ref|XP_005983888.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_008253317.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_004004413.1|  PREDICTED: protein RIC1 homolog isoform 1        58.9    5e-07    
ref|XP_001492194.3|  PREDICTED: protein RIC1 homolog isoform 1        58.9    5e-07    
ref|XP_005683746.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    5e-07    
ref|NP_065880.2|  RAB6A-GEF complex partner protein 1 isoform a       58.9    5e-07    
ref|XP_007967516.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_005251580.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
emb|CAB66809.1|  hypothetical protein                                 58.9    5e-07    
ref|XP_658887.1|  hypothetical protein AN1283.2                       58.9    5e-07    
ref|XP_010363395.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_005328016.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_005683745.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_008253334.1|  PREDICTED: protein RIC1 homolog isoform X4       58.9    5e-07    
ref|XP_008253326.1|  PREDICTED: protein RIC1 homolog isoform X3       58.9    5e-07    
ref|XP_002708149.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    5e-07    
ref|XP_002844251.1|  conserved hypothetical protein                   58.9    5e-07    
ref|XP_003823423.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_007967517.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    5e-07    
ref|XP_008975263.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    5e-07    
ref|XP_005199222.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_010363394.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_002923723.1|  PREDICTED: protein RIC1 homolog                  58.9    5e-07    
ref|XP_005199223.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_004279159.1|  PREDICTED: protein RIC1 homolog isoform 1        58.9    5e-07    
ref|NP_001129392.2|  RAB6A-GEF complex partner protein 1 isoform b    58.9    5e-07    
ref|XP_006737328.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_004047826.1|  PREDICTED: protein RIC1 homolog isoform 1        58.9    5e-07    
ref|XP_582388.6|  PREDICTED: RAB6A-GEF complex partner protein 1 ...  58.9    5e-07    
ref|XP_010796941.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_010991727.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    5e-07    
ref|XP_005581840.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
ref|XP_006080668.1|  PREDICTED: protein RIC1 homolog isoform X3       58.9    5e-07    
ref|XP_003911779.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    5e-07    
emb|CDQ03122.1|  Protein Bm5257, isoform c                            58.9    6e-07    
dbj|BAE16982.1|  connexin43-interacting protein of 150 kDa            58.9    6e-07    
ref|XP_009187066.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    6e-07    
ref|XP_007450280.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  58.9    6e-07    
ref|XP_001896129.1|  Hypothetical 216.3 kDa protein R06F6.8 in ch...  58.9    6e-07    
ref|XP_009454551.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    6e-07    
ref|XP_006080670.1|  PREDICTED: protein RIC1 homolog isoform X5       58.9    6e-07    
ref|XP_010991729.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    6e-07    
ref|XP_006080667.1|  PREDICTED: protein RIC1 homolog isoform X2       58.9    6e-07    
ref|XP_007967519.1|  PREDICTED: protein RIC1 homolog isoform X4       58.9    6e-07    
ref|XP_009187068.1|  PREDICTED: protein RIC1 homolog isoform X3       58.9    6e-07    
ref|XP_006080666.1|  PREDICTED: protein RIC1 homolog isoform X1       58.9    6e-07    
ref|XP_001108907.2|  PREDICTED: protein RIC1 homolog                  58.9    6e-07    
ref|XP_010958937.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.9    6e-07    
ref|XP_010958940.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.5    6e-07    
ref|XP_010958938.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.5    6e-07    
ref|XP_003700325.1|  PREDICTED: protein RIC1 homolog isoform 1        58.5    6e-07    
ref|XP_010958941.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.5    6e-07    
gb|EEH21055.2|  hypothetical protein PABG_03286                       58.5    6e-07    
ref|XP_010832128.1|  PREDICTED: RAB6A-GEF complex partner protein 1   58.5    6e-07    
ref|XP_003692344.1|  PREDICTED: LOW QUALITY PROTEIN: protein RIC1...  58.5    6e-07    
ref|XP_007967520.1|  PREDICTED: protein RIC1 homolog isoform X5       58.5    6e-07    
ref|XP_011108012.1|  hypothetical protein H072_2023                   58.5    6e-07    
ref|XP_010958939.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.5    6e-07    
ref|XP_010991728.1|  PREDICTED: RAB6A-GEF complex partner protein...  58.5    6e-07    
ref|XP_006173837.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    6e-07    
ref|XP_006615015.1|  PREDICTED: protein RIC1 homolog                  58.5    6e-07    
ref|XP_010186490.1|  PREDICTED: protein RIC1 homolog                  58.5    7e-07    
gb|EHB04985.1|  RIC1-like protein                                     58.5    7e-07    
ref|XP_007536137.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    7e-07    
emb|CDI52419.1|  ric1-domain-containing protein                       58.5    7e-07    
ref|XP_004677702.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    7e-07    
ref|XP_008470965.1|  PREDICTED: protein RIC1 homolog                  58.5    7e-07    
gb|KHJ30917.1|  putative duf1339 domain protein                       58.5    7e-07    
emb|CDH56344.1|  ric1-domain-containing protein                       58.5    7e-07    
ref|XP_004887988.1|  PREDICTED: protein RIC1 homolog                  58.5    7e-07    
gb|EZA51471.1|  RIC1-like protein                                     58.5    7e-07    
ref|XP_007921374.1|  hypothetical protein MYCFIDRAFT_213218           58.2    8e-07    
ref|XP_005891419.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    8e-07    
ref|XP_008601381.1|  DUF1339 domain protein                           58.2    8e-07    
ref|XP_004591873.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    8e-07    
ref|XP_006939097.1|  PREDICTED: protein RIC1 homolog isoform X1       58.5    8e-07    
ref|XP_001213361.1|  conserved hypothetical protein                   58.2    8e-07    
ref|XP_008056186.1|  PREDICTED: protein RIC1 homolog                  58.2    8e-07    



>gb|EYU32153.1| hypothetical protein MIMGU_mgv1a000520mg [Erythranthe guttata]
Length=1098

 Score =   362 bits (929),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/190 (90%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWS+SGCRLMST  QIGLSSVSSPV+KPNQ+ K EPMMGGTSLMHWDEHG
Sbjct  298  AVGWKLRGLTVWSISGCRLMSTIRQIGLSSVSSPVVKPNQDLKYEPMMGGTSLMHWDEHG  357

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERIIAFSFGKCCLNRGVSGTT  RQVIYGEDRLL+VQSEDTDEL+ILHL
Sbjct  358  YRLYAIEERSSERIIAFSFGKCCLNRGVSGTTYARQVIYGEDRLLIVQSEDTDELKILHL  417

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHVAASRDGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQ+IQC+GL
Sbjct  418  NLPVSYISQNWPVLHVAASRDGMYLAVAGRHGLILYDIRLKRWRVFGDVTQEQQIQCQGL  477

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  478  LWLGKIVVVC  487



>ref|XP_007051744.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like 
guanyl-nucleotide exchange factor isoform 3 [Theobroma cacao]
 gb|EOX95901.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like 
guanyl-nucleotide exchange factor isoform 3 [Theobroma cacao]
Length=826

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPV+KPNQ+ K EP+MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPVVKPNQDCKYEPLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGSLERI+AFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSEDTDEL++LHL
Sbjct  383  YRLYAIEEGSLERILAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDTDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLKKWRVFGDI+QEQKIQC+GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLILYDIRLKKWRVFGDISQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_007051742.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like 
guanyl-nucleotide exchange factor isoform 1 [Theobroma cacao]
 ref|XP_007051743.1| Quinoprotein amine dehydrogenase isoform 1 [Theobroma cacao]
 gb|EOX95899.1| Quinoprotein amine dehydrogenase, beta chain-like, RIC1-like 
guanyl-nucleotide exchange factor isoform 1 [Theobroma cacao]
 gb|EOX95900.1| Quinoprotein amine dehydrogenase isoform 1 [Theobroma cacao]
Length=1122

 Score =   356 bits (913),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPV+KPNQ+ K EP+MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPVVKPNQDCKYEPLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGSLERI+AFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSEDTDEL++LHL
Sbjct  383  YRLYAIEEGSLERILAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDTDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLKKWRVFGDI+QEQKIQC+GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLILYDIRLKKWRVFGDISQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_011092768.1| PREDICTED: RAB6A-GEF complex partner protein 1 [Sesamum indicum]
Length=1126

 Score =   355 bits (912),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGL SVSSPV+K NQ++K EPMMGGTS+MHWDEHG
Sbjct  326  AVGWKLRGLTVWSVSGCRLMSTIRQIGLGSVSSPVVKSNQDFKYEPMMGGTSMMHWDEHG  385

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS +RI+AFSFGKCCLNRGVSGTT VRQVIYGEDRLL+VQSEDTDEL+ILHL
Sbjct  386  YRLYAIEEGSSDRIVAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLIVQSEDTDELKILHL  445

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYI QNWPVLHVAASRDGMYLAVAG +GLILYD+RLK+WRVFGD++QEQ+IQCRGL
Sbjct  446  NLPVSYILQNWPVLHVAASRDGMYLAVAGVNGLILYDIRLKRWRVFGDVSQEQQIQCRGL  505

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  506  LWLGKIVVVC  515



>emb|CDP08777.1| unnamed protein product [Coffea canephora]
Length=1129

 Score =   353 bits (907),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPVIKPNQ+ K EPM+GGTS MHWDE+G
Sbjct  325  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPVIKPNQDCKYEPMIGGTSQMHWDEYG  384

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERIIAF FGKCCLNRGVSGTT VRQVIYGEDRLL+VQSEDTDEL+ILHL
Sbjct  385  YRLYAIEERSSERIIAFPFGKCCLNRGVSGTTYVRQVIYGEDRLLIVQSEDTDELKILHL  444

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSY++QNWPVLHVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGDITQEQKIQCRGL
Sbjct  445  KLPVSYMAQNWPVLHVAASKDGMYLAVAGLHGLILYDIRLKRWRVFGDITQEQKIQCRGL  504

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  505  LWLGKIVVVC  514



>ref|XP_006339612.1| PREDICTED: protein RIC1 homolog isoform X2 [Solanum tuberosum]
Length=914

 Score =   349 bits (896),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  326  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMNGTSLMNWDEYG  385

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EEGS ERIIAFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQ+EDTDEL++LHL
Sbjct  386  YRLYAVEEGSSERIIAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQTEDTDELKLLHL  445

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSYISQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  446  SLPVSYISQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  505

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  506  LWLGKIVVVC  515



>ref|XP_010326571.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Solanum lycopersicum]
Length=914

 Score =   349 bits (895),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  326  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMNGTSLMNWDEYG  385

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EEGS ERIIAFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQ+EDTDEL++LHL
Sbjct  386  YRLYAVEEGSSERIIAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQTEDTDELKLLHL  445

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSYISQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  446  SLPVSYISQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  505

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  506  LWLGKIVVVC  515



>ref|XP_002511895.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50564.1| conserved hypothetical protein [Ricinus communis]
Length=1124

 Score =   353 bits (905),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPV+KPNQ+ K EP++GGTSL+ WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPVVKPNQDCKYEPLIGGTSLLQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIEEGSLER++AFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YKLYAIEEGSLERMLAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLILYDMRLKKWRVFGDITQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_010661834.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Vitis vinifera]
Length=923

 Score =   349 bits (895),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GLSSVSSPV+KPNQ+ K EPMMGGTSLM WDE+G
Sbjct  324  AVGWKLRGLTVWSVSGCRLMSTIRQMGLSSVSSPVVKPNQDCKFEPMMGGTSLMQWDEYG  383

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE  +ERI+AFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQSEDTDEL+I HL
Sbjct  384  YRLYAIEERCIERIVAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQSEDTDELKIFHL  443

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HV AS+DGMYLAVAG HGLILYD+RLKKWR+FGDI+QEQKIQC GL
Sbjct  444  NLPVSYISQNWPVQHVVASKDGMYLAVAGLHGLILYDIRLKKWRMFGDISQEQKIQCNGL  503

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  504  LWLGKIVVVC  513



>emb|CAN81454.1| hypothetical protein VITISV_010293 [Vitis vinifera]
Length=1122

 Score =   351 bits (901),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GLSSVSSPV+KPNQ+ K EPMMGGTSLM WDE+G
Sbjct  320  AVGWKLRGLTVWSVSGCRLMSTIRQMGLSSVSSPVVKPNQDCKFEPMMGGTSLMQWDEYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE  +ERI+AFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQSEDTDEL+I HL
Sbjct  380  YRLYAIEERCIERIVAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQSEDTDELKIFHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HV AS+DGMYLAVAG HGLILYD+RLKKWR+FGDI+QEQKIQC GL
Sbjct  440  NLPVSYISQNWPVQHVVASKDGMYLAVAGLHGLILYDIRLKKWRMFGDISQEQKIQCNGL  499

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  500  LWLGKIVVVC  509



>ref|XP_006339611.1| PREDICTED: protein RIC1 homolog isoform X1 [Solanum tuberosum]
Length=1125

 Score =   351 bits (900),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  326  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMNGTSLMNWDEYG  385

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EEGS ERIIAFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQ+EDTDEL++LHL
Sbjct  386  YRLYAVEEGSSERIIAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQTEDTDELKLLHL  445

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSYISQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  446  SLPVSYISQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  505

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  506  LWLGKIVVVC  515



>ref|XP_010326569.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Solanum lycopersicum]
Length=1125

 Score =   351 bits (900),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  326  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMNGTSLMNWDEYG  385

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EEGS ERIIAFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQ+EDTDEL++LHL
Sbjct  386  YRLYAVEEGSSERIIAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQTEDTDELKLLHL  445

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSYISQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  446  SLPVSYISQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  505

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  506  LWLGKIVVVC  515



>emb|CBI40433.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   350 bits (899),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GLSSVSSPV+KPNQ+ K EPMMGGTSLM WDE+G
Sbjct  322  AVGWKLRGLTVWSVSGCRLMSTIRQMGLSSVSSPVVKPNQDCKFEPMMGGTSLMQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE  +ERI+AFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQSEDTDEL+I HL
Sbjct  382  YRLYAIEERCIERIVAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQSEDTDELKIFHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HV AS+DGMYLAVAG HGLILYD+RLKKWR+FGDI+QEQKIQC GL
Sbjct  442  NLPVSYISQNWPVQHVVASKDGMYLAVAGLHGLILYDIRLKKWRMFGDISQEQKIQCNGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  502  LWLGKIVVVC  511



>ref|XP_003633961.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Vitis vinifera]
Length=1126

 Score =   350 bits (899),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GLSSVSSPV+KPNQ+ K EPMMGGTSLM WDE+G
Sbjct  324  AVGWKLRGLTVWSVSGCRLMSTIRQMGLSSVSSPVVKPNQDCKFEPMMGGTSLMQWDEYG  383

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE  +ERI+AFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQSEDTDEL+I HL
Sbjct  384  YRLYAIEERCIERIVAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQSEDTDELKIFHL  443

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HV AS+DGMYLAVAG HGLILYD+RLKKWR+FGDI+QEQKIQC GL
Sbjct  444  NLPVSYISQNWPVQHVVASKDGMYLAVAGLHGLILYDIRLKKWRMFGDISQEQKIQCNGL  503

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  504  LWLGKIVVVC  513



>ref|XP_009800597.1| PREDICTED: protein RIC1 homolog [Nicotiana sylvestris]
Length=1130

 Score =   350 bits (897),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 166/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  328  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMSGTSLMNWDEYG  387

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIEEG+ ERIIAFSFGKCCLNRGVSGTT VRQVIYGEDRLLVVQSEDTDEL++LHL
Sbjct  388  YKLYAIEEGASERIIAFSFGKCCLNRGVSGTTYVRQVIYGEDRLLVVQSEDTDELKLLHL  447

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSY+SQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  448  SLPVSYVSQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  507

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  508  LWLGKIVVVC  517



>ref|XP_009621942.1| PREDICTED: protein RIC1 homolog [Nicotiana tomentosiformis]
Length=1129

 Score =   349 bits (895),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/190 (88%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+K NQE K EPMM GTSLM+WDE+G
Sbjct  328  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKRNQECKYEPMMSGTSLMNWDEYG  387

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIEEGS ERIIAFSFGKCCLNRGVSG T VRQVIYGEDRLLVVQSEDTDEL++LHL
Sbjct  388  YKLYAIEEGSPERIIAFSFGKCCLNRGVSGITYVRQVIYGEDRLLVVQSEDTDELKLLHL  447

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            +LPVSYISQNWPV HVAAS+DGMYLA AG HGLILYD+RLKKWRVFGD+TQEQKIQCRGL
Sbjct  448  SLPVSYISQNWPVQHVAASKDGMYLAAAGLHGLILYDIRLKKWRVFGDVTQEQKIQCRGL  507

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  508  LWLGKIVVVC  517



>ref|XP_007220289.1| hypothetical protein PRUPE_ppa000597mg [Prunus persica]
 gb|EMJ21488.1| hypothetical protein PRUPE_ppa000597mg [Prunus persica]
Length=1080

 Score =   348 bits (893),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP++KP  E K EP+M GTSLM WDEHG
Sbjct  281  AVGWKLRGLTVWSVSGCRLMSTVRQIGLSSVSSPMVKPIHECKYEPLMTGTSLMQWDEHG  340

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE SLERII+FSFGKCCLNRGVSG T VRQVIYG+DRLLVVQSEDTDEL++LHL
Sbjct  341  YRLYAIEERSLERIISFSFGKCCLNRGVSGMTYVRQVIYGDDRLLVVQSEDTDELKMLHL  400

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  401  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLIIYDIRLKKWRVFGDITQEQKIQCKGL  460

Query  542  LWLGKIVVVC  571
            LW+GKIVVVC
Sbjct  461  LWMGKIVVVC  470



>gb|KHG03882.1| Protein RIC1 [Gossypium arboreum]
Length=1122

 Score =   348 bits (892),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 178/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS SSPV+KPNQ+ K EP+MGGTSLM WD++G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSASSPVVKPNQDCKYEPLMGGTSLMQWDDYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGSLERI+AFSFGKCCL+RGVSG T VRQVIYGEDRLLVV SEDTDEL++LHL
Sbjct  383  YRLYAIEEGSLERILAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVLSEDTDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+R KKWRVFGDI+QEQKIQC+GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLILYDIRQKKWRVFGDISQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>gb|KDP28594.1| hypothetical protein JCGZ_14365 [Jatropha curcas]
Length=1121

 Score =   347 bits (890),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GL SVSSP +K NQ+ K+EP+MGGTSLM WDE+G
Sbjct  320  AVGWKLRGLTVWSVSGCRLMSTIRQVGLGSVSSPKVKSNQDCKDEPLMGGTSLMQWDEYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIE GS ERIIAFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  380  YKLYAIEAGSRERIIAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDTDELKILHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  440  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLILYDMRLKKWRVFGDITQEQKIQCKGL  499

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  500  LWLGKIVVVC  509



>ref|XP_008233006.1| PREDICTED: protein RIC1 homolog [Prunus mume]
Length=1122

 Score =   346 bits (888),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP++KP  E K EP+M GTSLM WDEHG
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTVRQIGLSSVSSPMVKPTHECKYEPLMTGTSLMQWDEHG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE SLERII+FSFGKCCLNRGVSG T VRQVIYG+DRLLVVQSEDTDEL++L L
Sbjct  383  YRLYAIEERSLERIISFSFGKCCLNRGVSGMTYVRQVIYGDDRLLVVQSEDTDELKMLQL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLIIYDIRLKKWRVFGDITQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LW+GKIVVVC
Sbjct  503  LWMGKIVVVC  512



>ref|XP_002320151.2| hypothetical protein POPTR_0014s08380g [Populus trichocarpa]
 gb|EEE98466.2| hypothetical protein POPTR_0014s08380g [Populus trichocarpa]
Length=1085

 Score =   345 bits (886),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP +KPNQ+ K EP+M GTSLM WDE+G
Sbjct  285  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPKVKPNQDRKYEPLMNGTSLMQWDEYG  344

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLY IEEGSLER+IAFSFGKCCL+RGVSG T V QVIYGEDRLLVVQSEDTDEL+ LHL
Sbjct  345  YRLYVIEEGSLERVIAFSFGKCCLSRGVSGMTYVCQVIYGEDRLLVVQSEDTDELKFLHL  404

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  405  NLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDIRLKKWRVFGDITQEQKIQCKGL  464

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  465  LWLGKIVVVC  474



>ref|XP_004301497.1| PREDICTED: protein RIC1 homolog [Fragaria vesca subsp. vesca]
Length=1062

 Score =   345 bits (884),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPV+KP  E K EP+MGGTSLM WDE+G
Sbjct  320  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPVVKPVNECKFEPLMGGTSLMQWDEYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE SLERI+ FSFGKCCLNRGVSG T VRQVIYG+DRLLVVQSEDTDEL++LHL
Sbjct  380  YRLYAIEERSLERILGFSFGKCCLNRGVSGMTYVRQVIYGDDRLLVVQSEDTDELKMLHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+R KKWRVFGDITQEQKIQC+GL
Sbjct  440  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLIIYDIRFKKWRVFGDITQEQKIQCKGL  499

Query  542  LWLGKIVVVC  571
            LW+GKIVVVC
Sbjct  500  LWMGKIVVVC  509



>ref|XP_010275696.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Nelumbo 
nucifera]
Length=1121

 Score =   345 bits (884),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIG+SSVSSP++KP+Q++K EP+MGGTSLM WDE+G
Sbjct  320  AVGWKLRGLTVWSVSGCRLMSTIRQIGISSVSSPMVKPHQDFKYEPLMGGTSLMQWDEYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLY IEEGS ERI++FSFGKCCLNRGVSGTT VRQVIY +DRLL+VQSEDTDEL++LHL
Sbjct  380  YRLYVIEEGSSERILSFSFGKCCLNRGVSGTTYVRQVIYSDDRLLIVQSEDTDELKLLHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWP+LHV AS+DGMYLA+AG HGLILYDLR KKWR+FGD++QEQKIQC+GL
Sbjct  440  NLPVSYISQNWPLLHVVASKDGMYLAIAGVHGLILYDLRYKKWRLFGDVSQEQKIQCKGL  499

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  500  LWLGKIVVVC  509



>gb|KHM99350.1| Protein RIC1 like [Glycine soja]
Length=942

 Score =   340 bits (873),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDE+G
Sbjct  321  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPISKPNHDCKYEPLMGGTSLMQWDEYG  380

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIE GS ERI++FSFGKCCL+RGVSGTT +RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  381  YRLYAIEVGSSERILSFSFGKCCLSRGVSGTTYIRQVIYGEDRLLIVQSEETDELKMLHL  440

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  441  KLPVSYISQNWPVQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  500

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  501  LWLGKIVVVC  510



>ref|XP_011036838.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Populus 
euphratica]
Length=1124

 Score =   344 bits (882),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP +KPNQ+ K EP+M GTSLM WDE+G
Sbjct  324  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPKVKPNQDRKYEPLMNGTSLMQWDEYG  383

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLY IEEGS+ER+IAFSFGKCCL+RGVSG T V QVIYG+DRLLVVQSEDTDEL+ LHL
Sbjct  384  YRLYVIEEGSMERVIAFSFGKCCLSRGVSGMTYVCQVIYGDDRLLVVQSEDTDELKFLHL  443

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  444  NLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDIRLKKWRVFGDITQEQKIQCKGL  503

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  504  LWLGKIVVVC  513



>ref|XP_010112948.1| hypothetical protein L484_021469 [Morus notabilis]
 gb|EXC35107.1| hypothetical protein L484_021469 [Morus notabilis]
Length=1132

 Score =   344 bits (882),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 179/190 (94%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSPV+KP++E K EP+M GTS++ WDE+G
Sbjct  321  AVGWKLRGLTVWSVSGCRLMSTVRQIGLSSVSSPVVKPSRECKYEPLMSGTSMLQWDEYG  380

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERI+AFSFGKCCLNRGVSGTT VRQV+YG+DRLLVVQSEDTDEL++LHL
Sbjct  381  YRLYAIEEQSSERIVAFSFGKCCLNRGVSGTTYVRQVLYGDDRLLVVQSEDTDELKMLHL  440

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+RLKKWRVFGD+TQEQKIQC+GL
Sbjct  441  NLPVSYISQNWPVQHVAASQDGMYLAVAGMHGLIIYDIRLKKWRVFGDVTQEQKIQCQGL  500

Query  542  LWLGKIVVVC  571
            LW+GKIVVVC
Sbjct  501  LWMGKIVVVC  510



>ref|XP_003534547.1| PREDICTED: protein RIC1 homolog isoformX1 [Glycine max]
Length=1121

 Score =   342 bits (878),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/190 (85%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPISKPNHDCKYEPLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIE GS ERII+FSFGKCCL+RGVSGTT +RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  383  YRLYAIEVGSSERIISFSFGKCCLSRGVSGTTYIRQVIYGEDRLLIVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPVQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>gb|KHN29329.1| Protein RIC1 like [Glycine soja]
Length=1121

 Score =   342 bits (876),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPISKPNHDCKYEPLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIE GS ERI++FSFGKCCL+RGVSGTT +RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  383  YRLYAIEVGSSERILSFSFGKCCLSRGVSGTTYIRQVIYGEDRLLIVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPVQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_003552406.1| PREDICTED: protein RIC1 homolog isoform 1 [Glycine max]
Length=1121

 Score =   341 bits (875),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPISKPNHDCKYEPLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIE GS ERI++FSFGKCCL+RGVSGTT +RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  383  YRLYAIEVGSSERILSFSFGKCCLSRGVSGTTYIRQVIYGEDRLLIVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPVQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_009378501.1| PREDICTED: protein RIC1 homolog [Pyrus x bretschneideri]
 ref|XP_009378502.1| PREDICTED: protein RIC1 homolog [Pyrus x bretschneideri]
 ref|XP_009378503.1| PREDICTED: protein RIC1 homolog [Pyrus x bretschneideri]
Length=1119

 Score =   341 bits (875),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP++KP  E K EP+M GTSLM WDE+G
Sbjct  319  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPMVKPIHECKYEPLMTGTSLMQWDEYG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE SLER++AFSFGKCCLNRGVSG T VRQVIYG+DRLLVVQSEDTDEL++LHL
Sbjct  379  YRLYAIEERSLERVLAFSFGKCCLNRGVSGMTYVRQVIYGDDRLLVVQSEDTDELKMLHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+R KKWRVFGDITQEQKIQC+GL
Sbjct  439  NLPVSYISQNWPVQHVAASKDGMYLAVAGLHGLIIYDIRWKKWRVFGDITQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LW+GKIVVVC
Sbjct  499  LWMGKIVVVC  508



>ref|XP_010055098.1| PREDICTED: protein RIC1 homolog [Eucalyptus grandis]
 gb|KCW71574.1| hypothetical protein EUGRSUZ_E00109 [Eucalyptus grandis]
Length=1127

 Score =   340 bits (872),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QIGLSSVSSP++KPNQ+ + EP++ G SLM WDE G
Sbjct  324  AVGWKYRGLTVWSVSGCRLMSTIRQIGLSSVSSPMVKPNQDSRCEPLVSGVSLMQWDEFG  383

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIEEGS ER++AFSFGKCCLNRGVSG T VRQVIYGEDRLLVVQSEDT+EL++LHL
Sbjct  384  YKLYAIEEGSSERVLAFSFGKCCLNRGVSGMTYVRQVIYGEDRLLVVQSEDTNELKMLHL  443

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSY+SQNWPV HVAAS+DGMYLAVAG HGLILYD+RLKKWRVFGDI+QEQKIQC+GL
Sbjct  444  NLPVSYLSQNWPVQHVAASKDGMYLAVAGLHGLILYDIRLKKWRVFGDISQEQKIQCKGL  503

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  504  LWLGKIVVVC  513



>ref|XP_011023294.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Populus euphratica]
Length=903

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLS +SSP +KPNQ+ K E +M GTSLM WDE+G
Sbjct  104  AVGWKLRGLTVWSVSGCRLMSTIRQIGLS-LSSPKVKPNQDCKYEALMKGTSLMQWDEYG  162

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LY IEE SLER+IAFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSED+DELRILHL
Sbjct  163  YKLYVIEEESLERVIAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDSDELRILHL  222

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  223  NLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDIRLKKWRVFGDITQEQKIQCKGL  282

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  283  LWLGKIVVVC  292



>ref|XP_004492773.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Cicer arietinum]
Length=1130

 Score =   339 bits (870),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDEHG
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPIAKPNHDCKYEPLMGGTSLMQWDEHG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERI++FSFGKCCL+RGVSGT  +RQVIYGEDRLL+VQSE+ DEL++LHL
Sbjct  383  YRLYAIEERSSERILSFSFGKCCLSRGVSGTAYIRQVIYGEDRLLIVQSEEIDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWP+ HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPIQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>gb|ABD28704.1| WD40-like [Medicago truncatula]
 gb|AES80223.2| RIC1-like protein [Medicago truncatula]
Length=1123

 Score =   338 bits (868),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 159/190 (84%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDEHG
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPIAKPNHDCKYEPLMGGTSLMQWDEHG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERII+FSFGKCCL+RGVSGTT  RQVIYGEDRLL+VQSE+ DEL++LHL
Sbjct  383  YRLYAIEERSSERIISFSFGKCCLSRGVSGTTYTRQVIYGEDRLLIVQSEEIDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV +VAAS+DGMYLAVAG HGLILYD+R+K+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPVQYVAASQDGMYLAVAGLHGLILYDIRMKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_002301368.2| hypothetical protein POPTR_0002s16350g [Populus trichocarpa]
 gb|EEE80641.2| hypothetical protein POPTR_0002s16350g [Populus trichocarpa]
Length=1083

 Score =   337 bits (863),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 163/190 (86%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLS +SSP +KPNQE K E +M GTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLS-LSSPKVKPNQECKYEALMNGTSLMQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LY IEE SLER+IAFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSEDTDELRILHL
Sbjct  382  YKLYVIEEESLERVIAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDTDELRILHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD++LKKWRVFGDITQEQKIQC+GL
Sbjct  442  NLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDIQLKKWRVFGDITQEQKIQCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  502  LWLGKIVVVC  511



>ref|XP_004169372.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog, partial 
[Cucumis sativus]
Length=690

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWS+SGCRLMST  Q+GLSSVSSP++KPNQ+ K EP++ GTSL+ WDE+G
Sbjct  322  AVGWKLRGLAVWSISGCRLMSTIRQVGLSSVSSPMVKPNQDCKYEPLISGTSLIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+EE + ERI+AFSFGKCCLNRGVS TT +RQVIYG+DRLL+VQSED+DEL++L++
Sbjct  382  YKLYAVEERTSERILAFSFGKCCLNRGVSRTTHIRQVIYGDDRLLIVQSEDSDELKMLNV  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWP+ HVAAS DGMYLAVAG HGLILYD+R+KKWRVFGDITQEQKI+C GL
Sbjct  442  NLPVSYISQNWPIQHVAASEDGMYLAVAGLHGLILYDIRVKKWRVFGDITQEQKIKCEGL  501

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  502  LWLGKIIVVC  511



>ref|XP_011023293.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Populus euphratica]
Length=1122

 Score =   335 bits (860),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/190 (85%), Positives = 175/190 (92%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLS +SSP +KPNQ+ K E +M GTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLS-LSSPKVKPNQDCKYEALMKGTSLMQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LY IEE SLER+IAFSFGKCCL+RGVSG T VRQVIYGEDRLLVVQSED+DELRILHL
Sbjct  382  YKLYVIEEESLERVIAFSFGKCCLSRGVSGMTYVRQVIYGEDRLLVVQSEDSDELRILHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+RLKKWRVFGDITQEQKIQC+GL
Sbjct  442  NLPVSYISQNWPVQHVAASKDGMHLAVAGLHGLILYDIRLKKWRVFGDITQEQKIQCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  502  LWLGKIVVVC  511



>ref|XP_010669998.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=1116

 Score =   333 bits (855),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GL SVSSPV KPN ++K EP+M G + +HWDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQVGLGSVSSPVAKPNPDWKYEPLMAGAATLHWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EE S ERI+AFSFGKCCLNRGVSG+T VRQVIYGEDR+L+VQSE+TDEL++LHL
Sbjct  383  YRLYAVEENSSERILAFSFGKCCLNRGVSGSTHVRQVIYGEDRVLLVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHVAAS DG +LAVAG HGLILYD+RLKKWR FGDITQEQKI C+GL
Sbjct  443  NLPVSYISQNWPVLHVAASIDGTFLAVAGLHGLILYDIRLKKWRFFGDITQEQKINCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_010669989.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1117

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  Q+GL SVSSPV KPN ++K EP+M G + +HWDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQVGLGSVSSPVAKPNPDWKYEPLMAGAATLHWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EE S ERI+AFSFGKCCLNRGVSG+T VRQVIYGEDR+L+VQSE+TDEL++LHL
Sbjct  383  YRLYAVEENSSERILAFSFGKCCLNRGVSGSTHVRQVIYGEDRVLLVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHVAAS DG +LAVAG HGLILYD+RLKKWR FGDITQEQKI C+GL
Sbjct  443  NLPVSYISQNWPVLHVAASIDGTFLAVAGLHGLILYDIRLKKWRFFGDITQEQKINCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_007139804.1| hypothetical protein PHAVU_008G060200g [Phaseolus vulgaris]
 gb|ESW11798.1| hypothetical protein PHAVU_008G060200g [Phaseolus vulgaris]
Length=1123

 Score =   333 bits (855),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSS+SSP+ K N + K E +MGGTSLM WDE+G
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTVRQIGLSSMSSPIAKSNHDCKYESLMGGTSLMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEG  ERI++FSFGKCCL+RGVSGTT +RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  383  YRLYAIEEGCSERILSFSFGKCCLSRGVSGTTYIRQVIYGEDRLLIVQSEETDELKMLHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLA+AG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  443  KLPVSYISQNWPVQHVAASQDGMYLAIAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  503  LWLGKIVVVC  512



>ref|XP_008458179.1| PREDICTED: protein RIC1 homolog [Cucumis melo]
Length=1119

 Score =   332 bits (851),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 175/190 (92%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWS+SGCRLMST  Q+GLSSVSSP++KPNQ+ K EP++ GTSL+ WDE+G
Sbjct  323  AVGWKLRGLAVWSISGCRLMSTIRQVGLSSVSSPMVKPNQDCKYEPLISGTSLIQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+EE + ER+IAFSFGKCCLNRGVS TT +RQVIYG+DRLL+VQSED+DEL++L++
Sbjct  383  YKLYAVEERTSERLIAFSFGKCCLNRGVSRTTHIRQVIYGDDRLLIVQSEDSDELKMLNV  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWP+ HVAAS DGMYLAVAG HGLILYD+RLKKWRVFGDITQEQKIQC GL
Sbjct  443  NLPVSYISQNWPIQHVAASEDGMYLAVAGLHGLILYDIRLKKWRVFGDITQEQKIQCEGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_003624005.1| RIC1-like protein [Medicago truncatula]
Length=1168

 Score =   332 bits (852),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 175/195 (90%), Gaps = 5/195 (3%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDEHG
Sbjct  323  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPIAKPNHDCKYEPLMGGTSLMQWDEHG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEE S ERII+FSFGKCCL+RGVSGTT  RQVIYGEDRLL+VQSE+ DEL++LHL
Sbjct  383  YRLYAIEERSSERIISFSFGKCCLSRGVSGTTYTRQVIYGEDRLLIVQSEEIDELKMLHL  442

Query  362  NLP-----VSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKI  526
             LP     VSYISQNWPV +VAAS+DGMYLAVAG HGLILYD+R+K+WRVFGD+TQEQKI
Sbjct  443  KLPVMCLIVSYISQNWPVQYVAASQDGMYLAVAGLHGLILYDIRMKRWRVFGDVTQEQKI  502

Query  527  QCRGLLWLGKIVVVC  571
            QC+GLLWLGKIVVVC
Sbjct  503  QCKGLLWLGKIVVVC  517



>gb|KGN45685.1| hypothetical protein Csa_6G006710 [Cucumis sativus]
Length=1118

 Score =   331 bits (848),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWS+SGCRLMST  Q+GLSSVSSP++KPNQ+ K EP++GGTSL+ WDE+G
Sbjct  322  AVGWKLRGLAVWSISGCRLMSTIRQVGLSSVSSPMVKPNQDCKYEPLIGGTSLIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+EE + ERI+AFSFGKCCLNRGVS TT +RQVIYG+DRLL+VQSED+DEL++L++
Sbjct  382  YKLYAVEERTSERILAFSFGKCCLNRGVSRTTHIRQVIYGDDRLLIVQSEDSDELKMLNV  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWP+ HVAAS DGMYLAVAG HGLILYD+R+KKWRVFGDITQEQKI+C GL
Sbjct  442  NLPVSYISQNWPIQHVAASEDGMYLAVAGLHGLILYDIRVKKWRVFGDITQEQKIKCEGL  501

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  502  LWLGKIIVVC  511



>ref|XP_004138580.1| PREDICTED: protein RIC1 homolog [Cucumis sativus]
Length=1135

 Score =   331 bits (849),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 176/190 (93%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWS+SGCRLMST  Q+GLSSVSSP++KPNQ+ K EP++GGTSL+ WDE+G
Sbjct  322  AVGWKLRGLAVWSISGCRLMSTIRQVGLSSVSSPMVKPNQDCKYEPLIGGTSLIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+EE + ERI+AFSFGKCCLNRGVS TT +RQVIYG+DRLL+VQSED+DEL++L++
Sbjct  382  YKLYAVEERTSERILAFSFGKCCLNRGVSRTTHIRQVIYGDDRLLIVQSEDSDELKMLNV  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWP+ HVAAS DGMYLAVAG HGLILYD+R+KKWRVFGDITQEQKI+C GL
Sbjct  442  NLPVSYISQNWPIQHVAASEDGMYLAVAGLHGLILYDIRVKKWRVFGDITQEQKIKCEGL  501

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  502  LWLGKIIVVC  511



>gb|EPS67848.1| hypothetical protein M569_06924, partial [Genlisea aurea]
Length=821

 Score =   325 bits (834),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VGWKLRGL VWSVSGCRLMST  QIGLSSVSSP   PN + K EPMMGGT +MHWDE+G
Sbjct  22   SVGWKLRGLAVWSVSGCRLMSTIRQIGLSSVSSPTGYPNHDVKYEPMMGGTLVMHWDENG  81

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA+EEG  ERI+AFSFGKCC+N GVS TT  RQ+IYGEDR+L+VQSEDTDEL++LHL
Sbjct  82   YRLYAVEEGYAERIMAFSFGKCCINGGVSVTTYARQIIYGEDRVLIVQSEDTDELKMLHL  141

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAASRDG YLAVAG +GLILYD+RLK+WRVFGD+TQEQKIQCRGL
Sbjct  142  ILPVSYISQNWPVQHVAASRDGKYLAVAGVNGLILYDIRLKRWRVFGDVTQEQKIQCRGL  201

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  202  LWLGKIVVVC  211



>ref|XP_008785301.1| PREDICTED: protein RIC1 homolog [Phoenix dactylifera]
Length=1120

 Score =   328 bits (841),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWS SGCRLM T  Q G++S SSP+ KPNQ+ K EP+MGGTS +HWDE+G
Sbjct  325  AVGWKFRGLTVWSTSGCRLMCTIRQTGINSASSPMAKPNQDLKFEPLMGGTSHVHWDEYG  384

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+EE S ERI+AFSFGKCCLNRG+SGT+ VRQ+IYGEDR+LVVQ +DTDEL+I+HL
Sbjct  385  YKLYAVEENSSERILAFSFGKCCLNRGLSGTSYVRQIIYGEDRVLVVQPDDTDELKIMHL  444

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHV AS+DGMYLAVAG HGLILYDLR K+WRVFGD+TQEQKI+C+GL
Sbjct  445  NLPVSYISQNWPVLHVVASKDGMYLAVAGLHGLILYDLRYKRWRVFGDVTQEQKIECKGL  504

Query  542  LWLGKIVVVC  571
            LWLGK++VVC
Sbjct  505  LWLGKVIVVC  514



>ref|XP_010513767.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Camelina 
sativa]
Length=616

 Score =   317 bits (812),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSTSSPKINPKQDSKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_009387773.1| PREDICTED: protein RIC1 homolog [Musa acuminata subsp. malaccensis]
Length=1132

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 150/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWS SGCRLM T  QIG+SS SSP++KPNQ+ K EP++GGTS + WDE G
Sbjct  321  AVGWKFRGLTVWSASGCRLMCTIRQIGMSSASSPMVKPNQDLKFEPLIGGTSQVQWDEFG  380

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYAIEE S ERI+AFSFGKCCLNRG+SGT+ VRQ++YGEDR+LVVQ  DTDEL+I+HL
Sbjct  381  YKLYAIEERSSERILAFSFGKCCLNRGLSGTSYVRQIVYGEDRVLVVQPADTDELKIVHL  440

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHV AS+DGMYLAVAG HGLILYDLR KKWRVFGD+TQEQKI+C+GL
Sbjct  441  NLPVSYISQNWPVLHVVASKDGMYLAVAGVHGLILYDLRNKKWRVFGDVTQEQKIECKGL  500

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  501  LWLGKIIVVC  510



>gb|AEL30346.1| WD40-like protein [Arachis hypogaea]
Length=1119

 Score =   327 bits (837),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/190 (83%), Positives = 172/190 (91%), Gaps = 3/190 (2%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP+ KPN + K EP+MGGTSLM WDE+G
Sbjct  322  AVGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPIAKPNHDCKYEPLMGGTSLMQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIE  S  RII+FSFGKCCL+RGVS   D RQVIYGEDRLL+VQSE+TDEL++LHL
Sbjct  382  YRLYAIEGESSGRIISFSFGKCCLSRGVS---DSRQVIYGEDRLLIVQSEETDELKMLHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS+DGMYLAVAG HGLILYD+RLK+WRVFGD+TQEQKIQC+GL
Sbjct  439  KLPVSYISQNWPVQHVAASQDGMYLAVAGLHGLILYDIRLKRWRVFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  499  LWLGKIVVVC  508



>gb|KDO86263.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=696

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_010544754.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Tarenaya 
hassleriana]
Length=1126

 Score =   326 bits (835),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL+VWSVSGCRLMST  QIGLSS SSP IKP+Q+ K EP++ GTS++ WDE+G
Sbjct  322  AVGWKLRGLSVWSVSGCRLMSTIRQIGLSSASSPKIKPSQDCKYEPLINGTSVIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYA EE S +RI+AFSFGKCCLNRGVSG T VRQVIYGEDRLL+VQSEDTDEL++LHL
Sbjct  382  YRLYATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVIYGEDRLLMVQSEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             +PVSYI+QNWPV HVAAS DG Y+AVAG HGLILYD+RLKKWRVFGD++QEQKIQC+GL
Sbjct  442  KIPVSYIAQNWPVRHVAASPDGKYMAVAGLHGLILYDIRLKKWRVFGDVSQEQKIQCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_008386128.1| PREDICTED: protein RIC1 homolog [Malus domestica]
Length=1119

 Score =   325 bits (834),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/189 (82%), Positives = 169/189 (89%), Gaps = 0/189 (0%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            VGWKLRGLTVWSVSGCRLMST  QIGLSSVSSP++KP  E K EP+M GTSLM WDE+GY
Sbjct  320  VGWKLRGLTVWSVSGCRLMSTIRQIGLSSVSSPMVKPIHECKYEPLMTGTSLMQWDEYGY  379

Query  185  RLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHLN  364
            RLYAIEE SLER++AFSFGKCCLN GVSG T VRQVIYG+DRLLVVQSEDTDEL++LHLN
Sbjct  380  RLYAIEERSLERVLAFSFGKCCLNXGVSGMTYVRQVIYGDDRLLVVQSEDTDELKMLHLN  439

Query  365  LPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL  544
            LPVSYISQNWPV HVAAS+DGMYLAVAG HGLI+YD+R KKW VFGDIT EQK  C+G L
Sbjct  440  LPVSYISQNWPVQHVAASKDGMYLAVAGLHGLIIYDIRWKKWXVFGDITXEQKXXCKGXL  499

Query  545  WLGKIVVVC  571
            W+GKIVVVC
Sbjct  500  WMGKIVVVC  508



>gb|KDO86262.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=827

 Score =   318 bits (815),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_006491161.1| PREDICTED: protein RIC1 homolog isoform X5 [Citrus sinensis]
Length=905

 Score =   320 bits (819),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  104  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  163

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  164  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  223

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  224  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  283

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  284  LWLGKIIVVC  293



>ref|XP_006829039.1| hypothetical protein AMTR_s00001p00254210 [Amborella trichopoda]
 gb|ERM96455.1| hypothetical protein AMTR_s00001p00254210 [Amborella trichopoda]
Length=1105

 Score =   322 bits (825),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWS+SGCRLM T  QIG+SS SSP++K NQ++K EPM  G +  HWDEHG
Sbjct  321  AVGWKFRGLTVWSISGCRLMCTIRQIGISSASSPMVKANQDFKCEPMANGVAFAHWDEHG  380

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LYA+E+ + +RI+AF FGKCCLNRG+ GTT VRQ+IYGED++LVVQSEDTDEL+ LHL
Sbjct  381  YKLYAVEQRTTDRILAFPFGKCCLNRGICGTTYVRQIIYGEDKVLVVQSEDTDELKFLHL  440

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHV AS+DGMYLA+AG  GLILYDLR KKWRVFGDITQEQ IQC+GL
Sbjct  441  NLPVSYISQNWPVLHVVASKDGMYLAIAGSRGLILYDLRYKKWRVFGDITQEQMIQCKGL  500

Query  542  LWLGKIVVVC  571
            LWLGKIVVVC
Sbjct  501  LWLGKIVVVC  510



>gb|KDO86261.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=884

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_006444985.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
 gb|ESR58225.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
Length=909

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_010934365.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Elaeis guineensis]
Length=1120

 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWS SGCRLM T  Q G++S  SPV KP+Q+ K EP+MGGTS + WDE+G
Sbjct  325  AVGWKFRGLTVWSTSGCRLMCTIRQTGINSAFSPVAKPSQDLKFEPLMGGTSHVQWDEYG  384

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LY++EE S ERI+AFSFGKCCLNRG+SGT+ VRQ+IYGEDR+LVVQ +DTDEL+I+HL
Sbjct  385  YKLYSVEENSSERILAFSFGKCCLNRGLSGTSYVRQIIYGEDRVLVVQPDDTDELKIMHL  444

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHV AS+DGMYLAVAG HGLILYDLR K+WRVFGD+TQEQKI+C+GL
Sbjct  445  NLPVSYISQNWPVLHVVASKDGMYLAVAGLHGLILYDLRYKRWRVFGDVTQEQKIECKGL  504

Query  542  LWLGKIVVVC  571
            LWLGK++VVC
Sbjct  505  LWLGKVIVVC  514



>gb|KDO86260.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=927

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_006491159.1| PREDICTED: protein RIC1 homolog isoform X3 [Citrus sinensis]
Length=1009

 Score =   319 bits (818),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  208  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  267

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  268  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  327

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  328  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  387

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  388  LWLGKIIVVC  397



>ref|XP_010934364.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Elaeis guineensis]
Length=1149

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWS SGCRLM T  Q G++S  SPV KP+Q+ K EP+MGGTS + WDE+G
Sbjct  354  AVGWKFRGLTVWSTSGCRLMCTIRQTGINSAFSPVAKPSQDLKFEPLMGGTSHVQWDEYG  413

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+LY++EE S ERI+AFSFGKCCLNRG+SGT+ VRQ+IYGEDR+LVVQ +DTDEL+I+HL
Sbjct  414  YKLYSVEENSSERILAFSFGKCCLNRGLSGTSYVRQIIYGEDRVLVVQPDDTDELKIMHL  473

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPVLHV AS+DGMYLAVAG HGLILYDLR K+WRVFGD+TQEQKI+C+GL
Sbjct  474  NLPVSYISQNWPVLHVVASKDGMYLAVAGLHGLILYDLRYKRWRVFGDVTQEQKIECKGL  533

Query  542  LWLGKIVVVC  571
            LWLGK++VVC
Sbjct  534  LWLGKVIVVC  543



>gb|KDO86259.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=1052

 Score =   319 bits (818),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_006491160.1| PREDICTED: protein RIC1 homolog isoform X4 [Citrus sinensis]
Length=984

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>gb|KDO86256.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=1134

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  333  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  392

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  393  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  452

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  453  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  512

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  513  LWLGKIIVVC  522



>ref|XP_006444983.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
 ref|XP_006444984.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
 ref|XP_006491157.1| PREDICTED: protein RIC1 homolog isoform X1 [Citrus sinensis]
 ref|XP_006491158.1| PREDICTED: protein RIC1 homolog isoform X2 [Citrus sinensis]
 gb|ESR58223.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
 gb|ESR58224.1| hypothetical protein CICLE_v10018597mg [Citrus clementina]
 gb|KDO86257.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
 gb|KDO86258.1| hypothetical protein CISIN_1g001165mg [Citrus sinensis]
Length=1124

 Score =   319 bits (818),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/190 (83%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLMST  QI LSS+SSP++KPNQ+ K EP+M GTS+M WDE+G
Sbjct  323  AVGWKSRGLTVWSVSGCRLMSTIRQISLSSISSPIVKPNQDCKYEPLMSGTSMMQWDEYG  382

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRLYAIEEGS ER++ FSFGKCCLNRGVSG T  RQVIYGEDRLLVVQSEDTDEL+ILHL
Sbjct  383  YRLYAIEEGSSERVLIFSFGKCCLNRGVSGMTYARQVIYGEDRLLVVQSEDTDELKILHL  442

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            NLPVSYISQNWPV HVAAS+DGM+LAVAG HGLILYD+R KKWRVFGDITQEQKIQ +GL
Sbjct  443  NLPVSYISQNWPVQHVAASKDGMFLAVAGLHGLILYDIRQKKWRVFGDITQEQKIQSKGL  502

Query  542  LWLGKIVVVC  571
            LWLGKI+VVC
Sbjct  503  LWLGKIIVVC  512



>ref|XP_010413394.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X2 
[Camelina sativa]
Length=982

 Score =   316 bits (810),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS +SP I P Q+ K EP+M GTS + WDE+G
Sbjct  178  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSTTSPKINPKQDSKYEPLMNGTSAIQWDEYG  237

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  238  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  297

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  298  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  357

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  358  LWLGKIVVIC  367



>ref|XP_010413393.1| PREDICTED: RAB6A-GEF complex partner protein 1-like isoform X1 
[Camelina sativa]
Length=1126

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS +SP I P Q+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSTTSPKINPKQDSKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_010469083.1| PREDICTED: RAB6A-GEF complex partner protein 1-like [Camelina 
sativa]
Length=1126

 Score =   317 bits (811),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSTSSPKINPKQDCKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_002876617.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52876.1| hypothetical protein ARALYDRAFT_486626 [Arabidopsis lyrata subsp. 
lyrata]
Length=1127

 Score =   315 bits (807),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGLSS SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKSRGLAVWSVSGCRLMSTVRQIGLSSTSSPKINPKQDSKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASSDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|NP_191707.3| beta-chain like quinoprotein amine dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE80210.1| beta-chain like quinoprotein amine dehydrogenase [Arabidopsis 
thaliana]
Length=1080

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGL+S SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  276  AVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINPKQDCKYEPLMSGTSAIQWDEYG  335

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  336  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  395

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  396  KLPVSYISQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  455

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  456  LWLGKIVVIC  465



>emb|CAB71078.1| putative protein [Arabidopsis thaliana]
Length=1100

 Score =   314 bits (804),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGL+S SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  276  AVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINPKQDCKYEPLMSGTSAIQWDEYG  335

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  336  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  395

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  396  KLPVSYISQNWPVQHVAASEDGKYLAVAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  455

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  456  LWLGKIVVIC  465



>gb|KFK35333.1| hypothetical protein AALP_AA5G271500 [Arabis alpina]
Length=1123

 Score =   314 bits (805),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS SSP I PNQ+YK EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSASSPKINPNQDYKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSF KCCLNRGVSG T VRQV+YGEDRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASCDRILAFSFAKCCLNRGVSGKTYVRQVMYGEDRLLIVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPV YI+QNWPV HVAAS DG YLAVAG  G+ILYD+R KKWRVFG+I+QEQKI C+GL
Sbjct  442  KLPVLYITQNWPVQHVAASEDGQYLAVAGSRGVILYDVRNKKWRVFGNISQEQKIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>gb|KFK35334.1| hypothetical protein AALP_AA5G271500 [Arabis alpina]
Length=1132

 Score =   314 bits (805),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS SSP I PNQ+YK EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSASSPKINPNQDYKYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSF KCCLNRGVSG T VRQV+YGEDRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASCDRILAFSFAKCCLNRGVSGKTYVRQVMYGEDRLLIVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPV YI+QNWPV HVAAS DG YLAVAG  G+ILYD+R KKWRVFG+I+QEQKI C+GL
Sbjct  442  KLPVLYITQNWPVQHVAASEDGQYLAVAGSRGVILYDVRNKKWRVFGNISQEQKIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|NP_974846.2| Quinoprotein amine dehydrogenase, beta chain-like / RIC1-like 
guanyl-nucleotide exchange factor [Arabidopsis thaliana]
 gb|AED93792.1| Quinoprotein amine dehydrogenase, beta chain-like / RIC1-like 
guanyl-nucleotide exchange factor [Arabidopsis thaliana]
Length=1087

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGL+S SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  282  AVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINPKQDCKYEPLMSGTSAIQWDEYG  341

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  342  YRLFATEEASYDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  401

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS DG YLA AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  402  KLPVSYISQNWPVQHVAASEDGKYLAFAGLHGLILYDIRFKKWRVFGDVSQEQQIHCKGL  461

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  462  LWLGKIVVIC  471



>ref|XP_006402476.1| hypothetical protein EUTSA_v10005756mg [Eutrema salsugineum]
 gb|ESQ43929.1| hypothetical protein EUTSA_v10005756mg [Eutrema salsugineum]
Length=1125

 Score =   313 bits (802),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/190 (77%), Positives = 167/190 (88%), Gaps = 2/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  Q+GLSSVSSP I  NQ+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKLRGLAVWSVSGCRLMSTVRQLGLSSVSSPKI--NQDCKYEPLMNGTSAIQWDEYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YGEDRLL+VQ+EDTDEL++LHL
Sbjct  380  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYVRQVMYGEDRLLMVQAEDTDELKLLHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  440  KLPVSYITQNWPVQHVAASEDGKYLAVAGLHGLILYDIRFKKWRVFGDVSQEQQIHCKGL  499

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  500  LWLGKIVVIC  509



>ref|NP_568507.3| Quinoprotein amine dehydrogenase, beta chain-like / RIC1-like 
guanyl-nucleotide exchange factor [Arabidopsis thaliana]
 gb|AED93791.1| Quinoprotein amine dehydrogenase, beta chain-like / RIC1-like 
guanyl-nucleotide exchange factor [Arabidopsis thaliana]
Length=1127

 Score =   313 bits (802),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/190 (76%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGL+S SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  322  AVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINPKQDCKYEPLMSGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  382  YRLFATEEASYDRILAFSFGKCCLNRGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYISQNWPV HVAAS DG YLA AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYISQNWPVQHVAASEDGKYLAFAGLHGLILYDIRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>gb|EEC74137.1| hypothetical protein OsI_09207 [Oryza sativa Indica Group]
Length=1123

 Score =   305 bits (780),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/190 (73%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDYG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ERI+AFSF KCCLNRG+SGTT  RQ++YGEDR+L+VQ +DTDEL++LHL
Sbjct  379  YKLFAVEENLSERILAFSFAKCCLNRGLSGTTYTRQILYGEDRILLVQPDDTDELKMLHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WRVFGD+TQEQKIQC+GL
Sbjct  439  NVPASYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRVFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWLGKIV+VC
Sbjct  499  LWLGKIVIVC  508



>ref|XP_006649109.1| PREDICTED: protein RIC1 homolog [Oryza brachyantha]
Length=1149

 Score =   304 bits (778),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 165/190 (87%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  348  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDYG  406

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT  RQ++YGEDR+L+VQ +DTDEL++LHL
Sbjct  407  YKLFAVEESLSERVLAFSFAKCCLNRGLSGTTYTRQILYGEDRILLVQPDDTDELKMLHL  466

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WRVFGD+TQEQKIQC+GL
Sbjct  467  NVPASYISQNWPVLHVVASHDGMYLAVAGSHGLVLYDLRNKRWRVFGDVTQEQKIQCKGL  526

Query  542  LWLGKIVVVC  571
            LWLGKIV+VC
Sbjct  527  LWLGKIVIVC  536



>gb|EEE57940.1| hypothetical protein OsJ_08650 [Oryza sativa Japonica Group]
Length=1123

 Score =   302 bits (773),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/190 (73%), Positives = 164/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDYG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ERI+AFSF KCCLNRG+ GTT  RQ++YGEDR+L+VQ +DTDEL++LHL
Sbjct  379  YKLFAVEENLSERILAFSFAKCCLNRGLLGTTYTRQILYGEDRILLVQPDDTDELKMLHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WRVFGD+TQEQKIQC+GL
Sbjct  439  NVPASYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRVFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWLGKIV+VC
Sbjct  499  LWLGKIVIVC  508



>dbj|BAJ89601.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1095

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM TF Q G +S  SP++KPN + K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTFRQAGSNSALSPMVKPNAQ-KFEPLMGGTSHIQWDDYG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+S TT  RQ++YGEDR+L+VQ +DTDEL+ILHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCLNRGLSSTTYTRQILYGEDRILLVQPDDTDELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+PVSY SQNWPV+HV AS DGMYLAVAG  GL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPVSYSSQNWPVMHVVASDDGMYLAVAGSRGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWLGKIV+VC
Sbjct  499  LWLGKIVIVC  508



>emb|CDY48914.1| BnaA09g39230D [Brassica napus]
Length=1116

 Score =   298 bits (762),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGLSS SSP I PNQ+ + EP+M GTS + WDE+G
Sbjct  322  AVGWKSRGLAVWSVSGCRLMSTVRQIGLSSASSPKINPNQDSRYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T +RQV+YGEDRLL+VQ+EDTD+L++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYIRQVMYGEDRLLMVQAEDTDDLKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLA+AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGQYLAIAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_004954159.1| PREDICTED: protein RIC1 homolog [Setaria italica]
Length=1124

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 163/190 (86%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT   QV+YG+DR+L+VQ +D DEL++LHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDDRILLVQPDDADELKLLHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+PVSYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPVSYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWLGKIV+VC
Sbjct  499  LWLGKIVIVC  508



>ref|XP_009116813.1| PREDICTED: protein RIC1 homolog isoform X2 [Brassica rapa]
Length=1128

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGLSS SSP I PNQ+ + EP+M GTS + WDE+G
Sbjct  322  AVGWKSRGLAVWSVSGCRLMSTVRQIGLSSASSPKINPNQDSRYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T +RQV+YGEDRLL+VQ+EDTD+L++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYIRQVMYGEDRLLMVQAEDTDDLKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLA+AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGQYLAIAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_009116812.1| PREDICTED: protein RIC1 homolog isoform X1 [Brassica rapa]
Length=1129

 Score =   297 bits (761),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGLSS SSP I PNQ+ + EP+M GTS + WDE+G
Sbjct  322  AVGWKSRGLAVWSVSGCRLMSTVRQIGLSSASSPKINPNQDSRYEPLMNGTSAIQWDEYG  381

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T +RQV+YGEDRLL+VQ+EDTD+L++LHL
Sbjct  382  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYIRQVMYGEDRLLMVQAEDTDDLKLLHL  441

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLA+AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  442  KLPVSYITQNWPVQHVAASEDGQYLAIAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  501

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  502  LWLGKIVVIC  511



>ref|XP_006292424.1| hypothetical protein CARUB_v10018639mg [Capsella rubella]
 gb|EOA25322.1| hypothetical protein CARUB_v10018639mg [Capsella rubella]
Length=1086

 Score =   296 bits (759),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/191 (73%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWKLRGL VWSVSGCRLMST  QIGLSS SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  280  AVGWKLRGLAVWSVSGCRLMSTVRQIGLSSTSSPKINPKQDCKYEPLMNGTSAIQWDEYG  339

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLN GVSG T VRQV+YG+DRLL+VQ+EDTDEL++LHL
Sbjct  340  YRLFATEEASCDRILAFSFGKCCLNIGVSGKTYVRQVMYGDDRLLMVQAEDTDELKLLHL  399

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG  LAVAG HGL LY++  K+WRVFGD++QEQ+I C+GL
Sbjct  400  KLPVSYITQNWPVQHVAASEDGKDLAVAGLHGLTLYNVMYKRWRVFGDVSQEQQIHCKGL  459

Query  542  LWLG-KIVVVC  571
            LWLG KIVV+C
Sbjct  460  LWLGKKIVVIC  470



>emb|CDY65354.1| BnaC08g48990D [Brassica napus]
Length=1088

 Score =   296 bits (759),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 166/190 (87%), Gaps = 0/190 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGLSS SSP I PNQ+ + EP+M GTS + WDE+G
Sbjct  280  AVGWKSRGLAVWSVSGCRLMSTVRQIGLSSSSSPKINPNQDSRYEPLMNGTSAIQWDEYG  339

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T +RQV+YGEDRLL+VQ+EDTD+L++LHL
Sbjct  340  YRLFATEEASCDRILAFSFGKCCLNRGVSGKTYIRQVMYGEDRLLMVQAEDTDDLKLLHL  399

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LPVSYI+QNWPV HVAAS DG YLA+AG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  400  KLPVSYITQNWPVQHVAASEDGQYLAIAGLHGLILYDVRFKKWRVFGDVSQEQQIHCKGL  459

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  460  LWLGKIVVIC  469



>ref|XP_008679243.1| PREDICTED: protein RIC1 homolog isoform X4 [Zea mays]
Length=971

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  167  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDNG  225

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCC NRG+SGTT   QV+YGEDR+L+VQ +D DEL+ILHL
Sbjct  226  YKLFAVEESLSERVLAFSFAKCCPNRGLSGTTYSHQVLYGEDRILLVQPDDADELKILHL  285

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  286  NVPISYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  345

Query  542  LWLGKIVVVC  571
            LW+ KIV+VC
Sbjct  346  LWMRKIVIVC  355



>ref|XP_010236164.1| PREDICTED: guanine nucleotide exchange factor subunit Rich-like 
[Brachypodium distachyon]
Length=1126

 Score =   295 bits (756),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KPN + K EP+MGGTS + W ++G
Sbjct  321  AVGWKFRGLTVWSVSGCRLMCTIRQAGSNSASSPMVKPNAQ-KFEPLMGGTSHIQWGDYG  379

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+S TT  RQ++YGEDR+L+VQ +DTDEL++LHL
Sbjct  380  YKLFAVEESLSERVLAFSFAKCCLNRGLSSTTYTRQILYGEDRILLVQPDDTDELKMLHL  439

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+PVSY SQNWPV HV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  440  NVPVSYSSQNWPVQHVVASDDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  499

Query  542  LWLGKIVVVC  571
            LWLGK+V+VC
Sbjct  500  LWLGKVVIVC  509



>ref|XP_008679242.1| PREDICTED: protein RIC1 homolog isoform X3 [Zea mays]
Length=1083

 Score =   294 bits (752),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCC NRG+SGTT   QV+YGEDR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCPNRGLSGTTYSHQVLYGEDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPISYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LW+ KIV+VC
Sbjct  499  LWMRKIVIVC  508



>ref|XP_008679240.1| PREDICTED: protein RIC1 homolog isoform X1 [Zea mays]
 gb|AFW64209.1| hypothetical protein ZEAMMB73_817460 [Zea mays]
Length=1124

 Score =   294 bits (752),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 161/190 (85%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCC NRG+SGTT   QV+YGEDR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCPNRGLSGTTYSHQVLYGEDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWPVLHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPISYISQNWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LW+ KIV+VC
Sbjct  499  LWMRKIVIVC  508



>ref|XP_008646366.1| PREDICTED: protein RIC1 homolog isoform X3 [Zea mays]
Length=971

 Score =   289 bits (739),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++K     K EP+MGGTS + WD++G
Sbjct  167  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVK-RCTLKFEPLMGGTSHIQWDDNG  225

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT   QV+YG+DR+L+VQ +D DEL+ILHL
Sbjct  226  YKLFAVEENLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDDRILLVQPDDADELKILHL  285

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWP+LHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  286  NVPISYISQNWPLLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  345

Query  542  LWLGKIVVVC  571
            LWL KIV+VC
Sbjct  346  LWLRKIVIVC  355



>ref|XP_008646365.1| PREDICTED: protein RIC1 homolog isoform X2 [Zea mays]
Length=1063

 Score =   289 bits (739),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++K     K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVK-RCTLKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT   QV+YG+DR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEENLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWP+LHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPISYISQNWPLLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWL KIV+VC
Sbjct  499  LWLRKIVIVC  508



>ref|XP_008646364.1| PREDICTED: protein RIC1 homolog isoform X1 [Zea mays]
 gb|AFW73791.1| hypothetical protein ZEAMMB73_208881 [Zea mays]
 gb|AFW73792.1| hypothetical protein ZEAMMB73_208881 [Zea mays]
Length=1124

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 160/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++K     K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVK-RCTLKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT   QV+YG+DR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEENLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGDDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P+SYISQNWP+LHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVPISYISQNWPLLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  498

Query  542  LWLGKIVVVC  571
            LWL KIV+VC
Sbjct  499  LWLRKIVIVC  508



>ref|XP_008679241.1| PREDICTED: protein RIC1 homolog isoform X2 [Zea mays]
Length=1118

 Score =   277 bits (708),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 155/190 (82%), Gaps = 7/190 (4%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP+   K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPSA-LKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCC NRG+SGTT   QV+YGEDR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCPNRGLSGTTYSHQVLYGEDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
            N+P      NWPVLHV AS DGMYLAVAG HGL+LYDLR K+WR FGD+TQEQKIQC+GL
Sbjct  439  NVP------NWPVLHVVASNDGMYLAVAGSHGLVLYDLRNKRWRFFGDVTQEQKIQCKGL  492

Query  542  LWLGKIVVVC  571
            LW+ KIV+VC
Sbjct  493  LWMRKIVIVC  502



>gb|AAF88009.1| contains similarity to Drosophila melanogaster BcDNA.GH03694 
(GB:AAD55412) [Arabidopsis thaliana]
Length=1017

 Score =   255 bits (652),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 139/190 (73%), Gaps = 27/190 (14%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL VWSVSGCRLMST  QIGL+S SSP I P Q+ K EP+M GTS + WDE+G
Sbjct  262  AVGWKSRGLAVWSVSGCRLMSTVRQIGLTSTSSPKINPKQDCKYEPLMSGTSAIQWDEYG  321

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            YRL+A EE S +RI+AFSFGKCCLNRGVSG T VRQ                        
Sbjct  322  YRLFATEEASYDRILAFSFGKCCLNRGVSGKTYVRQ------------------------  357

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
               VSYISQNWPV HVAAS DG YLAVAG HGLILYD+R KKWRVFGD++QEQ+I C+GL
Sbjct  358  ---VSYISQNWPVQHVAASEDGKYLAVAGLHGLILYDIRFKKWRVFGDVSQEQQIHCKGL  414

Query  542  LWLGKIVVVC  571
            LWLGKIVV+C
Sbjct  415  LWLGKIVVIC  424



>ref|XP_002452938.1| hypothetical protein SORBIDRAFT_04g035280 [Sorghum bicolor]
 gb|EES05914.1| hypothetical protein SORBIDRAFT_04g035280 [Sorghum bicolor]
Length=1078

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM T  Q G +S SSP++KP    K EP+MGGTS + WD++G
Sbjct  320  AVGWKFRGLTVWSVSGCRLMCTIRQTGSNSASSPMVKPGA-VKFEPLMGGTSHIQWDDNG  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+SGTT   QV+YGEDR+L+VQ +D DEL+ILHL
Sbjct  379  YKLFAVEESLSERVLAFSFAKCCLNRGLSGTTYSHQVLYGEDRILLVQPDDADELKILHL  438

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            ++PVSYISQNWPVLHV AS DGMYLAVAG HG
Sbjct  439  HVPVSYISQNWPVLHVVASNDGMYLAVAGSHG  470



>ref|XP_001753139.1| predicted protein [Physcomitrella patens]
 gb|EDQ82180.1| predicted protein [Physcomitrella patens]
Length=1107

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 135/191 (71%), Gaps = 1/191 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYK-NEPMMGGTSLMHWDEH  178
            AVGWK RGL VWS SGCRLM T  Q  LS+  SP ++ N +   +EPM+ G   + W  H
Sbjct  312  AVGWKNRGLAVWSASGCRLMCTIRQGSLSNSQSPSLRVNSDRSMSEPMVQGVGALAWGHH  371

Query  179  GYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH  358
             Y LYA+E GS  R   F F K   ++ ++G TDV Q+++G DR+L+VQS++ ++++  H
Sbjct  372  AYELYAVERGSTLRFFEFRFAKSSSSQNIAGITDVWQLMHGADRVLLVQSDENNDVKSHH  431

Query  359  LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG  538
            L +P SYI  NWP+L VA + DG YLA+AG  GLIL+D+++KKWRVFGD+ QE+++ C G
Sbjct  432  LVIPHSYILDNWPILQVAGNEDGTYLAIAGRQGLILHDVQVKKWRVFGDVLQERQVHCVG  491

Query  539  LLWLGKIVVVC  571
            ++WLGKIVV+C
Sbjct  492  VVWLGKIVVLC  502



>ref|XP_002960230.1| hypothetical protein SELMODRAFT_75259 [Selaginella moellendorffii]
 gb|EFJ37769.1| hypothetical protein SELMODRAFT_75259 [Selaginella moellendorffii]
Length=1061

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RG++VWSVSGCRLM +  Q  +S+  SP        ++EP+  G + + W  HG
Sbjct  290  AVGWKNRGISVWSVSGCRLMCSIRQGSVSNAFSPASSGVDASRHEPLANGAAHLAWGPHG  349

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            + L A    +++ ++ FSF K  L R VSG++ +  V+YGEDRLL+V+ ++ DEL++ HL
Sbjct  350  FSLIAAGPRNVKGLLEFSFAKSSLKRCVSGSSHILDVLYGEDRLLLVEFDEEDELKLRHL  409

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             +P +YIS+ WPV HVA + DG YLA+AG  G+ILYD+ +K+WRVFGDITQE++I+C  L
Sbjct  410  MIPKTYISEGWPVRHVAINEDGSYLAIAGKQGVILYDVLMKRWRVFGDITQERQIRCFQL  469

Query  542  LWLGKIVVV  568
            +WL KI+V+
Sbjct  470  IWLDKIIVL  478



>ref|XP_002967485.1| hypothetical protein SELMODRAFT_439971 [Selaginella moellendorffii]
 gb|EFJ32084.1| hypothetical protein SELMODRAFT_439971 [Selaginella moellendorffii]
Length=1410

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 134/189 (71%), Gaps = 0/189 (0%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RG++VWSVSGCRLM +  Q  +S+  SP        ++EP+  G + + W  HG
Sbjct  642  AVGWKNRGISVWSVSGCRLMCSIRQGSVSNAFSPASSGVDASRHEPLANGAAHLAWGPHG  701

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            + L A    +++ ++ FSF K  L R VSG++ +  V+YGEDRLL+V+ ++ DEL++ HL
Sbjct  702  FSLIAAGPRNVKGLLEFSFAKSSLKRCVSGSSHILDVLYGEDRLLLVEFDEEDELKLRHL  761

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             +P +YIS+ WPV HVA + DG YLA+AG  G+ILYD+ +K+WRVFGDITQE++I+C  L
Sbjct  762  MIPKTYISEGWPVRHVAINEDGSYLAIAGKQGVILYDVLMKRWRVFGDITQERQIRCFQL  821

Query  542  LWLGKIVVV  568
            +WL KI+V+
Sbjct  822  IWLDKIIVL  830



>ref|XP_001758923.1| predicted protein [Physcomitrella patens]
 gb|EDQ76429.1| predicted protein [Physcomitrella patens]
Length=1122

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 135/191 (71%), Gaps = 1/191 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIK-PNQEYKNEPMMGGTSLMHWDEH  178
            AVGW+ RGL+VWSVSGCRLM T  Q  LS+  SP     N+   +EPM+ G +L+ W  +
Sbjct  315  AVGWRNRGLSVWSVSGCRLMCTIRQGSLSNSQSPAPGVDNERSMSEPMVKGVALLAWGRY  374

Query  179  GYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH  358
             Y L+A+E GS  R   F F K   ++ ++ TTD  Q+++G DR+++VQS+++ + +  H
Sbjct  375  AYELFAVERGSTLRFFEFRFAKSPASQSIAATTDAWQLMHGADRVVLVQSDESGDSKNHH  434

Query  359  LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG  538
            L +P  YI  NWPV+HV+ + DG YLA+AG  GL+L+DL++KK+RVFGD+ QE+++ C G
Sbjct  435  LIIPQPYIWDNWPVVHVSGNEDGSYLAIAGGKGLLLHDLQMKKFRVFGDVLQERQVHCVG  494

Query  539  LLWLGKIVVVC  571
            ++W+GKIVV+C
Sbjct  495  VIWVGKIVVIC  505



>gb|EMT13436.1| hypothetical protein F775_21841 [Aegilops tauschii]
Length=1067

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGLTVWSVSGCRLM TF Q G +S  SP++KPN + K EP+MGGTS + WD++G
Sbjct  297  AVGWKFRGLTVWSVSGCRLMCTFRQAGSNSALSPMVKPNAQ-KFEPLMGGTSHIQWDDYG  355

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y+L+A+EE   ER++AFSF KCCLNRG+S TT  RQ++YGEDR+L+VQ +DTDEL+ILHL
Sbjct  356  YKLFAVEESLSERVLAFSFAKCCLNRGLSSTTYTRQILYGEDRILLVQPDDTDELKILHL  415

Query  362  NLPV  373
            N+PV
Sbjct  416  NVPV  419



>ref|XP_003285309.1| hypothetical protein DICPUDRAFT_149161 [Dictyostelium purpureum]
 gb|EGC38182.1| hypothetical protein DICPUDRAFT_149161 [Dictyostelium purpureum]
Length=1296

 Score =   124 bits (312),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 67/192 (35%), Positives = 103/192 (54%), Gaps = 11/192 (6%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RG  +WSV GC+L  T  Q+   + +S  ++P +E        G     W    
Sbjct  322  AVGWKNRGFCLWSVYGCKLTCTIPQMNDVTSNSRYLEPCKE--------GVLAFSWGPES  373

Query  182  YRLYAIEEGS-LERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV--QSEDTDELRI  352
            Y L  +  G+ L     F+F K  L    S     R ++  EDRL+++  + ++  ++R 
Sbjct  374  YHLVLLSNGNDLGEFFQFTFLKASLASNPSLNYSERIILQTEDRLMLLNYKGKELGDIRW  433

Query  353  LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQC  532
             HL +P +Y++ NWP+ H+A SRD    AVAG  G+ILY+   K+W++FGD  QEQ I+ 
Sbjct  434  KHLQIPSAYLNDNWPIRHIALSRDRNQFAVAGKRGIILYNSLSKRWKMFGDRNQEQNIES  493

Query  533  RGLLWLGKIVVV  568
              L W   +++V
Sbjct  494  LCLAWYKNVIIV  505



>ref|XP_005647066.1| hypothetical protein COCSUDRAFT_83479 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22522.1| hypothetical protein COCSUDRAFT_83479 [Coccomyxa subellipsoidea 
C-169]
Length=1315

 Score =   119 bits (298),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 71/232 (31%), Positives = 111/232 (48%), Gaps = 47/232 (20%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMG---GTSLMHWD  172
            AVGW+  GL +W+ SGCRL+ +  Q    + + P+   +  +K+ P +    G S M W 
Sbjct  286  AVGWRRSGLGLWTPSGCRLLCSVRQ----ARTGPMHSMSSSFKSPPPLSFENGVSAMAWG  341

Query  173  EHGYRLYAIEEGSLERIIAFSFGKCCLNR------------GVSGTTDVRQVIYGEDRLL  316
              GYRL   E G   +++  S  K                    G      ++  +DRLL
Sbjct  342  AFGYRLVLAEAGMAAQVLELSLAKSLTGSHRIVHHPLPGPSQAPGPQPEVHLLQADDRLL  401

Query  317  VVQSEDTD---------------------------ELRILHLNLPVSYISQNWPVLHVAA  415
            V+ +E ++                           +L ++HL  P  Y++ NWP+ H A 
Sbjct  402  VI-TEGSEVSGGAGLAAGMRQGGAAGNASAAPHAADLGVVHLQPPAPYVAANWPLSHAAL  460

Query  416  SRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLLWLGKIVVVC  571
            S DGM +AVAG +GL LY  R  +WR+FGD++QE++I    L+WL ++V+ C
Sbjct  461  SADGMDIAVAGRNGLALYSRRSARWRLFGDVSQEREITVHHLMWLPRVVLAC  512



>dbj|GAM24943.1| hypothetical protein SAMD00019534_081180, partial [Acytostelium 
subglobosum LB1]
Length=1230

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 68/195 (35%), Positives = 104/195 (53%), Gaps = 17/195 (9%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQI--GLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDE  175
            AVGW+ RGL +WSV GC+L  T  Q+  G S  +            EP   G     W  
Sbjct  285  AVGWRNRGLCIWSVYGCKLTCTIPQMHDGASRFA------------EPCREGVLSFSWGP  332

Query  176  HGYRLYAIEEGSLE-RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV--QSEDTDEL  346
             GY L  +  G+     +  +F K  L+   +     R ++  EDRL+++  + ++  ++
Sbjct  333  EGYHLILLSSGNEPGEFLQLTFLKASLSANPNLNYSERIILQTEDRLMLLNYKGKELGDI  392

Query  347  RILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKI  526
            R  HL +P  Y++ NWP+ H+A SRD   LAVAG  G+ILY+   K+W++FGD TQEQ+I
Sbjct  393  RWKHLQIPSIYLNDNWPIKHIALSRDRSQLAVAGRKGVILYNSLSKRWKMFGDRTQEQEI  452

Query  527  QCRGLLWLGKIVVVC  571
            +  GL W    +++ 
Sbjct  453  ESLGLTWYKHTIIIA  467



>ref|XP_005710408.1| unnamed protein product [Chondrus crispus]
 emb|CDF40114.1| unnamed protein product [Chondrus crispus]
Length=1064

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 70/214 (33%), Positives = 113/214 (53%), Gaps = 27/214 (13%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNE----PMMGGTSLMHWD  172
            VGW+ RGL VWSVSGCRLM T  Q+G +  ++P  + N++ K+     PM  G     W 
Sbjct  60   VGWEKRGLAVWSVSGCRLMWTLPQVGGTLPTTPASR-NKDSKSHAVVHPMEQGVLAAAWG  118

Query  173  EHGYRLYA---IEEGSLERIIAFSFGKCCLNRGVSGT-----TDVRQVIYGEDRLLVVQS  328
             +G  L+A   + E + E I+   F +  + +G  G+        R  ++G DR+L++  
Sbjct  119  SNGLFLWAAPRVTEETPEPILDCHFMEFAIYKGSVGSHFCQGESSRLAMFGSDRVLLLWH  178

Query  329  ED--------------TDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLIL  466
             D               D     HL +P  Y+ +NWP   +A + D  ++AVAG +G+ +
Sbjct  179  ADGSDEATGQQGSAAWNDLFSWQHLLIPHDYLWRNWPPKRIAVNADASFVAVAGEYGVAM  238

Query  467  YDLRLKKWRVFGDITQEQKIQCRGLLWLGKIVVV  568
              +R +KWRVFGD+  +++I+C  L W+ K +V+
Sbjct  239  CHVRTQKWRVFGDLEHDRRIRCCALAWVSKTIVI  272



>ref|XP_004356075.1| hypothetical protein DFA_08587 [Dictyostelium fasciculatum]
 gb|EGG17591.1| hypothetical protein DFA_08587 [Dictyostelium fasciculatum]
Length=1318

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 101/192 (53%), Gaps = 6/192 (3%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK RGL +WSV GC+L  T  Q+  +S S P     +   +  +   T    W   G
Sbjct  326  AVGWKKRGLCLWSVHGCKLTCTIPQMHENSFSEPC---KEGVLSLVLSTKTKEKSWGTEG  382

Query  182  YRLYAIEEGS-LERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV--QSEDTDELRI  352
            Y +  +  G+ +   +  +F K   +   +     R ++  EDRL+ +  + ++  ++R 
Sbjct  383  YHMILLSSGNEVGEFLQLTFVKSSSSSNPNLNHSERIILQTEDRLMFLNYKGKELGDIRW  442

Query  353  LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQC  532
             HL LP +Y++ NWP+ H+A SRD    AVAG  G+ILY+   K+W++FGD  Q+Q I+ 
Sbjct  443  KHLQLPAAYLNDNWPIKHLAISRDRSQYAVAGRRGIILYNSLSKRWKMFGDRQQDQAIEA  502

Query  533  RGLLWLGKIVVV  568
              L W    + V
Sbjct  503  ISLAWYKHAIAV  514



>ref|XP_002507935.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69193.1| predicted protein [Micromonas sp. RCC299]
Length=1262

 Score =   107 bits (268),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 74/251 (29%), Positives = 102/251 (41%), Gaps = 61/251 (24%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIG-----------------------------LSSV  94
            A GW  RG+ VWS +GCRLM T  Q G                              +SV
Sbjct  362  AAGWWRRGVAVWSANGCRLMCTLPQGGGTAGSHADTATRDPWDGVDDAAGGRDGASTASV  421

Query  95   SSPVIKPNQEYKNEPMM--------GGTSLMHWDEHGYRLYAIEEGSLE-----------  217
            +   + P       P          GGT+ + W   GYRL+A                  
Sbjct  422  AGAGLSPRHFAGGRPTNARDREGGDGGTARLAWSGDGYRLFAASASGGGGVGGGGVGGGD  481

Query  218  ---------RIIAFSFGKCCLNRGVSGTTDV---RQVIYGEDRLLVVQSEDTDELRILHL  361
                     R+  F F   C    +  +T       ++   DR++VV   D DE    H+
Sbjct  482  GEARRAKKGRLREFLFAAACPGHHLDASTRRGARAHLLRAADRVIVVTGGDEDERAARHV  541

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LP +Y + NWP+  VA S DG  LA AG  GL+L+D +  KWR FGD++ E++     L
Sbjct  542  MLPDAYAAPNWPLRLVAESADGRDLAAAGSRGLVLHDFKTGKWRFFGDVSHEREFVATAL  601

Query  542  LWL-GKIVVVC  571
             WL G ++ VC
Sbjct  602  AWLEGGVIAVC  612



>ref|XP_002683438.1| WD40 domain-containing protein [Naegleria gruberi]
 gb|EFC50694.1| WD40 domain-containing protein [Naegleria gruberi]
Length=1784

 Score =   102 bits (255),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 65/196 (33%), Positives = 105/196 (54%), Gaps = 9/196 (5%)
 Frame = +2

Query  2     AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEY--KN---EPMMGGTSLMH  166
             AVG+  RG  V+ +SG  +M+T  Q     + S + + NQ +  KN   EP   G   + 
Sbjct  924   AVGFSKRGFAVFHISGICIMTTLPQFSEKEMQSILSQTNQTHVSKNKLIEPFGSGVRSLV  983

Query  167   WDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ-SEDTDE  343
             W+  G  L A+  G+   +  F+F K  L+   + + + + V+   ++LL    S  TD 
Sbjct  984   WNSDGCHLVAVSNGT-STLADFTFCKSILSNNFAQSKNSKVVLQTSEKLLRFHMSSGTDF  1042

Query  344   LRI--LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQE  517
             +      L +P SY+  N+P+ +VA S DG  LA++G  G I+Y   +KKWR+FG++ QE
Sbjct  1043  VNADWEPLEIPRSYLGFNYPIENVATSPDGNSLALSGRKGCIIYSGNVKKWRMFGNLEQE  1102

Query  518   QKIQCRGLLWLGKIVV  565
               I C G++W+  IV+
Sbjct  1103  YCINCIGMVWIDNIVL  1118



>gb|ESA10341.1| hypothetical protein GLOINDRAFT_197566 [Rhizophagus irregularis 
DAOM 181602]
Length=933

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 98/202 (49%), Gaps = 21/202 (10%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  GL VWSV G  LM+T           P+ KP  +   +  + G + + W    
Sbjct  345  AVGWKNEGLAVWSVYGRLLMTTVKD------DWPISKPTAQ---DSFLHGVNDLFWSSGN  395

Query  182  YRLYAIEEGSLER---IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRI  352
              L+ +     E+   +    F K  +    S     R  +  +DRLL+ +  D ++L  
Sbjct  396  CELFILHTAWTEKEVQLYTLPFAKSAVTTIHSPDNAKRGFLQMDDRLLLYRGGDQEDLSA  455

Query  353  L--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDI  508
            +        H+ +P+ YIS NWP+ + + S DG Y+A+AG  GL  +++   +W++FG+ 
Sbjct  456  INPDTIVWQHIPIPIMYISDNWPIKYASISSDGRYIAIAGRRGLAHHNVSSGRWKLFGNQ  515

Query  509  TQEQKIQCR-GLLWLGKIVVVC  571
             QEQ+   R GLLW  + +V  
Sbjct  516  QQEQEFAVRGGLLWYKQTLVAA  537



>gb|EXX77082.1| hypothetical protein RirG_027190 [Rhizophagus irregularis DAOM 
197198w]
Length=968

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 98/202 (49%), Gaps = 21/202 (10%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  GL VWSV G  LM+T           P+ KP  +   +  + G + + W    
Sbjct  321  AVGWKNEGLAVWSVYGRLLMTTVKD------DWPISKPTAQ---DSFLHGVNDLFWSSGN  371

Query  182  YRLYAIEEGSLER---IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRI  352
              L+ +     E+   +    F K  +    S     R  +  +DRLL+ +  D ++L  
Sbjct  372  CELFILHTAWTEKEVQLYTLPFAKSAVTTIHSPDNAKRGFLQMDDRLLLYRGGDQEDLSA  431

Query  353  L--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDI  508
            +        H+ +P+ YIS NWP+ + + S DG Y+A+AG  GL  +++   +W++FG+ 
Sbjct  432  INPDTIVWQHIPIPIMYISDNWPIKYASISSDGRYIAIAGRRGLAHHNVSSGRWKLFGNQ  491

Query  509  TQEQKIQCR-GLLWLGKIVVVC  571
             QEQ+   R GLLW  + +V  
Sbjct  492  QQEQEFAVRGGLLWYKQTLVAA  513



>ref|XP_641650.1| hypothetical protein DDB_G0279477 [Dictyostelium discoideum AX4]
 gb|EAL67677.1| hypothetical protein DDB_G0279477 [Dictyostelium discoideum AX4]
Length=1363

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 50/148 (34%), Positives = 79/148 (53%), Gaps = 3/148 (2%)
 Frame = +2

Query  134  EPMMGGTSLMHWDEHGYRLYAIEEGSLE-RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDR  310
            EP   G     W    Y L  +   + +     F+F K  L    +     R ++  EDR
Sbjct  313  EPCRDGVLSFSWGLESYHLILLSNDNDDGEFFQFTFLKASLASNPTLNYSERIILQTEDR  372

Query  311  LLVV--QSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLK  484
            L+++  + ++  ++R  HL +P +Y++ NWP+ H+A SRD    AVAG  G+ILY+   K
Sbjct  373  LMLLNYKGKELGDIRWKHLQIPSAYLNDNWPIRHIALSRDRNQYAVAGKRGIILYNQLSK  432

Query  485  KWRVFGDITQEQKIQCRGLLWLGKIVVV  568
            +W++FGD  QEQ+IQ   L W   +V+V
Sbjct  433  RWKMFGDRNQEQEIQSLSLAWYKNVVIV  460



>ref|XP_006675340.1| hypothetical protein BATDEDRAFT_21645 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF84001.1| hypothetical protein BATDEDRAFT_21645 [Batrachochytrium dendrobatidis 
JAM81]
Length=1117

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 96/203 (47%), Gaps = 17/203 (8%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AV W   G++VWSV G  LMST  +      +  ++       NE    GT  + W E G
Sbjct  322  AVAWIYGGMSVWSVYGSLLMSTISEDTFVHSADGIVS----NTNEIFFTGTQDLFWSESG  377

Query  182  YRLYAIEEGSLER-----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ--SEDT-  337
            + L+ +   + E+     I    F K  +    S +      +  +DRLL+ +    DT 
Sbjct  378  HDLFILPSSTFEKESVSDIYVLQFAKASILTCDSWSNSRHICLLLDDRLLMYEGLHSDTN  437

Query  338  ----DELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
                D +    + +P  YIS NWP+ +V+ +  G ++A+AG  GL  Y+    KW++FG+
Sbjct  438  VTSLDPMGWETIQIPNVYISDNWPIRYVSLNSSGKFIAIAGKRGLAHYNTFSGKWKLFGN  497

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    + G+LW   +++V 
Sbjct  498  EHQEQGFTVQGGILWFRSMLIVA  520



>emb|CEI86573.1| hypothetical protein RMCBS344292_01010 [Rhizopus microsporus]
Length=623

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 94/202 (47%), Gaps = 22/202 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG++  GL VWSV G  L +T     L  ++      N+E   +  + G   + W    
Sbjct  328  SVGYESHGLAVWSVYGSMLCATN---ELDEIA------NEENLKDTYIKGIQYLFWGPGN  378

Query  182  YRLYAIEEGSLERIIAFS--FGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE--------  331
            Y LY + +   +  I ++  F K  L   +      + ++  +DR+L+  S         
Sbjct  379  YSLYVLAKYKADENIMYTLPFVKSALASYLHSDNAKKGLLQMDDRMLIYNSSGDYQDEST  438

Query  332  --DTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
              D   +   H+  P  YI+ NWP+ + + S DG Y+A+AG  G   Y+    +W++FG+
Sbjct  439  TIDPAAVAWTHIQYPAMYIADNWPIRYSSISSDGSYIAIAGKRGFAHYNTISSRWKLFGN  498

Query  506  ITQEQKIQCR-GLLWLGKIVVV  568
              QEQ    R G++W   I++V
Sbjct  499  QQQEQSFLVRGGMVWYKTILIV  520



>ref|XP_005705101.1| hypothetical protein Gasu_39580 [Galdieria sulphuraria]
 gb|EME28581.1| hypothetical protein Gasu_39580 [Galdieria sulphuraria]
Length=1241

 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/238 (26%), Positives = 103/238 (43%), Gaps = 52/238 (22%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC------------------------QIGLSSVSSPVI  109
            AVG++  G+ VWS  G  +  TF                         Q+G +  SS + 
Sbjct  329  AVGYEKAGVVVWSNFGHCVFHTFSSFEHPKEEMRYLAETIQEMQNNHEQLGQTDPSSSIY  388

Query  110  KPN--QEYKNEPMMGGTSLMHWDEHGYRLYAI----------EEGSLERIIAF--SFGKC  247
                 + +K   +   T  + W   GY L+ +          E  S    + F  SF K 
Sbjct  389  GETKMESFKQGYLFRHTKAVCWGAFGYSLFVLGSIDYTRNHWEAQSFVPFLLFELSFLKT  448

Query  248  CLNRGVSGTTDVRQVIYGEDRLLVVQSED-----------TDELRILHLNLPVSYISQNW  394
              ++G       R  + G D  +   SED           + +  I H+  P  Y+S NW
Sbjct  449  GFSKGSCQNEATRSFLLGPDFFV---SEDNAMIHYPDMMSSKKKMIRHIEAPYEYVSNNW  505

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLLWLGKIVVV  568
            P+  ++ + D  ++AV+G HG+ +Y+ R ++WR+FGD+ +E+ IQC  L W G+ +++
Sbjct  506  PLRSISVNDDKSFVAVSGKHGVAIYNTRSRRWRLFGDVVEERMIQCCSLCWYGRSIII  563



>ref|XP_004356522.1| RIC1 protein [Acanthamoeba castellanii str. Neff]
 gb|ELR24622.1| RIC1 protein [Acanthamoeba castellanii str. Neff]
Length=1471

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 91/197 (46%), Gaps = 35/197 (18%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLM------STFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLM  163
            AVGW   G  +WS  G RL       S  C  G++S+S                      
Sbjct  346  AVGWLGGGFALWSSYGSRLCISPASESALCGKGIASLS----------------------  383

Query  164  HWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDE  343
             W   GYRL+              F +           + R V++GE  LL+    + +E
Sbjct  384  -WGREGYRLFLTSPPDDSTASPAGFEQINF-----AMEEERLVLWGEAELLLYCPHELNE  437

Query  344  -LRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQ  520
             ++   + +P +Y++ NWP++HVA S +   +AVAG  G+ +Y   + +WR+FGD ++EQ
Sbjct  438  TMKWQRIQVPQTYMTDNWPIMHVAVSPESGDVAVAGRRGVAIYSAAVHRWRLFGDRSEEQ  497

Query  521  KIQCRGLLWLGKIVVVC  571
            +++C G+ W   ++V+ 
Sbjct  498  ELECLGMAWYRSLLVLA  514



>ref|XP_007265866.1| RIC1-domain-containing protein [Fomitiporia mediterranea MF3/22]
 gb|EJD04265.1| RIC1-domain-containing protein [Fomitiporia mediterranea MF3/22]
Length=1007

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 95/203 (47%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  G  VWS+ G  L   F       V   V   N+ +++  M G   L  W +  
Sbjct  381  AVGWK-NGWAVWSIGGRCLAWGF------GVEEDV--DNERFRDIFMFGVLDLF-WGQGN  430

Query  182  YRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L+ + + SL     ++    F K  +    +        +  +DR+LV +  D  ++ 
Sbjct  431  FELFVVSQPSLNNPDGQLFVIPFAKSAVTEQQTPDNTRYAFLQLDDRVLVYRGADQPDMS  490

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P+ Y++ NWP+ + A S DG  +AVAG  GLI +     +W++FGD
Sbjct  491  VINPESDVWQHIKIPLEYLASNWPIRYSAISMDGRLIAVAGRRGLIHFSTTSGRWKLFGD  550

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R G+LW   +++  
Sbjct  551  SVQEQAFAVRGGVLWFHHVLIAA  573



>gb|EPB91624.1| hypothetical protein HMPREF1544_01546 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=1087

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 93/204 (46%), Gaps = 24/204 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG+K  GL VWSV G          GL   SS +       + +  + G   + W    
Sbjct  364  SVGYKTHGLAVWSVYG----------GLLCASSEMDDVFGGDRYDTYVKGIQSLFWGPGN  413

Query  182  YRLYAI---EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE-------  331
            ++LY +   ++G+  +    SF K  L   +      R ++  +DR+L+  +        
Sbjct  414  HQLYVLSKDKDGTTSKFFTLSFAKSALTSYLHSDNAKRGLLLADDRILLYNNGGDYQENN  473

Query  332  ---DTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
               D   +   H+  P  YI+ +WP+ + + S DG Y+A+AG  G   Y+    +W++FG
Sbjct  474  TTIDPAAVAWTHIQYPALYITDHWPIRYASISSDGKYIAIAGKRGFAHYNAISNRWKLFG  533

Query  503  DITQEQKIQCR-GLLWLGKIVVVC  571
            +  QEQ    R G++W   I++V 
Sbjct  534  NQHQEQSFLVRGGMVWYKNIIIVA  557



>emb|CEG65932.1| hypothetical protein RMATCC62417_02604 [Rhizopus microsporus]
Length=1024

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 94/203 (46%), Gaps = 22/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG++  GL VWSV G  L +T     L  ++      N+E   +  + G   + W    
Sbjct  328  SVGYESHGLAVWSVYGSMLCATN---ELDEIA------NEENLKDTYIKGIQYLFWGPGN  378

Query  182  YRLYAIEEGSLERIIAFS--FGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE--------  331
            Y LY + +   +  I ++  F K  L   +      + ++  +DR+L+  S         
Sbjct  379  YSLYVLAKYKADENIMYTLPFVKSALASYLHSDNAKKGLLQMDDRMLIYNSSGDYQDEST  438

Query  332  --DTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
              D   +   H+  P  YI+ NWP+ + + S DG Y+A+AG  G   Y+    +W++FG+
Sbjct  439  TIDPAAVAWTHIQYPAMYIADNWPIRYSSISSDGSYIAIAGKRGFAHYNTISSRWKLFGN  498

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R G++W   I++V 
Sbjct  499  QQQEQSFLVRGGMVWYKTILIVS  521



>emb|CBN76586.1| conserved unknown protein [Ectocarpus siliculosus]
Length=3082

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 51/156 (33%), Positives = 78/156 (50%), Gaps = 17/156 (11%)
 Frame = +2

Query  140  MMGGTSLMHWDEHGYRLYAIEEGSL-----------ERIIAFSFGKCCLNRGVSGTTDVR  286
            + GG   + W+  GYRL ++                + I+AF F    L R  S  +   
Sbjct  645  IAGGARALSWEREGYRLMSVGSAVGAAAGVGGDAGAQGIVAFDF----LRRARSNLSSSL  700

Query  287  QVIYGEDRLLVVQSEDTDELRILHLNLPV--SYISQNWPVLHVAASRDGMYLAVAGFHGL  460
              + G DR+ +V S+      +L   LPV   Y+S N P+ HV+ SR G Y+AVAG  G 
Sbjct  701  LSLQGSDRIALVDSQPWSAQVLLWRVLPVHPGYLSSNAPLRHVSTSRAGTYVAVAGSRGF  760

Query  461  ILYDLRLKKWRVFGDITQEQKIQCRGLLWLGKIVVV  568
             +Y     +WR+FG+I QE+++Q  G+ W G+  +V
Sbjct  761  AVYSRPTNRWRLFGNIEQEREVQVAGMCWWGESALV  796



>emb|CEG82973.1| hypothetical protein RMATCC62417_16958 [Rhizopus microsporus]
Length=745

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 94/203 (46%), Gaps = 22/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG++  GL VWSV G  L +T     L  ++      N+E   +  + G   + W    
Sbjct  231  SVGYESHGLAVWSVYGSILCATN---ELDEIA------NEENLKDTYIKGIQYLFWGPGN  281

Query  182  YRLYAIEEGSLERIIAFS--FGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE--------  331
            Y LY + +   +  I ++  F K  L   +      + ++  +DR+L+  S         
Sbjct  282  YSLYILAKYKTDENIMYTLPFVKSALATYLHSDNAKKGLLQMDDRMLIYNSSGDYQDEST  341

Query  332  --DTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
              D   +   H+  P  YI+ NWP+ + + S DG Y+A+AG  G   Y+    +W++FG+
Sbjct  342  TIDPAAVAWTHIQYPAMYIADNWPIRYSSISSDGNYIAIAGKRGFAHYNTISSRWKLFGN  401

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R G++W   I++V 
Sbjct  402  QQQEQSFLVRGGMVWYKTILIVS  424



>ref|XP_005848243.1| hypothetical protein CHLNCDRAFT_144800 [Chlorella variabilis]
 gb|EFN56141.1| hypothetical protein CHLNCDRAFT_144800 [Chlorella variabilis]
Length=1666

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 54/191 (28%), Positives = 81/191 (42%), Gaps = 36/191 (19%)
 Frame = +2

Query  107  IKPNQEYKNEPMMGGTSLMHWDEHGYRLYAIEEGSLERIIAFSFGK-----------CCL  253
            + P Q  +   + GG S + W  HGY+L   E G    +    F +              
Sbjct  535  LNPGQAPEAGVLEGGVSALTWSVHGYQLLVAEVGQARSLHQLEFARYMHGSHRVVQQAAG  594

Query  254  NRGVSGTTDVRQVIYGEDRLLVVQSEDT------------------------DELRILHL  361
              G     D  Q +   DR+L++                              +L + H+
Sbjct  595  GGGAGSGLDEVQALQAADRVLLISEARQIVNPALRVPGGAAEAAEGEGVGVRPDLSVQHV  654

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             LP  YI   +PVLH + S+    +AVAG  GL LY  R ++WR+FGD TQE+ ++ +GL
Sbjct  655  KLPQQYIEAAYPVLHASISQSCGEVAVAGTRGLALYSRRARRWRLFGDATQEKNLRVQGL  714

Query  542  LWL-GKIVVVC  571
            +WL G I+  C
Sbjct  715  MWLPGGIIAAC  725



>ref|XP_002912152.1| hypothetical protein CC1G_13684 [Coprinopsis cinerea okayama7#130]
 gb|EFI28658.1| hypothetical protein CC1G_13684 [Coprinopsis cinerea okayama7#130]
Length=1007

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 93/202 (46%), Gaps = 22/202 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW   G  V+SV G  L S+F      +V     K    Y++  M G  SL  W    
Sbjct  376  AVGWT-NGWGVFSVGGRCLASSF------NVEHNTDK--SRYQDTFMFGVRSLF-WGPGN  425

Query  182  YRLYAIEEGSLE---RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRI  352
            + L+ +   S++   ++ A  F K      +S        +  +DR L+ +  D  ++ I
Sbjct  426  FDLFVLANHSIQSDAQLFAIPFAKSATTGQLSPDNTRYAFLQLDDRALIYRGADQPDMSI  485

Query  353  L--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDI  508
            +        H+ +P  YI+ NWP+ + + S DG  +AVAG  GLI Y     +W+VF D 
Sbjct  486  INPESDVWQHVKIPQRYIAMNWPIRYSSLSSDGRLIAVAGRRGLIHYSSMSGRWKVFADE  545

Query  509  TQEQKIQCR-GLLWLGKIVVVC  571
             QEQ    R GLLW   ++V  
Sbjct  546  VQEQAFTVRGGLLWFHHVLVAA  567



>ref|XP_001352891.1| GA21512 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL30392.1| GA21512 [Drosophila pseudoobscura pseudoobscura]
Length=1417

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 98/234 (42%), Gaps = 55/234 (24%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LMST     GL+             K  P+      + W   
Sbjct  329  AVSWANGGLSLWSTFGALLMSTLSWDFGLNV---------DLLKQNPL--KLRRLEWSTE  377

Query  179  GYRLYAI---EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDE--  343
            GY+L+ +    E     ++   F K  L+     T +   ++ G+D L + Q  + +E  
Sbjct  378  GYQLFMLMKEAENQANNVLQLQFVKSALSMNPCMTANPHILLQGDDCLYINQGNNLEETY  437

Query  344  --------------------LRILH----------------LNLPVSYISQNWPVLHVAA  415
                                L + H                L LP++Y S NWP+ + A 
Sbjct  438  GGNKFTFPSSGGADQPEDDCLELKHSLNTGSILTESKYWTLLQLPLNYASTNWPIRYAAI  497

Query  416  SRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
             +DG++LAVAG  GL  Y L  +KW++FG+ +QE+     G  L W G IV+ C
Sbjct  498  DKDGLHLAVAGRTGLAHYSLMTRKWKLFGNESQEKDFVVSGGLLWWHGFIVMGC  551



>gb|KDR85280.1| hypothetical protein GALMADRAFT_83897 [Galerina marginata CBS 
339.88]
Length=987

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 92/204 (45%), Gaps = 24/204 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  G  V+SV G  L+S F       V+  +   ++E   +  M G   + W    
Sbjct  373  AVGWK-HGWGVFSVGGKCLVSAF------GVNDAI---DEEKFQDGFMYGIRNLFWGPGN  422

Query  182  YRLYAIEEGSLE-----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDEL  346
            + L+ + E  +      ++ A  F K       S        +  +DR L+ +  D  +L
Sbjct  423  FELFVLAESVVHHRHDGQLFAIPFAKSATTGQHSPDNTRYAFLQMDDRALIYRGADQPDL  482

Query  347  RIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
             ++        H+ +P  Y++ NWP+ + + S DG  +A+AG  GLI Y     +W++F 
Sbjct  483  SVINPESDVWQHIKIPQKYLALNWPIRYSSLSNDGRLIAIAGRRGLIHYSSTSGRWKIFT  542

Query  503  DITQEQKIQCR-GLLWLGKIVVVC  571
            D  QEQ    R GLLW   ++V  
Sbjct  543  DEEQEQNFTVRGGLLWFHHVLVAA  566



>ref|XP_007336256.1| RIC1-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
 gb|EJD55298.1| RIC1-domain-containing protein [Auricularia delicata TFB-10046 
SS5]
Length=980

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 24/202 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW   G +VWSVSG  L      +G       V + N  + +  M G  SL  W    
Sbjct  356  AVGWA-GGWSVWSVSGRCLAHG---VG-------VEEDNPSFSDMFMQGVLSLF-WIPGN  403

Query  182  YRLYAIEE---GSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRI  352
              L  +      S  ++ +  F K  +    +       ++  +DR+LV +  D  ++ +
Sbjct  404  LELVLLAPRDCDSDAQLFSIPFAKSAITGQHAPDNTRYALLLMDDRVLVYRGADQPDMSV  463

Query  353  L--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDI  508
            +        H+ LP++YI+ NWP+ + + S DG  +A AG +GLI Y     +W++FGD 
Sbjct  464  INPEADVWQHIKLPLTYIASNWPIRYASISTDGRLIACAGRNGLIHYSTASGRWKMFGDE  523

Query  509  TQEQKIQCR-GLLWLGKIVVVC  571
             QEQ  Q R GLLW   ++V  
Sbjct  524  GQEQAFQVRGGLLWFYHVLVAA  545



>ref|XP_001419080.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97373.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=1049

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 85/196 (43%), Gaps = 13/196 (7%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNE---PMMGGT-SLMHW  169
            AVGW+ RG++VWS SGC LM T    G  S       P   +  +   P MG   +   W
Sbjct  193  AVGWRRRGVSVWSESGCLLMCTLHHGGGDSAVGTSSSPRATFTGDEEVPEMGACLAPPAW  252

Query  170  DEHGYRLY-AIEEGSLERIIAFSFGKCCLNRGVSGTT-------DVRQVIYGEDRLLVVQ  325
                Y L+  +   S  +++ ++  K   N  V+  +       D   ++ G+DR+ +V 
Sbjct  253  GVGDYALFVPVRSESGSKVLEYALAKSVSNSRVAPRSYDGGCDHDDASLLLGDDRIFIVA  312

Query  326  SEDTD-ELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
            S  T   +       P  Y+ + WP+     S  G  +AV G  G +++D R + W   G
Sbjct  313  SSATSTRVHARQEVCPSEYVQRQWPMCVAGMSPSGDRVAVGGVRGCVVFDTRGECWSQLG  372

Query  503  DITQEQKIQCRGLLWL  550
            D+ +E   +     W+
Sbjct  373  DVEEENSFEAIAFDWM  388



>ref|XP_002061620.1| GK17088 [Drosophila willistoni]
 gb|EDW72606.1| GK17088 [Drosophila willistoni]
Length=1466

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 69/243 (28%), Positives = 105/243 (43%), Gaps = 68/243 (28%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSL----MH  166
            AV W   GL++WS  G  LMST     GL               N  +M    L    + 
Sbjct  332  AVSWSRGGLSLWSTFGALLMSTLSWDFGL---------------NVDLMKQNPLQLRRLE  376

Query  167  WDEHGYRLYAI--EEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQS  328
            W   GY+L+ I  E+ ++E     ++   F K CL+     T++   ++ G+D L + Q 
Sbjct  377  WSTEGYQLFMITKEKENMENKESNVLQLQFVKSCLSMNPCMTSNPHILLQGDDCLYINQG  436

Query  329  EDTD-------------------------ELR--------ILH-------LNLPVSYISQ  388
             + +                         EL+        IL        L LP++Y + 
Sbjct  437  NNLEQTFGGQKSTFPQSGGKEKEEESECLELKQNSIDMGSILTESKYWSLLQLPLNYAAT  496

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIV  562
            NWP+ + A  +DG++LAVAG  GL  Y L  +KW++FG+ +QE+     G  L W G IV
Sbjct  497  NWPIRYAAIDKDGIHLAVAGRTGLAHYSLITRKWKLFGNESQEKDFVVSGGLLWWQGFIV  556

Query  563  VVC  571
            + C
Sbjct  557  MGC  559



>gb|KFM27402.1| RIC1-like protein [Auxenochlorella protothecoides]
Length=663

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/219 (27%), Positives = 87/219 (40%), Gaps = 50/219 (23%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEP--MMGGTSLMHWDE  175
            AVG    GL+VW+ SGCR++ T                 Q    EP  + G  + + W  
Sbjct  348  AVGQARAGLSVWTASGCRVLCTL---------------RQHAGVEPGILEGPVTALAWAR  392

Query  176  HGYRLYAIEEGSLERIIAFSFGKCCL--NRGV--------------------SGTTDVRQ  289
            HG RL A E GS + +    F +     +R +                     G      
Sbjct  393  HGARLLAAEGGSPQLLQELRFARTLAGDHRAILRRRWTGAQASGSELPPWLDPGEEGAGH  452

Query  290  VIYGEDRLLVVQSEDT-----------DELRILHLNLPVSYISQNWPVLHVAASRDGMYL  436
             +  EDR+L+V                 EL + HL +P +Y+   +P++  A       +
Sbjct  453  ALLAEDRVLLVGPCAAVGRGARGLGLRPELALEHLQVPEAYLEAAYPLVRAAVDPSSGDV  512

Query  437  AVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLLWLG  553
            AVAG  G  L+     +WR+FGD  QE+  Q   L+WLG
Sbjct  513  AVAGGVGFALHSRSQARWRLFGDAAQERSFQALALVWLG  551



>emb|CDO70231.1| hypothetical protein BN946_scf184942.g31 [Trametes cinnabarina]
Length=992

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 92/203 (45%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  VWSV G  L   F   G+        + ++E   +  M G   + W    
Sbjct  361  AVGWE-KGWAVWSVGGRCLAWGF---GVE------YEVDEERFKDAFMYGVRSLFWAPGN  410

Query  182  YRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + S  +    +    F K       S        +  +DR+LV +  D  ++ 
Sbjct  411  FELVILAQSSPNQPDGQLFVLPFAKSATTGQQSPDNTQYAFLQMDDRVLVYRGADQPDMS  470

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P SY+S NWP+ + + S DG  +A+AG  GL+ Y     +W++F D
Sbjct  471  VINPEADVWQHVKIPQSYMSANWPIRYSSLSGDGRLIAIAGRRGLVHYSSTSGRWKLFAD  530

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    + GLLW   ++++ 
Sbjct  531  ELQEQAFTVKGGLLWFHHVLIIA  553



>ref|XP_003080654.1| WD40 repeat protein (ISS) [Ostreococcus tauri]
Length=1045

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 83/191 (43%), Gaps = 8/191 (4%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGT-SLMHWDEH  178
            AV W+ RGL +WS SGC LM T    G +  +    K   +    P +G       W   
Sbjct  194  AVAWRRRGLAIWSDSGCLLMCTLHHHGRAEGAVVPRKSFVDIDETPEVGACLGTPAWGIL  253

Query  179  GYRLYAIEEG-----SLERIIAFSFGKCCLNRGVS--GTTDVRQVIYGEDRLLVVQSEDT  337
            GY LY +  G       E  +A S  K C+    S   T D   ++ G+DR+ V+ S   
Sbjct  254  GYSLYVVVNGYEGTHVEEYSLARSCPKPCVPPRASEHATGDESSLLIGDDRVFVIASNAM  313

Query  338  DELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQE  517
             +  +     P  Y+   WP+   A S DG  +AVAG  G ++YD   ++W +  ++  +
Sbjct  314  GKFCMRQEICPTEYVESQWPMRVAAMSPDGTRVAVAGSRGCVVYDTDFEEWIMHPELEHK  373

Query  518  QKIQCRGLLWL  550
               +     W+
Sbjct  374  IATEVIDFTWV  384



>emb|CEG01378.1| WD40/YVTN repeat-like-containing domain [Ostreococcus tauri]
Length=1123

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 83/191 (43%), Gaps = 8/191 (4%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGT-SLMHWDEH  178
            AV W+ RGL +WS SGC LM T    G +  +    K   +    P +G       W   
Sbjct  272  AVAWRRRGLAIWSDSGCLLMCTLHHHGRAEGAVVPRKSFVDIDETPEVGACLGTPAWGIL  331

Query  179  GYRLYAIEEGSL-----ERIIAFSFGKCCLNRGVS--GTTDVRQVIYGEDRLLVVQSEDT  337
            GY LY +  G       E  +A S  K C+    S   T D   ++ G+DR+ V+ S   
Sbjct  332  GYSLYVVVNGYEGTHVEEYSLARSCPKPCVPPRASEHATGDESSLLIGDDRVFVIASNAM  391

Query  338  DELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQE  517
             +  +     P  Y+   WP+   A S DG  +AVAG  G ++YD   ++W +  ++  +
Sbjct  392  GKFCMRQEICPTEYVESQWPMRVAAMSPDGTRVAVAGSRGCVVYDTDFEEWIMHPELEHK  451

Query  518  QKIQCRGLLWL  550
               +     W+
Sbjct  452  IATEVIDFTWV  462



>ref|XP_007230663.1| PREDICTED: protein RIC1 homolog [Astyanax mexicanus]
Length=1410

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 94/231 (41%), Gaps = 53/231 (23%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  322  VTWECGGLSLWSVFGAHLI---CTLGEDFAYR-----SDGTKKDPL--KISSMSWGAEGY  371

Query  185  RLYAIE--EGSLER--------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE-  331
             L+ I   EG ++         I+ F F K  L      +   + +++GEDRL +   + 
Sbjct  372  HLWVISSSEGGVDESTELRQASILQFQFIKSALTVNPCTSNQEQVLLHGEDRLFLTCGDA  431

Query  332  -----------DTDELRILHLNLPVS--------------------YISQNWPVLHVAAS  418
                       D+  +   H   P+S                    Y+  NWP+   A  
Sbjct  432  AQVHSPVEPLRDSSPMHRPHTTPPLSQGLSTLLGHKHWHVVQIHSTYLESNWPIRFAAID  491

Query  419  RDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVV  568
              G  LAVAG  G   Y L  +KW++FG+ITQEQ +    GL W    VVV
Sbjct  492  SAGQCLAVAGRRGFAHYSLFTRKWKLFGNITQEQSMTVTGGLAWWNDFVVV  542



>ref|XP_006454604.1| hypothetical protein AGABI2DRAFT_114349 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV51625.1| hypothetical protein AGABI2DRAFT_114349 [Agaricus bisporus var. 
bisporus H97]
Length=984

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 88/203 (43%), Gaps = 19/203 (9%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW   G  V+SV G  L S F    +   S P ++       +  M G   + W    
Sbjct  371  AVGWTY-GWGVFSVGGRCLASAFEVEDILEESRPSVR-----FQDIFMSGVHQLFWGPGN  424

Query  182  YRLYAIEEGSLERI----IAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  +     +++     +  F KC      S        +  +DR LV +  D  ++ 
Sbjct  425  FELILLARRHSQKVDGQLFSIPFAKCATTGQHSPDNTRYAFLQMDDRALVYRGADQPDMS  484

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ LP  Y+++NWP+ + + S DG  +AVAG  GLI Y     +W+VF D
Sbjct  485  VINPESDVWQHIKLPQQYLAKNWPIRYSSISADGRLIAVAGRRGLIHYSSTSGRWKVFMD  544

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              Q Q    R GLLW   +++  
Sbjct  545  EHQGQAFVVRGGLLWFHHVLIAA  567



>ref|XP_007378315.1| RIC1-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN13398.1| RIC1-domain-containing protein [Punctularia strigosozonata HHB-11173 
SS5]
Length=1032

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 90/203 (44%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G  VWSV G  L   F  +          + +++   +  M G   + W    
Sbjct  385  AVGWQY-GWAVWSVGGRCLAWGFGTVD---------EVDEDRFQDAFMHGVRDLFWAPGN  434

Query  182  YRLYAIEEGSLER------IIAFSFGKCCLNRGVSGTTDVRQVIYG----EDRLLVVQSE  331
            + L+ + + S         +I F+          +    +    Y     +DR+LV +  
Sbjct  435  FELFVLAQSSPNTEDGQLFVIPFAKSAATSQHSPARLQHLDNTRYAFLQLDDRMLVYRGA  494

Query  332  DTDELRILHL--NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            D  ++ +++   ++P  YI+ NWP+ + A S DG  +AVAG  GLI Y     +W++F D
Sbjct  495  DQPDMSVINPESDVPHDYIAANWPIRYSALSTDGRLIAVAGRRGLIHYSSNSGRWKLFAD  554

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GL+W   +++  
Sbjct  555  EMQEQAFSVRGGLVWFHHVLIAA  577



>ref|XP_007359996.1| RIC1-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF66424.1| RIC1-domain-containing protein [Dichomitus squalens LYAD-421 
SS1]
Length=1006

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 90/203 (44%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  VWSV G  L   F   G+        + ++E   +  M G   + W    
Sbjct  375  AVGWE-KGWAVWSVGGRCLAWGF---GVE------YEVDEEKFTDSFMYGVRSLFWVSGN  424

Query  182  YRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + S  +    +    F K       S        +  +DR+LV +  D  ++ 
Sbjct  425  FELVMLAQNSPNKPDGQMFVLPFAKSATTGQHSPDNTQYAFLQMDDRVLVYRGADQPDMS  484

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P  Y+S NWP+ + + S DG  +A+AG  GL+ Y     +W++F D
Sbjct  485  VINPEADVWQHIKVPQDYMSANWPIRYSSLSSDGRLIAIAGRRGLVHYSSTSGRWKMFAD  544

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    + GLLW   +++  
Sbjct  545  ERQEQAFTVKGGLLWFHHVLIAA  567



>ref|XP_007314619.1| hypothetical protein SERLADRAFT_445869 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO28420.1| hypothetical protein SERLADRAFT_445869 [Serpula lacrymans var. 
lacrymans S7.9]
Length=1004

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/163 (28%), Positives = 72/163 (44%), Gaps = 13/163 (8%)
 Frame = +2

Query  122  EYKNEPMMGGTSLMHWDEHGYRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQ  289
            E   +  M G   M W    + L A+   S      +I    F K       S       
Sbjct  416  EKFQDTFMCGIRDMFWSPGNFELLALAHPSDNSVDGQIFVIPFAKSATTGQHSPDNTRYA  475

Query  290  VIYGEDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVA  445
             +  +DR LV +  D  ++ ++        H+ +P +Y++ NWP+ + A S DG  +AVA
Sbjct  476  FLQMDDRALVYRGVDQPDMSVINPESDVWQHIKIPQAYLASNWPIQYSALSNDGRLIAVA  535

Query  446  GFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            G  GLI Y     +W++F D+ QEQ    + GLLW   +++  
Sbjct  536  GRRGLIHYSSSSGRWKLFADVIQEQAFAVKGGLLWFHHVLIAA  578



>ref|XP_007763267.1| RIC1-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW86459.1| RIC1-domain-containing protein [Coniophora puteana RWD-64-598 
SS2]
Length=985

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G   +SV G  L S+   +G+      V   + E   +  M G   + W    
Sbjct  373  AVGWR-HGWATFSVGGRCLASS---LGI------VDNLDSEKFEDTFMLGIRDLFWAPGN  422

Query  182  YRL----YAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L    + +E  +  +I    F K      +S        +  +DR LV +  D  ++ 
Sbjct  423  FELVVLTHPVENKTEGQIFIIPFAKSATTCQLSPDNTQHAFLLLDDRALVYRGADQPDMS  482

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P +Y++ NWP+ + A S DG  +A AG  GL+ Y     +W++F +
Sbjct  483  VINPESDVWQHVKIPQAYLATNWPIRYSALSSDGRLIAFAGRRGLVHYSSASGRWKLFAN  542

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
            +TQEQ    + GLLW   +++  
Sbjct  543  VTQEQAFCVKGGLLWFHHVLIAA  565



>ref|XP_003037446.1| hypothetical protein SCHCODRAFT_80930 [Schizophyllum commune 
H4-8]
 gb|EFJ02544.1| hypothetical protein SCHCODRAFT_80930 [Schizophyllum commune 
H4-8]
Length=972

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 91/203 (45%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G  V SV G  L S F   G+            ++++  M G +SL  W    
Sbjct  349  AVGWE-NGWGVISVGGRCLASAF---GVEDSVD-----TDKFQDRYMYGVSSLF-WAPGN  398

Query  182  YRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L+ +   S +    ++    F K       S        +  +DR L+ +  D  ++ 
Sbjct  399  FELFVLALPSSKPVDGQLFVIPFAKSATTGQHSPDNTRYAFLQMDDRALIYRGADQPDMS  458

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P SY++ NWP+ + A S DG  +A+AG  GLI Y     +W++F D
Sbjct  459  VINPDSDVWQHVKIPQSYLATNWPIKYSALSSDGRLIAIAGRRGLIHYSATSGRWKLFSD  518

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GLLW   ++V  
Sbjct  519  ELQEQAFTVRGGLLWFHHVLVAS  541



>gb|EPS99074.1| hypothetical protein FOMPIDRAFT_1125058 [Fomitopsis pinicola 
FP-58527 SS1]
Length=1002

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 90/203 (44%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  +WSV G  L   F   G+     P      ++++  M G T L  W    
Sbjct  371  AVGWE-KGWAIWSVGGRCLAWGF---GVEYEVDP-----DKFQDSFMYGVTELF-WAPGN  420

Query  182  YRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + +   +R    +    F K       S        +  +DR+LV +  D  ++ 
Sbjct  421  FELVVLAKPMSDRTDGQLFVLPFAKSATTGQHSPDNTQYAFLQMDDRVLVYRGADQPDMS  480

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P +Y+S NWP+ + A S DG  +AVAG  GL  Y     +W++F D
Sbjct  481  VINPESDVWQHVKIPHAYLSANWPIRYSALSADGRLIAVAGRRGLAHYSTTSGRWKLFAD  540

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QE     + GLLW   +++  
Sbjct  541  DLQENAFMVKGGLLWFHHVLIAA  563



>gb|KDQ20395.1| hypothetical protein BOTBODRAFT_26402 [Botryobasidium botryosum 
FD-172 SS1]
Length=1056

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 89/202 (44%), Gaps = 24/202 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ RG  VWSV G R ++    +G           +     +  M G   + W    
Sbjct  425  AVGWE-RGWAVWSVGG-RCLAWGLGVGQ----------DDGGIEDTFMNGVIDLFWIPGN  472

Query  182  YRLYAI---EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRI  352
              L+ +    E S  ++ +  F K  +    S        +  +DR+LV +  D  ++ +
Sbjct  473  SELFVLAHPSEDSKSQLFSLPFAKSAVTGQHSPDNTRYAFLQMDDRVLVYRGADQPDMSV  532

Query  353  LH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDI  508
            ++        + +P  Y++ NWP+ + + S DG  +AVAG  GL+ Y     +W+ F D 
Sbjct  533  INPESDVWQQIKIPAEYLAANWPIRYASISNDGRLVAVAGRRGLVHYSAASGRWKQFSDP  592

Query  509  TQEQKIQCR-GLLWLGKIVVVC  571
             QEQ    R GL+W   +++  
Sbjct  593  AQEQAFTVRGGLIWFHHVLIAS  614



>ref|XP_008032971.1| RIC1-domain-containing protein [Trametes versicolor FP-101664 
SS1]
 gb|EIW64556.1| RIC1-domain-containing protein [Trametes versicolor FP-101664 
SS1]
Length=1014

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 90/203 (44%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  +WSV G  L   F   G+        + + E   +  M G   + W    
Sbjct  378  AVGWE-KGWAIWSVGGRCLAWGF---GVE------YEVDAERFQDAFMYGVRGLFWAPGN  427

Query  182  YRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + S      ++    F K       S        +  +DR+LV +  D  ++ 
Sbjct  428  FELVMLAQSSPNMADGQLFVLPFAKSATTGQHSPDNTQYAFLQMDDRVLVYRGADQPDMS  487

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P SY+S NWP+ + + S DG  +A+AG  GL+ Y     +W++F D
Sbjct  488  VINPEADVWQHVKVPQSYMSANWPIRYSSLSADGRLIAIAGRRGLVHYSSTSGRWKMFAD  547

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    + GLLW   +++  
Sbjct  548  ELQEQAFTVKGGLLWFHHVLIAA  570



>gb|EJT51573.1| hypothetical protein A1Q1_07204 [Trichosporon asahii var. asahii 
CBS 2479]
Length=963

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 12/163 (7%)
 Frame = +2

Query  119  QEYKNEPM---MGGTSLMHWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQ  289
            QE  + P+   M G S + W      L+ +   +  R+ A  F K       S       
Sbjct  352  QEDDSGPVDDFMRGVSALFWAPGNLDLFMVAPSAPTRLFALPFVKSATTSQHSPDNTRYA  411

Query  290  VIYGEDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVA  445
             +  +DR+LV +  D  ++ ++        H+++P  YI+ NWP+ +   S DG ++AVA
Sbjct  412  FLQLDDRVLVYRGADQPDMSVINPESDVWQHIHIPAVYIATNWPIRYACISSDGRFVAVA  471

Query  446  GFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            G  GL  Y     +W++F    +E+    R GLLW   +++  
Sbjct  472  GKRGLTHYSAASGRWKLFTHEREERAFSVRGGLLWFHHVLIAA  514



>gb|EKD02925.1| hypothetical protein A1Q2_02756 [Trichosporon asahii var. asahii 
CBS 8904]
Length=963

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 12/163 (7%)
 Frame = +2

Query  119  QEYKNEPM---MGGTSLMHWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQ  289
            QE  + P+   M G S + W      L+ +   +  R+ A  F K       S       
Sbjct  352  QEDDSGPVDDFMRGVSALFWAPGNLDLFMVAPSAPTRLFALPFVKSATTSQHSPDNTRYA  411

Query  290  VIYGEDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVA  445
             +  +DR+LV +  D  ++ ++        H+++P  YI+ NWP+ +   S DG ++AVA
Sbjct  412  FLQLDDRVLVYRGADQPDMSVINPESDVWQHIHIPAVYIATNWPIRYACISSDGRFVAVA  471

Query  446  GFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            G  GL  Y     +W++F    +E+    R GLLW   +++  
Sbjct  472  GKRGLTHYSAASGRWKLFTHEREERAFSVRGGLLWFHHVLIAA  514



>ref|XP_001873933.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR15725.1| predicted protein [Laccaria bicolor S238N-H82]
Length=967

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 93/205 (45%), Gaps = 26/205 (13%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  G  ++SV G  L S F       V  P+   + E   +  M G   + W    
Sbjct  350  AVGWK-HGWGIFSVCGRCLASGF------GVEDPI---DLEKFQDVFMFGVRDLSWGPGN  399

Query  182  YRLY----AIEEGSLERIIAFS--FGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDE  343
            + L      +++G + RI+ F+  F K       S        +  +DR LV +  D  +
Sbjct  400  FELLVLAQPLDQGRI-RILLFAIPFAKSSTTGQHSPDNTRYAFLQMDDRALVYRGADQPD  458

Query  344  LRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVF  499
            + ++        H+ +P  Y+S NWPV + + S DG  +A+AG  G I Y     +W++F
Sbjct  459  MSVINPESDVWQHIKIPQKYLSSNWPVRYSSLSSDGRLIAIAGRRGFIHYSSTSGRWKLF  518

Query  500  GDITQEQKIQCR-GLLWLGKIVVVC  571
             D  +EQ    R GLLW   +++V 
Sbjct  519  VDEMEEQAFTVRGGLLWFHHVLIVA  543



>gb|KDQ30439.1| hypothetical protein PLEOSDRAFT_1062460 [Pleurotus ostreatus 
PC15]
Length=985

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 85/203 (42%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW   G  ++SV G  L    C  G+  +       ++    +  M G   + W    
Sbjct  351  AVGWD-HGWGIFSVGGRCLA---CGFGVDDLV------DENKFQDTFMNGVFNLFWAPGN  400

Query  182  YRLYAIEEGSLERI----IAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  +   S ++I        F K       S        +  EDR LV +  D  +L 
Sbjct  401  FELMLMARPSPKKIDGQIFVIPFAKSATTGQQSPDNTRYAFLQMEDRALVYRGADQPDLS  460

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P SY+S NWP+ + A S DG  +A+ G  GLI Y     +W+ + D
Sbjct  461  VINPESDVWQHIKIPQSYLSTNWPIRYSALSSDGRLIAIGGRRGLIHYSSTSGRWKTYAD  520

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GLLW   +++  
Sbjct  521  ELQEQAFIVRGGLLWFHHVLIAA  543



>ref|XP_007325489.1| hypothetical protein AGABI1DRAFT_123933 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83606.1| hypothetical protein AGABI1DRAFT_123933 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=984

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 87/203 (43%), Gaps = 19/203 (9%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW   G  V+SV G  L S F        S P ++       +  M G   + W    
Sbjct  371  AVGWTY-GWGVFSVGGRCLASAFEVEDTLEESRPSVR-----FQDIFMSGVHQLFWGPGN  424

Query  182  YRLYAIEEGSLERI----IAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  +     +++     +  F KC      S        +  +DR LV +  D  ++ 
Sbjct  425  FELILLARRHSQKVDGQLFSIPFAKCATTGQHSPDNTRYAFLQMDDRALVYRGADQPDMS  484

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ LP  Y+++NWP+ + + S DG  +AVAG  GLI Y     +W+VF D
Sbjct  485  VINPESDVWQHIKLPQQYLAKNWPIRYSSISADGRLIAVAGRRGLIHYSSTSGRWKVFMD  544

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              Q Q    R G+LW   +++  
Sbjct  545  EHQGQAFVVRGGVLWFHHVLIAA  567



>gb|EUC67168.1| RIC1-domain protein [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP55536.1| RIC1-domain protein [Rhizoctonia solani 123E]
Length=1040

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 93/209 (44%), Gaps = 25/209 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            A+GW+ RG   WS+ G       C  +G+ +V +  I  N+  K +  M G   + W+  
Sbjct  405  AIGWE-RGWGAWSIGG----RCLCWAVGMENVGA-GIGMNESGKQDAFMSGVRTLFWNPG  458

Query  179  GYRLYAI---------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE  331
               L+ +         E      + +  F K  +    S        +  +DR+LV +  
Sbjct  459  NTELWVLAAGHSNPPKEPAHSASLFSIPFVKSAIAGQHSPDNTRYAFLQMDDRVLVYRGA  518

Query  332  DTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKK  487
            D  ++ ++        H+ +P  Y++ NWP+   + + DG  +AVAG  GL+ Y     K
Sbjct  519  DQPDMSVINPESDVWQHICVPADYLAYNWPIRSASIAPDGRLIAVAGRRGLVHYSSASGK  578

Query  488  WRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            W+ F D+ QEQ    + G++W   +++V 
Sbjct  579  WKRFLDLKQEQAFAVKGGMIWFHHVLLVA  607



>gb|EGO02717.1| hypothetical protein SERLA73DRAFT_119756 [Serpula lacrymans var. 
lacrymans S7.3]
Length=923

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 72/167 (43%), Gaps = 17/167 (10%)
 Frame = +2

Query  122  EYKNEPMMGGTSLMHWDEHGYRLYAIEEGSLE--------RIIAFSFGKCCLNRGVSGTT  277
            E   +  M G   M W    + L A+   S          +I    F K       S   
Sbjct  331  EKFQDTFMCGIRDMFWSPGNFELLALAHPSDNSKGAFLNGQIFVIPFAKSATTGQHSPDN  390

Query  278  DVRQVIYGEDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMY  433
                 +  +DR LV +  D  ++ ++        H+ +P +Y++ NWP+ + A S DG  
Sbjct  391  TRYAFLQMDDRALVYRGVDQPDMSVINPESDVWQHIKIPQAYLASNWPIQYSALSNDGRL  450

Query  434  LAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            +AVAG  GLI Y     +W++F D+ QEQ    + GLLW   +++  
Sbjct  451  IAVAGRRGLIHYSSSSGRWKLFADVIQEQAFAVKGGLLWFHHVLIAA  497



>ref|XP_001958491.1| GF23489 [Drosophila ananassae]
 gb|EDV41297.1| GF23489 [Drosophila ananassae]
Length=1433

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 101/243 (42%), Gaps = 64/243 (26%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV WK  GL++WS  G  LMST     GL+             +N P+      + W   
Sbjct  331  AVSWKNGGLSLWSTFGALLMSTQSWDFGLNV---------DLLRNNPL--KLRRLEWSTE  379

Query  179  GYRLYAIEEGSLE----------RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ-  325
            GY+L+ + +   E           ++   F K  L+     TT+   ++ GED L + Q 
Sbjct  380  GYQLFMLTQKPSEGQDETEKDRSNVLQLQFVKSALSMNPCMTTNPHILLQGEDCLYLNQG  439

Query  326  -----------------------SEDTDELRILH----------------LNLPVSYISQ  388
                                   + D D L +                  L LP++Y + 
Sbjct  440  NNLERTYAGSQATFPSSGTGAETTTDDDCLELKQSPHTGSILTESKYWTVLQLPLNYAAT  499

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIV  562
            NWP+ + A  ++G++LAVAG  GL  Y L  ++W++FG+ +QE+     G  L W G +V
Sbjct  500  NWPIRYAAIDQEGLHLAVAGRTGLAHYSLVSRRWKLFGNESQEKDFVVSGGLLWWQGFVV  559

Query  563  VVC  571
            + C
Sbjct  560  MGC  562



>ref|XP_001973722.1| GG13186 [Drosophila erecta]
 gb|EDV52748.1| GG13186 [Drosophila erecta]
Length=1430

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 101/238 (42%), Gaps = 59/238 (25%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV WK  GL++WS  G  LMST     GL+     +++ N      P+      + W   
Sbjct  331  AVSWKNGGLSLWSTFGALLMSTLSWDFGLNV---DLVREN------PL--KLRRLEWSTE  379

Query  179  GYRLYAIE---EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ--------  325
            GY+L+ ++   E     ++   F K  L+     TT    ++ G+D L + Q        
Sbjct  380  GYQLFMLKQHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDCLYLNQGNNLELTY  439

Query  326  ------------------SEDTDELRILH----------------LNLPVSYISQNWPVL  403
                              S D D L +                  L LP++Y + NWP+ 
Sbjct  440  AGSHGTFPSSGVGSDEGISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIR  499

Query  404  HVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            + A   DG++LAVAG  GL  Y L  ++W++FG+ +QE+     G  L W G +V+ C
Sbjct  500  YAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGC  557



>emb|CCM01611.1| predicted protein [Fibroporia radiculosa]
Length=689

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 88/204 (43%), Gaps = 24/204 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  VWSV G  L   F       V   V   + E   +  M G + + W    
Sbjct  56   AVGWE-KGWAVWSVGGRCLAWGF------GVEYEV---DDEKFQDAFMYGVNDLFWAPGN  105

Query  182  YRLYAIEEGSLER-----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDEL  346
            + L  +   +  +     +    F K       S        +  +DR+LV +  D  ++
Sbjct  106  FELVVLAGSAPPKKPDGQLFIIPFAKSATTGQHSPDNTQYAFLQMDDRVLVYRGADQPDM  165

Query  347  RIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
             ++        H+ +P SY+S NWP+ + A S DG  +AVAG  GL  Y     +W++F 
Sbjct  166  SVINPESDVWQHVKIPQSYLSTNWPIRYSALSADGRLIAVAGRRGLAHYSTTSGRWKMFT  225

Query  503  DITQEQKIQCR-GLLWLGKIVVVC  571
            D  QEQ    + GLLW   +++  
Sbjct  226  DEIQEQAFIVKGGLLWFHHVLIAA  249



>ref|XP_007307452.1| RIC1-domain-containing protein [Stereum hirsutum FP-91666 SS1]
 gb|EIM83316.1| RIC1-domain-containing protein [Stereum hirsutum FP-91666 SS1]
Length=1037

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 87/203 (43%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGWK  G  VWSV+G  L   F   G+        + ++E   +  M G   + W    
Sbjct  409  AVGWK-HGWAVWSVAGRCLAWGF---GVEE------QVDEERFQDAFMYGIKDLFWVPGN  458

Query  182  YRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + S  R    +    F K                +  +DR LV +  D  ++ 
Sbjct  459  FELIVLAQSSPNRPDGQLFILPFAKSATTGQHVPDNSEYAFLQMDDRALVYRGADQPDMS  518

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P SY++ NWP+ +   S DG  +AVAG  GL  Y     +W++F D
Sbjct  519  VINPESDVWQHIKIPQSYLAANWPIRYSTISADGRLIAVAGRRGLAHYSSASGRWKLFAD  578

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    + G+LW   +++  
Sbjct  579  ELQEQAFVVKGGMLWFHHVLIAT  601



>ref|XP_002008966.1| GI11518 [Drosophila mojavensis]
 gb|EDW19442.1| GI11518 [Drosophila mojavensis]
Length=1418

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 98/230 (43%), Gaps = 51/230 (22%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W+  GL++WS  G  LMST     GL      ++K N      P+      + W   
Sbjct  328  AVSWENGGLSLWSTFGALLMSTLSWDFGLHV---DLVKQN------PLQ--LRRLEWSTE  376

Query  179  GYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ-----------  325
            GY+L+         ++   F K  L+     T     ++ G+D L + Q           
Sbjct  377  GYQLFMTTRDEKNNVLQLQFVKSALSMNPCMTAHPHILLQGDDCLYINQGDNLELTYGNA  436

Query  326  ------------SEDTDELR-------ILH-------LNLPVSYISQNWPVLHVAASRDG  427
                        ++D  EL+       IL        L LP++Y + NWP+ + A    G
Sbjct  437  KCTFPSSTATGQNDDCLELKQSPNMGSILTESKYWTLLQLPLNYAATNWPIRYAAIDAAG  496

Query  428  MYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            ++LAVAG  GL  Y +  KKW++FG+ +QE+     G  L W G IV+ C
Sbjct  497  LHLAVAGRTGLAHYSMLNKKWKLFGNESQEKDFVVSGGLLWWQGFIVMGC  546



>emb|CDQ80175.1| unnamed protein product [Oncorhynchus mykiss]
Length=1329

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 93/233 (40%), Gaps = 54/233 (23%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  229  VTWECGGLSLWSVFGAHLI---CTLGEDFAYR-----SDGTKKDPI--KISSMCWGAEGY  278

Query  185  RLYAI---EEGSLER---------------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDR  310
             L+ I   EE  L                 I+ F F K  L      +   + +++GEDR
Sbjct  279  HLWVITSREEAELVENMEEAPPPTQTKQAGILQFHFIKSALTVNPCTSNQEQVLLHGEDR  338

Query  311  LLVVQSEDTDELRILHLNLPV------------------------SYISQNWPVLHVAAS  418
            L +   + T    + H + P                         +Y+  NWP+   A  
Sbjct  339  LYLTCGDPTQGSPLHHRSAPSPNSISQGLSTLLGHKHWHVVQIHSTYLESNWPIRFAAID  398

Query  419  RDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
              G  +AVAG  G   Y +  +KW++FG+ITQEQ +   G L  W   +VV C
Sbjct  399  TAGQCIAVAGRRGFAHYSMSTRKWKLFGNITQEQNMTVTGGLAWWNDFVVVAC  451



>gb|KFH70163.1| hypothetical protein MVEG_04965 [Mortierella verticillata NRRL 
6337]
Length=965

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 92/200 (46%), Gaps = 20/200 (10%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVG +    ++WSV G RL  +    G   +  P +K   E   +P + G+  + W    
Sbjct  364  AVGQESHCPSIWSVYGRRLFPS----GAHDI--PNLKNATE---DPYLQGSRALFWSAGN  414

Query  182  YRLYAI-EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV---------QSE  331
              L  +  + S     A    K   +     ++  + +++  DRLLV           + 
Sbjct  415  MDLIVLGTDDSASNFYAIPCAKALPSVQNHLSSAPQCLLHLNDRLLVYTEGHRQDVSSTI  474

Query  332  DTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDIT  511
            + D     ++ +P  Y+S NWP+ +   S DG YLA+AG  GL  Y+L   +WR+FG+  
Sbjct  475  NPDTFVWNNVMVPAVYLSDNWPIRYSCLSPDGHYLAIAGRRGLAHYNLHSCRWRLFGNWQ  534

Query  512  QEQKIQCR-GLLWLGKIVVV  568
            QEQ  +C+ GL W   I++ 
Sbjct  535  QEQSFRCQGGLAWFKNILIA  554



>ref|XP_002040902.1| GM22097 [Drosophila sechellia]
 gb|EDW44455.1| GM22097 [Drosophila sechellia]
Length=1428

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 100/238 (42%), Gaps = 59/238 (25%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LMST     GL+     +++ N      P+      + W   
Sbjct  330  AVSWTNGGLSLWSTFGALLMSTLSWDFGLNV---DLVRQN------PL--KIRRLEWSTE  378

Query  179  GYRLYAIE---EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ--------  325
            GY+L+ ++   E     ++   F K  L+     TT    ++ G+D L + Q        
Sbjct  379  GYQLFMLKQHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDSLYLNQGNNLELTY  438

Query  326  ------------------SEDTDELRILH----------------LNLPVSYISQNWPVL  403
                              S D D L +                  L LP++Y + NWP+ 
Sbjct  439  AGSHGTFPSSGVGSDEGISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIR  498

Query  404  HVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            + A   DG++LAVAG  GL  Y L  ++W++FG+ +QE+     G  L W G +V+ C
Sbjct  499  YAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGC  556



>ref|XP_007904716.1| PREDICTED: protein RIC1 homolog [Callorhinchus milii]
Length=1421

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 98/242 (40%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L   FC +G      P        K EP+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAHL---FCTLGGDFAYRP-----DGTKKEPI--KISSMSWGAEGY  370

Query  185  RLYAI-------EEGSLE--------RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I        E  LE         I+ F F K  L          + ++ GEDRL +
Sbjct  371  HLWVICSDGAPQTENDLENKNAVQQGEILQFQFIKSALTVNPCMNNQEQVLLQGEDRLYL  430

Query  320  V------QSEDT-----------------DELRI-------------LHLNLPVSYISQN  391
                   Q+  T                 D++ +             L + +  +Y+  N
Sbjct  431  NSGDALHQNSSTASANSGHQPVREKNPLLDDIAVPQSLSTLLGHRHWLVVQIHSTYLESN  490

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  R G  +AVAG +G+  Y L  +KW++FG+ITQEQ +   G L  W   IV+
Sbjct  491  WPIKFSAIDRLGQSVAVAGRYGIAHYSLFTRKWKLFGNITQEQNLAVTGGLAWWNDFIVL  550

Query  566  VC  571
             C
Sbjct  551  AC  552



>ref|XP_002095799.1| GE19511 [Drosophila yakuba]
 gb|EDW95511.1| GE19511 [Drosophila yakuba]
Length=1557

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 100/237 (42%), Gaps = 57/237 (24%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AV WK  GL++WS  G  LMST       +V   +++ N      P+      + W   G
Sbjct  331  AVSWKNGGLSLWSTFGALLMSTLSWDFGHNVD--LVRQN------PL--KLRRLEWSTEG  380

Query  182  YRLYAIE---EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ---------  325
            Y+L+ ++   E     ++   F K  L+     TT    ++ G+D L + Q         
Sbjct  381  YQLFMLKQEPESDKSNVLQMQFVKSVLSMNPCMTTSPHILLQGDDCLYLNQGNNLELTYA  440

Query  326  -----------------SEDTDELRILH----------------LNLPVSYISQNWPVLH  406
                             S D D L +                  L LP++Y + NWP+ +
Sbjct  441  GSHGTFPSSGVGSNEGISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIRY  500

Query  407  VAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
             A   DG++LAVAG  GL  Y L  ++W++FG+ +QE+     G  L W G IV+ C
Sbjct  501  AAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFIVMGC  557



>emb|CEI98379.1| hypothetical protein RMCBS344292_12488 [Rhizopus microsporus]
Length=2105

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/190 (28%), Positives = 83/190 (44%), Gaps = 39/190 (21%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG++  GL VWSV G  L +T     L  ++      N+E   +  + G   + W    
Sbjct  328  SVGYESHGLAVWSVYGSMLCATN---ELDEIA------NEENLKDTYIKGIQYLFWGPGN  378

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            Y LY +              KC  +  +  T            L  V+S  T  L     
Sbjct  379  YSLYVL-------------AKCKADENIMYT------------LPFVKSALTSYLH----  409

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-G  538
            + P  YI+ NWP+ + + S DG Y+A+AG  G   Y+    +W++FG+  QEQ    R G
Sbjct  410  SYPAMYIADNWPICYSSISSDGSYIAIAGKRGFAHYNTISSRWKLFGNQQQEQSFLVRGG  469

Query  539  LLWLGKIVVV  568
            ++W   I++V
Sbjct  470  MVWYKTILIV  479



>ref|XP_001628242.1| predicted protein [Nematostella vectensis]
 gb|EDO36179.1| predicted protein [Nematostella vectensis]
Length=971

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 49/73 (67%), Gaps = 2/73 (3%)
 Frame = +2

Query  359  LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG  538
            + +P+SY+  NWPV + A  + G+++AVAG  G+  Y L  ++W++FG+I+QEQ I CRG
Sbjct  331  IQIPMSYLEANWPVRYAAVDKSGIHVAVAGKAGVAHYALNTRRWKLFGNISQEQSITCRG  390

Query  539  LL--WLGKIVVVC  571
             L  W   ++V C
Sbjct  391  GLAWWKDFLIVPC  403



>gb|KEI40736.1| hypothetical protein L969DRAFT_59649 [Mixia osmundae IAM 14324]
Length=1120

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 95/208 (46%), Gaps = 24/208 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVG  LRG +VWSV G RL    C  G    S  V + +    ++    G   + W+   
Sbjct  389  AVGL-LRGWSVWSVFG-RLA---CWAGNGQASGAVEENDSSSFSDAFFNGIDALFWNAAD  443

Query  182  YRLYAIE-----EGSL-----ERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE  331
              L+ +      EGS       ++ A  F K  +    S       ++  +DR+++ + +
Sbjct  444  SELFVLAKPRQVEGSACKAIDTQLFAIPFAKSAVATLHSPDNCQHALLQLDDRVMIYRGQ  503

Query  332  DTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKK  487
            D  ++ ++        ++ +P  YI+ NWP+     S DG  LAVAG  G + Y+    +
Sbjct  504  DQPDMSVINPESDVWQYIKVPSEYIAGNWPIRSSCVSSDGRLLAVAGRRGFVHYNTLSGR  563

Query  488  WRVFGDITQEQKIQCR-GLLWLGKIVVV  568
            W++F +  +EQ  Q   G++W   ++VV
Sbjct  564  WKLFDNEAEEQAFQVTGGMVWYENVLVV  591



>dbj|GAA98116.1| hypothetical protein E5Q_04799 [Mixia osmundae IAM 14324]
Length=1109

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 95/208 (46%), Gaps = 24/208 (12%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVG  LRG +VWSV G RL    C  G    S  V + +    ++    G   + W+   
Sbjct  389  AVGL-LRGWSVWSVFG-RLA---CWAGNGQASGAVEENDSSSFSDAFFNGIDALFWNAAD  443

Query  182  YRLYAIE-----EGSL-----ERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE  331
              L+ +      EGS       ++ A  F K  +    S       ++  +DR+++ + +
Sbjct  444  SELFVLAKPRQVEGSACKAIDTQLFAIPFAKSAVATLHSPDNCQHALLQLDDRVMIYRGQ  503

Query  332  DTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKK  487
            D  ++ ++        ++ +P  YI+ NWP+     S DG  LAVAG  G + Y+    +
Sbjct  504  DQPDMSVINPESDVWQYIKVPSEYIAGNWPIRSSCVSSDGRLLAVAGRRGFVHYNTLSGR  563

Query  488  WRVFGDITQEQKIQCR-GLLWLGKIVVV  568
            W++F +  +EQ  Q   G++W   ++VV
Sbjct  564  WKLFDNEAEEQAFQVTGGMVWYENVLVV  591



>ref|XP_009541502.1| hypothetical protein HETIRDRAFT_154043 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87622.1| hypothetical protein HETIRDRAFT_154043 [Heterobasidion irregulare 
TC 32-1]
Length=1030

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 93/220 (42%), Gaps = 40/220 (18%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G  VWSV+G  L   F   GL        + +++   +  M G   + W    
Sbjct  388  AVGWQ-HGWAVWSVAGRCLAWGF---GLED------QVDEDRFQDAFMFGICDLFWVAGN  437

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVS--------------GTTDVRQ-------VIY  298
            + L  +   S    +   F + C+N  +S               TT +          + 
Sbjct  438  FELVVLARSSPNSALTILFPELCVNASISESDGQLFTIPFAKSATTGLHAPDNTEYAFLQ  497

Query  299  GEDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFH  454
             +DR+LV +  D  ++ ++        H+ +P  Y++ NWPV +   S DG  +A+AG  
Sbjct  498  MDDRVLVYRGADQPDMSVINPESDVWQHIKIPQDYLAANWPVRYSTISADGRLVAIAGRR  557

Query  455  GLILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            GL  Y     +W++F D  QEQ    + GLLW   +++  
Sbjct  558  GLAHYSSTSGRWKLFADELQEQAFTVKGGLLWFHHVLIAT  597



>ref|XP_002027218.1| GL25449 [Drosophila persimilis]
 gb|EDW35082.1| GL25449 [Drosophila persimilis]
Length=1410

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 78/180 (43%), Gaps = 43/180 (24%)
 Frame = +2

Query  161  MHWDEHGYRLYAI---EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE  331
            + W   GY+L+ +    E     ++   F K  L+     T +   ++ G+D L + Q  
Sbjct  365  LEWSTEGYQLFMLMKEAENQANNVLQLQFVKSALSMNPCMTANPHILLQGDDCLYINQGN  424

Query  332  DTDE----------------------LRILH----------------LNLPVSYISQNWP  397
            + +E                      L + H                L LP++Y S NWP
Sbjct  425  NLEETYGGNKFTFPSSGGADQPEDDCLELKHSLNTGSILTESKYWTLLQLPLNYASTNWP  484

Query  398  VLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            + + A  +DG++LAVAG  GL  Y L  +KW++FG+ +QE+     G  L W G IV+ C
Sbjct  485  IRYAAIDKDGLHLAVAGRTGLAHYSLMTRKWKLFGNESQEKDFVVSGGLLWWHGFIVMGC  544



>gb|KGL78978.1| Protein RIC1 [Tinamus guttatus]
Length=1320

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 97/223 (43%), Gaps = 43/223 (19%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AV W+  GL++WSV G +L+   C +G           +   K +P+    S M W   G
Sbjct  242  AVTWECGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKDPL--KISSMSWGSEG  291

Query  182  YRLYAIE---------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLL  316
            Y L+ I+               E     I+ F F K  L      +   + ++ GEDRL 
Sbjct  292  YHLWVIDGNCSQNTRTERDAKNESQQFGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLY  351

Query  317  V-----VQSE----DTDELRIL------HL-NLPVSYISQNWPVLHVAASRDGMYLAVAG  448
            +      Q++    D+  L  L      H+  +  +Y+  NWP+   A  + G  +AV G
Sbjct  352  LNCGDATQAQNGSLDSQGLSTLLGHRHWHVVQIHSTYLESNWPIKFSAIDKPGQNVAVVG  411

Query  449  FHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
              G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  412  KFGFAHYSLVTKKWKLFGNITQEQNMVVTGGLAWWNDFIVLAC  454



>gb|EMP30478.1| Protein RIC1 like protein [Chelonia mydas]
Length=1463

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 83/191 (43%), Gaps = 28/191 (15%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W   GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  286  VTWDCGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKDPL--KISSMSWGSEGY  335

Query  185  RLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHLN  364
             L+ I+            G C LN G    T       G  +   ++S  T    ++H  
Sbjct  336  HLWVID------------GNCSLNAGCDIDTKNEAHQLGILQFQFIKSALTANTCMIH--  381

Query  365  LPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL  544
               +Y+  NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G +
Sbjct  382  --STYLESNWPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVTGGI  439

Query  545  --WLGKIVVVC  571
              W   IV+ C
Sbjct  440  AWWNDFIVLAC  450



>gb|EMD41642.1| hypothetical protein CERSUDRAFT_128592 [Ceriporiopsis subvermispora 
B]
Length=1014

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 91/203 (45%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+ +G  V+SV G  L   F   G+        + +++   +  M G   + W    
Sbjct  382  AVGWE-KGWGVFSVGGRCLAWNF---GVE------YEVDEDRFQDAFMYGICSLFWAPGN  431

Query  182  YRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + S  +    +    F K       +        +  +DR+LV +  D  ++ 
Sbjct  432  FELVVLAQSSPNKPDGQLFVIPFAKSATTGQHAPDNTQYASLQMDDRVLVYRGADQPDMS  491

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P +Y++ NWP+ + + S DG  +AVAG  GL+ Y     +W++F D
Sbjct  492  VINPEADVWQHVKIPQTYLAANWPMRYASLSADGRLIAVAGRRGLVHYSSTSGRWKLFAD  551

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GLLW   +++  
Sbjct  552  ELQEQAFAVRGGLLWFHHVLIAA  574



>ref|XP_007390251.1| hypothetical protein PHACADRAFT_246956 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60805.1| hypothetical protein PHACADRAFT_246956 [Phanerochaete carnosa 
HHB-10118-sp]
Length=1013

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 87/203 (43%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G  +WSV G  L   F   G+        + ++E   +  M G     W    
Sbjct  383  AVGWE-GGWAIWSVGGRCLAWAF---GVE------YEVDEERFLDAFMYGVRGFFWGPGN  432

Query  182  YRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + +       +    F K  +    S        +  +DR+LV +  D  ++ 
Sbjct  433  FELVMLAQSAPNSPDGELFVLPFAKSAITAQHSPDNTQYAFLQMDDRVLVYRGADQPDMS  492

Query  350  ILH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            +++        + +P  Y+S NWP+ + A S DG  +A+AG  GL  Y     +W++F D
Sbjct  493  VINPESDVWQRIKVPQDYLSTNWPIRYSAISSDGRLIAIAGRRGLAHYSSNSGRWKMFAD  552

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GLLW   +++  
Sbjct  553  EIQEQAFAVRGGLLWFHHVLIAA  575



>emb|CCA67809.1| hypothetical protein PIIN_01633 [Piriformospora indica DSM 11827]
Length=965

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 12/155 (8%)
 Frame = +2

Query  143  MGGTSLMHWDEHGYRLYAIEEGS---LERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRL  313
            M G S + W    + L+    G+    E++   SF K       +        +  +DR+
Sbjct  398  MHGVSTLFWGPGNFELFLASSGTGGEPEQVSILSFSKSSFATQQTPDNTRYAFLMLDDRV  457

Query  314  LVVQSEDTDELRILH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILY  469
            LV +  D  ++ +++        + +PV YI+ NWP+ +   S DG  +AVAG  GLI Y
Sbjct  458  LVYRGADQPDMSVINPESDVWQSIKIPVQYIADNWPLRYSTISGDGRLIAVAGRRGLIHY  517

Query  470  DLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
             +   +W+ F     EQ    R GLLW   +++  
Sbjct  518  SMSSGRWKCFDISAHEQAFFVRGGLLWFHHVLIAA  552



>ref|NP_649385.1| RIC1 homolog [Drosophila melanogaster]
 sp|Q9V3C5.1|RIC1_DROME RecName: Full=Guanine nucleotide exchange factor subunit Rich; 
AltName: Full=Protein RIC1 homolog [Drosophila melanogaster]
 gb|AAD55412.1|AF181626_1 BcDNA.GH03694 [Drosophila melanogaster]
 gb|AAF51813.1| RIC1 homolog [Drosophila melanogaster]
Length=1429

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 98/238 (41%), Gaps = 59/238 (25%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LMST     GL+ V      P +  +          + W   
Sbjct  330  AVSWTNGGLSLWSTFGALLMSTLSWDFGLN-VDLVCQNPLKIRR----------LEWSTE  378

Query  179  GYRLYAIE---EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ--------  325
            GY+L+ ++   E     ++   F K  L+     TT    ++ G+D L + Q        
Sbjct  379  GYQLFMLKLHPEKDKSNVLQLQFVKSALSMNPCMTTSPHILLQGDDCLYLNQGNNLELTY  438

Query  326  ------------------SEDTDELRILH----------------LNLPVSYISQNWPVL  403
                              S D D L +                  L LP++Y + NWP+ 
Sbjct  439  AGSHGTFPSSGLGSDEDISGDGDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIR  498

Query  404  HVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            + A   DG++LAVAG  GL  Y L  ++W++FG+ +QE+     G  L W G +V+ C
Sbjct  499  YAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFGNESQEKDFVVSGGLLWWHGFVVMGC  556



>gb|KDQ54856.1| hypothetical protein JAAARDRAFT_37967 [Jaapia argillacea MUCL 
33604]
Length=1029

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 90/203 (44%), Gaps = 23/203 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW+  G  VWSV G  L   F   G+        + +++   +  M G   + W    
Sbjct  397  AVGWE-HGWAVWSVGGRCLAWGF---GVED------QVDEDKFQDTFMYGLRSLFWAPGN  446

Query  182  YRLYAIEEGSLE----RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELR  349
            + L  + + +L+    ++    F +       +        +  +DR+LV +  D  ++ 
Sbjct  447  FELVVLAQRTLKNDDGQMFVVPFARSATTGQHAPDNTRYAFLQMDDRVLVYRGADQPDMS  506

Query  350  IL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGD  505
            ++        H+ +P  Y++ NWP+ + + S DG  +AVAG  GL+ Y     +W+ F D
Sbjct  507  VINPESDVWQHIMIPQVYLAMNWPLRYSSISTDGRLIAVAGRRGLVHYSTTSGRWKSFAD  566

Query  506  ITQEQKIQCR-GLLWLGKIVVVC  571
              QEQ    R GLLW   +++  
Sbjct  567  EVQEQAFSVRGGLLWFHHVLIAS  589



>gb|EJU04689.1| RIC1-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
Length=1158

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 71/152 (47%), Gaps = 15/152 (10%)
 Frame = +2

Query  143  MGGTSLMHWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV  322
            MG T L  +   G       +   ++I    F K  L    +        ++ +DR+LV 
Sbjct  489  MGNTELFTFALPG------PDSPADQIFVVPFIKSALTGQQAPENARYAFLHMDDRVLVY  542

Query  323  QSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLR  478
            +  D  ++ ++        H+ +P SY+S NWP+ + + S DG  +AVAG  GL+ Y   
Sbjct  543  RGADQPDMSVINPESDVWQHIKIPPSYLSTNWPIRYASISADGRLIAVAGRRGLVHYSSA  602

Query  479  LKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
              +W++F D  QEQ    R G++W   ++V  
Sbjct  603  SGRWKMFVDEGQEQAFIVRGGMIWFHHVLVAA  634



>ref|XP_004345658.1| conserved hypothetical protein [Capsaspora owczarzaki ATCC 30864]
 gb|EFW40936.1| hypothetical protein CAOG_06068 [Capsaspora owczarzaki ATCC 30864]
Length=1293

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 88/211 (42%), Gaps = 31/211 (15%)
 Frame = +2

Query  2    AVGWKLRGL-TVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            A GW   G+  VWS  G  L ST   +GL++ +S        +       G   M W   
Sbjct  409  ACGWADCGVVAVWSACGSPLFST---LGLNANASDDATVRMNF------SGIRSMTWGPE  459

Query  179  GYRLYAI--------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSED  334
            GY L           +  S   I  F+F +  L      T     + + +DRL  + S  
Sbjct  460  GYSLLIAPSFDNDGQDSSSNGDIYEFAFVRSALAANSCVTHWSHMLFHSDDRLYFLPSRS  519

Query  335  TDELRI-------------LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDL  475
            T +  +             L + +P++Y++++WP+    A   G  +AVAG  G   Y +
Sbjct  520  TSKHVLPDNSDGASVVAQWLSIKVPLTYMAEHWPIKIACADESGDCIAVAGRQGFAQYTV  579

Query  476  RLKKWRVFGDITQEQKIQCRGLLWLGKIVVV  568
               KWR+F +   E++I C+ L W   I+VV
Sbjct  580  STLKWRLFANQNHEREIACKALHWAHDILVV  610



>emb|CBY20780.1| unnamed protein product [Oikopleura dioica]
Length=1408

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 92/207 (44%), Gaps = 28/207 (14%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W+  GL V+SV G  LM T     G+++         +  + E  +  TSL  W   
Sbjct  326  AVTWESGGLAVFSVFGSCLMCTLGGDFGVTA---------EGLRREASIF-TSLC-WGTE  374

Query  179  GYRLYAIEEGSLER---IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV-QSEDTDEL  346
            GY+L+ I +   E    +   SF K  L    + +     ++  EDR+     SE+    
Sbjct  375  GYQLWMIMQDKKESKKGLYQLSFTKSALTSNPNSSNHSHVILQAEDRIFFTPHSEERRGS  434

Query  347  RI----------LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRV  496
            R           + + +P +Y+S NWP+   A    G Y+A+AG  G   Y +  KKW++
Sbjct  435  RNQINSVGSKQWMVIQMPCNYLSGNWPIRFSAVDSKGAYVAIAGNFGFAHYSVATKKWKL  494

Query  497  FGDITQEQKIQCRGLL--WLGKIVVVC  571
            FG+I  E+ +   G L  W   I V C
Sbjct  495  FGNIMHERDMVVTGGLTWWQDFICVAC  521



>ref|XP_009636476.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Egretta 
garzetta]
Length=1398

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/222 (29%), Positives = 94/222 (42%), Gaps = 43/222 (19%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  371  HLWVIDGNSSSNMKPERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  430

Query  320  VQSEDTDEL---------------RILHL-NLPVSYISQNWPVLHVAASRDGMYLAVAGF  451
               + T                  R  H+  +  +Y+  NWP+   A  + G  +AV G 
Sbjct  431  NCGDATQAQSPRNTWQGLSTLLGHRHWHVVQIHSTYLESNWPIRFSAIDKLGQNVAVVGK  490

Query  452  HGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
             G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  491  FGFAHYSLLTKKWKLFGNITQEQNMTVTGGLAWWNDFIVLAC  532



>emb|CBY34225.1| unnamed protein product [Oikopleura dioica]
Length=1325

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 92/207 (44%), Gaps = 28/207 (14%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W+  GL V+SV G  LM T     G+++         +  + E  +  TSL  W   
Sbjct  326  AVTWESGGLAVFSVFGSCLMCTLGGDFGVTA---------EGLRREASIF-TSLC-WGTE  374

Query  179  GYRLYAIEEGSLER---IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVV-QSEDTDEL  346
            GY+L+ I +   E    +   SF K  L    + +     ++  EDR+     SE+    
Sbjct  375  GYQLWMIMQDKKESKKGLYQLSFTKSALTSNPNSSNHSHVILQAEDRIFFTPHSEERRGS  434

Query  347  RI----------LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRV  496
            R           + + +P +Y+S NWP+   A    G Y+A+AG  G   Y +  KKW++
Sbjct  435  RNQINSVGSKQWMVIQMPCNYLSGNWPIRFSAVDSKGAYVAIAGNFGFAHYSVATKKWKL  494

Query  497  FGDITQEQKIQCRGLL--WLGKIVVVC  571
            FG+I  E+ +   G L  W   I V C
Sbjct  495  FGNIMHERDMVVTGGLTWWQDFICVAC  521



>ref|XP_007065685.1| PREDICTED: protein RIC1 homolog [Chelonia mydas]
Length=1318

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 95/220 (43%), Gaps = 41/220 (19%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W   GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  243  VTWDCGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKDPL--KISSMSWGSEGY  292

Query  185  RLYAIE---------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+               E     I+ F F K  L      +   + ++ GEDRL +
Sbjct  293  HLWVIDGNCSLNAGCDIDTKNEAHQLGILQFQFIKSALTANTCMSNQEQVLLQGEDRLYL  352

Query  320  -----VQSED----TDELRILH-----LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
                  Q+++    ++   + H     + +  +Y+  NWP+   A  + G  +AV G  G
Sbjct  353  NCGDATQAQNPRSASEHTLLGHRHWHVVQIHSTYLESNWPIRFSAIDKLGQNVAVVGKFG  412

Query  458  LILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
               Y L  KKW++FG+ITQEQ +   G +  W   IV+ C
Sbjct  413  FAHYSLLTKKWKLFGNITQEQNMVVTGGIAWWNDFIVLAC  452



>ref|XP_002047711.1| GJ11773 [Drosophila virilis]
 gb|EDW70053.1| GJ11773 [Drosophila virilis]
Length=1420

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 95/229 (41%), Gaps = 50/229 (22%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LMST     GL              K+ P+      + W   
Sbjct  328  AVSWANGGLSLWSTFGSLLMSTLSWDFGLHV---------DLVKHNPLQ--LRRLEWSTE  376

Query  179  GYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ-----------  325
            GY L+       + ++   F K  L+     +     ++ G+D L + Q           
Sbjct  377  GYHLFMTCREGEDNVLQLQFVKSALSMNPCMSAHSHILLQGDDCLYINQGDNLEQTYGNA  436

Query  326  -----------SEDTDELR-------ILH-------LNLPVSYISQNWPVLHVAASRDGM  430
                       ++D  EL+       IL        L LP++Y + NWP+ + A    G+
Sbjct  437  KCTFPSSSAGQNDDCLELKQSPNMGSILTESKYWTLLQLPLNYAATNWPIRYAAIDAAGL  496

Query  431  YLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            ++AVAG  GL  Y +  KKW++FG+ +QE+     G  L W G IV+ C
Sbjct  497  HVAVAGRTGLAHYSMLSKKWKLFGNESQEKDFVVSGGLLWWQGFIVMGC  545



>ref|XP_005819546.1| hypothetical protein GUITHDRAFT_121275 [Guillardia theta CCMP2712]
 gb|EKX32566.1| hypothetical protein GUITHDRAFT_121275 [Guillardia theta CCMP2712]
Length=557

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 86/209 (41%), Gaps = 30/209 (14%)
 Frame = +2

Query  26   LTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTS-LMHWDEHGYRLYAIE  202
            L +WS SG    +     G  +    V+ P      E +  G +  + W   GY+L  + 
Sbjct  152  LKLWSFSGSCTGTALRPAGEEAEGHRVMVPALSAAQEDLHEGENGAVCWSGDGYKLL-VS  210

Query  203  EGSLERIIAFSFGKCCLNRGVSGTTDV------RQVIYGEDRLLVVQSEDTDELRI----  352
             GS   I   S  +   N     +         R V+ GEDRLLV+++E +   +     
Sbjct  211  RGSDGYIYELSLVRPSFNTRSRSSGGGSRVGSDRSVLQGEDRLLVLRTEISSLAKGAESY  270

Query  353  ------------------LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLR  478
                              LH+ LP +Y  +   V H A      +LAV+   G  ++D  
Sbjct  271  NADDPLGGLPTSLGGEGWLHILLPDAYTDERGSVTHAAMDESERFLAVSCTRGFCVFDRI  330

Query  479  LKKWRVFGDITQEQKIQCRGLLWLGKIVV  565
            L +WR+FGD+ QE  + C GLLWL   ++
Sbjct  331  LSRWRLFGDVHQEYSLLCAGLLWLQHCIL  359



>emb|CCD81511.1| hypothetical protein Smp_125550 [Schistosoma mansoni]
Length=1412

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (52%), Gaps = 3/120 (3%)
 Frame = +2

Query  221  IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSED-TDELRILHLNLPVSYISQNWP  397
            ++ F   +  +    +    +  V+   DR++V   +  T  ++  +L +P  YI+ NWP
Sbjct  346  LVVFHLARSSITANPTSDNHLHIVLQTTDRIIVANRDLLTSRMQTENLLVPKQYINSNWP  405

Query  398  VLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            V +VA S DG  +AV+G +G I Y+   ++W VFG+I QE  +   G +  W   I + C
Sbjct  406  VRYVAVSTDGKKIAVSGRNGFIHYNTDSQRWHVFGNIKQENSLHVFGGMAWWKQYICLTC  465



>gb|KGB41158.1| Protein RIC1-like protein, partial [Schistosoma haematobium]
Length=1321

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (51%), Gaps = 3/120 (3%)
 Frame = +2

Query  221  IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSED-TDELRILHLNLPVSYISQNWP  397
            ++ F   +  +    +    +  V+   DR++V   +  T  ++   L +P  YI+ NWP
Sbjct  273  LVVFHLARSSITANPTSDNHLHIVLQTTDRIIVTNKDLLTSRMQTESLLIPKQYINSNWP  332

Query  398  VLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            V +VA S DG  +AV+G +G I Y+   ++W VFG+I QE  +   G +  W   I + C
Sbjct  333  VRYVAVSTDGKKIAVSGRNGFIHYNTDSQRWHVFGNIKQENSLHVFGGMAWWKQYICLTC  392



>emb|CCX30388.1| Similar to Protein ric1; acc. no. O42656 [Pyronema omphalodes 
CBS 100304]
Length=1076

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 87/199 (44%), Gaps = 20/199 (10%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            VG++  G   WSV G    ++F     +  +  V KPN+ Y     + G     W  +G 
Sbjct  411  VGYQ-NGWATWSVYGKPGGNSFG----TRAALIVRKPNEAY-----LSGVKYGAWIANGG  460

Query  185  RLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH--  358
             +  +     E I +  F K  +    S     R ++   ++LL+ +  D D+  ++   
Sbjct  461  EILLLRNQGDELIWSLEFVKSAVVGCFSSVNTARPMLQTGEQLLIYRGYDQDDNTMISQD  520

Query  359  -------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQE  517
                   + +P SY+++NWP+     S +G Y+AVAG  GL  Y +   +W+ F D   E
Sbjct  521  SSVLWHTVQVPASYLAENWPIRSSVISPEGRYVAVAGTRGLAHYSVNSGRWKTFTDARME  580

Query  518  QKIQCR-GLLWLGKIVVVC  571
            Q    R G+ W   I++  
Sbjct  581  QDFTVRGGMCWFQHILIAA  599



>ref|XP_001985143.1| GH16901 [Drosophila grimshawi]
 gb|EDV97491.1| GH16901 [Drosophila grimshawi]
Length=1421

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 94/229 (41%), Gaps = 50/229 (22%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LMST     GL              K  P+      + W   
Sbjct  328  AVSWTNGGLSLWSTFGALLMSTLSWDFGLHV---------DLLKRNPLQ--LRRLEWSTE  376

Query  179  GYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQ-----------  325
            GY+L+         ++   F K  L+     +     ++ G+D L + Q           
Sbjct  377  GYQLFMTCREGENNVLQLQFVKSALSMNPCMSAHSHILLQGDDCLYINQGDNLEQTYGNA  436

Query  326  -----------SEDTDELR-------ILH-------LNLPVSYISQNWPVLHVAASRDGM  430
                       ++D  EL+       IL        L LP++Y + NWP+ + A    G+
Sbjct  437  NCTFPSSSTARTDDCVELKQSPNMGSILTESKYWTLLQLPLNYAATNWPIRYAAIDAAGL  496

Query  431  YLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
            ++AVAG  GL  Y +  KKW++FG+ +QE+     G  L W G IV+ C
Sbjct  497  HIAVAGRTGLAHYAMLSKKWKLFGNESQEKDFVVSGGLLWWQGFIVMGC  545



>ref|XP_007842499.1| duf1339 domain protein [Moniliophthora roreri MCA 2997]
 gb|ESK98197.1| duf1339 domain protein [Moniliophthora roreri MCA 2997]
Length=993

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 9/127 (7%)
 Frame = +2

Query  218  RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRIL--------HLNLPV  373
            +I    F K       S        +  +DR LV +  D  ++ ++        H+ +P 
Sbjct  447  QIFIIPFAKSATTGQHSPDNTRYAFLQLDDRALVYRGADQPDMSVINPESDVWQHIKIPQ  506

Query  374  SYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWL  550
            SY+ +NWP+ + + S DG  +AVAG  GLI Y     +W++F D  QEQ    + GLLW 
Sbjct  507  SYLEKNWPIRYSSLSSDGRLVAVAGRWGLIHYSASSGRWKIFADEGQEQAFSVKGGLLWF  566

Query  551  GKIVVVC  571
              +++  
Sbjct  567  HHVLIAA  573



>ref|XP_002427318.1| conserved hypothetical protein [Pediculus humanus corporis]
 gb|EEB14580.1| conserved hypothetical protein [Pediculus humanus corporis]
Length=1463

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 98/233 (42%), Gaps = 55/233 (24%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLS-SVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W   GL++WS  G  LM   C +G    + + + K N      P+      + W   
Sbjct  316  AVAWSKGGLSLWSTFGALLM---CTLGWDYGLHADICKAN------PL--NIKSIEWSAE  364

Query  179  GYRLYAI---------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSE  331
            GY+L+ +         E   ++ I+   F K  L+   S +     ++ GED+L +   +
Sbjct  365  GYQLWLLNHTCHCNEKETDEVDNILQLDFVKSTLSVNPSMSYSQHILLQGEDKLYINLCD  424

Query  332  DT---------------------------------DELRILHLNLPVSYISQNWPVLHVA  412
             T                                 D  + + + LP +Y + NWP+ + A
Sbjct  425  STLKGLSKRGRETSNSRFSSDMIETHNCIGRNSFMDSKQWIIIPLPATYSATNWPIRYTA  484

Query  413  ASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQK-IQCRGLLWLGKIVVV  568
               +G  +AVAG  GL  Y L  +KW++FG+ TQE+  +   GLLW   ++V+
Sbjct  485  IDLEGQNVAVAGRTGLAHYSLLTRKWKLFGNETQEKDFVVTGGLLWWNTLLVM  537



>gb|EIE89489.1| hypothetical protein RO3G_14200 [Rhizopus delemar RA 99-880]
Length=577

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 77/178 (43%), Gaps = 33/178 (19%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            +VG+K +GL++WSV G  L   F    L   S       +E   +  M G   + W    
Sbjct  84   SVGYKEQGLSIWSVYGSML---FASNELDEASE------EENLKDTYMKGVRSLFWGPGN  134

Query  182  YRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILHL  361
            ++L+                   L+   + T++ R   Y E+   +    D   +   H+
Sbjct  135  HQLF------------------VLSTDEANTSNFRD--YQENSTAI----DPAAVAWTHI  170

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR  535
              P  YI+ NWP+ + + S DG Y+AVAG  G   Y+    +W++FG+  QEQ    R
Sbjct  171  QYPALYITDNWPIRYSSISSDGNYIAVAGKRGFAHYNTISNRWKLFGNQQQEQSFLIR  228



>ref|XP_006627063.1| PREDICTED: protein RIC1 homolog isoform X1 [Lepisosteus oculatus]
Length=1412

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 97/241 (40%), Gaps = 65/241 (27%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K EP+   +  M W   GY
Sbjct  322  VTWECGGLSLWSVFGAHLI---CTLGEDFAYR-----SDGTKKEPIRIIS--MSWGAEGY  371

Query  185  RLYAI------------------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDR  310
             L+ I                  ++GS   I+ F F K  L      +   + +++GEDR
Sbjct  372  HLWVISSEGDRSSSSETEKKDCLKQGS---ILQFQFIKSALTVNPCTSNQEQVLLHGEDR  428

Query  311  LLVV-----QSEDTD-------ELRILHLNLPVS--------------------YISQNW  394
            L +      Q+  T        E+  LH +  VS                    Y+  NW
Sbjct  429  LYLTCGDHAQAHSTSTEHRLPREMSPLHTSASVSQGLSTLLGHRHWHVVQIHSTYLESNW  488

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVV  568
            P+   A    G  +A+AG  G   Y L  +KW++FG+ITQEQ +   G L  W   IV+ 
Sbjct  489  PIRFAAIDTLGQCVAIAGRCGFAHYSLYTRKWKLFGNITQEQNMMVTGGLAWWKDFIVIA  548

Query  569  C  571
            C
Sbjct  549  C  549



>ref|XP_009507925.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog, partial 
[Phalacrocorax carbo]
Length=1177

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 95/239 (40%), Gaps = 60/239 (25%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  83   VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGTKKDPL--KISSMTWGSEGY  132

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S     LER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  133  HLWVIDGNSSSNMKLERDGNNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  192

Query  320  -------VQSEDTDELRILH--------------------------LNLPVSYISQNWPV  400
                    QS         H                          + +  +Y+  NWP+
Sbjct  193  NCGDATQAQSSRNPSSHSEHXAKEAQDGSLDSQGLSTLLGHRHWHVVQIHSTYLESNWPI  252

Query  401  LHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
               A  + G  +AV G +G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  253  RFSAIDKVGQNVAVVGKYGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVLAC  311



>gb|EKC36120.1| RIC1-like protein [Crassostrea gigas]
Length=1406

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 96/226 (42%), Gaps = 49/226 (22%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIG--LSSVSSPVIKPNQEYKNEPMMGGTSLMHWDE  175
            AV WK  G ++WSV G  L+   C +G  L    SP + P       P++     M W  
Sbjct  323  AVCWKNGGFSLWSVFGALLL---CSLGGDLYPSDSPKLFP------PPVLS----MEWGL  369

Query  176  HGYRLYAI---------------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDR  310
             GY+L+ +               +  S+  ++   F K  L      T      + GEDR
Sbjct  370  EGYQLWVVCQEEQSVNGFAETEEDNHSITNVMQLQFVKSALTVNPCVTNHEHVFLQGEDR  429

Query  311  LLVVQSE----------DTDELRILHLN-----LPVS--YISQNWPVLHVAASRDGMYLA  439
            L +  S+          D+ +  +   N     +P+S  Y+  NWP+ + A  + G  +A
Sbjct  430  LYMSISDGCASQDGGCQDSSQSLMSIGNKIWQIIPISHTYLGANWPIRYAAVDKTGQCVA  489

Query  440  VAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            VAG  GL  Y    +KW++FG+ TQE+ +   G +  W   I V C
Sbjct  490  VAGKTGLAHYTFSTRKWKLFGNETQEKDLVVSGGMTWWKDFICVAC  535



>ref|XP_005941604.1| PREDICTED: protein RIC1 homolog isoform X1 [Haplochromis burtoni]
Length=1444

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 97/252 (38%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G        I  +   K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLG-----EDFIHRSDGTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAI---------EEGSLER------------IIAFSFGKCCLNRGVSGTTDVRQVIYG  301
             L+ +         EE  +E             I+ F F K  L      +   + +++G
Sbjct  373  HLWVLPHKQERRRQEEQDVEMVAPPNSSALQAGILQFHFIKSALTVNPCTSNQEQVLLHG  432

Query  302  EDRLLVV--------QSEDTDELRILH------LNLPV----------------------  373
            EDRL +          + DT     LH      L+ P                       
Sbjct  433  EDRLYLTCGDPTQIHSNSDTHPHTHLHPRDGSPLHPPPNPDSSLSQGLSTLLGHKHWHVV  492

Query  374  ----SYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                +Y+  NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  493  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  552

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  553  LAWWNDFVVVAC  564



>gb|KDE04043.1| hypothetical protein MVLG_05482 [Microbotryum violaceum p1A1 
Lamole]
Length=1316

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 88/206 (43%), Gaps = 20/206 (10%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVGW L G ++WSV G RL S   Q  L +      + +  +++   M G   M W   G
Sbjct  555  AVGWHL-GWSIWSVYG-RLGSWSVQGSLKAGYGVEGEKSDAFEDH-FMNGVRGMFWTRGG  611

Query  182  YRL--------YAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDT  337
            Y L        Y   +   E++    F K  +    +        +  +DR++V +  D 
Sbjct  612  YELVVLCPPPVYPKSKAHDEQLFVIPFAKSAVTTAHTPDNTNHAFLQMDDRVMVYRGADQ  671

Query  338  DELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWR  493
             ++ ++        H+ +P SYI+   P+ +   S D  ++AVAG  G   Y+    +W+
Sbjct  672  PDMSVINPESDVWQHIKIPASYIATQHPIRYAVISHDARFIAVAGRRGFTHYNALSGRWK  731

Query  494  VFGDITQEQKIQ-CRGLLWLGKIVVV  568
            +F    +E       G+ W   +++V
Sbjct  732  LFESEKEENAFHVVGGMAWWANLLIV  757



>ref|XP_774156.1| hypothetical protein CNBG4560 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL19509.1| hypothetical protein CNBG4560 [Cryptococcus neoformans var. neoformans 
B-3501A]
Length=993

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 72/159 (45%), Gaps = 11/159 (7%)
 Frame = +2

Query  128  KNEPMMGGTSLMHWDEHGYRLYAIE--EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYG  301
            K+E    G   + W      L+ +   E    +I   SF K       S        +  
Sbjct  388  KDESEDSGVIDLFWIPGNLELFVLRPYEKGKPQIEVVSFTKSATTNQPSPDNTRYAFLQM  447

Query  302  EDRLLVVQSEDTDELRILH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            +DR++V +  D  ++ +++        + +P +YI+ NWP+ + + S DG  +AVAG  G
Sbjct  448  DDRVMVYRGADQPDMSVINPESDVWQSIKIPTAYIATNWPIRYASISSDGKLIAVAGRRG  507

Query  458  LILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            L  Y     +WR+F D  +E+    + GLLW   +++V 
Sbjct  508  LTHYSAASGRWRLFQDEREERDFTVKGGLLWFHHVLIVA  546



>emb|CDH56343.1| ric1-domain-containing protein [Lichtheimia corymbifera JMRC:FSU:9682]
Length=1111

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 91/214 (43%), Gaps = 24/214 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVG++ +GL VWSV G  L S      +    +       E   +  + G   + W    
Sbjct  369  AVGFEKQGLAVWSVYGNLLCSISATDDIFYSRADNDDFGSELSQDAYVAGVQGLFWGPGN  428

Query  182  YRLYAI---EEGSLERI---------IAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV--  319
            ++L+ +   +  +L ++             F K  +    +     R ++  +DR+L+  
Sbjct  429  HQLFILSKHQPNTLSQLDPSKQNGALFTLPFAKSAITNFHNAENARRGLLQMDDRILLYN  488

Query  320  ---------VQSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYD  472
                       + D D      +  P  YI+++WP+ + + S+DG ++A+AG  G   Y+
Sbjct  489  YGGDYQENNTTTIDPDAALWTQVLYPPMYITEHWPIRYASISQDGRFIAIAGRRGFAHYN  548

Query  473  LRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
                +W++FG+  QEQ    R G+ W   I++  
Sbjct  549  TFSNRWKMFGNQQQEQSFLVRGGMAWYKNILIAA  582



>ref|XP_005941605.1| PREDICTED: protein RIC1 homolog isoform X2 [Haplochromis burtoni]
Length=1443

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 97/252 (38%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G        I  +   K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLG-----EDFIHRSDGTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAI---------EEGSLER------------IIAFSFGKCCLNRGVSGTTDVRQVIYG  301
             L+ +         EE  +E             I+ F F K  L      +   + +++G
Sbjct  373  HLWVLPHKQERRRQEEQDVEMVAPPNSSALQAGILQFHFIKSALTVNPCTSNQEQVLLHG  432

Query  302  EDRLLVV--------QSEDTDELRILH------LNLPV----------------------  373
            EDRL +          + DT     LH      L+ P                       
Sbjct  433  EDRLYLTCGDPTQIHSNSDTHPHTHLHPRDGSPLHPPPNPDSSLSQGLSTLLGHKHWHVV  492

Query  374  ----SYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                +Y+  NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  493  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  552

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  553  LAWWNDFVVVAC  564



>ref|XP_571747.1| hypothetical protein [Cryptococcus neoformans var. neoformans 
JEC21]
 gb|AAW44440.1| conserved hypothetical protein [Cryptococcus neoformans var. 
neoformans JEC21]
Length=785

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/159 (26%), Positives = 72/159 (45%), Gaps = 11/159 (7%)
 Frame = +2

Query  128  KNEPMMGGTSLMHWDEHGYRLYAIE--EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYG  301
            K+E    G   + W      L+ +   E    +I   SF K       S        +  
Sbjct  182  KDESEDSGVIDLFWIPGNLELFVLRPYEKGKPQIEVVSFTKSATTNQPSPDNTRYAFLQM  241

Query  302  EDRLLVVQSEDTDELRILH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            +DR++V +  D  ++ +++        + +P +YI+ NWP+ + + S DG  +AVAG  G
Sbjct  242  DDRVMVYRGADQPDMSVINPESDVWQSIKIPTAYIATNWPIRYASISSDGKLIAVAGRRG  301

Query  458  LILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            L  Y     +WR+F D  +E+    + GLLW   +++V 
Sbjct  302  LTHYSAASGRWRLFQDEREERDFTVKGGLLWFHHVLIVA  340



>gb|ETN62247.1| connexin43-interacting protein of 150 kDa [Anopheles darlingi]
Length=1717

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 3/102 (3%)
 Frame = +2

Query  266  SGTTDVRQVIYGEDRLLVVQSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVA  445
            SG TD   +    D+ L   S  ++    + LNLP +YIS NWP+ + A    G  +AVA
Sbjct  550  SGDTDATDI--SGDQYLKFNSVLSESKHWVVLNLPTAYISSNWPIRYSAIDHSGTNIAVA  607

Query  446  GFHGLILYDLRLKKWRVFGDITQEQK-IQCRGLLWLGKIVVV  568
            G  G+ LY    +KW++FG+ TQE+  +   GLLW  + +++
Sbjct  608  GRTGVALYAFNTRKWKLFGNETQEKDFVITGGLLWWKEFIIM  649



>ref|XP_009473244.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Nipponia 
nippon]
Length=1409

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 95/233 (41%), Gaps = 54/233 (23%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  371  HLWVIDGNSSSSMKPERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  430

Query  320  -----VQSEDT----------------------DELRILHLNLPVSYISQNWPVLHVAAS  418
                  Q+++                         LR     +  +Y+  NWP+   A  
Sbjct  431  NCGDATQAQNPRNTSAHSEHKPTRDRTGICSXCHHLRWHLFKIHSTYLESNWPIRFSAID  490

Query  419  RDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  491  KLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMTVTGGLAWWNDFIVLAC  543



>ref|XP_002836720.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ80911.1| unnamed protein product [Tuber melanosporum]
Length=1105

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 81/194 (42%), Gaps = 19/194 (10%)
 Frame = +2

Query  20   RGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGYRLYAI  199
            RG   WSV G    ++F      S  + +++ N     E  + G     W   G  +  +
Sbjct  437  RGWATWSVYGKPGGNSF------SADTRLLERN---AGEGYLDGVRTGSWVSAGGEIMLV  487

Query  200  EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRIL--------  355
            +EG  ERI    F +  +          R V+   +++L+ +  D  ++  +        
Sbjct  488  KEGGDERIWVMEFARSAVTGCFCSANIARPVLQTNEKILIYRGYDKSDIAAISQETSVLW  547

Query  356  -HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQC  532
             H+ +P  Y+  NWP+     S DG Y+A+AG  GL  Y +   +W+ F +   EQ    
Sbjct  548  HHVQMPSVYLVDNWPIRSAVISPDGRYVAIAGRRGLAHYSVNSGRWKTFINENMEQDFVV  607

Query  533  R-GLLWLGKIVVVC  571
            R G+ W   I++  
Sbjct  608  RGGMCWYQHILIAA  621



>gb|KDR12929.1| RIC1-like protein [Zootermopsis nevadensis]
Length=1330

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 95/237 (40%), Gaps = 58/237 (24%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLS-SVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W+  GL++WS  G  L+   C +G    +   + + N  + +         M W   
Sbjct  317  AVSWEQGGLSLWSTFGALLL---CTLGWDYGLHVDLARSNPLHIHS--------MEWSAE  365

Query  179  GYRLYAIE---------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV----  319
            GY+L+ ++          GSL+ +I   F K  L      +      + GEDRL V    
Sbjct  366  GYQLWMVKRQPDHDPGGNGSLDCVIQLDFVKSALTVNPCMSHQSHLYLQGEDRLFVNLGD  425

Query  320  -----VQSEDTDELRILH--------------------------LNLPVSYISQNWPVLH  406
                       D+L  L+                          + +P +Y+  NWP+ +
Sbjct  426  NLTKVYHERPRDQLSSLYGSNEMFLDVGNLIVTSTLTGSKQWTVVPIPSAYLGTNWPIRY  485

Query  407  VAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLWLGKIVVVC  571
             A   +G  LAVAG  GL  Y +  +KW++FG+ TQE+     G  L W   +V+ C
Sbjct  486  TAIDSEGQNLAVAGRTGLAHYSMVSRKWKLFGNETQEKDFVVTGGLLWWRDHVVMGC  542



>ref|XP_005803826.1| PREDICTED: protein RIC1 homolog [Xiphophorus maculatus]
Length=1440

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/251 (27%), Positives = 95/251 (38%), Gaps = 72/251 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLGEDFAHH-----SDGTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAI-----------EEGSLER-----------IIAFSFGKCCLNRGVSGTTDVRQVIY  298
             L+ I           EE  +E            I+ F F K  L      +   + +++
Sbjct  373  HLWVIPSRQERRKQEDEEQDVEMISPPHPSLQAGILQFHFIKSALTVNPCTSNQEQVLLH  432

Query  299  GEDRLLVVQSEDT---------------DELRILHLNLPVSYISQ---------------  388
            GEDRL +   + T               D   + H   P S +SQ               
Sbjct  433  GEDRLYLTCGDPTQIHSTSDAHTNLHPRDGSPLHHPPNPDSSLSQGLSTLLGHKHWHVVQ  492

Query  389  --------NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL  544
                    NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G L
Sbjct  493  IHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGGL  552

Query  545  --WLGKIVVVC  571
              W   +VV C
Sbjct  553  AWWKDFVVVAC  563



>ref|XP_007428187.1| PREDICTED: protein RIC1 homolog [Python bivittatus]
Length=1419

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 99/241 (41%), Gaps = 62/241 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G        I      K EP+    S M W   GY
Sbjct  320  VTWECGGLSLWSVFGAQLI---CTLG-----GDFIHRTDGTKKEPL--KISSMSWGSEGY  369

Query  185  RLYAIEEGS-----LER--------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLL---  316
             L+ I+  +      ER        I+ F F K  L      ++  + ++ GEDRL    
Sbjct  370  HLWVIDANNSGNSMTERKNKGKHFGILQFQFIKSALTVNPCISSQEQVLLQGEDRLYLNC  429

Query  317  --VVQSE-------------------------DTDELRIL--HLNLPVS-----YISQNW  394
              VVQ++                         D+  L  L  H +  V      Y+  NW
Sbjct  430  GDVVQAQNPRSSSAHAEHKTVRERGQFSYGSLDSQGLSTLLGHRHWHVVQIHNIYLEINW  489

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVV  568
            P+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ 
Sbjct  490  PIRFSAIDKMGQNVAVVGKFGFAHYSLLSKKWKLFGNITQEQNMTVTGGLAWWNDFIVIA  549

Query  569  C  571
            C
Sbjct  550  C  550



>ref|XP_007513762.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16287.1| predicted protein [Bathycoccus prasinos]
Length=1764

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/77 (39%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = +2

Query  320  VQSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVF  499
            + S+    LR  H  LP  YI+  +P   +A S DG+ +AVAG  G + Y L  KKWR+F
Sbjct  806  ISSKPPKPLRCRHELLPSEYIATRFPARKIAISPDGLDIAVAGSRGFVTYSLTRKKWRMF  865

Query  500  GDITQEQKIQCRGLLWL  550
             D+++E++I+   + WL
Sbjct  866  RDVSKEKRIRVTKMAWL  882



>emb|CDS11790.1| hypothetical protein LRAMOSA11434 [Absidia idahoensis var. thermophila]
Length=1111

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 86/214 (40%), Gaps = 24/214 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AVG++ +GL VWSV G  L S      +    +       E   +  + G   + W    
Sbjct  370  AVGFEKQGLAVWSVYGNLLCSISGTDDIFYSKADSDDFGSELNQDAYVAGVQGLFWGPGN  429

Query  182  YRLYAIEEGSLERI------------IAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV--  319
            ++L+ +       I                F K  +    +     R ++  +DR+L+  
Sbjct  430  HQLFILSRHQPNAISQLDPSKQHGALFTLPFAKSAITNFHNAENARRGLLQMDDRILLYN  489

Query  320  ---------VQSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYD  472
                       + D D      +  P  YI+ +WP+ + + S+DG ++A+AG  G   Y+
Sbjct  490  YGGDYQENNTTTIDPDAALWTQVLYPPMYITDHWPIRYASISQDGRFIAIAGRRGFAHYN  549

Query  473  LRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
                +W++FG+  QEQ    R G+ W   I++  
Sbjct  550  TFSNRWKMFGNQQQEQSFLIRGGMAWYKNILIAA  583



>ref|XP_008298405.1| PREDICTED: protein RIC1 homolog [Stegastes partitus]
 ref|XP_008298406.1| PREDICTED: protein RIC1 homolog [Stegastes partitus]
Length=1441

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 96/252 (38%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           + + K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLGEDFAYR-----SDDTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAI----------EEGSLER-----------IIAFSFGKCCLNRGVSGTTDVRQVIYG  301
             L+ +          E+  +E            I+ F F K  L      +   + +++G
Sbjct  373  HLWVLPYKPERRRPEEQQDVEMVAPPHSSLQAGILQFHFIKSALTVNPCTSNQEQVLLHG  432

Query  302  EDRLLVV--------QSEDTDELRILH--------------------------------L  361
            EDRL +          S DT     +H                                +
Sbjct  433  EDRLYLTCVDPTQIHSSSDTHPRTHMHPRDGSPMHHPPNPDSSLSQGLSTLLGHKHWHVV  492

Query  362  NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
             +  +Y+  NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  493  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  552

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  553  LAWWNDFVVVAC  564



>ref|XP_005185602.1| PREDICTED: protein RIC1 homolog [Musca domestica]
Length=1486

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 101/248 (41%), Gaps = 69/248 (28%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            AV W+  G+ +WS  G  LMS+F    G   ++  +I  N      P+    S + W   
Sbjct  328  AVSWENGGIALWSTFGALLMSSFSWDFG---INVDLIHDN------PLC--VSKLEWSTE  376

Query  179  GYRLYAI------EEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV---  319
            GY+L+        EE  ++     +   SF K  L      T     ++ G+D L +   
Sbjct  377  GYQLFLTCKGRKNEEQHIDEPYTNVCQLSFVKSALTMNPCMTAHPHILLQGDDTLYLNQG  436

Query  320  ----------------------VQSEDTDE----LRILH----------------LNLPV  373
                                   QS DT E    L + +                L LP 
Sbjct  437  DNLEKIYFGGKFVFPNNKTDTHTQSLDTKEADGCLEVKNAVDISSILAESKYWTVLQLPQ  496

Query  374  SYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRG--LLW  547
            +Y++ NWP+ + A   +G+++AVAG  GL  Y +  KKW++FG+ +QE+     G  L W
Sbjct  497  TYVATNWPIRYSAIDAEGVHIAVAGRTGLAHYSMPTKKWKLFGNESQEKDFVVSGGLLWW  556

Query  548  LGKIVVVC  571
             G IV  C
Sbjct  557  KGFIVCGC  564



>ref|XP_319216.4| AGAP010061-PA [Anopheles gambiae str. PEST]
 gb|EAA13960.5| AGAP010061-PA [Anopheles gambiae str. PEST]
Length=1342

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 5/102 (5%)
 Frame = +2

Query  266  SGTTDVRQVIYGEDRLLVVQSEDTDELRILHLNLPVSYISQNWPVLHVAASRDGMYLAVA  445
            SG TD     + +D  L   S  ++    + LNLP +YIS NWP+ + A    G  +AVA
Sbjct  462  SGKTDE----FRKDSYLKFNSVLSESKHWVVLNLPTAYISSNWPIRYSAIDHTGTNVAVA  517

Query  446  GFHGLILYDLRLKKWRVFGDITQEQK-IQCRGLLWLGKIVVV  568
            G  G+ LY    +KW++FG+ TQE+  +   GLLW  + +++
Sbjct  518  GRTGVALYSFNTRKWKLFGNETQEKDFVITGGLLWWKEFIIM  559



>gb|AFR96809.2| hypothetical protein CNAG_03587 [Cryptococcus neoformans var. 
grubii H99]
Length=993

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (48%), Gaps = 9/132 (7%)
 Frame = +2

Query  203  EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH--------  358
            E    +I   SF K       S        +  +DR++V +  D  ++ +++        
Sbjct  415  EKGRPQIEVVSFTKSATANQPSPDNTRYAFLQMDDRVMVYRGADQPDMSVINPESDVWQS  474

Query  359  LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-  535
            + +P +YI+ NWP+ + + S DG  +AVAG  GL  Y     +WR+F D  +E+    + 
Sbjct  475  IKIPTAYIATNWPIRYASISSDGKLIAVAGRRGLTHYSAASGRWRLFQDEREERDFTVKG  534

Query  536  GLLWLGKIVVVC  571
            GLLW   +++V 
Sbjct  535  GLLWFHHVLIVA  546



>ref|XP_007861344.1| RIC1-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ61089.1| RIC1-domain-containing protein [Gloeophyllum trabeum ATCC 11539]
Length=979

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 55/99 (56%), Gaps = 9/99 (9%)
 Frame = +2

Query  302  EDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            +DR+L+ +  D  ++ ++        H+ +P +Y++ NWP+ + + S DG  +AVAG  G
Sbjct  439  DDRVLIYRGADQPDMSVINPESDVWQHIQIPQTYLATNWPIKYSSISSDGRLVAVAGRRG  498

Query  458  LILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            L+ Y     +W++F D  QEQ    + GLLW   +++  
Sbjct  499  LVHYSSSSGRWKLFADEVQEQAFAVKGGLLWFHHVLIAA  537



>ref|XP_010079562.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Pterocles 
gutturalis]
Length=607

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/235 (28%), Positives = 93/235 (40%), Gaps = 57/235 (24%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGAKKDPLK--ISSMTWGSEGY  370

Query  185  RLYAIEEGSLER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-----  319
             L+ I+ G  ER          I+ F F K  L      +   + ++ GEDRL +     
Sbjct  371  HLWVID-GKPERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYLNCGDA  429

Query  320  --VQS-EDTDELRILHLNLPVS--------------------------YISQNWPVLHVA  412
               QS  +T          P S                          Y+  NWP+   A
Sbjct  430  TQAQSPRNTSAXXXXXXXGPFSDGSLDSQGLSTLLGHRHWHVVQIHSMYLESNWPIRFSA  489

Query  413  ASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
              + G  +AV G  G   Y L  KKW++FG++TQEQ +   G L  W   IV+ C
Sbjct  490  IDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNVTQEQNMMVTGGLAWWNDFIVLAC  544



>dbj|GAC76506.1| predicted K+/H+-antiporter [Pseudozyma antarctica T-34]
Length=1395

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 56/208 (27%), Positives = 89/208 (43%), Gaps = 33/208 (16%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKN--EPMMGGTSLMHWDE  175
            AVGW+ +GL +WS  G +LM    +      S          KN  E  M GT+ + W  
Sbjct  484  AVGWQ-KGLAIWSTYG-KLMGCTLREDWELAS----------KNFAEAFMFGTADLFWAP  531

Query  176  HGYRLYAIEEGSLE--------RIIAFSFGKCCLNRGVSGTTDVRQVIY-GEDRLLVVQS  328
               +L+ +     +        ++    F K  +  G     + R   Y  +D L V + 
Sbjct  532  GNTQLFILAAPKQDSAPLLPDNQLFILPFSKSAV-AGQHSPDNTRFAFYQTDDSLHVYRG  590

Query  329  EDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLK  484
             D  +L  +        H+ +P SY++ NWPV + A S DG  +AVAG  GL  Y     
Sbjct  591  ADQTDLTAITPESDVWQHIKIPQSYLAANWPVRYAAISADGNLIAVAGRRGLAHYSSASG  650

Query  485  KWRVFGDITQEQKIQCR-GLLWLGKIVV  565
            +W++   + QEQ    R G+ W   +++
Sbjct  651  RWKLHKSVAQEQSFVVRGGMQWFQHVLI  678



>ref|XP_009934331.1| PREDICTED: protein RIC1 homolog isoform X1 [Opisthocomus hoazin]
Length=1426

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 95/242 (39%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIE--------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ ++              E S   I+ F F K  L      +   + ++ GEDRL + 
Sbjct  371  HLWVVDGNSSNVKPESGGISEASQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYLN  430

Query  320  --------------VQSEDTDEL---------------------RILHL-NLPVSYISQN  391
                          V SED                         R  H+  +  +Y+  N
Sbjct  431  CGDATQAQSPRNSSVHSEDKPTRERGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  490

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  491  WPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVL  550

Query  566  VC  571
             C
Sbjct  551  AC  552



>ref|XP_009310110.1| hypothetical protein DQ04_02391050 [Trypanosoma grayi]
 gb|KEG11659.1| hypothetical protein DQ04_02391050 [Trypanosoma grayi]
Length=1260

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 74/154 (48%), Gaps = 9/154 (6%)
 Frame = +2

Query  125  YKNEPMMGGTSLMHWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTD---VRQVI  295
            Y    ++ G +   W  H +RL+ IE    + + A  F +  +    SG T       V 
Sbjct  350  YTQHCIIEGCASFSWSSHSHRLFLIEPQG-KNLTALDFNQ--IVSSPSGDTKGCFTPIVA  406

Query  296  YGEDRL-LVVQSEDTDELRILHL-NLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILY  469
            +  +RL L   S    +L +  L  +   Y ++N+P+ H A S DG  + +AG HG +L+
Sbjct  407  FDNERLHLAGHSSVVGDLTLNDLVKVHPQYAAENYPLTHGAVSPDGAVVVLAGRHGFVLF  466

Query  470  DLRLKKWRVFGDITQEQKIQCRG-LLWLGKIVVV  568
            D   ++WR F D + E+++ C    LWL  + VV
Sbjct  467  DRFTRRWRAFRDKSLEREMTCVARPLWLNSVAVV  500



>ref|XP_009817911.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Gavia stellata]
Length=1416

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 97/237 (41%), Gaps = 58/237 (24%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  324  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  373

Query  185  RLYAIEEGSL-----ER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  374  HLWVIDGNSSSNMKSERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  433

Query  320  -------VQSE-----------------DTDELRIL------HL-NLPVSYISQNWPVLH  406
                    QS                  D+  L  L      H+  +  +Y+  NWP+  
Sbjct  434  NCGDATQAQSPKNTSAXLERGPFSDGSLDSQGLSTLLGHRHWHVVQIHTTYLESNWPIRF  493

Query  407  VAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
             A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  494  SAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVLAC  550



>ref|XP_005352178.1| PREDICTED: protein RIC1 homolog [Microtus ochrogaster]
Length=1342

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 93/242 (38%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K EP+   +  M W   GY
Sbjct  244  VTWEYGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKEPLKIHS--MSWGAEGY  293

Query  185  RLYAIE---------EGSLERIIA------FSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I          E  L  I+       F F K  L      +   + ++ GEDRL +
Sbjct  294  HLWVISGFGSQHTEIESDLRSIVKQPSILLFQFIKSVLTVNPCMSNQEQVLLQGEDRLYL  353

Query  320  -------VQSEDTDELRILHL------------------------------NLPVSYISQ  388
                    Q+  +   R  H+                               +  +Y+  
Sbjct  354  NCGEASQTQNSKSSSARADHMPSRGKNPFADGGLESQGLSTLLGHRHWHVVQISSTYLES  413

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQK-IQCRGLLWLGKIVV  565
            NWP+   A  + G  +AVAG  G   Y L  KKW++FG+ITQEQ  I   GL W    +V
Sbjct  414  NWPIRFSAIDKLGQNIAVAGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFMV  473

Query  566  VC  571
            + 
Sbjct  474  LA  475



>ref|XP_007568814.1| PREDICTED: protein RIC1 homolog isoform X2 [Poecilia formosa]
Length=1441

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/252 (26%), Positives = 92/252 (37%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  322  VTWECGGLSLWSVFGAHLI---CTLGEDFAHH-----SDGTKKDPL--KISSMSWGAEGY  371

Query  185  RLYAIEEGSLER-----------------------IIAFSFGKCCLNRGVSGTTDVRQVI  295
             L+ I      R                       I+ F F K  L      +   + ++
Sbjct  372  HLWVIPSRQERRKQEEDEEQDVEMISPPHPSLQAGILQFHFIKSALTVNPCTSNQEQVLL  431

Query  296  YGEDRLLVVQSEDT---------------DELRILHLNLPVSYISQ--------------  388
            +GEDRL +   + T               D   + H   P S +SQ              
Sbjct  432  HGEDRLYLTCGDPTQIHSTADAHTNLHPRDGSPMHHPPNPDSSLSQGLSTLLGHKHWHVV  491

Query  389  ---------NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                     NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  492  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  551

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  552  LAWWKDFVVVAC  563



>ref|XP_007568807.1| PREDICTED: protein RIC1 homolog isoform X1 [Poecilia formosa]
Length=1442

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/252 (26%), Positives = 92/252 (37%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLGEDFAHH-----SDGTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAIEEGSLER-----------------------IIAFSFGKCCLNRGVSGTTDVRQVI  295
             L+ I      R                       I+ F F K  L      +   + ++
Sbjct  373  HLWVIPSRQERRKQEEDEEQDVEMISPPHPSLQAGILQFHFIKSALTVNPCTSNQEQVLL  432

Query  296  YGEDRLLVVQSEDT---------------DELRILHLNLPVSYISQ--------------  388
            +GEDRL +   + T               D   + H   P S +SQ              
Sbjct  433  HGEDRLYLTCGDPTQIHSTADAHTNLHPRDGSPMHHPPNPDSSLSQGLSTLLGHKHWHVV  492

Query  389  ---------NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                     NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  493  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  552

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  553  LAWWKDFVVVAC  564



>ref|XP_003195472.1| hypothetical protein CGB_G6490C [Cryptococcus gattii WM276]
 gb|ADV23685.1| Hypothetical protein CGB_G6490C [Cryptococcus gattii WM276]
Length=993

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 62/127 (49%), Gaps = 9/127 (7%)
 Frame = +2

Query  218  RIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH--------LNLPV  373
            +I   SF K       S        +  +DR++V +  D  ++ +++        + +P 
Sbjct  420  QIEVVSFTKSATTNQPSPDNTRYAFLQMDDRVMVYRGADQPDMSVINPESDVWQSIKIPT  479

Query  374  SYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR-GLLWL  550
            +YI+ NWP+ + + S DG  +AVAG  GL  Y     +WR+F D  +E+    + GLLW 
Sbjct  480  AYIATNWPIRYASISSDGKLIAVAGRRGLTHYSATSGRWRLFQDEREERDFIVKGGLLWF  539

Query  551  GKIVVVC  571
              +++V 
Sbjct  540  HHVLIVA  546



>dbj|GAK63381.1| RIC1-domain-containing protein [Pseudozyma antarctica]
Length=1365

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 92/210 (44%), Gaps = 33/210 (16%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKN--EPMMGGTSLMHWDE  175
            AVGW+ +GL +WS  G +LM    +      S          KN  +  M GT+ + W  
Sbjct  455  AVGWQ-KGLAIWSTYG-KLMGCTLREDWELAS----------KNFADAFMFGTADLFWAP  502

Query  176  HGYRLY---AIEEGSL-----ERIIAFSFGKCCLNRGVSGTTDVRQVIY-GEDRLLVVQS  328
               +L+   A ++ S+      ++    F K  +  G     + R   Y  +D L V + 
Sbjct  503  GNTQLFILAAPKQDSVPVPPDNQLFILPFSKSAVA-GQHSPDNTRFAFYQTDDSLHVYRG  561

Query  329  EDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLK  484
             D  +L  +        H+ +P SY++ NWPV + A S DG  +AVAG  GL  Y     
Sbjct  562  ADQTDLTAITPESDVWQHIKIPQSYLAANWPVRYAAISADGNLIAVAGRRGLAHYSSASG  621

Query  485  KWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            +W++   + QEQ    R G+ W   +++  
Sbjct  622  RWKLHKSVAQEQSFVVRGGMQWFQHVLIAA  651



>ref|XP_008422505.1| PREDICTED: protein RIC1 homolog isoform X1 [Poecilia reticulata]
Length=1442

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 94/252 (37%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAHLI---CTLGEDFAHH-----SDGTKKDPL--KISSMSWGAEGY  372

Query  185  RLYAI------------EEGSLER-----------IIAFSFGKCCLNRGVSGTTDVRQVI  295
             L+ I            EE  +E            I+ F F K  L      +   + ++
Sbjct  373  HLWVIPSRQERRKQEENEEQDVEMISPPHPSLQTGILQFHFIKSALTVNPCTSNQEQVLL  432

Query  296  YGEDRLLVV--QSEDTDELRILHLNL-------------PVSYISQ--------------  388
            +GEDRL +             +H NL             P S +SQ              
Sbjct  433  HGEDRLYLTCGDPRQIHSTSDVHTNLHPQDGSPMHHPPNPDSSLSQGLSTLLGHKHWHVV  492

Query  389  ---------NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                     NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  493  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  552

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  553  LAWWKDLVVVAC  564



>gb|KFR11846.1| Protein RIC1, partial [Opisthocomus hoazin]
Length=1343

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 95/242 (39%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  238  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  287

Query  185  RLYAIE--------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ ++              E S   I+ F F K  L      +   + ++ GEDRL + 
Sbjct  288  HLWVVDGNSSNVKPESGGISEASQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYLN  347

Query  320  --------------VQSEDTDEL---------------------RILHL-NLPVSYISQN  391
                          V SED                         R  H+  +  +Y+  N
Sbjct  348  CGDATQAQSPRNSSVHSEDKPTRERGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  407

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  408  WPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVL  467

Query  566  VC  571
             C
Sbjct  468  AC  469



>ref|XP_003328520.2| hypothetical protein PGTG_10479 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP84101.2| hypothetical protein PGTG_10479 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=1119

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = +2

Query  23   GLTVWSVSG----CRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGYRL  190
            GL+VWSV G    C   +T  +  L  +        ++Y     MG    + W    + L
Sbjct  417  GLSVWSVFGRLQTCCDSATISETNLHEIQF------EDY----FMGSCRSLFWGPGNFEL  466

Query  191  Y---AIEEGSL-----ERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDEL  346
            +   A  E S      +++    F K  +    S        +  +DR+ V +  D  +L
Sbjct  467  FLLTAPSESSTRYIADDQLFVLPFAKSAVATLHSPDNTKHGFLQLDDRVSVYRGADCPDL  526

Query  347  RIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
             ++        H+ +P  YIS NWP+     S DG  LAVAG  G   ++    +W++F 
Sbjct  527  SVINPESDVWQHIKIPADYISTNWPIECSCISEDGKLLAVAGKRGFTHFNSVSGRWKLFE  586

Query  503  DITQEQKIQCR-GLLWLGKIVVV  568
            +  +EQ I  R G+ W   ++V 
Sbjct  587  NEDEEQAIHVRGGMQWFENVLVT  609



>ref|XP_008422506.1| PREDICTED: protein RIC1 homolog isoform X2 [Poecilia reticulata]
Length=1441

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 67/252 (27%), Positives = 94/252 (37%), Gaps = 73/252 (29%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G           +   K +P+    S M W   GY
Sbjct  322  VTWECGGLSLWSVFGAHLI---CTLGEDFAHH-----SDGTKKDPL--KISSMSWGAEGY  371

Query  185  RLYAI------------EEGSLER-----------IIAFSFGKCCLNRGVSGTTDVRQVI  295
             L+ I            EE  +E            I+ F F K  L      +   + ++
Sbjct  372  HLWVIPSRQERRKQEENEEQDVEMISPPHPSLQTGILQFHFIKSALTVNPCTSNQEQVLL  431

Query  296  YGEDRLLVV--QSEDTDELRILHLNL-------------PVSYISQ--------------  388
            +GEDRL +             +H NL             P S +SQ              
Sbjct  432  HGEDRLYLTCGDPRQIHSTSDVHTNLHPQDGSPMHHPPNPDSSLSQGLSTLLGHKHWHVV  491

Query  389  ---------NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGL  541
                     NWP+   A    G  +AVAG  G   Y L  +KW++FG+ITQEQ +   G 
Sbjct  492  QIHSTYLESNWPIRFAAIDTAGQCMAVAGRRGFAHYSLFTRKWKLFGNITQEQNMTVTGG  551

Query  542  L--WLGKIVVVC  571
            L  W   +VV C
Sbjct  552  LAWWKDLVVVAC  563



>emb|CDS25415.1| protein RIC1 [Hymenolepis microstoma]
Length=1411

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 56/208 (27%), Positives = 90/208 (43%), Gaps = 23/208 (11%)
 Frame = +2

Query  11   WKLRGLTVWSVSGC----------RLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSL  160
            W L+G  +W++S              ++ F +  L+S ++      Q  KN   M   S 
Sbjct  317  WTLKGFHLWTISSFVDDPDRREREEYLNAFRERLLNSCNALPQTQRQIAKNVAKM--RSD  374

Query  161  MHWD-----EHGYRLYAIEEGSLER----IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRL  313
            +H D     E G  +    E +LE+    ++ F   K  L    +    +  +++  D +
Sbjct  375  LHLDDSEDYESGSAISTNVESTLEKNRNFLMVFHLAKSALAANPTVDNHLHLLMHTADSI  434

Query  314  LVVQSEDTDELR-ILHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKW  490
             V         R +L + LP  YI  N+P+   A + +G  +AVAG  G  L  L   +W
Sbjct  435  FVTVRRFLHSRRNMLIVPLPPEYIRTNFPLKFAAINPEGSQVAVAGSRGFALCVLSTLQW  494

Query  491  RVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            R+FG+ITQEQ  +   GL W G  +  C
Sbjct  495  RLFGNITQEQAFEVHAGLTWWGHFICFC  522



>ref|XP_003889645.1| hypothetical protein, variant [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EHS63500.1| hypothetical protein, variant [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=822

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/203 (26%), Positives = 85/203 (42%), Gaps = 31/203 (15%)
 Frame = +2

Query  23   GLTVWSVSG----CRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGYRL  190
            GL+VWSV G    C   +T  +  L  +        ++Y     MG    + W    + L
Sbjct  120  GLSVWSVFGRLQTCCDSATISETNLHEIQF------EDY----FMGSCRSLFWGPGNFEL  169

Query  191  Y---AIEEGSL-----ERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDEL  346
            +   A  E S      +++    F K  +    S        +  +DR+ V +  D  +L
Sbjct  170  FLLTAPSESSTRYIADDQLFVLPFAKSAVATLHSPDNTKHGFLQLDDRVSVYRGADCPDL  229

Query  347  RIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFG  502
             ++        H+ +P  YIS NWP+     S DG  LAVAG  G   ++    +W++F 
Sbjct  230  SVINPESDVWQHIKIPADYISTNWPIECSCISEDGKLLAVAGKRGFTHFNSVSGRWKLFE  289

Query  503  DITQEQKIQCR-GLLWLGKIVVV  568
            +  +EQ I  R G+ W   ++V 
Sbjct  290  NEDEEQAIHVRGGMQWFENVLVT  312



>ref|XP_006817611.1| PREDICTED: protein RIC1 homolog [Saccoglossus kowalevskii]
Length=1434

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 92/228 (40%), Gaps = 49/228 (21%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTF-CQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEH  178
            A+GW+  GL +WSV G +L+ T     G S            +++ P+   +  M W   
Sbjct  316  AMGWENGGLALWSVFGAKLLCTLGGDYGFS---------QDAFRDNPLQIKS--MEWGME  364

Query  179  GYRLYAIEEGSLER------------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
            GY L+      L              +I   F K  L      +      + GEDRL + 
Sbjct  365  GYHLWVTTTPKLSSNGKRKSVVSPGGLIQLQFVKSSLTVNPCISNHEHLFLQGEDRLYLN  424

Query  320  ----VQSEDTDEL-----------RILHLN-------LPVSYISQNWPVLHVAASRDGMY  433
                +   +T E+            IL  N       LP SY++ NWPV   A  R G  
Sbjct  425  TGDTILKTNTQEIASGGSPASQGPSILVGNKQWQIIQLPHSYLATNWPVRFAAVDRTGHC  484

Query  434  LAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            +AV+G  GL  Y L  ++W++FG+  QE+ +   G L  W   I+  C
Sbjct  485  VAVSGKTGLAHYALFTRRWKLFGNENQERDMVVNGGLCWWRDFIIAGC  532



>ref|XP_009985198.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog, partial 
[Tauraco erythrolophus]
Length=1308

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 91/239 (38%), Gaps = 60/239 (25%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  212  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  261

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  262  HLWVIDGSSSSNTKPERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  321

Query  320  -------VQSEDTDELRILHLNLPVS--------------------------YISQNWPV  400
                    QS             P S                          Y+  NWP+
Sbjct  322  NCGDATQAQSPRNTSXXXXXXEXPFSESSLDSQGLSTLLGHRHWHVVQIHSTYLESNWPI  381

Query  401  LHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
               A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  382  RFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMVVTGGLAWWNDFIVLAC  440



>gb|KFO06535.1| Protein RIC1, partial [Balearica regulorum gibbericeps]
Length=1336

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 93/243 (38%), Gaps = 64/243 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  238  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  287

Query  185  RLYAIE---------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+               E     I+ F F K  L      +   + ++ GEDRL +
Sbjct  288  HLWVIDGNPSTNMKPDRDANNEAHQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  347

Query  320  -------VQSEDTDELRILH------------------------------LNLPVSYISQ  388
                    QS  +   R  H                              + +  +Y+  
Sbjct  348  NCGDATQAQSPRSTSARSEHKPTRERGPFSDGNLDSQGLSTLLGHRHWHVVQIHSTYLES  407

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIV  562
            NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV
Sbjct  408  NWPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIV  467

Query  563  VVC  571
            + C
Sbjct  468  LAC  470



>ref|XP_010309900.1| PREDICTED: RAB6A-GEF complex partner protein 1 isoform X1 [Balearica 
regulorum gibbericeps]
Length=1419

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 93/243 (38%), Gaps = 64/243 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIE---------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+               E     I+ F F K  L      +   + ++ GEDRL +
Sbjct  371  HLWVIDGNPSTNMKPDRDANNEAHQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  430

Query  320  -------VQSEDTDELRILH------------------------------LNLPVSYISQ  388
                    QS  +   R  H                              + +  +Y+  
Sbjct  431  NCGDATQAQSPRSTSARSEHKPTRERGPFSDGNLDSQGLSTLLGHRHWHVVQIHSTYLES  490

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIV  562
            NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV
Sbjct  491  NWPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIV  550

Query  563  VVC  571
            + C
Sbjct  551  LAC  553



>ref|XP_003762183.1| PREDICTED: protein RIC1 homolog, partial [Sarcophilus harrisii]
Length=1375

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 93/243 (38%), Gaps = 64/243 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K EP+    S M W   GY
Sbjct  275  VTWEYGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKEPL--KISSMSWGAEGY  324

Query  185  RLYAI-----EEGSLER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I     + G +E           I+ F F K  L      +   + ++ GEDRL +
Sbjct  325  HLWVISGFGSQNGDVESDIKSSANQPGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYL  384

Query  320  -------VQSEDTDELRILH------------------------------LNLPVSYISQ  388
                    QS         H                              + +  +Y+  
Sbjct  385  NCGDASQAQSPRNSSAHSEHKPIREKSPFSDGNLDSQGLSTLLGHRHWHVVQISSTYLES  444

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIV  562
            NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV
Sbjct  445  NWPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFIV  504

Query  563  VVC  571
            + C
Sbjct  505  LAC  507



>ref|XP_009487214.1| PREDICTED: protein RIC1 homolog, partial [Pelecanus crispus]
Length=478

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  238  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYGSDGAKKDPLK--ISSMTWGSEGY  287

Query  185  RLYAIEEGS----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I+  S     ER          I+ F F K  L      +   + ++ GEDRL + 
Sbjct  288  HLWVIDGSSSNMKPERDANNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYLN  347

Query  320  ------VQSEDTDELRILH------------------------------LNLPVSYISQN  391
                   QS         H                              + +  +Y+  N
Sbjct  348  CGDATQTQSPRNTSAHSEHKPTRESGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  407

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  408  WPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVL  467

Query  566  VC  571
             C
Sbjct  468  AC  469



>ref|XP_006004695.1| PREDICTED: protein RIC1 homolog isoform X1 [Latimeria chalumnae]
Length=1414

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 98/241 (41%), Gaps = 62/241 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G  L+   C +G        +  +   K +P+   +  M W   GY
Sbjct  322  VTWECGGLSLWSVFGAHLL---CTLG-----GDFVYRSDGTKKDPLKVKS--MCWGAEGY  371

Query  185  RLYAIEEGSLER--------------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I + S +               I+ F F K  L      +   + ++ GEDRL + 
Sbjct  372  HLWVINDWSQQSENDARSKDTALQSDILQFQFTKSALTANPCMSNQEQVLLQGEDRLYLN  431

Query  320  ----VQSEDTDEL------------------------------RILH-LNLPVSYISQNW  394
                 Q++++  +                              R  H + +  +Y+  NW
Sbjct  432  CGDATQTQNSSSISASTGRQRVRERSQLSDTLDSQGLSTLLGHRHWHVIQIHSAYLESNW  491

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVV  568
            P+   A  R G  +A+AG  G   Y L  +KW++FG++TQEQ +   G L  W   IV+ 
Sbjct  492  PIRFSAIDRLGQCVAIAGRFGFAHYSLITRKWKLFGNVTQEQNMVVTGGLAWWNEFIVLA  551

Query  569  C  571
            C
Sbjct  552  C  552



>ref|XP_010391175.1| PREDICTED: RAB6A-GEF complex partner protein 1 isoform X2 [Corvus 
cornix cornix]
Length=1417

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  320  VTWEYGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  369

Query  185  RLYAIEEGS----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I+  S     ER          I+ F F K  L      +   + ++ GEDRL + 
Sbjct  370  HLWVIDRNSSNVKPERNANNEVHRFGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLN  429

Query  320  ------VQSEDTDELRILH------------------------------LNLPVSYISQN  391
                   QS         H                              + +  +Y+  N
Sbjct  430  CGDAAQAQSPRNTSAHSEHNHSRERGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  489

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  490  WPIRFSAIDKLGQNVAVVGRFGFAHYSLLTKKWKLFGNITQEQTMMVTGGLAWWNDFIVL  549

Query  566  VC  571
             C
Sbjct  550  AC  551



>gb|KEF56034.1| hypothetical protein A1O9_07615 [Exophiala aquamarina CBS 119918]
Length=1136

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 81/198 (41%), Gaps = 30/198 (15%)
 Frame = +2

Query  20   RGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEP-----MMGGTSLMHWDEHGY  184
            RG T WSV G    ++F    LS   S     N+ +   P     + GG  ++   E   
Sbjct  363  RGWTTWSVFGKEGATSF-HGNLSHAQSN----NENWLLSPHRATWISGGAEILITSEDDE  417

Query  185  RLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRIL---  355
            R++ +E      +  FS    C N        VR ++     L V +  +  +L  +   
Sbjct  418  RIWKVEMSRSASMACFS----CANL-------VRALLQTPSELTVYRGHELPDLTSISNE  466

Query  356  -----HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQ  520
                 H   P  Y+   WP+     S+DG Y+A+AG  GL  Y L+  +W+ F DIT E 
Sbjct  467  ASLWHHAQYPAVYLHNQWPIKTCVVSQDGRYIAIAGRRGLAHYSLQSGRWKTFSDITVES  526

Query  521  KIQCR-GLLWLGKIVVVC  571
                R G+ W   I+ V 
Sbjct  527  SFAVRGGMCWFNHILAVA  544



>ref|XP_010391176.1| PREDICTED: RAB6A-GEF complex partner protein 1 isoform X3 [Corvus 
cornix cornix]
Length=1212

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWEYGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I+  S     ER          I+ F F K  L      +   + ++ GEDRL + 
Sbjct  371  HLWVIDRNSSNVKPERNANNEVHRFGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLN  430

Query  320  ------VQSEDTDELRILH------------------------------LNLPVSYISQN  391
                   QS         H                              + +  +Y+  N
Sbjct  431  CGDAAQAQSPRNTSAHSEHNHSRERGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  490

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  491  WPIRFSAIDKLGQNVAVVGRFGFAHYSLLTKKWKLFGNITQEQTMMVTGGLAWWNDFIVL  550

Query  566  VC  571
             C
Sbjct  551  AC  552



>ref|XP_010391173.1| PREDICTED: RAB6A-GEF complex partner protein 1 isoform X1 [Corvus 
cornix cornix]
Length=1418

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 93/242 (38%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWEYGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I+  S     ER          I+ F F K  L      +   + ++ GEDRL + 
Sbjct  371  HLWVIDRNSSNVKPERNANNEVHRFGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLYLN  430

Query  320  ------VQSEDTDELRILH------------------------------LNLPVSYISQN  391
                   QS         H                              + +  +Y+  N
Sbjct  431  CGDAAQAQSPRNTSAHSEHNHSRERGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  490

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  491  WPIRFSAIDKLGQNVAVVGRFGFAHYSLLTKKWKLFGNITQEQTMMVTGGLAWWNDFIVL  550

Query  566  VC  571
             C
Sbjct  551  AC  552



>ref|XP_004526095.1| PREDICTED: protein RIC1 homolog [Ceratitis capitata]
Length=1475

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 58/245 (24%), Positives = 97/245 (40%), Gaps = 67/245 (27%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFC-QIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            V W+  G+++WS  G  LMS+     GL               + P+  G   + W   G
Sbjct  333  VAWEKGGISLWSTFGSLLMSSLSWDFGLHV---------DLMHHNPLQVGK--LEWSTEG  381

Query  182  YRLYAI-----------EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQS  328
            Y L+                 + +++  +F K  L+      +    ++ G+D L + Q 
Sbjct  382  YHLFMTCKKKLGESCTENNNDIYKVLQLNFVKSTLSMNPCMASHSHLLLQGDDTLYINQG  441

Query  329  EDTDEL-----------------------------------RILH-------LNLPVSYI  382
            ++ +++                                    IL        + LP++Y 
Sbjct  442  DNLEKIYFGNKFSFPNNSSEATKVDCNLDDSIDVKKSVDISSILSESKLWNMIQLPLTYA  501

Query  383  SQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGK  556
            S NWPV + A + +G +LAVAG  GL  Y +  KKW++FG+ +QE+     G L  W G 
Sbjct  502  SSNWPVRYSAINAEGTHLAVAGRTGLAHYSMLTKKWKLFGNESQEKDFVVSGGLIWWKGF  561

Query  557  IVVVC  571
            IV+ C
Sbjct  562  IVMGC  566



>gb|KGB76204.1| hypothetical protein CNBG_2042 [Cryptococcus gattii R265]
Length=983

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/159 (25%), Positives = 72/159 (45%), Gaps = 11/159 (7%)
 Frame = +2

Query  128  KNEPMMGGTSLMHWDEHGYRLYAIE--EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYG  301
            ++E    G + + W      L+ +   E    +I   SF K       S        +  
Sbjct  388  EDESEDPGVADLFWIPGNLELFVLRSYEKGRPQIEVVSFTKSATTNQPSPDNTRYAFLQM  447

Query  302  EDRLLVVQSEDTDELRILH--------LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            +DR++V +  D  ++ +++        + +P +YI+ NWP+ + + S  G  +AVAG  G
Sbjct  448  DDRVMVYRGADQPDMSVINPESDVWQSIKIPTAYIATNWPIRYASISSHGKLIAVAGRRG  507

Query  458  LILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            L  Y     +WR+F D  +E+    + GLLW   +++V 
Sbjct  508  LTHYSATSGRWRLFQDEREERNFTVKGGLLWFHHVLIVA  546



>gb|EPX73063.1| guanyl-nucleotide exchange factor [Schizosaccharomyces octosporus 
yFS286]
Length=1014

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 66/133 (50%), Gaps = 12/133 (9%)
 Frame = +2

Query  203  EGSLER--IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQS-EDTDELRI-------  352
            E   ER  +    F K  +     GTT++  V    DRL + ++  +++ L         
Sbjct  384  ESPKERSCVYILPFLKSTITNSAYGTTNITGV-QSTDRLFISKAYSNSNNLEANFGNSSW  442

Query  353  LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQC  532
            L +  P +YIS  WP+ + A S+DG Y+A+AG HG  +Y+ + + W VF + + EQ I  
Sbjct  443  LQVEYPQTYISAEWPIRYTAISKDGEYIAIAGSHGFAVYNFQNRIWNVFDNGSLEQAITI  502

Query  533  R-GLLWLGKIVVV  568
               +LW  + +V 
Sbjct  503  SCPMLWHDRYLVT  515



>ref|XP_007411246.1| hypothetical protein MELLADRAFT_107549 [Melampsora larici-populina 
98AG31]
 gb|EGG05324.1| hypothetical protein MELLADRAFT_107549 [Melampsora larici-populina 
98AG31]
Length=794

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 91/205 (44%), Gaps = 22/205 (11%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AV W   G +VWSV G RL +     GL +        + ++++  M  GTSL  W    
Sbjct  323  AVSWS-NGFSVWSVFG-RLQA--WGNGLPTDEEGDTVRDNKWQDVFMGSGTSLF-WGPGN  377

Query  182  YRLYAIEEGSL--------ERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDT  337
            + L+ + +           E++    F K  +    S        +  +DR+L  +  D+
Sbjct  378  FELFLLTKPHSGTTKWTCDEQLFVLPFAKSAVTTLHSPDNTKHAFLQLDDRVLAYRGADS  437

Query  338  DELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWR  493
             ++ ++        H+ +P  YIS NWP+     S DG  +AVAG  GL  ++    +W+
Sbjct  438  PDMSVINPESDVWQHIKIPSDYISTNWPIEMSCISDDGKLVAVAGRKGLTHFNSVSGRWK  497

Query  494  VFGDITQEQKIQCR-GLLWLGKIVV  565
            +F    +EQ      G+ W+G ++V
Sbjct  498  LFEREEEEQAFCVSGGMQWIGNVLV  522



>gb|ETS62781.1| hypothetical protein PaG_02525 [Pseudozyma aphidis DSM 70725]
Length=1392

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 89/210 (42%), Gaps = 33/210 (16%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKN--EPMMGGTSLMHWDE  175
            AVGW+ +GL +WS  G +LM    +      S          KN  +  M GT+ + W  
Sbjct  484  AVGWQ-KGLAIWSTYG-KLMGCTLREDWELAS----------KNFADAFMFGTADLFWAP  531

Query  176  HGYRLYAIEEGSLE--------RIIAFSFGKCCLNRGVSGTTDVRQVIY-GEDRLLVVQS  328
               +L+ +     +        ++    F K  +  G     + R   Y  +D L V + 
Sbjct  532  GNTQLFILAAPKQDSAPLLPDNQLFILPFSKSAVA-GQHSPDNTRFAFYQTDDSLHVYRG  590

Query  329  EDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLK  484
             D  +L  +        H+ +P SY++ NWPV + A S DG  +AVAG  GL  Y     
Sbjct  591  ADQTDLTAITPESDVWQHIKIPQSYLAANWPVRYAAISADGNLIAVAGRRGLAHYSSASG  650

Query  485  KWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            +W++   + QEQ    R G+ W   +++  
Sbjct  651  RWKLHKSVAQEQSFVVRGGMQWFQHVLIAA  680



>ref|XP_009998943.1| PREDICTED: protein RIC1 homolog isoform X1 [Chaetura pelagica]
Length=1418

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 98/242 (40%), Gaps = 63/242 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV-  319
             L+ I+  S     ER          I+ F F K  L      +   + ++ GEDRL + 
Sbjct  371  HLWVIDGSSSNMKPERDGNNEARQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYLN  430

Query  320  --------------VQSE---------------DTDELRIL------HL-NLPVSYISQN  391
                          V SE               D+  L  L      H+  +  +Y+  N
Sbjct  431  CGDATQAQSPRNTSVHSEHKPARXXXPFSDGSLDSQGLSTLLGHRHWHVVQIHSTYLESN  490

Query  392  WPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVV  565
            WP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+
Sbjct  491  WPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVL  550

Query  566  VC  571
             C
Sbjct  551  AC  552



>ref|XP_006863817.1| PREDICTED: protein RIC1 homolog isoform X1 [Chrysochloris asiatica]
Length=1422

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 67/243 (28%), Positives = 96/243 (40%), Gaps = 64/243 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K EP+    S M W   GY
Sbjct  323  VTWECGGLSLWSVFGAQLV---CTLG-----GDFAYRSDGTKKEPL--KISSMSWGAEGY  372

Query  185  RLYAIE---------EGSLER------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I          E  L R      I+ F F K  L      +   + ++ GEDRL +
Sbjct  373  HLWVISGFGSQNSESEADLRRPTRQPSILLFPFLKSVLTVNPCMSNQEQVLLQGEDRLYL  432

Query  320  ---------------------------------VQSEDTDEL---RILHL-NLPVSYISQ  388
                                             V+S+    L   R  H+  +  +Y+  
Sbjct  433  NCGEASQAQNPRGSSAHSPHTPGRERSPFADGGVESQGLSTLLGHRHWHVVQISSTYLES  492

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIV  562
            NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV
Sbjct  493  NWPIRFSAIDKLGQNIAVVGKFGFAHYSLLTKKWKLFGNITQEQNMIVTGGLAWWNDFIV  552

Query  563  VVC  571
            + C
Sbjct  553  LAC  555



>ref|XP_009953308.1| PREDICTED: LOW QUALITY PROTEIN: protein RIC1 homolog [Leptosomus 
discolor]
Length=1278

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 64/240 (27%), Positives = 93/240 (39%), Gaps = 61/240 (25%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  183  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  232

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  233  HLWVIDGNSSSNMKPERDANNEAHQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  292

Query  320  -------VQSEDTDELRILH---------------------------LNLPVSYISQNWP  397
                    QS         H                           + +  +Y+  NWP
Sbjct  293  NCGDATQAQSPRNTSAHSEHKPARERXDGSLDSQGLSTLLGHRHWHVVQIHSTYLESNWP  352

Query  398  VLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVVC  571
            +   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ C
Sbjct  353  IRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMMVTGGLAWWNDFIVLAC  412



>ref|XP_003742426.1| PREDICTED: protein RIC1 homolog [Metaseiulus occidentalis]
Length=1401

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 56/216 (26%), Positives = 87/216 (40%), Gaps = 53/216 (25%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSG----CRLM--STFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLM  163
            AV W+  GL VWSV G    C L   S +C+I + +                       M
Sbjct  310  AVAWEKCGLAVWSVFGSLIFCSLNWESPYCKIQIRA-----------------------M  346

Query  164  HWDEHGYRLYAIEEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDE  343
             W  HGY L+   +   E +   SF K       +  +D ++++      +++ S+DT  
Sbjct  347  EWGFHGYNLWLGSDR--EDLCLLSFMKAAATNYSAPQSDQQKILLQGASSVLISSKDTLS  404

Query  344  LRI---------------------LHLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGL  460
             +                      +H+ +P +Y + N P+ +     D   L +AG  G 
Sbjct  405  RKQNEPGSPWSGPSLENHAANKHWIHIVVPSTYSALNGPICYSCIDSDANNLCIAGRSGF  464

Query  461  ILYDLRLKKWRVFGDITQEQKIQ-CRGLLWLGKIVV  565
             LY L+ KKW+ FG+ TQEQ      G+LW    VV
Sbjct  465  CLYSLQTKKWKFFGNETQEQDFNIIGGVLWWSDYVV  500



>ref|XP_008101552.1| PREDICTED: protein RIC1 homolog isoform X2 [Anolis carolinensis]
Length=1417

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 98/241 (41%), Gaps = 62/241 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  319  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAHRSDGTKKDPL--KISSMSWGSEGY  368

Query  185  RLYAIEEGSL-------------ER--IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S              +R  I+ F F K  L      +   + ++ GEDRL +
Sbjct  369  HLWVIDANSFGSSVTESKCKNESQRCGILQFQFIKSALTVNPCISNQEQVLLQGEDRLYL  428

Query  320  -----VQSEDT------DELRILH------------------------LNLPVSYISQNW  394
                 +Q+++        E + L                         + +  +Y+  NW
Sbjct  429  NCGDAIQAQNPRCSSAHSEHKALRGQFSDGSVDSQGLSTLLGHRHWHVVQIHSTYLEINW  488

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVV  568
            P+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ 
Sbjct  489  PIRFSAIDKMGQNVAVVGKFGFAHYSLLSKKWKLFGNITQEQNMTVTGGLAWWNDFIVIA  548

Query  569  C  571
            C
Sbjct  549  C  549



>ref|XP_003216611.1| PREDICTED: protein RIC1 homolog isoform X1 [Anolis carolinensis]
Length=1418

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 98/241 (41%), Gaps = 62/241 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  320  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAHRSDGTKKDPL--KISSMSWGSEGY  369

Query  185  RLYAIEEGSL-------------ER--IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S              +R  I+ F F K  L      +   + ++ GEDRL +
Sbjct  370  HLWVIDANSFGSSVTESKCKNESQRCGILQFQFIKSALTVNPCISNQEQVLLQGEDRLYL  429

Query  320  -----VQSEDT------DELRILH------------------------LNLPVSYISQNW  394
                 +Q+++        E + L                         + +  +Y+  NW
Sbjct  430  NCGDAIQAQNPRCSSAHSEHKALRGQFSDGSVDSQGLSTLLGHRHWHVVQIHSTYLEINW  489

Query  395  PVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIVVV  568
            P+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV+ 
Sbjct  490  PIRFSAIDKMGQNVAVVGKFGFAHYSLLSKKWKLFGNITQEQNMTVTGGLAWWNDFIVIA  549

Query  569  C  571
            C
Sbjct  550  C  550



>gb|KDN49477.1| LOW QUALITY PROTEIN: hypothetical protein RSAG8_02179, partial 
[Rhizoctonia solani AG-8 WAC10335]
Length=956

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (56%), Gaps = 9/99 (9%)
 Frame = +2

Query  302  EDRLLVVQSEDTDELRIL--------HLNLPVSYISQNWPVLHVAASRDGMYLAVAGFHG  457
            +DR+LV +  D  ++ ++        H+ +P +Y++ NWP+   + + DG  +AVAG  G
Sbjct  427  DDRVLVYRGADQPDMSVINPESDVWQHICVPAAYLAYNWPIRSASIAPDGRLIAVAGRRG  486

Query  458  LILYDLRLKKWRVFGDITQEQKIQCR-GLLWLGKIVVVC  571
            L+ Y     KW+ F D+ QEQ    + G++W   ++VV 
Sbjct  487  LVHYSSASGKWKRFIDLKQEQAFAVKGGMIWFHHVLVVA  525



>ref|XP_008494447.1| PREDICTED: protein RIC1 homolog isoform X1 [Calypte anna]
Length=1419

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 95/243 (39%), Gaps = 64/243 (26%)
 Frame = +2

Query  5    VGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGY  184
            V W+  GL++WSV G +L+   C +G           +   K +P+    S M W   GY
Sbjct  321  VTWECGGLSLWSVFGAQLI---CTLG-----GDFAYQSDGAKKDPL--KISSMTWGSEGY  370

Query  185  RLYAIEEGS-----LER----------IIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLV  319
             L+ I+  S      ER          I+ F F K  L      +   + ++ GEDRL +
Sbjct  371  HLWVIDGNSSSNMKPERDGSNQAHQFGILQFHFIKSALTVNPCMSNQEQVLLQGEDRLYL  430

Query  320  -----VQSEDTDELRILHLNLPV--------------------------------SYISQ  388
                  Q+++     +   + P                                 +Y+  
Sbjct  431  NCGDATQTQNPRNTSVHSEHNPARERGPFSDGSLDAQILSTLLGHRHWHVVQIHSTYLES  490

Query  389  NWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLGKIV  562
            NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W   IV
Sbjct  491  NWPIRFSAIDKLGQNVAVVGKFGFAHYSLLTKKWKLFGNITQEQNMTVTGGLAWWNDFIV  550

Query  563  VVC  571
            + C
Sbjct  551  LAC  553



>ref|XP_010215452.1| PREDICTED: LOW QUALITY PROTEIN: RAB6A-GEF complex partner protein 
1 [Tinamus guttatus]
Length=1386

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 93/246 (38%), Gaps = 66/246 (27%)
 Frame = +2

Query  2    AVGWKLRGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHG  181
            AV W+  GL++WSV G +L+   C +G           +   K +P+    S M W   G
Sbjct  285  AVTWECGGLSLWSVFGAQLI---CTLG-----GDFAYRSDGTKKDPL--KISSMSWGSEG  334

Query  182  YRLYAIE---------------EGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLL  316
            Y L+ I+               E     I+ F F K  L      +   + ++ GEDRL 
Sbjct  335  YHLWVIDGNCSQNTRTERDAKNESQQFGILQFQFIKSALTVNPCMSNQEQVLLQGEDRLY  394

Query  317  V-------VQSEDTDELRILH--------------------------------LNLPVSY  379
            +        QS     +   H                                + +  +Y
Sbjct  395  LNCGDATQAQSPRNASVHPEHKLTRXXXXGPFSDGSLDSQGLSTLLGHRHWHVVQIHSTY  454

Query  380  ISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCRGLL--WLG  553
            +  NWP+   A  + G  +AV G  G   Y L  KKW++FG+ITQEQ +   G L  W  
Sbjct  455  LESNWPIKFSAIDKPGQNVAVVGKFGFAHYSLVTKKWKLFGNITQEQNMVVTGGLAWWND  514

Query  554  KIVVVC  571
             IV+ C
Sbjct  515  FIVLAC  520



>gb|EMF16857.1| RIC1-domain-containing protein [Sphaerulina musiva SO2202]
Length=1050

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 79/193 (41%), Gaps = 20/193 (10%)
 Frame = +2

Query  20   RGLTVWSVSGCRLMSTFCQIGLSSVSSPVIKPNQEYKNEPMMGGTSLMHWDEHGYRLYAI  199
            RG   W+V G    +TF           + +   E  +E  + G     W   G  L A+
Sbjct  396  RGWATWTVYGKPCANTFS----------IDRAQSEANDERWLHGVRTAFWIGGGCEL-AL  444

Query  200  EEGSLERIIAFSFGKCCLNRGVSGTTDVRQVIYGEDRLLVVQSEDTDELRILH-------  358
               +  R+      +      ++     R ++Y  D +++ +  D  ++  L        
Sbjct  445  FPFADNRLYVLDIARNAATGCLTPANVSRGLLYSTDSIMIYKGHDVPDVTSLPSDISLWQ  504

Query  359  -LNLPVSYISQNWPVLHVAASRDGMYLAVAGFHGLILYDLRLKKWRVFGDITQEQKIQCR  535
             + +P  Y+ Q WP+   A S DG Y+AVAG  GL  + +   +WR F D   EQ+   R
Sbjct  505  TVQVPSQYLIQQWPIKSAAISSDGKYVAVAGRRGLAHFSVASGRWRTFDDPQAEQEFTVR  564

Query  536  -GLLWLGKIVVVC  571
             G+ W   I++V 
Sbjct  565  GGMCWHYHILIVA  577



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 632043024200