BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81370_g1_i1 len=1663 path=[1664:0-1662]

Length=1663
                                                                      Score     E

ref|XP_006343160.1|  PREDICTED: serine carboxypeptidase-like 18-l...    464   7e-155   
ref|XP_009601001.1|  PREDICTED: serine carboxypeptidase-like 7 is...    463   8e-155   
ref|XP_009768014.1|  PREDICTED: serine carboxypeptidase-like 17         464   8e-155   
ref|XP_004252000.2|  PREDICTED: serine carboxypeptidase-like 7          464   9e-155   
ref|XP_010320198.1|  PREDICTED: serine carboxypeptidase-like 17         463   2e-154   
ref|XP_009600999.1|  PREDICTED: serine carboxypeptidase-like 7 is...    459   5e-153   
ref|XP_010321496.1|  PREDICTED: serine carboxypeptidase-like 13 i...    456   3e-152   
ref|XP_009764359.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    456   5e-152   
ref|XP_004292764.1|  PREDICTED: serine carboxypeptidase-like 18-like    453   1e-150   
ref|XP_010321495.1|  PREDICTED: serine carboxypeptidase-like 13 i...    451   3e-150   
ref|XP_004238557.1|  PREDICTED: uncharacterized protein LOC101252581    463   6e-149   
ref|XP_009771128.1|  PREDICTED: serine carboxypeptidase-like 13 i...    446   6e-148   
ref|XP_002283413.1|  PREDICTED: serine carboxypeptidase-like 2          444   2e-147   Vitis vinifera
ref|XP_004238067.1|  PREDICTED: uncharacterized protein LOC101252078    459   2e-147   
ref|XP_010321497.1|  PREDICTED: serine carboxypeptidase-like 12         444   3e-147   
dbj|BAF99695.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          444   3e-147   Clitoria ternatea
emb|CBI19380.3|  unnamed protein product                                445   4e-147   
ref|XP_006356866.1|  PREDICTED: uncharacterized protein LOC102592829    461   6e-147   
ref|XP_003593858.1|  Serine carboxypeptidase-like protein               443   8e-147   
ref|XP_006472320.1|  PREDICTED: serine carboxypeptidase-like 18-l...    443   8e-147   
ref|XP_006433655.1|  hypothetical protein CICLE_v10001060mg             442   1e-146   
gb|KDO81468.1|  hypothetical protein CISIN_1g012276mg                   441   5e-146   
ref|XP_006433653.1|  hypothetical protein CICLE_v10001059mg             441   5e-146   
ref|XP_010277006.1|  PREDICTED: serine carboxypeptidase-like 1 is...    440   2e-145   
ref|XP_007018461.1|  Serine carboxypeptidase-like 7, putative           440   2e-145   
gb|KDO81474.1|  hypothetical protein CISIN_1g012236mg                   439   3e-145   
emb|CDP01267.1|  unnamed protein product                                437   1e-144   
ref|XP_003593861.1|  Serine carboxypeptidase family protein             437   1e-144   
ref|XP_010320337.1|  PREDICTED: serine carboxypeptidase-like 13 i...    436   4e-144   
ref|XP_006472316.1|  PREDICTED: serine carboxypeptidase-like 18-l...    436   4e-144   
ref|XP_003604931.1|  Serine carboxypeptidase                            436   4e-144   
ref|NP_001242803.1|  uncharacterized protein LOC100794342               436   5e-144   
ref|XP_006354895.1|  PREDICTED: serine carboxypeptidase-like 18-like    436   7e-144   
ref|XP_009784016.1|  PREDICTED: serine carboxypeptidase-like 11 i...    436   9e-144   
gb|AES87127.2|  1-O-acylglucose:anthocyanin acyltransferase             435   1e-143   
gb|KDP41600.1|  hypothetical protein JCGZ_16007                         435   2e-143   
ref|XP_009612197.1|  PREDICTED: serine carboxypeptidase-like 11 i...    435   2e-143   
ref|XP_009626153.1|  PREDICTED: serine carboxypeptidase-like 13         434   2e-143   
gb|KHN06942.1|  Serine carboxypeptidase-like 19                         434   2e-143   
ref|XP_006594522.1|  PREDICTED: serine carboxypeptidase-like 12-like    432   1e-142   
gb|AFK49380.1|  unknown                                                 431   7e-142   
ref|XP_010314600.1|  PREDICTED: serine carboxypeptidase-like 11         430   8e-142   
ref|XP_003593859.1|  Serine carboxypeptidase-like protein               430   9e-142   
ref|XP_010555479.1|  PREDICTED: serine carboxypeptidase-like 7          430   1e-141   
ref|XP_002510077.1|  serine carboxypeptidase, putative                  429   1e-141   Ricinus communis
ref|XP_010320342.1|  PREDICTED: serine carboxypeptidase-like 10 i...    427   6e-141   
dbj|BAF99694.1|  1-O-acylglucose:anthocyanin-O-acyltransferase          429   7e-141   Clitoria ternatea
ref|XP_006356867.1|  PREDICTED: serine carboxypeptidase-like 19-like    440   8e-141   
ref|XP_010320340.1|  PREDICTED: serine carboxypeptidase-like 13 i...    428   9e-141   
gb|KFK44962.1|  hypothetical protein AALP_AA1G326200                    427   1e-140   
ref|XP_003604928.1|  Serine carboxypeptidase                            425   1e-139   
ref|XP_007159376.1|  hypothetical protein PHAVU_002G233100g             424   5e-139   
ref|XP_009761854.1|  PREDICTED: serine carboxypeptidase-like 18         421   7e-139   
gb|KDO81471.1|  hypothetical protein CISIN_1g012205mg                   422   1e-138   
emb|CDP21038.1|  unnamed protein product                                422   1e-138   
gb|KDP41601.1|  hypothetical protein JCGZ_16008                         422   2e-138   
ref|XP_004486284.1|  PREDICTED: serine carboxypeptidase-like 12-like    421   2e-138   
dbj|BAO04183.1|  putative acyl-glucose-dependent anthocyanin acyl...    421   3e-138   
ref|XP_006472322.1|  PREDICTED: serine carboxypeptidase-like 18-like    421   3e-138   
dbj|BAF99698.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    422   3e-138   Gentiana triflora
ref|XP_006433654.1|  hypothetical protein CICLE_v10001055mg             421   4e-138   
ref|XP_006342727.1|  PREDICTED: uncharacterized protein LOC102585123    432   4e-137   
gb|AES73172.2|  1-O-acylglucose:anthocyanin acyltransferase             419   5e-137   
ref|XP_003604929.1|  Serine carboxypeptidase                            432   8e-137   
ref|XP_010936155.1|  PREDICTED: serine carboxypeptidase-like 18         417   9e-137   
ref|XP_006356850.1|  PREDICTED: serine carboxypeptidase-like 18-like    417   1e-136   
ref|XP_003604927.1|  Serine carboxypeptidase                            421   3e-136   
ref|XP_003520964.1|  PREDICTED: serine carboxypeptidase-like 11-like    416   4e-136   
gb|AES87130.2|  1-O-acylglucose:anthocyanin acyltransferase             416   5e-136   
ref|XP_003604930.1|  Serine carboxypeptidase family protein             431   5e-136   
ref|XP_009382032.1|  PREDICTED: serine carboxypeptidase-like 7          415   1e-135   
ref|XP_010556479.1|  PREDICTED: serine carboxypeptidase-like 19         414   1e-135   
emb|CDP17360.1|  unnamed protein product                                414   3e-135   
ref|XP_009771129.1|  PREDICTED: serine carboxypeptidase-like 13 i...    412   5e-135   
ref|XP_010061646.1|  PREDICTED: serine carboxypeptidase-like 2          413   5e-135   
dbj|BAF99697.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    414   5e-135   Gentiana triflora
ref|XP_006597032.1|  PREDICTED: uncharacterized protein LOC100794...    412   5e-135   
ref|XP_006415267.1|  hypothetical protein EUTSA_v10007571mg             412   8e-135   
gb|KEH29042.1|  1-O-acylglucose:anthocyanin acyltransferase             426   8e-135   
ref|XP_007136774.1|  hypothetical protein PHAVU_009G072900g             412   1e-134   
gb|AES87126.2|  1-O-acylglucose:anthocyanin acyltransferase             426   1e-134   
ref|XP_011006024.1|  PREDICTED: serine carboxypeptidase-like 3 is...    411   2e-134   
dbj|BAO04182.1|  hypothetical protein                                   412   2e-134   
ref|XP_010936150.1|  PREDICTED: serine carboxypeptidase-like 18 i...    412   2e-134   
gb|KHN45135.1|  Serine carboxypeptidase-like 19                         411   2e-134   
ref|XP_003604933.1|  Serine carboxypeptidase                            411   3e-134   
emb|CDY59210.1|  BnaA09g54030D                                          411   3e-134   
emb|CDP06925.1|  unnamed protein product                                410   4e-134   
ref|XP_009114926.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    410   4e-134   
ref|XP_006581276.1|  PREDICTED: serine carboxypeptidase-like 19-l...    411   4e-134   
ref|XP_010277008.1|  PREDICTED: serine carboxypeptidase-like 18 i...    409   5e-134   
ref|XP_007138067.1|  hypothetical protein PHAVU_009G177800g             411   5e-134   
gb|KEH29044.1|  1-O-acylglucose:anthocyanin acyltransferase             410   5e-134   
emb|CDP21040.1|  unnamed protein product                                411   6e-134   
ref|XP_006404766.1|  hypothetical protein EUTSA_v10000651mg             408   9e-134   
ref|XP_006342726.1|  PREDICTED: serine carboxypeptidase-like 11-like    409   9e-134   
ref|XP_009784017.1|  PREDICTED: serine carboxypeptidase-like 7 is...    409   1e-133   
ref|XP_006343161.1|  PREDICTED: serine carboxypeptidase-like 18-l...    408   1e-133   
ref|XP_008644916.1|  PREDICTED: serine carboxypeptidase-like 18 i...    409   2e-133   
emb|CDY22581.1|  BnaC05g24190D                                          409   2e-133   
emb|CDP17658.1|  unnamed protein product                                408   3e-133   
ref|XP_009131550.1|  PREDICTED: serine carboxypeptidase-like 7 is...    407   3e-133   
ref|XP_008790304.1|  PREDICTED: uncharacterized protein LOC103707550    424   4e-133   
ref|XP_006472315.1|  PREDICTED: serine carboxypeptidase-like 18-l...    408   7e-133   
ref|XP_009140440.1|  PREDICTED: serine carboxypeptidase-like 13 i...    405   1e-132   
ref|XP_010422959.1|  PREDICTED: serine carboxypeptidase-like 19         407   1e-132   
ref|XP_010936154.1|  PREDICTED: serine carboxypeptidase-like 18         407   2e-132   
ref|XP_009139971.1|  PREDICTED: serine carboxypeptidase-like 13 i...    404   3e-132   
emb|CDY53115.1|  BnaCnng24430D                                          404   4e-132   
ref|XP_010314652.1|  PREDICTED: serine carboxypeptidase-like 11         412   7e-132   
ref|XP_006415266.1|  hypothetical protein EUTSA_v10007559mg             404   1e-131   
emb|CDX70702.1|  BnaC03g07860D                                          403   1e-131   
ref|XP_010499905.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    404   1e-131   
gb|KFK25883.1|  hypothetical protein AALP_AA8G174700                    403   2e-131   
emb|CDP01266.1|  unnamed protein product                                403   3e-131   
ref|XP_006295774.1|  hypothetical protein CARUB_v10024896mg             402   3e-131   
sp|Q9C7Z9.2|SCP18_ARATH  RecName: Full=Serine carboxypeptidase-li...    403   3e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290031.1|  hypothetical protein CARUB_v10003665mg             402   5e-131   
ref|XP_008790306.1|  PREDICTED: uncharacterized protein LOC103707552    418   5e-131   
ref|XP_009103431.1|  PREDICTED: serine carboxypeptidase-like 10         401   6e-131   
emb|CDX85493.1|  BnaA02g03200D                                          402   7e-131   
ref|XP_008452660.1|  PREDICTED: serine carboxypeptidase-like 7          402   8e-131   
ref|XP_002878651.1|  hypothetical protein ARALYDRAFT_900758             401   9e-131   
ref|XP_008452664.1|  PREDICTED: serine carboxypeptidase-like 2          402   9e-131   
ref|XP_009126130.1|  PREDICTED: serine carboxypeptidase-like 12 i...    401   1e-130   
ref|XP_009131551.1|  PREDICTED: serine carboxypeptidase-like 7 is...    401   1e-130   
ref|XP_009125362.1|  PREDICTED: serine carboxypeptidase-like 19         401   2e-130   
ref|XP_004163543.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    401   2e-130   
ref|NP_187656.1|  serine carboxypeptidase-like 7                        400   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415268.1|  hypothetical protein EUTSA_v10007570mg             400   2e-130   
ref|XP_010429239.1|  PREDICTED: serine carboxypeptidase-like 10 i...    399   3e-130   
ref|XP_002510076.1|  serine carboxypeptidase, putative                  400   4e-130   Ricinus communis
emb|CDX76889.1|  BnaC08g34750D                                          399   4e-130   
ref|XP_004163541.1|  PREDICTED: serine carboxypeptidase-like 19-like    399   8e-130   
ref|XP_006399445.1|  hypothetical protein EUTSA_v10015495mg             399   1e-129   
gb|AAQ91191.1|  1-O-sinapoylglucose:choline sinapoyltransferase         399   1e-129   Brassica napus [oilseed rape]
emb|CDX69437.1|  BnaA10g17860D                                          398   1e-129   
ref|XP_006376417.1|  serine carboxypeptidase S10 family protein         397   2e-129   
ref|NP_179881.3|  serine carboxypeptidase-like 13                       397   3e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452662.1|  PREDICTED: serine carboxypeptidase-like 13         398   3e-129   
gb|KDO81472.1|  hypothetical protein CISIN_1g012205mg                   396   3e-129   
ref|NP_568215.2|  serine carboxypeptidase-like 19                       398   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179883.1|  sinapoylglucose:anthocyanin sinapoyltransferase       397   4e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556471.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    396   4e-129   
emb|CDY49647.1|  BnaC09g41250D                                          396   5e-129   
ref|XP_009121469.1|  PREDICTED: serine carboxypeptidase-like 7          397   6e-129   
ref|XP_010936152.1|  PREDICTED: serine carboxypeptidase-like 18 i...    397   6e-129   
gb|AAK52316.1|  sinapoylglucose:choline sinapoyltransferase             397   8e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491604.1|  PREDICTED: serine carboxypeptidase-like 19         397   9e-129   
ref|XP_007134008.1|  hypothetical protein PHAVU_010G011400g             397   9e-129   
emb|CAM91989.1|  sinapoylglucose:choline sinapoyltransferase            397   1e-128   
ref|XP_010461188.1|  PREDICTED: serine carboxypeptidase-like 18         396   1e-128   
ref|XP_009365383.1|  PREDICTED: serine carboxypeptidase-like 13         396   2e-128   
ref|XP_002882669.1|  hypothetical protein ARALYDRAFT_478377             394   2e-128   
ref|XP_010452962.1|  PREDICTED: serine carboxypeptidase-like 19         395   3e-128   
ref|XP_009125363.1|  PREDICTED: serine carboxypeptidase-like 19         395   3e-128   
ref|XP_009133994.1|  PREDICTED: serine carboxypeptidase-like 10 i...    394   4e-128   
emb|CAM91988.1|  sinapoylglucose:choline sinapoyltransferase            395   4e-128   Brassica oleracea var. medullosa [marrow-stem kale]
ref|XP_003573757.1|  PREDICTED: serine carboxypeptidase-like 13         395   5e-128   
ref|XP_010472298.1|  PREDICTED: serine carboxypeptidase-like 10 i...    394   6e-128   
ref|XP_004983497.1|  PREDICTED: serine carboxypeptidase-like 18-like    395   6e-128   
ref|NP_001077946.1|  serine carboxypeptidase-like 13                    393   7e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556480.1|  PREDICTED: serine carboxypeptidase-like 1          393   9e-128   
ref|XP_010429230.1|  PREDICTED: serine carboxypeptidase-like 11 i...    393   1e-127   
emb|CDY49438.1|  BnaA09g42290D                                          392   2e-127   
gb|KDP32094.1|  hypothetical protein JCGZ_12555                         394   2e-127   
ref|XP_009122528.1|  PREDICTED: serine carboxypeptidase-like 19         393   2e-127   
ref|NP_179880.1|  serine carboxypeptidase-like 11                       391   4e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939016.1|  PREDICTED: serine carboxypeptidase-like 18 i...    394   4e-127   
ref|XP_010426467.1|  PREDICTED: serine carboxypeptidase-like 7          390   9e-127   
ref|XP_009120822.1|  PREDICTED: serine carboxypeptidase-like 15 i...    390   1e-126   
ref|XP_004292112.1|  PREDICTED: serine carboxypeptidase-like 18-like    392   1e-126   
ref|XP_006390568.1|  hypothetical protein EUTSA_v10018572mg             390   2e-126   
ref|XP_010527656.1|  PREDICTED: serine carboxypeptidase-like 2          390   2e-126   
ref|NP_177471.1|  serine carboxypeptidase-like 3                        390   2e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297701.1|  hypothetical protein CARUB_v10013730mg             390   2e-126   
ref|XP_008452663.1|  PREDICTED: serine carboxypeptidase-like 13         390   2e-126   
ref|NP_179876.1|  serine carboxypeptidase-like 12                       389   3e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300201.1|  hypothetical protein CARUB_v10016437mg             390   4e-126   
ref|XP_006399443.1|  hypothetical protein EUTSA_v10015958mg             390   5e-126   
ref|XP_009117321.1|  PREDICTED: serine carboxypeptidase-like 10 i...    389   5e-126   
ref|XP_006651780.1|  PREDICTED: serine carboxypeptidase-like 18-like    389   7e-126   
emb|CDY11114.1|  BnaC06g23660D                                          388   7e-126   
ref|XP_008452655.1|  PREDICTED: serine carboxypeptidase-like 13 i...    389   8e-126   
ref|XP_008337031.1|  PREDICTED: serine carboxypeptidase-like 18         388   8e-126   
ref|NP_177473.1|  serine carboxypeptidase-like 2                        388   9e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009384628.1|  PREDICTED: serine carboxypeptidase-like 18         389   1e-125   
ref|NP_177472.1|  serine carboxypeptidase-like 5                        388   1e-125   Arabidopsis thaliana [mouse-ear cress]
sp|Q9CAU2.2|SCP5_ARATH  RecName: Full=Serine carboxypeptidase-lik...    387   1e-125   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566614.1|  PREDICTED: serine carboxypeptidase-like 13 i...    390   1e-125   
ref|XP_006297708.1|  hypothetical protein CARUB_v10013737mg             387   2e-125   
gb|EYU37561.1|  hypothetical protein MIMGU_mgv1a005963mg                388   2e-125   
ref|XP_010939013.1|  PREDICTED: serine carboxypeptidase-like 18 i...    387   2e-125   
emb|CDY38096.1|  BnaC02g06770D                                          389   3e-125   
emb|CDY50564.1|  BnaA01g30780D                                          387   3e-125   
ref|XP_003525944.2|  PREDICTED: serine carboxypeptidase-like 19-l...    386   4e-125   
ref|XP_003633199.2|  PREDICTED: serine carboxypeptidase-like 13 i...    387   4e-125   
ref|XP_010429234.1|  PREDICTED: serine carboxypeptidase-like 12 i...    386   5e-125   
ref|XP_010515304.1|  PREDICTED: serine carboxypeptidase-like 7          386   5e-125   
gb|KFK38432.1|  hypothetical protein AALP_AA3G112600                    386   5e-125   
ref|XP_007047573.1|  Serine carboxypeptidase-like 2, putative iso...    387   6e-125   
ref|XP_003560245.1|  PREDICTED: serine carboxypeptidase-like 18         387   6e-125   
ref|XP_003604932.1|  Serine carboxypeptidase                            385   6e-125   
ref|XP_006407566.1|  hypothetical protein EUTSA_v10020743mg             386   7e-125   
ref|XP_004975754.1|  PREDICTED: serine carboxypeptidase-like 7-like     387   7e-125   
ref|XP_010656845.1|  PREDICTED: serine carboxypeptidase-like 13         387   8e-125   
emb|CDX78700.1|  BnaA03g06120D                                          386   9e-125   
emb|CDY44586.1|  BnaA04g10040D                                          386   1e-124   
ref|XP_010472296.1|  PREDICTED: serine carboxypeptidase-like 11 i...    385   1e-124   
ref|NP_973517.1|  serine carboxypeptidase-like 9                        385   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179884.1|  serine carboxypeptidase-like 9                        385   2e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486655.1|  PREDICTED: serine carboxypeptidase-like 7 is...    385   2e-124   
ref|XP_010556472.1|  PREDICTED: serine carboxypeptidase-like 18 i...    385   3e-124   
emb|CBI17847.3|  unnamed protein product                                387   4e-124   
ref|XP_009140442.1|  PREDICTED: serine carboxypeptidase-like 13 i...    384   5e-124   
ref|XP_006403281.1|  hypothetical protein EUTSA_v10003211mg             384   5e-124   
ref|XP_009139928.1|  PREDICTED: serine carboxypeptidase-like 7 is...    383   7e-124   
ref|XP_009139927.1|  PREDICTED: serine carboxypeptidase-like 7 is...    383   8e-124   
gb|KFK39468.1|  hypothetical protein AALP_AA3G248300                    383   8e-124   
ref|XP_011006023.1|  PREDICTED: serine carboxypeptidase-like 3 is...    384   9e-124   
emb|CBI17848.3|  unnamed protein product                                387   9e-124   
ref|XP_002459781.1|  hypothetical protein SORBIDRAFT_02g010510          384   9e-124   Sorghum bicolor [broomcorn]
ref|XP_006294237.1|  hypothetical protein CARUB_v10023234mg             383   9e-124   
gb|KEH33547.1|  serine carboxypeptidase-like protein                    383   1e-123   
emb|CDP01265.1|  unnamed protein product                                385   1e-123   
gb|KCW68631.1|  hypothetical protein EUGRSUZ_F02236                     383   1e-123   
ref|NP_198467.2|  serine carboxypeptidase-like 1                        382   1e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376415.1|  serine carboxypeptidase S10 family protein         382   1e-123   
ref|XP_006399444.1|  hypothetical protein EUTSA_v10016050mg             383   2e-123   
ref|XP_010509542.1|  PREDICTED: serine carboxypeptidase-like 9 is...    382   2e-123   
ref|XP_010556477.1|  PREDICTED: serine carboxypeptidase-like 18         382   2e-123   
emb|CDY08603.1|  BnaA05g28390D                                          382   2e-123   
ref|XP_010464720.1|  PREDICTED: serine carboxypeptidase-like 7          382   2e-123   
ref|XP_010486652.1|  PREDICTED: serine carboxypeptidase-like 7 is...    382   3e-123   
emb|CDY52618.1|  BnaCnng22970D                                          381   3e-123   
ref|XP_006472317.1|  PREDICTED: serine carboxypeptidase-like 18-l...    382   3e-123   
emb|CDX89533.1|  BnaC04g35520D                                          382   3e-123   
ref|NP_850034.1|  sinapoylglucose:malate sinapoyltransferase            381   4e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509543.1|  PREDICTED: serine carboxypeptidase-like 9 is...    381   4e-123   
gb|AAC17816.2|  putative serine carboxypeptidase I                      380   6e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878650.1|  hypothetical protein ARALYDRAFT_481168             380   7e-123   
ref|XP_009146838.1|  PREDICTED: serine carboxypeptidase-like 7 is...    381   7e-123   
gb|KHN47358.1|  ABC transporter B family member 9                       407   7e-123   
ref|NP_177470.4|  serine carboxypeptidase-like 6                        381   7e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464717.1|  PREDICTED: serine carboxypeptidase-like 7 is...    380   8e-123   
ref|XP_010484310.1|  PREDICTED: serine carboxypeptidase-like 7          380   9e-123   
gb|AAG52139.1|AC010556_21  putative serine carboxypeptidase; 1519...    380   9e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428244.1|  PREDICTED: serine carboxypeptidase-like 2 is...    380   1e-122   
ref|XP_010429240.1|  PREDICTED: serine carboxypeptidase-like 10 i...    379   1e-122   
ref|XP_006299183.1|  hypothetical protein CARUB_v10015328mg             380   1e-122   
ref|XP_006855958.1|  hypothetical protein AMTR_s00037p00227730          382   2e-122   
ref|XP_004165535.1|  PREDICTED: serine carboxypeptidase-like 1-like     380   2e-122   
ref|XP_010656846.1|  PREDICTED: serine carboxypeptidase-like 13 i...    380   2e-122   
ref|XP_004141409.1|  PREDICTED: serine carboxypeptidase-like 1-like     380   2e-122   
ref|XP_002268517.1|  PREDICTED: serine carboxypeptidase-like 17         380   3e-122   Vitis vinifera
dbj|BAJ85413.1|  predicted protein                                      380   3e-122   
emb|CDY00943.1|  BnaC05g42570D                                          379   3e-122   
ref|XP_010320339.1|  PREDICTED: serine carboxypeptidase-like 10 i...    379   3e-122   
ref|XP_010503611.1|  PREDICTED: serine carboxypeptidase-like 7          379   3e-122   
ref|NP_001151152.1|  serine carboxypeptidase 1 precursor                380   4e-122   Zea mays [maize]
ref|NP_187828.1|  serine carboxypeptidase-like 17                       379   4e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006401829.1|  hypothetical protein EUTSA_v10013495mg             379   4e-122   
emb|CDY30277.1|  BnaC04g31880D                                          379   5e-122   
tpg|DAA39921.1|  TPA: Serine carboxypeptidase 1                         381   5e-122   
ref|XP_009122530.1|  PREDICTED: serine carboxypeptidase-like 19         379   5e-122   
ref|XP_009135216.1|  PREDICTED: serine carboxypeptidase-like 15         379   6e-122   
gb|AAN60354.1|  unknown                                                 377   6e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KDP35358.1|  hypothetical protein JCGZ_10342                         380   6e-122   
gb|KHN45449.1|  Serine carboxypeptidase-like 11                         378   6e-122   
ref|XP_010429242.1|  PREDICTED: serine carboxypeptidase-like 10 i...    379   6e-122   
emb|CDP06924.1|  unnamed protein product                                379   6e-122   
ref|XP_009343181.1|  PREDICTED: serine carboxypeptidase-like 1 is...    379   7e-122   
ref|XP_010416123.1|  PREDICTED: serine carboxypeptidase-like 2          378   8e-122   
ref|XP_006296383.1|  hypothetical protein CARUB_v10025556mg             378   9e-122   
ref|XP_009105991.1|  PREDICTED: serine carboxypeptidase-like 2 is...    378   1e-121   
gb|KFK38585.1|  hypothetical protein AALP_AA3G132800                    377   1e-121   
ref|NP_177474.1|  serine carboxypeptidase-like 4                        377   1e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CDY68040.1|  BnaAnng25990D                                          377   1e-121   
ref|XP_010472300.1|  PREDICTED: serine carboxypeptidase-like 9 is...    379   1e-121   
ref|XP_010556473.1|  PREDICTED: serine carboxypeptidase-like 18 i...    378   2e-121   
ref|XP_004956083.1|  PREDICTED: serine carboxypeptidase-like 19-like    379   2e-121   
emb|CDX96466.1|  BnaA07g30770D                                          377   2e-121   
gb|EYU37560.1|  hypothetical protein MIMGU_mgv1a005845mg                378   2e-121   
emb|CDX77573.1|  BnaA07g07110D                                          377   2e-121   
ref|XP_006296372.1|  hypothetical protein CARUB_v10025545mg             376   3e-121   
ref|XP_006294243.1|  hypothetical protein CARUB_v10023242mg             376   3e-121   
gb|KGN55284.1|  hypothetical protein Csa_4G644120                       377   3e-121   
ref|XP_008790305.1|  PREDICTED: serine carboxypeptidase-like 18         390   4e-121   
ref|XP_002298786.2|  hypothetical protein POPTR_0001s29870g             377   4e-121   
ref|NP_001031402.1|  serine carboxypeptidase-like 13                    375   5e-121   
ref|XP_010320338.1|  PREDICTED: serine carboxypeptidase-like 17 i...    376   5e-121   
ref|XP_002265842.1|  PREDICTED: serine carboxypeptidase-like 18         378   5e-121   
ref|XP_009102688.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    375   5e-121   
emb|CDP18838.1|  unnamed protein product                                375   5e-121   
emb|CBI22424.3|  unnamed protein product                                378   7e-121   
ref|XP_009375674.1|  PREDICTED: serine carboxypeptidase-like 7          376   8e-121   
ref|XP_009388678.1|  PREDICTED: serine carboxypeptidase-like 18         377   9e-121   
ref|XP_003579296.2|  PREDICTED: serine carboxypeptidase-like 2          377   9e-121   
emb|CDY09545.1|  BnaC05g23740D                                          375   1e-120   
ref|XP_010472299.1|  PREDICTED: serine carboxypeptidase-like 10 i...    374   1e-120   
ref|XP_010428248.1|  PREDICTED: serine carboxypeptidase-like 2 is...    374   1e-120   
ref|NP_001030669.1|  serine carboxypeptidase-like 7                     373   1e-120   
ref|XP_009115052.1|  PREDICTED: serine carboxypeptidase-like 14         374   1e-120   
emb|CDX73832.1|  BnaA03g32150D                                          374   2e-120   
ref|XP_010429231.1|  PREDICTED: serine carboxypeptidase-like 11 i...    374   2e-120   
emb|CDX72978.1|  BnaC06g34260D                                          374   2e-120   
ref|XP_006294236.1|  hypothetical protein CARUB_v10023233mg             374   2e-120   
ref|XP_008236292.1|  PREDICTED: serine carboxypeptidase-like 13 i...    375   2e-120   
ref|XP_006303239.1|  hypothetical protein CARUB_v10012575mg             374   2e-120   
ref|XP_009343914.1|  PREDICTED: serine carboxypeptidase-like 7          375   2e-120   
ref|XP_004956082.1|  PREDICTED: serine carboxypeptidase-like 19-like    375   3e-120   
ref|XP_010471386.1|  PREDICTED: serine carboxypeptidase-like 2          374   3e-120   
ref|NP_001077947.1|  serine carboxypeptidase-like 13                    373   4e-120   
ref|XP_009343180.1|  PREDICTED: serine carboxypeptidase-like 1          374   5e-120   
ref|XP_003576949.1|  PREDICTED: serine carboxypeptidase-like 18 i...    375   5e-120   
emb|CDY02322.1|  BnaA09g25800D                                          373   5e-120   
ref|XP_009393004.1|  PREDICTED: serine carboxypeptidase-like 2          374   5e-120   
emb|CDY21592.1|  BnaC09g47000D                                          374   5e-120   
ref|XP_010464978.1|  PREDICTED: serine carboxypeptidase-like 14         372   8e-120   
ref|XP_007018464.1|  Serine carboxypeptidase-like 2, putative           372   8e-120   
ref|XP_011030307.1|  PREDICTED: serine carboxypeptidase-like 18 i...    374   9e-120   
ref|XP_002878649.1|  hypothetical protein ARALYDRAFT_481165             372   9e-120   
gb|EMT21721.1|  Serine carboxypeptidase-like 17                         374   1e-119   
ref|XP_006407354.1|  hypothetical protein EUTSA_v10022069mg             372   1e-119   
ref|XP_006350185.1|  PREDICTED: serine carboxypeptidase-like 18-l...    373   1e-119   
ref|XP_009133997.1|  PREDICTED: serine carboxypeptidase-like 10 i...    373   1e-119   
ref|XP_004299780.1|  PREDICTED: serine carboxypeptidase-like 18-like    374   1e-119   
ref|XP_010486651.1|  PREDICTED: serine carboxypeptidase-like 7 is...    373   1e-119   
gb|KFK39469.1|  hypothetical protein AALP_AA3G248300                    371   1e-119   
ref|XP_004288266.1|  PREDICTED: serine carboxypeptidase-like 18-like    374   2e-119   
ref|XP_008236290.1|  PREDICTED: serine carboxypeptidase-like 17 i...    373   2e-119   
ref|XP_009120828.1|  PREDICTED: serine carboxypeptidase-like 15 i...    370   2e-119   
gb|KFK44963.1|  hypothetical protein AALP_AA1G326300                    371   2e-119   
ref|XP_002522135.1|  serine carboxypeptidase, putative                  373   3e-119   
ref|XP_008669340.1|  PREDICTED: serine carboxypeptidase-like 7          373   3e-119   
ref|XP_006415429.1|  hypothetical protein EUTSA_v10007675mg             371   3e-119   
ref|XP_003577669.1|  PREDICTED: serine carboxypeptidase-like 19 i...    372   3e-119   
dbj|BAA96893.1|  serine carboxypeptidase                                373   4e-119   
ref|XP_006415270.1|  hypothetical protein EUTSA_v10009366mg             370   6e-119   
ref|XP_002525293.1|  serine carboxypeptidase, putative                  375   6e-119   
ref|XP_003633198.1|  PREDICTED: serine carboxypeptidase-like 13 i...    371   7e-119   
ref|XP_007201135.1|  hypothetical protein PRUPE_ppa016992mg             370   7e-119   
ref|XP_008452668.1|  PREDICTED: serine carboxypeptidase-like 7          371   8e-119   
ref|XP_010509547.1|  PREDICTED: serine carboxypeptidase-like 9 is...    370   8e-119   
ref|NP_001077945.1|  serine carboxypeptidase-like 11                    370   8e-119   
ref|XP_008236294.1|  PREDICTED: serine carboxypeptidase-like 14         371   9e-119   
ref|XP_009104820.1|  PREDICTED: serine carboxypeptidase-like 2 is...    370   9e-119   
emb|CDY38920.1|  BnaA04g13410D                                          371   9e-119   
ref|XP_010238599.1|  PREDICTED: serine carboxypeptidase-like 3          372   1e-118   
ref|XP_010417054.1|  PREDICTED: serine carboxypeptidase-like 9          370   1e-118   
ref|XP_004165534.1|  PREDICTED: serine carboxypeptidase-like 7-like     370   1e-118   
ref|XP_010505112.1|  PREDICTED: serine carboxypeptidase-like 9 is...    370   1e-118   
ref|XP_006301868.1|  hypothetical protein CARUB_v10022339mg             369   1e-118   
emb|CDP06914.1|  unnamed protein product                                371   2e-118   
ref|XP_010429235.1|  PREDICTED: serine carboxypeptidase-like 12 i...    369   2e-118   
gb|EAY93240.1|  hypothetical protein OsI_15047                          370   2e-118   
ref|XP_008452666.1|  PREDICTED: serine carboxypeptidase-like 7 is...    370   2e-118   
dbj|BAJ97596.1|  predicted protein                                      370   2e-118   
ref|XP_010028339.1|  PREDICTED: serine carboxypeptidase-like 18         370   2e-118   
ref|NP_001052165.1|  Os04g0176400                                       370   2e-118   
gb|ABG22467.1|  Serine carboxypeptidase family protein, expressed       370   2e-118   
ref|XP_006653168.1|  PREDICTED: serine carboxypeptidase-like 18-like    369   3e-118   
ref|XP_010505113.1|  PREDICTED: serine carboxypeptidase-like 9 is...    369   3e-118   
gb|EEC68084.1|  hypothetical protein OsI_35952                          370   3e-118   
emb|CAN74923.1|  hypothetical protein VITISV_038590                     371   3e-118   
ref|XP_002878648.1|  SCPL11                                             368   3e-118   
ref|XP_009104816.1|  PREDICTED: serine carboxypeptidase-like 2          369   3e-118   
ref|XP_010429238.1|  PREDICTED: serine carboxypeptidase-like 9          369   3e-118   
gb|ACF84666.1|  unknown                                                 371   3e-118   
ref|NP_001149249.1|  serine carboxypeptidase 1 precursor                371   3e-118   
ref|XP_008236287.1|  PREDICTED: serine carboxypeptidase-like 13         370   3e-118   
ref|XP_004289672.1|  PREDICTED: serine carboxypeptidase-like 18-like    370   4e-118   
ref|XP_009135217.1|  PREDICTED: serine carboxypeptidase-like 14         368   5e-118   
ref|XP_011045684.1|  PREDICTED: serine carboxypeptidase-like 18 i...    369   5e-118   
ref|XP_010065879.1|  PREDICTED: serine carboxypeptidase-like 13         369   6e-118   
dbj|BAB09519.1|  serine carboxypeptidase                                368   8e-118   
ref|NP_001067796.1|  Os11g0432900                                       369   9e-118   
ref|NP_174619.1|  serine carboxypeptidase-like 18                       367   1e-117   
ref|XP_011003871.1|  PREDICTED: serine carboxypeptidase-like 18 i...    368   1e-117   
ref|XP_009795830.1|  PREDICTED: serine carboxypeptidase-like 18 i...    368   1e-117   
ref|XP_007199819.1|  hypothetical protein PRUPE_ppa005264mg             368   1e-117   
ref|XP_006581277.1|  PREDICTED: serine carboxypeptidase-like 19-l...    368   1e-117   
ref|XP_010028346.1|  PREDICTED: serine carboxypeptidase-like 18         368   1e-117   
gb|KGN55283.1|  hypothetical protein Csa_4G643620                       368   2e-117   
ref|XP_006401830.1|  hypothetical protein EUTSA_v10015511mg             365   2e-117   
ref|XP_010472297.1|  PREDICTED: serine carboxypeptidase-like 11 i...    366   2e-117   
ref|XP_006294239.1|  hypothetical protein CARUB_v10023237mg             367   2e-117   
ref|XP_004151544.1|  PREDICTED: serine carboxypeptidase-like 7-like     367   2e-117   
ref|XP_010464977.1|  PREDICTED: serine carboxypeptidase-like 16         366   2e-117   
ref|XP_006662864.1|  PREDICTED: serine carboxypeptidase-like 18-like    367   2e-117   
ref|NP_566414.3|  serine carboxypeptidase-like 16                       366   2e-117   
ref|XP_010238598.1|  PREDICTED: serine carboxypeptidase-like 3 is...    368   2e-117   
ref|XP_006369794.1|  hypothetical protein POPTR_0001s31980g             367   3e-117   
ref|XP_008236291.1|  PREDICTED: serine carboxypeptidase-like 13 i...    367   4e-117   
ref|XP_002871383.1|  hypothetical protein ARALYDRAFT_487780             367   4e-117   
ref|XP_008452665.1|  PREDICTED: serine carboxypeptidase-like 7 is...    366   5e-117   
ref|XP_011030310.1|  PREDICTED: serine carboxypeptidase-like 18 i...    367   5e-117   
gb|KFK38433.1|  hypothetical protein AALP_AA3G112700                    363   6e-117   
ref|XP_010028345.1|  PREDICTED: serine carboxypeptidase-like 18         366   6e-117   
ref|XP_004513964.1|  PREDICTED: serine carboxypeptidase-like 18-l...    367   6e-117   
ref|XP_002884894.1|  hypothetical protein ARALYDRAFT_897434             365   7e-117   
gb|KFK41348.1|  hypothetical protein AALP_AA2G118800                    365   7e-117   
ref|XP_004960851.1|  PREDICTED: serine carboxypeptidase-like 19-like    366   8e-117   
emb|CDX68234.1|  BnaA07g22740D                                          365   8e-117   
ref|XP_002265154.3|  PREDICTED: serine carboxypeptidase-like 13         365   9e-117   
ref|XP_010028341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    365   1e-116   
ref|XP_010465794.1|  PREDICTED: serine carboxypeptidase-like 16         365   1e-116   
ref|XP_004296446.1|  PREDICTED: serine carboxypeptidase-like 18-like    366   1e-116   
ref|XP_003577668.1|  PREDICTED: serine carboxypeptidase-like 19         366   1e-116   
ref|NP_973516.2|  sinapoylglucose:malate sinapoyltransferase            364   1e-116   
ref|NP_001067860.1|  Os11g0460800                                       366   2e-116   
ref|XP_011100015.1|  PREDICTED: serine carboxypeptidase-like 7 is...    365   2e-116   
ref|XP_006663395.1|  PREDICTED: serine carboxypeptidase-like 18-like    365   2e-116   
ref|XP_010028347.1|  PREDICTED: serine carboxypeptidase-like 18         366   2e-116   
ref|XP_006663388.1|  PREDICTED: serine carboxypeptidase-like 18-like    365   2e-116   
ref|XP_006662125.1|  PREDICTED: serine carboxypeptidase-like 18-like    367   2e-116   
ref|XP_010474419.1|  PREDICTED: serine carboxypeptidase-like 9          363   3e-116   
ref|XP_011045683.1|  PREDICTED: serine carboxypeptidase-like 18 i...    365   3e-116   
ref|XP_002522137.1|  serine carboxypeptidase, putative                  365   3e-116   
ref|XP_010498752.1|  PREDICTED: serine carboxypeptidase-like 16         363   3e-116   
ref|XP_006403280.1|  hypothetical protein EUTSA_v10003211mg             363   3e-116   
gb|ACN30985.1|  unknown                                                 364   3e-116   
gb|EMS61531.1|  Serine carboxypeptidase-like 19                         365   3e-116   
ref|XP_002300184.2|  hypothetical protein POPTR_0001s31980g             363   4e-116   
gb|EMS55666.1|  Serine carboxypeptidase-like 19                         366   4e-116   
ref|XP_007201001.1|  hypothetical protein PRUPE_ppa005249mg             364   5e-116   
ref|XP_010939015.1|  PREDICTED: serine carboxypeptidase-like 18 i...    362   6e-116   
ref|XP_009395245.1|  PREDICTED: serine carboxypeptidase-like 12         363   6e-116   
ref|XP_011003870.1|  PREDICTED: serine carboxypeptidase-like 18 i...    364   6e-116   
ref|NP_187832.2|  serine carboxypeptidase-like 15                       362   6e-116   
ref|XP_006297707.1|  hypothetical protein CARUB_v10013735mg             362   7e-116   
ref|XP_006299292.1|  hypothetical protein CARUB_v10015451mg             362   7e-116   
gb|KHG24307.1|  Serine carboxypeptidase-like 18                         363   7e-116   
gb|EMT02053.1|  Serine carboxypeptidase-like 18                         365   9e-116   
ref|XP_006353974.1|  PREDICTED: serine carboxypeptidase-like 18-like    363   9e-116   
ref|XP_011088733.1|  PREDICTED: serine carboxypeptidase-like 7          364   1e-115   
ref|XP_006663397.1|  PREDICTED: serine carboxypeptidase-like 18-like    363   1e-115   
ref|XP_010030506.1|  PREDICTED: serine carboxypeptidase-like 7          364   1e-115   
ref|XP_010320341.1|  PREDICTED: serine carboxypeptidase-like 18 i...    362   1e-115   
ref|XP_008236280.1|  PREDICTED: serine carboxypeptidase-like 17 i...    363   1e-115   
ref|XP_010065873.1|  PREDICTED: serine carboxypeptidase-like 2          363   1e-115   
ref|XP_011100017.1|  PREDICTED: serine carboxypeptidase-like 13         362   2e-115   
ref|XP_004299781.1|  PREDICTED: serine carboxypeptidase-like 18-like    363   2e-115   
dbj|BAJ86585.1|  predicted protein                                      362   2e-115   
gb|KFK41349.1|  hypothetical protein AALP_AA2G118800                    362   2e-115   
dbj|BAJ96525.1|  predicted protein                                      362   2e-115   
ref|XP_010231763.1|  PREDICTED: serine carboxypeptidase-like 13 i...    362   2e-115   
ref|XP_003569208.1|  PREDICTED: serine carboxypeptidase-like 18         362   2e-115   
ref|XP_009139973.1|  PREDICTED: serine carboxypeptidase-like 13 i...    359   2e-115   
ref|XP_008661498.1|  PREDICTED: uncharacterized protein LOC100216...    362   2e-115   
ref|NP_001149348.1|  serine carboxypeptidase 1 precursor                363   3e-115   
ref|XP_009614132.1|  PREDICTED: serine carboxypeptidase-like 18 i...    362   3e-115   
ref|XP_010046975.1|  PREDICTED: serine carboxypeptidase-like 17         363   3e-115   
gb|EEC73813.1|  hypothetical protein OsI_08530                          362   3e-115   
ref|XP_010647903.1|  PREDICTED: serine carboxypeptidase-like 13         362   3e-115   
dbj|BAF99696.1|  1-O-acylglucose:anthocyanin-O-acyltransferase- l...    362   3e-115   
ref|XP_010046973.1|  PREDICTED: serine carboxypeptidase-like 18         362   4e-115   
ref|NP_001064014.1|  Os10g0101100                                       361   4e-115   
ref|XP_006651779.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    363   5e-115   
ref|XP_011100013.1|  PREDICTED: serine carboxypeptidase-like 13 i...    361   5e-115   
ref|XP_007200784.1|  hypothetical protein PRUPE_ppa024053mg             361   5e-115   
gb|EEE57601.1|  hypothetical protein OsJ_07974                          361   8e-115   
ref|XP_009120840.1|  PREDICTED: serine carboxypeptidase-like 15         359   1e-114   
ref|XP_002888921.1|  hypothetical protein ARALYDRAFT_476459             359   1e-114   
ref|XP_010235061.1|  PREDICTED: serine carboxypeptidase-like 10         361   1e-114   
ref|XP_010065871.1|  PREDICTED: serine carboxypeptidase-like 2 is...    360   1e-114   
ref|XP_004248778.1|  PREDICTED: serine carboxypeptidase-like 18         360   2e-114   
gb|AAF64227.1|AF248647_1  glucose acyltransferase                       360   2e-114   
ref|XP_004248779.1|  PREDICTED: serine carboxypeptidase-like 18         359   2e-114   
emb|CDX69895.1|  BnaA10g22440D                                          361   3e-114   
gb|KCW63569.1|  hypothetical protein EUGRSUZ_G01197                     359   4e-114   
ref|XP_009139930.1|  PREDICTED: serine carboxypeptidase-like 7 is...    360   4e-114   
ref|NP_001137115.1|  serine carboxypeptidase 1 precursor                360   5e-114   
emb|CBI22421.3|  unnamed protein product                                362   6e-114   
ref|XP_010065898.1|  PREDICTED: serine carboxypeptidase-like 18         359   6e-114   
ref|XP_006353975.1|  PREDICTED: serine carboxypeptidase-like 18-like    358   6e-114   
ref|NP_850035.1|  sinapoylglucose:malate sinapoyltransferase            358   6e-114   
ref|XP_003573745.1|  PREDICTED: serine carboxypeptidase-like 17 i...    358   7e-114   
ref|XP_010048652.1|  PREDICTED: serine carboxypeptidase-like 18         359   7e-114   
ref|XP_010106919.1|  Serine carboxypeptidase-like 18                    358   7e-114   
ref|XP_010065869.1|  PREDICTED: serine carboxypeptidase-like 2 is...    358   8e-114   
ref|NP_001130406.1|  uncharacterized protein LOC100191502 precursor     359   8e-114   
ref|XP_010939012.1|  PREDICTED: serine carboxypeptidase-like 17 i...    358   1e-113   
ref|NP_850036.1|  sinapoylglucose:malate sinapoyltransferase            356   1e-113   
ref|XP_010108032.1|  Serine carboxypeptidase-like 7                     367   1e-113   
ref|XP_009105992.1|  PREDICTED: serine carboxypeptidase-like 2 is...    357   2e-113   
gb|AAD01264.1|  glucose acyltransferase                                 357   2e-113   
gb|KFK38434.1|  hypothetical protein AALP_AA3G112800                    355   2e-113   
gb|KDP44531.1|  hypothetical protein JCGZ_16364                         360   2e-113   
ref|XP_008236286.1|  PREDICTED: serine carboxypeptidase-like 2 is...    357   2e-113   
ref|XP_002266354.2|  PREDICTED: serine carboxypeptidase-like 18         357   4e-113   
ref|XP_009612206.1|  PREDICTED: serine carboxypeptidase-like 18 i...    353   4e-113   
gb|KFK25893.1|  hypothetical protein AALP_AA8G176200                    353   4e-113   
ref|XP_010472301.1|  PREDICTED: serine carboxypeptidase-like 9 is...    357   4e-113   
ref|XP_003572138.1|  PREDICTED: serine carboxypeptidase-like 10         356   5e-113   
ref|XP_008338878.1|  PREDICTED: serine carboxypeptidase-like 1          356   6e-113   
ref|XP_007199854.1|  hypothetical protein PRUPE_ppa005665mg             355   7e-113   
ref|XP_003571685.1|  PREDICTED: serine carboxypeptidase-like 17         355   8e-113   
ref|XP_004299782.1|  PREDICTED: serine carboxypeptidase-like 18-like    356   8e-113   
emb|CDY50563.1|  BnaA01g30770D                                          367   1e-112   



>ref|XP_006343160.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Solanum 
tuberosum]
Length=480

 Score =   464 bits (1194),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 226/441 (51%), Positives = 306/441 (69%), Gaps = 17/441 (4%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V ++PG    G LPF+L+TGYIGVGE EEVQ+FYYFVKS+++P TDP I W  GGPGC
Sbjct  42    SSVKYLPGF---GFLPFQLDTGYIGVGEGEEVQLFYYFVKSESDPETDPLILWITGGPGC  98

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+L  +  E GP+  + ++Y G +P L LN H+WTKV++++F+DLP + GF+YATT+KAN
Sbjct  99    SSLEGLTMEFGPLHFDDMEYNGSLPTLSLNTHSWTKVASIIFLDLPVKTGFSYATTEKAN  158

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              ++N++  E AY+F++KW  +H ++L NP Y+GGDS+SG TVPI+ + I++GN+A TKP+
Sbjct  159   QTNNLQTGEHAYQFLQKWLANHSKFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPM  218

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             INLKGYILGNP +   +   YRIP A+GM L+  DLYK+L  NC G Y + +  N  C+ 
Sbjct  219   INLKGYILGNPLTINPDELNYRIPFAHGMGLLSDDLYKALVSNCGGEYQNIAPNNSACSN  278

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSLS------QRPVLPPGEFCWQM  607
              +  F++L  GIN  HILE  C  V      S G R SL       +  ++ PG  C + 
Sbjct  279   SVQTFNKLCEGINKEHILEPLCDSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLED  338

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRA  427
              W   S  WAN+ +VQ+ALHVRKGTI  W  C   D+ +T ++ + +PYHANL+ +G R+
Sbjct  339   -WRKLSVHWANDDSVQEALHVRKGTIQNWTRCR-GDLSFTYNVYNVVPYHANLSAKGYRS  396

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             LIYSGDHDL +P +STEAWI SLNYS  D WR W   +G +AG+T+SYSNN+TFAT+KGS
Sbjct  397   LIYSGDHDLTIPFISTEAWIGSLNYSVTDDWRKWIV-NGQVAGYTKSYSNNLTFATVKGS  455

Query  246   GHIAPFFSAYECLIMFERWIS  184
             GH+AP +   ECL M  +WIS
Sbjct  456   GHVAPLWKPLECLTMLTKWIS  476



>ref|XP_009601001.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=464

 Score =   463 bits (1192),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 304/446 (68%), Gaps = 18/446 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A   S V  +PG  + GPLPFELETGYIGV ++E+ Q+FYYF+KS++NP +DP + W  
Sbjct  22    LAIAASPVKLLPG--FKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWIT  79

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCSAL  +I EIGPI+ E V+Y G +P + LNP++WTKV++++F+DLP   GF+YA 
Sbjct  80    GGPGCSALSGLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYAR  139

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A  SSN++ S+QAYEF+ +WF DHPE+L NP YV GDS+SG+ VPIIT++I   NE 
Sbjct  140   TPAALQSSNLQASDQAYEFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEM  199

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G KP ++LKGY+LGNP S+      Y IP AYGM LI  +LY+SL++NCKG Y +   SN
Sbjct  200   GIKPFMDLKGYLLGNP-STFKGEKNYEIPFAYGMGLISDELYESLKRNCKGVYQNTDPSN  258

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQR------PVLPPGE  622
               C QD+  F +L + IN  HILE  C           G +RSL+ +      P   P  
Sbjct  259   TQCLQDVQTFQELLKRINNPHILEPNCQFASPKPHLLFGQKRSLNVKFHQLNNPQQLPAL  318

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
              C +  WY+ S  WA++  V++ALH+RKGTIG+W  C    + Y   +  ++PYHANL+ 
Sbjct  319   KC-RNDWYILSSHWADDSQVREALHIRKGTIGKWVRC--ASLQYQKTVMSSIPYHANLSA  375

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD +V  +ST+AWI SLNYS VD WRPW   D  +AG+TRSYSN MTF 
Sbjct  376   KGYRSLIYSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIV-DNQVAGYTRSYSNRMTFV  434

Query  261   TLKGSGHIAPFFSAYECLIMFERWIS  184
             T+KG+GH AP +   ECL M +RW+S
Sbjct  435   TVKGAGHTAPEYKPRECLAMLKRWMS  460



>ref|XP_009768014.1| PREDICTED: serine carboxypeptidase-like 17 [Nicotiana sylvestris]
Length=477

 Score =   464 bits (1193),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 234/466 (50%), Positives = 325/466 (70%), Gaps = 27/466 (6%)
 Frame = -2

Query  1518  LYCSSMVSVV--MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQT  1345
             L+C  ++++   +   GS V ++PG  ++GPLPFELETGYIGVGE +EVQ++YYFVKSQ+
Sbjct  18    LFCFLVLAIFPQLVVAGSPVKYLPG--FEGPLPFELETGYIGVGEADEVQLYYYFVKSQS  75

Query  1344  NPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFI  1165
             NP  DP I W  GGPGCS L A+  E+GP+  +  +Y G +P L  NP  +TKV+N++F+
Sbjct  76    NPKIDPLILWFTGGPGCSTLNAVALELGPMMFDDREYNGSLPTLSSNPFAYTKVANIIFV  135

Query  1164  DLPARAGFTYATTKKANVSSNMKESEQAYEFMRKW-FNDHPEYLTNPFYVGGDSFSGLTV  988
             D P   GF+YATT K+N S+N++  + AY+F+RKW   +HPEY+ NPFYVGGDS+SG+T+
Sbjct  136   DFPVGTGFSYATTVKSNHSNNLQAGDHAYQFLRKWLLTEHPEYINNPFYVGGDSYSGITL  195

Query  987   PIITKMIADGN--------EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPT  832
             P++T++I+           +AG KP I+LKGYILGNP + + +   Y+IP A+GM LI  
Sbjct  196   PVVTQVISLCKYFFWGQWIDAGIKPWIDLKGYILGNPVTIIPDQDNYKIPFAHGMGLISD  255

Query  831   DLYKSLEKNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRR  658
             +LYKSL+ NC G Y+H   SN LC++DM  F+ L +GI   HILE  C +   GS   RR
Sbjct  256   ELYKSLKGNCGGEYNHINPSNTLCSKDMRTFNWLLKGIVAAHILEPNCDQSLYGS---RR  312

Query  657   SLSQRPVL------PPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI  496
             SL+++  L       PG  C    W   S++WAN+  V++ALHVRKGTIG W  C  +++
Sbjct  313   SLARKLPLELNTPAKPGVKCLGD-WLHLSEIWANDENVREALHVRKGTIGAWEKCR-SNL  370

Query  495   GYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAH  316
              +T ++ + + YHA L+T+GL++LIYSGDHD+I P +ST+AWI SLNYS VD WRPW   
Sbjct  371   PFTMNVNNTISYHAYLSTKGLKSLIYSGDHDMITPFISTQAWIKSLNYSIVDDWRPWIV-  429

Query  315   DGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +G +AG+TRS+SN MTFATLKG+GH AP ++  ECL M +RW+S +
Sbjct  430   NGQVAGYTRSFSNQMTFATLKGAGHTAPNWAPAECLAMLKRWLSNK  475



>ref|XP_004252000.2| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
 ref|XP_010314007.1| PREDICTED: serine carboxypeptidase-like 7 [Solanum lycopersicum]
Length=499

 Score =   464 bits (1195),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 307/444 (69%), Gaps = 17/444 (4%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V ++PG    G LPF+L+TGYIGVG  EEVQ+FYYFVKS+++P TDP I W  GGPGC
Sbjct  61    SSVKYLPGF---GFLPFQLDTGYIGVGVGEEVQLFYYFVKSESDPETDPLILWITGGPGC  117

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+L  +  E GP+  + ++Y G +P L LN H+WTKV++++F+DLP + GF+YATT+KAN
Sbjct  118   SSLEGLTMEFGPLHFDDMEYNGSLPTLSLNTHSWTKVASIIFLDLPVKTGFSYATTEKAN  177

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + N++  E AY+F++KW  +H E+L NP Y+GGDS+SG TVPI+ + I++GN+A TKP+
Sbjct  178   QTDNLQTGEHAYQFLQKWLANHSEFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPM  237

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             INLKGYILGNP +   +   YRIP A GM L+  DLYK+L  NCKG Y + +  N  C+ 
Sbjct  238   INLKGYILGNPLTINPDELNYRIPFARGMGLLSDDLYKALVSNCKGEYQNIATNNSACSN  297

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSLS------QRPVLPPGEFCWQM  607
             ++  F++L  GIN  HILE  C  V      S G R SL       +  ++ PG  C + 
Sbjct  298   NVRTFNKLCEGINKEHILEPLCDSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLED  357

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRA  427
              W      WAN+ +VQ+ALHVRKGTI  W  C   D+ +T ++ + +PYHANL+ +G R+
Sbjct  358   -WRKLCVHWANDDSVQEALHVRKGTIENWTRCR-GDLSFTYNVYNVVPYHANLSAKGYRS  415

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             LIYSGDHDL +P +STEAWI SLNYS +D WR W   +G +AG+T++YSNN+TFAT+KGS
Sbjct  416   LIYSGDHDLTIPFISTEAWIESLNYSVIDDWRKWIV-NGQVAGYTKTYSNNLTFATVKGS  474

Query  246   GHIAPFFSAYECLIMFERWISGQK  175
             GH+AP +   ECL M  +WIS ++
Sbjct  475   GHVAPLWKPLECLTMLTKWISSKQ  498



>ref|XP_010320198.1| PREDICTED: serine carboxypeptidase-like 17 [Solanum lycopersicum]
Length=476

 Score =   463 bits (1191),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/476 (50%), Positives = 315/476 (66%), Gaps = 35/476 (7%)
 Frame = -2

Query  1521  QLYCSSMVSVV--------------MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENE  1384
             Q+ C ++ SV+              + A GS V  +PG Q  GPLPFELETGYIGVG+++
Sbjct  6     QMLCCNLFSVIFLFLLAEIIHFPECVKAAGSPVKFLPGFQ--GPLPFELETGYIGVGDSD  63

Query  1383  EVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKY--------TG  1228
             +VQ+FYYFVKS++NP +DP I W  GGPGCSAL  ++ EIGPI+ E V+Y         G
Sbjct  64    DVQLFYYFVKSESNPKSDPLILWLTGGPGCSALSGLLFEIGPITFEPVEYGDFKPAEYNG  123

Query  1227  GMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDH  1048
               P L LNPHTWTKV++ +F+DLP   GF+YA T  A  S ++  S+ AY+F+ KWFNDH
Sbjct  124   SFPSLVLNPHTWTKVASFIFLDLPVCTGFSYARTSVARQSDDLLASDHAYQFLHKWFNDH  183

Query  1047  PEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYR  868
             PE+  NPFYV GDS++G+ +PII+++IA+GNE G +P I+LKGY+LGNPA + +  + Y+
Sbjct  184   PEFFRNPFYVAGDSYAGIGIPIISQLIANGNEKGLEPFIDLKGYLLGNPA-TFHGEYNYK  242

Query  867   IPAAYGMNLIPTDLYKSLEKNCKGNY--DHFSNELCAQDMGKFDQLTRGINPTHILEDFC  694
             I  A+G+ LI  +L++SL++NCKG Y   H SN  C  DM  +DQ+  GI   HILE  C
Sbjct  243   ISYAHGVGLISDELFESLKQNCKGEYFDIHPSNTKCWNDMQTYDQMLGGITNAHILEPKC  302

Query  693   IRVGTGSD----GLRRSLSQRPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIG  526
                G+       G RRSL +   L  G    +  W   S  WA++  V++ALHVR+G+IG
Sbjct  303   -EFGSPRPQKWIGQRRSLDEMLYL--GRLRCRFDWEKMSYHWADDDKVREALHVRRGSIG  359

Query  525   RWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYST  346
             +W  C    + Y   + +++PYHANL+ +G R+LIYSGDHD ++P  STEAWI SLNYS 
Sbjct  360   KWKRCAGDALPYQKIIGNSIPYHANLSVKGYRSLIYSGDHDTMIPYTSTEAWIRSLNYSI  419

Query  345   VDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             VD WRPW   DG +AG+TR+YSN MTFAT+KG GH AP +   ECL M  RW+S Q
Sbjct  420   VDDWRPWIV-DGQVAGYTRTYSNKMTFATVKGGGHTAPEYKPVECLAMLRRWLSYQ  474



>ref|XP_009600999.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=465

 Score =   459 bits (1180),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 229/447 (51%), Positives = 304/447 (68%), Gaps = 19/447 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A   S V  +PG  + GPLPFELETGYIGV ++E+ Q+FYYF+KS++NP +DP + W  
Sbjct  22    LAIAASPVKLLPG--FKGPLPFELETGYIGVDDSEDTQLFYYFIKSESNPESDPILLWIT  79

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCSAL  +I EIGPI+ E V+Y G +P + LNP++WTKV++++F+DLP   GF+YA 
Sbjct  80    GGPGCSALSGLIYEIGPITFEPVEYNGSLPTMILNPYSWTKVASIIFLDLPVGTGFSYAR  139

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A  SSN++ S+QAYEF+ +WF DHPE+L NP YV GDS+SG+ VPIIT++I   NE 
Sbjct  140   TPAALQSSNLQASDQAYEFLYRWFLDHPEFLKNPLYVAGDSYSGMLVPIITQIIETKNEM  199

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G KP ++LKGY+LGNP S+      Y IP AYGM LI  +LY+SL++NCKG Y +   SN
Sbjct  200   GIKPFMDLKGYLLGNP-STFKGEKNYEIPFAYGMGLISDELYESLKRNCKGVYQNTDPSN  258

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQR------PVLPPGE  622
               C QD+  F +L + IN  HILE  C           G +RSL+ +      P   P  
Sbjct  259   TQCLQDVQTFQELLKRINNPHILEPNCQFASPKPHLLFGQKRSLNVKFHQLNNPQQLPAL  318

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
              C +  WY+ S  WA++  V++ALH+RKGTIG+W  C    + Y   +  ++PYHANL+ 
Sbjct  319   KC-RNDWYILSSHWADDSQVREALHIRKGTIGKWVRC--ASLQYQKTVMSSIPYHANLSA  375

Query  441   RGLRALIY-SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
             +G R+LIY SGDHD +V  +ST+AWI SLNYS VD WRPW   D  +AG+TRSYSN MTF
Sbjct  376   KGYRSLIYSSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIV-DNQVAGYTRSYSNRMTF  434

Query  264   ATLKGSGHIAPFFSAYECLIMFERWIS  184
              T+KG+GH AP +   ECL M +RW+S
Sbjct  435   VTVKGAGHTAPEYKPRECLAMLKRWMS  461



>ref|XP_010321496.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Solanum 
lycopersicum]
Length=454

 Score =   456 bits (1174),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 224/439 (51%), Positives = 311/439 (71%), Gaps = 17/439 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V ++PG  ++GPLPF+LETGYIGVGE  EVQ+FYYF+KSQ+N   DP ++W  GGPG
Sbjct  21    GSPVKYLPG--FEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNYKIDPLVYWFTGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS L AI+ E+GPI++++  Y G +P L LNP+ +TKV+NM+F+DLP  +GF+YATT+KA
Sbjct  79    CSPLSAILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGFSYATTQKA  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               S +++ ++ AYEF+RKW  +H EYL NPFYVGGDS+SG+TVPI+T++I++GN+ G KP
Sbjct  139   IYSDDLQAADHAYEFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFSNELCA  763
              INLKGYI+GNP +S +  ++Y++P A+GM LIP +LY+S   NC  +Y  +  +N+LC+
Sbjct  199   WINLKGYIIGNPVTSTDPDYKYKVPFAHGMGLIPNELYESFVTNCGRDYSPNDSTNQLCS  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP------GEFCWQMFW  601
             +D+  FD L + I   HILE  C  V   S   RRSL+             G  C +  W
Sbjct  259   RDIRTFDWLIKDIYQYHILESPCELVSHDS---RRSLAGNVQKLKNLSSFFGMKCREE-W  314

Query  600   YLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALI  421
             +  S +WAN+  VQDALHVRK ++  W  C  +++ +   + +++ YHANL+ +G R+LI
Sbjct  315   HELSVIWANDKVVQDALHVRKTSMA-WERCR-SNLSFGLIINNSVSYHANLSRKGFRSLI  372

Query  420   YSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGH  241
             YSGDHD++VP  ST+ WI SL YS +D W+PW   DG +AG+TRSYSN MTFAT+KG GH
Sbjct  373   YSGDHDMVVPFSSTQLWIKSLKYSIIDDWKPWVV-DGQVAGYTRSYSNQMTFATVKGGGH  431

Query  240   IAPFFSAYECLIMFERWIS  184
              AP +   ECL M +RW+S
Sbjct  432   TAPEWKRVECLEMLKRWLS  450



>ref|XP_009764359.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Nicotiana sylvestris]
Length=461

 Score =   456 bits (1173),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 231/446 (52%), Positives = 303/446 (68%), Gaps = 21/446 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A   S V  +PG  + GPLPFELETGYIGVG++E+VQ+F    KS++NP +DP + W  
Sbjct  22    LAIAASPVKLLPG--FKGPLPFELETGYIGVGDSEDVQLF---XKSESNPESDPLLLWIT  76

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCSAL  +I EIGPI+ E V+Y G +P +KLNP++WTKV++++F+DLP   GF+YA 
Sbjct  77    GGPGCSALSGLIYEIGPITFEPVEYNGSLPTMKLNPYSWTKVASIIFLDLPVGTGFSYAR  136

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A  SS+++ S+QAYEF+ KWF DHPE+L NP YVGGDS+SG+ VPIIT++IA  NE 
Sbjct  137   TPTALQSSDLQASDQAYEFLYKWFLDHPEFLKNPLYVGGDSYSGMVVPIITQIIATKNEM  196

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G KP ++L+GY+LGNP S+      Y IP AYGM LI  +LY+SL +NCKG Y +   SN
Sbjct  197   GIKPFVDLQGYLLGNP-STFKGEKNYEIPFAYGMGLISDELYESLTRNCKGEYQNTDPSN  255

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQR------PVLPPGE  622
               C QD+  F +L + IN  HILE  C           G RRSL+ +      P   P  
Sbjct  256   TQCLQDVHTFQELLKRINNPHILEPKCQFASPKPHLLFGQRRSLNVKFHQLNNPQQLPAL  315

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
              C +  WY  S  WA++  V++ALH+RKGTIG+W  C    + Y   +  ++PYHANL+ 
Sbjct  316   KC-RNDWYKLSSHWADDGQVREALHIRKGTIGKWVRC--ASLQYQKTIMSSIPYHANLSA  372

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD +V  +ST+AWI SLNYS VD WRPW   D  +AG+TRSYSN MTFA
Sbjct  373   KGYRSLIYSGDHDKVVTFLSTQAWIKSLNYSIVDDWRPWIV-DNQVAGYTRSYSNRMTFA  431

Query  261   TLKGSGHIAPFFSAYECLIMFERWIS  184
             T+KG+GH AP +   ECL M +R +S
Sbjct  432   TVKGAGHTAPEYKPRECLAMLKRLMS  457



>ref|XP_004292764.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   453 bits (1165),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 223/450 (50%), Positives = 304/450 (68%), Gaps = 21/450 (5%)
 Frame = -2

Query  1482  ARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGG  1303
             +  S V  +PGLQ  GPLPFELETGY+GVGE+EE+Q+FYYFVKS+ NP  DP + W  GG
Sbjct  28    SHSSLVKFLPGLQ--GPLPFELETGYVGVGESEELQLFYYFVKSERNPEKDPLMLWLTGG  85

Query  1302  PGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTK  1123
             PGCSA+ A+  EIGP++ +V +Y G +P L LNPH+WTKV +++FID P   GF+YA T 
Sbjct  86    PGCSAVSALFFEIGPLNFKVEQYNGSLPTLVLNPHSWTKVCSIIFIDSPVGTGFSYARTS  145

Query  1122  KANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGT  943
              A+   ++++ + A +F+R+W  DHP +++NPFY+GGDS+SG+ VP++ + I++GNEAG 
Sbjct  146   FASQPGDLEQVQHALQFLRRWLVDHPSFMSNPFYIGGDSYSGIPVPVLAEQISNGNEAGV  205

Query  942   KPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNEL  769
             KP+INL+GYILGNP +         IP A+GM LI  +LY+SL  +C+G++     SN  
Sbjct  206   KPIINLQGYILGNPVTVRQYEVNSEIPFAHGMGLISDELYESLTTSCRGDFQDVDPSNVE  265

Query  768   CAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVL------------PPG  625
             C +++  FD+ T  IN  HILE  C   G  S  L+  L +R  L            P  
Sbjct  266   CVKNVQAFDECTSHINFAHILERHCD--GLISPKLQHMLGKRRYLSDNNGLHHHSRSPLP  323

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT-DALPYHANL  448
              F  + + YL S  WAN+  V+  LH+RKG+IG W  C+Y D+ Y AD+  ++L YH NL
Sbjct  324   TFGCRTYGYLLSQYWANDPVVRKVLHIRKGSIGNWQRCDY-DMPYVADLLGNSLQYHVNL  382

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G  +LIYSGDHD++VP + T+AWI SLNYS VD WRPW  H   IAG+TR+Y+N MT
Sbjct  383   SAKGYPSLIYSGDHDMLVPFLGTQAWIRSLNYSIVDDWRPWFVHSQ-IAGYTRTYANRMT  441

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             FAT+KG+GH AP +   ECL MF RWISG+
Sbjct  442   FATVKGAGHTAPEYKREECLNMFTRWISGE  471



>ref|XP_010321495.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=457

 Score =   451 bits (1161),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 224/442 (51%), Positives = 311/442 (70%), Gaps = 20/442 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V ++PG  ++GPLPF+LETGYIGVGE  EVQ+FYYF+KSQ+N   DP ++W  GGPG
Sbjct  21    GSPVKYLPG--FEGPLPFQLETGYIGVGEANEVQLFYYFIKSQSNYKIDPLVYWFTGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS L AI+ E+GPI++++  Y G +P L LNP+ +TKV+NM+F+DLP  +GF+YATT+KA
Sbjct  79    CSPLSAILYELGPITVDIRAYNGSLPTLSLNPYAYTKVANMIFVDLPVGSGFSYATTQKA  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               S +++ ++ AYEF+RKW  +H EYL NPFYVGGDS+SG+TVPI+T++I++GN+ G KP
Sbjct  139   IYSDDLQAADHAYEFIRKWLIEHKEYLNNPFYVGGDSYSGITVPIVTQVISNGNDMGIKP  198

Query  936   LINLK---GYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFSNE  772
              INLK   GYI+GNP +S +  ++Y++P A+GM LIP +LY+S   NC  +Y  +  +N+
Sbjct  199   WINLKNLQGYIIGNPVTSTDPDYKYKVPFAHGMGLIPNELYESFVTNCGRDYSPNDSTNQ  258

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP------GEFCWQ  610
             LC++D+  FD L + I   HILE  C  V   S   RRSL+             G  C +
Sbjct  259   LCSRDIRTFDWLIKDIYQYHILESPCELVSHDS---RRSLAGNVQKLKNLSSFFGMKCRE  315

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
               W+  S +WAN+  VQDALHVRK ++  W  C  +++ +   + +++ YHANL+ +G R
Sbjct  316   E-WHELSVIWANDKVVQDALHVRKTSMA-WERCR-SNLSFGLIINNSVSYHANLSRKGFR  372

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LIYSGDHD++VP  ST+ WI SL YS +D W+PW   DG +AG+TRSYSN MTFAT+KG
Sbjct  373   SLIYSGDHDMVVPFSSTQLWIKSLKYSIIDDWKPWVV-DGQVAGYTRSYSNQMTFATVKG  431

Query  249   SGHIAPFFSAYECLIMFERWIS  184
              GH AP +   ECL M +RW+S
Sbjct  432   GGHTAPEWKRVECLEMLKRWLS  453



>ref|XP_004238557.1| PREDICTED: uncharacterized protein LOC101252581 [Solanum lycopersicum]
Length=921

 Score =   463 bits (1192),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 233/456 (51%), Positives = 316/456 (69%), Gaps = 13/456 (3%)
 Frame = -2

Query  1521  QLYCSSMVSVVMA---ARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKS  1351
             QLY    + VV+A   A  ++V  +PG  ++GPLPF+LETGY+GVG++E VQ+FYYF++S
Sbjct  8     QLYYYLFLLVVVADHAAASTQVKFLPG--FEGPLPFQLETGYVGVGDSEIVQLFYYFIES  65

Query  1350  QTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNML  1171
             +++P +DP + W  GGPGCSAL  +I EIGPI+ E V+Y G  PK+ LNP++WTKVS+++
Sbjct  66    ESDPDSDPLMLWITGGPGCSALSGLIYEIGPITFEPVEYNGSFPKMILNPYSWTKVSSII  125

Query  1170  FIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLT  991
             F+DL    GF+YATT  A  SS+++ S+ AY+F+RKWF DHPE+L NPFYVGGDS+SG+ 
Sbjct  126   FLDLSVGTGFSYATTLAARQSSDLQASDHAYQFLRKWFVDHPEFLKNPFYVGGDSYSGIV  185

Query  990   VPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
             VPIIT++IA  NE   +  INLKGY+LGNP +  ++  +Y+IP AYGM LI  +LY+SL+
Sbjct  186   VPIITQIIAIKNEMEVELFINLKGYLLGNPVTFKDHEDDYKIPFAYGMGLISEELYESLK  245

Query  810   KNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQ  646
              +CKG Y +   SN  C QD+  F++L +GI   HILE  C R         G RRSL Q
Sbjct  246   SSCKGEYFNINASNAPCLQDVQTFNELLKGIYKAHILEPKCKRFSPRPHQLFGERRSLHQ  305

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                LP    C +  WY  S  WA++  V+DAL++RK + G+W  C  +++ Y   +  ++
Sbjct  306   LNNLPGLIKCREN-WYKHSYHWADDDQVRDALNIRKRSTGKWKRCE-SNLQYNRMVMSSI  363

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH NL+++G R+LIYSGDHD+IV   ST+AWI SLNYS VD WR W   D  +A +TRS
Sbjct  364   PYHKNLSSKGYRSLIYSGDHDMIVTFPSTQAWIKSLNYSIVDDWRAWTV-DNQVARYTRS  422

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             YSN MTFAT+KG+GH AP +   ECL M  RW+S Q
Sbjct  423   YSNQMTFATVKGAGHTAPEYKPRECLAMLTRWMSYQ  458


 Score =   463 bits (1191),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 237/453 (52%), Positives = 311/453 (69%), Gaps = 12/453 (3%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L+   +V+ + AA GS V  +PG Q  G LPFELETGY+GVG++E VQ+FYYF++S++ P
Sbjct  473   LFLFLVVAELAAATGSTVKFLPGFQ--GQLPFELETGYVGVGDSENVQLFYYFIESESEP  530

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
              +DP + W  GGPGCSAL  ++ E+GPI+ E V+Y G  P + LNP++WTKVS+++F+DL
Sbjct  531   DSDPLMLWITGGPGCSALSGLVYEMGPITFEAVEYNGSFPTMILNPYSWTKVSSIIFLDL  590

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+YATT  A  SS+++ SE AY+F+RKWF DH E+L NPFYVGGDS SG+ VP+I
Sbjct  591   PVGTGFSYATTPAALQSSDLQASEHAYQFLRKWFVDHQEFLENPFYVGGDSCSGMIVPVI  650

Query  978   TKMIADGNEAGTKPL-INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             T+++A  NE     L INLKGY+LGNP ++      YRIP AYGM LI  +LY+SL+ NC
Sbjct  651   TQIVAIKNEIMEVELFINLKGYLLGNP-TTFEGETNYRIPFAYGMGLISDELYESLKSNC  709

Query  801   KGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPV  637
             KG Y +   SN  C QD+  F++L +GIN  HILE  C R         G RRSL Q   
Sbjct  710   KGEYFNMNASNVPCLQDVQTFNELLKGINNPHILEPKCKRFSPRPHTLFGERRSLHQLNN  769

Query  636   LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYH  457
             L     C +  WY  S  WA++  V+DAL++RKGTIG+W  C  +++ Y   +T++LPYH
Sbjct  770   LRGLIKCREN-WYKHSYHWADDDQVRDALNIRKGTIGKWERCA-SNLQYQMMITNSLPYH  827

Query  456   ANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSN  277
              NL+ +G R+LIYSGDHD +V   ST+AWI SLNYS VD WR W   D  +AG+TRSYSN
Sbjct  828   KNLSNKGYRSLIYSGDHDKLVTFQSTQAWIKSLNYSVVDDWRAWTV-DNEVAGYTRSYSN  886

Query  276   NMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
              MTFAT+KG+GH AP +   ECL M  RW+S Q
Sbjct  887   QMTFATVKGAGHTAPEYKPRECLAMLTRWMSHQ  919



>ref|XP_009771128.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Nicotiana 
sylvestris]
Length=467

 Score =   446 bits (1147),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 220/441 (50%), Positives = 295/441 (67%), Gaps = 9/441 (2%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V+ +PG  ++GPLPF LETGYIGVGE EEVQ+FYYF+KS++ PT DP + W  G
Sbjct  29    AASHSTVEFLPG--FEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSG  86

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+  A++ +IGP+  E  +Y G +PKL LNP++WTKV+N++F+D P  +GF+YATT
Sbjct  87    GPGCSSFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATT  146

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                  S++++     Y+F+RKW   H E++ NP Y+GGDS+SG+TVP+IT++I++G EAG
Sbjct  147   STTFKSTDLQACHHIYQFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAG  206

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG---NYDHFSN  775
              KP INLKGYILGNP S+    + Y +P A+GM LI  +LY+ LEKNC G    Y   SN
Sbjct  207   HKPSINLKGYILGNP-STFPLQYNYWVPYAHGMGLISDELYQLLEKNCNGENLQYADPSN  265

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYL  595
              LC Q    F+QL  GIN  HILE  C          R    +R +        ++  + 
Sbjct  266   VLCYQHYQTFEQLISGINKPHILEPSCGSDAESKRSFRLFGKRRSLYENYSTKCRVEVHR  325

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG--YTADMTDALPYHANLTTRGLRALI  421
              S  WAN+  VQ+AL+VRKG I RW  C  + +   YT    D++PYH  L+ +  R+LI
Sbjct  326   LSTYWANDPRVQEALNVRKGAITRWTRCRESIVNKTYTITFQDSIPYHVELSKKLYRSLI  385

Query  420   YSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGH  241
             YSGDHD+ +P  ST+ WI SLNYS VD WRPW + DG +AG+TRSYSN MTFAT+KG+GH
Sbjct  386   YSGDHDMGIPFQSTQFWIKSLNYSIVDEWRPW-SFDGQVAGYTRSYSNQMTFATVKGAGH  444

Query  240   IAPFFSAYECLIMFERWISGQ  178
             +AP +   EC  MF+RW+S +
Sbjct  445   VAPEYKPKECFTMFQRWLSHE  465



>ref|XP_002283413.1| PREDICTED: serine carboxypeptidase-like 2 [Vitis vinifera]
Length=469

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 297/455 (65%), Gaps = 21/455 (5%)
 Frame = -2

Query  1500  VSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFI  1321
             VS V+AA  S V  +PG  ++GPLPFELETGY+GVGE+EEVQ+FYYFVKS+ NPT DP +
Sbjct  20    VSSVVAASHSPVKFLPG--FEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLL  77

Query  1320  FWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGF  1141
              W  GGPGCSA  A+  EIGP+  E V Y G +P L+LNPH+WT+VSN++F+D P   GF
Sbjct  78    LWLTGGPGCSAFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGF  137

Query  1140  TYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIAD  961
             +YATT +A+ S + + + QA+EF+RKW  DHPE+L+NP YVGGDS+SG+TVP++ + I++
Sbjct  138   SYATTSRASHSGDFQATHQAHEFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISN  197

Query  960   GNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--D  787
             GNE  T+P INLKGY+LGNP +        +   A+GM LI  +LY+SL+ +C   Y   
Sbjct  198   GNEDDTEPFINLKGYLLGNPVTEQGTETTAQFRFAHGMALISDELYESLKTSCGDEYPFK  257

Query  786   HFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGS--------DGLR----RSLSQR  643
             +  N  C +D+  F +   GI    ILE  C   G GS         G R    +   +R
Sbjct  258   YPINIQCIKDVQAFYKCISGIQFGQILEPVC---GFGSLKPEDIFLSGRRYLIGKLRERR  314

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
             P      F  +   Y+ +  WANN  VQ+ALH+RK TI  W  C    + YT ++  +  
Sbjct  315   PEPSLSAFECRTDGYILAPYWANNATVQEALHIRKNTIREWQRCA-MGLSYTPEIESSFE  373

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             YH  L+ +G R+LIYSGDHD+IVP  ST+AWI SLNYS VD WR W   +G + G+TR+Y
Sbjct  374   YHVTLSKKGYRSLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMV-EGQVGGYTRTY  432

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             SN MTFAT+KG GH AP +   EC  M++RW+SGQ
Sbjct  433   SNQMTFATVKGGGHTAPEYRPKECFGMYKRWVSGQ  467



>ref|XP_004238067.1| PREDICTED: uncharacterized protein LOC101252078 [Solanum lycopersicum]
Length=907

 Score =   459 bits (1180),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 230/445 (52%), Positives = 305/445 (69%), Gaps = 12/445 (3%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN-PTTDP  1327
             +V    A  GS V  +PG  + GPLPF+LETGY+GVG++E+VQ+FYYF++S++  P +DP
Sbjct  13    LVVAEPAIAGSPVKFLPG--FKGPLPFQLETGYVGVGDSEDVQLFYYFIESESGYPDSDP  70

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              + W  GGPGCSAL  +I EIGPI+   V+Y G +P + LNP++WTKVS+++F+DLP   
Sbjct  71    LMLWITGGPGCSALSGLIYEIGPITFGAVEYNGSLPTMILNPYSWTKVSSIIFLDLPVGT  130

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             GF+YATT  A  +S+++ S+ AY+F+RKWF DHP +L NP Y+GGDS+SG+ VPII+++I
Sbjct  131   GFSYATTPAALQTSDLQTSDHAYQFLRKWFVDHPTFLKNPLYIGGDSYSGMVVPIISQII  190

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
             A  NE   KP INLKGY+LGNP S+    + Y IP AYGM LI  +LY+SL  NCKG Y 
Sbjct  191   ASNNEMEIKPFINLKGYLLGNP-STFEGENNYEIPFAYGMGLISDELYESLNTNCKGEYI  249

Query  786   HF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGE  622
             +   SN LC QD+  F +L RGIN  HILE  C R         G RRSL+++       
Sbjct  250   NINPSNLLCLQDVQTFKELLRGINKPHILEPKCKRFSPRPHQLFGERRSLNEKLHQLNNL  309

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
                +  WY  S  WA++  V+DAL++RKGTIG+W  C    + +   +T+++PYH NL++
Sbjct  310   IKCRNNWYKHSYHWADDDQVRDALNIRKGTIGKWERC--ATLKFQKIVTNSIPYHENLSS  367

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD IV   ST+AWI SLNYS VD WR W   D  +AG+TRSYSN MTFA
Sbjct  368   KGYRSLIYSGDHDKIVTFRSTQAWIKSLNYSIVDDWRAWTV-DNQVAGYTRSYSNQMTFA  426

Query  261   TLKGSGHIAPFFSAYECLIMFERWI  187
             T+KG+GH AP +   ECL M  RWI
Sbjct  427   TVKGAGHTAPEYKPRECLAMLTRWI  451


 Score =   417 bits (1071),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 291/454 (64%), Gaps = 27/454 (6%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
              +     + V  +PG  +DGPLPF LETGY+GVG+ E+ Q+FYYF+KS+++P  DP I W
Sbjct  460   TLQVQAAATVKFLPG--FDGPLPFHLETGYVGVGKEEKHQLFYYFIKSESDPGNDPLILW  517

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS+   ++ EIGP+  +  KY G +P L + P++WTKV+N++F++ P   GF+Y
Sbjct  518   LTGGPGCSSFNGVVYEIGPLYYKQKKYNGSLPTLGVTPNSWTKVANIIFLEQPVNTGFSY  577

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             ATT +A    ++      Y+F+ KW  DHPE+ +N FY+GGDS+SG+ VP + ++I+DG 
Sbjct  578   ATTPEAMHVIDVDACTHVYQFLLKWLVDHPEFSSNNFYLGGDSYSGIVVPRVVQLISDGI  637

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--  781
             EAG KPL+NLKGY+LGNP  +      + IP   GM +IP +LY+S+ +NCKG Y     
Sbjct  638   EAGNKPLVNLKGYLLGNPL-TFPEEKNFMIPFLVGMAIIPIELYQSMMQNCKGEYRKEFA  696

Query  780   -SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD----------GLRRSLSQRPVL  634
              +N  C+QD+   D+L+  IN  H+L+  C   G+ ++          G RRS+ +  + 
Sbjct  697   PTNAQCSQDLNIVDELSNNINDQHVLDPLC---GSETELKSPFPSKFRGSRRSIQENAIS  753

Query  633   PPGEFCWQMF--WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG--YTADMTDAL  466
             P    C+      +  S+ WAN+  VQ ALHVRKGTI  W  C    I   YT    D++
Sbjct  754   PS---CYGKLVDRHELSNYWANDPRVQKALHVRKGTIDHWARCKQNGIKKYYTFTSMDSI  810

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              YH N + +G R+LIYSGDHD+ VP  STEAWI SLNYS VD+WR W   +G +AG+TRS
Sbjct  811   SYHRNHSAKGYRSLIYSGDHDMGVPFQSTEAWIKSLNYSIVDNWRQWIV-NGQVAGYTRS  869

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             Y+N MT+AT+KG+GH+AP +   EC  MF+RWIS
Sbjct  870   YANKMTYATVKGAGHVAPEYKREECFNMFKRWIS  903



>ref|XP_010321497.1| PREDICTED: serine carboxypeptidase-like 12 [Solanum lycopersicum]
Length=459

 Score =   444 bits (1141),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 301/444 (68%), Gaps = 19/444 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  G  V ++PG  ++G L F+LETGYIGVGE +EVQVFYYF+KS++NP  DP I+W  G
Sbjct  21    ALAGLSVKYLPG--FEGQLAFQLETGYIGVGEADEVQVFYYFIKSESNPKVDPLIYWFTG  78

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSAL AI  E GPI+++   Y G +P L LNP+ +TKV++++F+DLP   GF+YATT
Sbjct  79    GPGCSALSAIFFEFGPITLDTRAYNGSLPTLSLNPYAYTKVASIIFVDLPVGTGFSYATT  138

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +KAN S N+  ++ AYEF+RKW  +H EYL NPFYVGGDS+SG+TVPI+T+ I++GN+ G
Sbjct  139   QKANYSDNLLSADHAYEFIRKWLIEHQEYLNNPFYVGGDSYSGITVPIVTQFISNGNDMG  198

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH----FS  778
              KP INLKGYILGNP +     + Y IP A+GM LI  +LY+SL  NC+G   +      
Sbjct  199   IKPWINLKGYILGNPVTFAGQDY-YIIPFAHGMGLISDELYESLVTNCEGELIYRDRPII  257

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQ------RPVLPPGEFC  616
             N LC++DM  F+ LT+ I   +ILE  C  V   S   RR L+Q           P   C
Sbjct  258   NPLCSRDMDTFNWLTKDIYLYNILESPCELVSKDS---RRWLTQNVTKLKNSATYPQVKC  314

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              +  W+  + +WAN+  V+DALHVRK TIG W  C   ++ +   + + + YH+NL+ +G
Sbjct  315   -RKEWHALALIWANDNNVRDALHVRKKTIGAWEECR-GNLSFGDIINNTILYHSNLSRKG  372

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHD++VP +ST+ WI SLNYS +D WRPW   DG +AG+TRSYSN MTF T+
Sbjct  373   FRSLIYSGDHDMVVPFISTQVWIKSLNYSIIDDWRPWIV-DGQVAGYTRSYSNKMTFVTV  431

Query  255   KGSGHIAPFFSAYECLIMFERWIS  184
             KG+GH  P +   + L M +RW+S
Sbjct  432   KGAGHTTPEYKPVQSLAMLKRWLS  455



>dbj|BAF99695.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=469

 Score =   444 bits (1142),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 300/445 (67%), Gaps = 17/445 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A+ G+ VD +PG  +DGPLPF LETGY+GVGE E+VQ +YYFV+S+ NP  DP + W  
Sbjct  28    LASCGTTVDFLPG--FDGPLPFVLETGYVGVGEGEDVQAYYYFVESENNPNEDPLMLWLT  85

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS+   ++ EIGP+  +  +Y G +P L L PH+WTKVS+++F+DLP   GFTYA 
Sbjct  86    GGPGCSSFSGLVLEIGPLIFKREEYNGSLPNLILRPHSWTKVSSIIFLDLPVSTGFTYAR  145

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T+ A   S++K   QA+EF+RKW  DHP++L+N  Y+GGDS+SG+TVP I + I+ GNE 
Sbjct  146   TEVAAQKSDLKLVHQAHEFLRKWLIDHPKFLSNEVYIGGDSYSGITVPAIVQEISQGNEK  205

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--N  775
             G +P INL+GYILGN A +      Y IP A+GM LI  +LY+SL+KNCKG Y      N
Sbjct  206   GIQPSINLQGYILGN-AFTTRKEENYAIPFAHGMALISDELYESLQKNCKGEYIDVDTKN  264

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-------VLPPGEFC  616
              LC++ M  ++++  GI+ +HILE  C  V T +  LRRSL QR           P   C
Sbjct  265   ALCSRVMESYNEVISGISFSHILEPNCDWVDTETS-LRRSLIQRHHGKKFLNTRLPALSC  323

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              + +   +S  WAN+  V+ ALH+RKG+IG+W  C   ++ YT D+  +  YH NL+ +G
Sbjct  324   -RTYANFQSSFWANDDNVRSALHIRKGSIGKWRRCT-RNLPYTEDIPSSFEYHVNLSGKG  381

Query  435   -LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
               R+L+YSGDHDL+VP + T+AWI SLNYS VD WR W   +G +AG+TR+YSN MTFAT
Sbjct  382   YYRSLVYSGDHDLMVPFLGTQAWIRSLNYSIVDDWRQWNT-NGQVAGYTRTYSNRMTFAT  440

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KG GH AP F   EC  M+ RWIS
Sbjct  441   VKGGGHTAPEFKPEECFAMYSRWIS  465



>emb|CBI19380.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   445 bits (1145),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 297/455 (65%), Gaps = 21/455 (5%)
 Frame = -2

Query  1500  VSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFI  1321
             VS V+AA  S V  +PG  ++GPLPFELETGY+GVGE+EEVQ+FYYFVKS+ NPT DP +
Sbjct  54    VSSVVAASHSPVKFLPG--FEGPLPFELETGYVGVGESEEVQLFYYFVKSENNPTEDPLL  111

Query  1320  FWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGF  1141
              W  GGPGCSA  A+  EIGP+  E V Y G +P L+LNPH+WT+VSN++F+D P   GF
Sbjct  112   LWLTGGPGCSAFSALFYEIGPLYFESVPYHGSLPTLELNPHSWTQVSNIIFLDAPVGTGF  171

Query  1140  TYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIAD  961
             +YATT +A+ S + + + QA+EF+RKW  DHPE+L+NP YVGGDS+SG+TVP++ + I++
Sbjct  172   SYATTSRASHSGDFQATHQAHEFLRKWLIDHPEFLSNPVYVGGDSYSGITVPVVVQHISN  231

Query  960   GNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--D  787
             GNE  T+P INLKGY+LGNP +        +   A+GM LI  +LY+SL+ +C   Y   
Sbjct  232   GNEDDTEPFINLKGYLLGNPVTEQGTETTAQFRFAHGMALISDELYESLKTSCGDEYPFK  291

Query  786   HFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGS--------DGLR----RSLSQR  643
             +  N  C +D+  F +   GI    ILE  C   G GS         G R    +   +R
Sbjct  292   YPINIQCIKDVQAFYKCISGIQFGQILEPVC---GFGSLKPEDIFLSGRRYLIGKLRERR  348

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
             P      F  +   Y+ +  WANN  VQ+ALH+RK TI  W  C    + YT ++  +  
Sbjct  349   PEPSLSAFECRTDGYILAPYWANNATVQEALHIRKNTIREWQRCA-MGLSYTPEIESSFE  407

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             YH  L+ +G R+LIYSGDHD+IVP  ST+AWI SLNYS VD WR W   +G + G+TR+Y
Sbjct  408   YHVTLSKKGYRSLIYSGDHDMIVPFFSTQAWIRSLNYSIVDDWRSWMV-EGQVGGYTRTY  466

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             SN MTFAT+KG GH AP +   EC  M++RW+SGQ
Sbjct  467   SNQMTFATVKGGGHTAPEYRPKECFGMYKRWVSGQ  501



>ref|XP_006356866.1| PREDICTED: uncharacterized protein LOC102592829 [Solanum tuberosum]
Length=1021

 Score =   461 bits (1186),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 229/447 (51%), Positives = 310/447 (69%), Gaps = 14/447 (3%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +V    AA GS+V  +PG Q  GPLPF+LETGY+GVG++E+VQ+FYYF +S+T+P +DP 
Sbjct  14    LVVAEHAAAGSQVKFLPGFQ--GPLPFQLETGYVGVGDSEDVQLFYYFTESETDPDSDPL  71

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             + W  GGPGCSAL  ++ EIGPI+ E V+Y G  PK+ LNP++WTKVS+++F+DLP   G
Sbjct  72    MLWITGGPGCSALSGLLYEIGPITFEAVEYNGSFPKMILNPYSWTKVSSIIFLDLPVGTG  131

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+YATT  A  SS+++ S+ AY+F+RKWF DHPE+L NPFYVGGDS+SG+ VPIIT++IA
Sbjct  132   FSYATTPAARQSSDLQASDHAYQFLRKWFVDHPEFLKNPFYVGGDSYSGIVVPIITQIIA  191

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
               NE   +P INLKGY+LGNP  +      YRIP AYGM LI  +LY+S + NCKG Y +
Sbjct  192   IKNEMEVEPFINLKGYLLGNPW-TFEGEDNYRIPFAYGMGLISEELYESFKSNCKGEYLN  250

Query  783   F--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGEF  619
                SN+LC QD+  F +L +GI+  +ILE  C           G RRSL ++      + 
Sbjct  251   INPSNKLCLQDVQTFIELLQGIDVVNILEPNCGFTSPRPHLLFGQRRSLDEK----FHQL  306

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
               +   Y  S  W ++  V+DAL++RKG+IG+W  C  +++ Y   +  ++PYH NL+++
Sbjct  307   KCRNDLYKFSYQWTDDGQVRDALNIRKGSIGKWERCA-SNLQYNRMVMSSIPYHKNLSSK  365

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD++V   ST+AWI SLNYS VD WR W   D  +AG+TRSYSN MTFAT
Sbjct  366   GYRSLIYSGDHDIVVTFRSTQAWIKSLNYSIVDDWRAWTV-DNQVAGYTRSYSNQMTFAT  424

Query  258   LKGSGHIAPFFSAYECLIMFERWISGQ  178
             +KG+GH AP +   ECL M  +W+S Q
Sbjct  425   VKGAGHTAPEYKPRECLAMLTKWMSYQ  451


 Score =   454 bits (1167),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 237/459 (52%), Positives = 311/459 (68%), Gaps = 19/459 (4%)
 Frame = -2

Query  1515  YCSSMVSVVM--AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN  1342
             YC  ++ VV   A  GS V  +PG Q  G LPFELETGY+GVG++E VQ+FYYF++S++ 
Sbjct  567   YCLFLLRVVAEHATAGSTVKFLPGFQ--GQLPFELETGYVGVGDSENVQLFYYFIESESE  624

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTK--VSNMLF  1168
             P +DP + W  GGPGCSAL  +I EIGPI+ E V+Y G  P + LNP++WTK  VS+++F
Sbjct  625   PDSDPLMLWITGGPGCSALSGLIYEIGPITFEAVEYNGSFPTMILNPYSWTKVRVSSIIF  684

Query  1167  IDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTV  988
             +DLP   GF+YAT   A  SS+++ SE AY+F+ KWF DH E+L NPFYVGGDS SG+ V
Sbjct  685   LDLPVGTGFSYATIPAALQSSDLQASEHAYQFLHKWFVDHQEFLENPFYVGGDSCSGMVV  744

Query  987   PIITKMIADGNE-AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
             P+IT++IA  NE    KP INLKGY+LGNP ++      YRIP AYGM LI  +LY+SL+
Sbjct  745   PVITQIIAIKNEIMEVKPFINLKGYLLGNP-TTFEGEDNYRIPFAYGMGLISDELYESLK  803

Query  810   KNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQ  646
              NC G Y +   SN LC QD+  F++L +GIN  HILE  C           G RRSL +
Sbjct  804   SNCNGEYFNINPSNVLCLQDVQTFNELLKGINNPHILEPKCKLFSPRPHQLFGERRSLDE  863

Query  645   RPVL---PPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT  475
             +       PG  C +  WY  S  WA++  V++AL++RKGTIG+W  C  +++ Y   +T
Sbjct  864   KLHELNNLPGLKC-RNNWYKHSYHWADDDQVRNALNIRKGTIGKWERCA-SNLQYLMMVT  921

Query  474   DALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGF  295
             +++PYH NL+++G R+LIYSGDHD +V   ST+AWI SLNYS VD WR W   D  +AG+
Sbjct  922   NSIPYHENLSSKGYRSLIYSGDHDKLVTFQSTQAWIKSLNYSVVDDWRAWTV-DNEVAGY  980

Query  294   TRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             TRSYSN MTFAT+KG+GH AP +   ECL M  RW+S Q
Sbjct  981   TRSYSNQMTFATVKGAGHTAPEYKPRECLAMLTRWMSYQ  1019



>ref|XP_003593858.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64109.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   443 bits (1140),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 220/455 (48%), Positives = 297/455 (65%), Gaps = 19/455 (4%)
 Frame = -2

Query  1506  SMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDP  1327
             S +S  +A  GS V  +PG Q  GPLPF LETGY+GVGE E+VQVFYYF++S+ NP  DP
Sbjct  20    SNISFQVATCGSIVKFLPGFQ--GPLPFVLETGYVGVGEKEDVQVFYYFIESEKNPKDDP  77

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              I W  GGPGCSAL  ++ EIGP+  +  +Y G +P L L PH+WTKVS+++F+DLP   
Sbjct  78    LILWLTGGPGCSALSGLMLEIGPLEFKKEEYNGSLPNLILKPHSWTKVSSIIFVDLPVST  137

Query  1146  GFTYATTKKANVS-SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKM  970
             GFTYATT+++    S+     Q Y+F+RKW  DHP++ +N  Y+ GDS+SG+ +P++ + 
Sbjct  138   GFTYATTEESGAKRSDWILVHQTYQFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVVVQE  197

Query  969   IADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY  790
             IA GNE G +P INL+GYILGN  ++      Y IP A+GM LI  +LY+SL+KNC G+Y
Sbjct  198   IAQGNEKGVQPWINLQGYILGNGVTTRKE-RNYAIPFAHGMGLISDELYESLQKNCNGDY  256

Query  789   --DHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV-------  637
                   N LC++D+  F +LT G+N  HIL+  C          RRSL +          
Sbjct  257   VNAETRNVLCSKDINSFSELTSGLNTAHILDPLCEWRDDNEKSPRRSLIKNYFSKFLHIN  316

Query  636   --LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
               LPP     + + Y     WAN+  V+ ALH+RKG+IG+W  C Y +I + AD+ ++  
Sbjct  317   LKLPP--LSCRSYSYFLMGFWANDDNVRKALHIRKGSIGKWHRCTY-NIRHNADIPNSYD  373

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             YH NL+ +G+R+LIY+GDHD+ VP ++T+AWI SLNYS VD WR W   D  +AG+TR+Y
Sbjct  374   YHVNLSRKGIRSLIYNGDHDMTVPFLATQAWIRSLNYSIVDDWRQWYTDDQ-VAGYTRTY  432

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             SN MTFAT+KG GH AP F   EC  MF RWIS +
Sbjct  433   SNQMTFATVKGGGHTAPEFRPKECFDMFSRWISKR  467



>ref|XP_006472320.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472321.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   443 bits (1139),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 295/449 (66%), Gaps = 21/449 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+EE Q+FYYFVKS+ NP  DP + W  G
Sbjct  21    AASHSTVKFLPGFQ--GPLPFELETGYVGVGESEEAQLFYYFVKSEKNPKEDPLLLWLTG  78

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGP++   V+Y G +P L+LNP++WTK +++LF+D P   GF+YA T
Sbjct  79    GPGCSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYART  138

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+     +F+RKW  DHPE+++NPFYVGGDS+SG+TVP + + I++ NE  
Sbjct  139   PHASQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEED  198

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGNP + +      +IP A+GM LI  +LY+SL+  C G Y +   +N+
Sbjct  199   IKPLINLQGYILGNPRTDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK  258

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLS----------QRPVLP  631
              C  D+  F +LT G+  +HILE  C         S   RRSL+            P  P
Sbjct  259   DCLNDIQTFSKLTSGVEKSHILEPHCQFFSPKPRASSRNRRSLNVNEQSQEFLDPEPTFP  318

Query  630   PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
             P     + + YL +  W N+  V+ ALHVR+G+ G W  CNY D+ YT ++ ++  YH +
Sbjct  319   P--IGCRSYGYLLARYWDNDHNVRKALHVRQGSKGEWIRCNY-DLPYTHEIGNSFSYHVS  375

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             L+T+G R+LIYSGDHD+++P + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN M
Sbjct  376   LSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNQM  434

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWIS  184
             T+AT+KG GH AP +   EC  MF+RWI+
Sbjct  435   TYATVKGGGHTAPEYRPAECYAMFQRWIN  463



>ref|XP_006433655.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
 gb|ESR46895.1| hypothetical protein CICLE_v10001060mg [Citrus clementina]
Length=467

 Score =   442 bits (1138),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 294/449 (65%), Gaps = 21/449 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+EE Q+FYYFVKS  NP  DP + W  G
Sbjct  21    AASHSTVKFLPGFQ--GPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTG  78

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGP++   V+Y G +P L+LNP++WTK +++LF+D P   GF+YA T
Sbjct  79    GPGCSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYART  138

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+     +F+RKW  DHPE+++NPFYVGGDS+SG+TVP + + I++ NE  
Sbjct  139   PHASQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEED  198

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGNP + +      +IP A+GM LI  +LY+SL+  C G Y +   +N+
Sbjct  199   IKPLINLQGYILGNPRTDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK  258

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRS----------LSQRPVLP  631
              C  D+  F +LT G+  +HILE  C         S   RRS          L+  P  P
Sbjct  259   DCLNDIQTFSKLTSGVEKSHILEPHCQFFSPKPRASSHNRRSLNVNEQSQEFLNPEPTFP  318

Query  630   PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
             P     + + YL +  W N+  V+ ALH+R+G+ G W  CNY D+ YT ++ ++  YH +
Sbjct  319   P--IGCRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNY-DLPYTHEIGNSFSYHVS  375

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             L+T+G R+LIYSGDHD+I+P + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN M
Sbjct  376   LSTKGYRSLIYSGDHDMIIPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNQM  434

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWIS  184
             T+AT+KG GH AP +   EC  MF+RWI+
Sbjct  435   TYATVKGGGHTAPEYRPAECYAMFQRWIN  463



>gb|KDO81468.1| hypothetical protein CISIN_1g012276mg [Citrus sinensis]
Length=467

 Score =   441 bits (1134),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 294/449 (65%), Gaps = 21/449 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+EE Q+FYYFVKS  NP  DP + W  G
Sbjct  21    AASHSTVKFLPGFQ--GPLPFELETGYVGVGESEEAQLFYYFVKSDKNPKEDPLLLWLTG  78

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGP++   V+Y G +P L+LNP++WTK +++LF+D P   GF+YA T
Sbjct  79    GPGCSAFSGLAYEIGPVNFNTVEYNGSLPTLRLNPYSWTKEASILFVDSPVGTGFSYART  138

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+     +F+RKW  DHPE+++NPFYVGGDS+SG+TVP + + I++ NE  
Sbjct  139   PHASQTGDFKQVHHLDQFLRKWLMDHPEFISNPFYVGGDSYSGITVPALVQRISNENEED  198

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGNP + +      +IP A+GM LI  +LY+SL+  C G Y +   +N+
Sbjct  199   IKPLINLQGYILGNPRTDMVVEQNSQIPFAHGMGLISNELYESLKITCGGEYVNVDPNNK  258

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLS----------QRPVLP  631
              C  D+  F +LT G+  +HILE  C         S   RRSL+            P  P
Sbjct  259   DCLNDIQTFSKLTSGVEKSHILEPHCQFFSPKPRASSRNRRSLNVNEQSQEFLDPEPTFP  318

Query  630   PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
             P     + + YL +  W N+  V+ ALH+R+G+ G W  CNY D+ YT ++ ++  YH +
Sbjct  319   P--IGCRSYGYLLARYWDNDHNVRKALHIRQGSKGEWIRCNY-DLPYTHEIGNSFSYHVS  375

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             L+T+G R+LIYSGDHD+++P + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN M
Sbjct  376   LSTKGYRSLIYSGDHDMLIPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNQM  434

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWIS  184
             T+AT+KG GH AP +   EC  MF+RWI+
Sbjct  435   TYATVKGGGHTAPEYRPAECYAMFQRWIN  463



>ref|XP_006433653.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
 gb|ESR46893.1| hypothetical protein CICLE_v10001059mg [Citrus clementina]
Length=467

 Score =   441 bits (1134),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 216/445 (49%), Positives = 294/445 (66%), Gaps = 21/445 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S    +PG Q  GPLPFELETGY+GVGE+E+ Q+FYYFVKS+ NP  DP + W  GGPGC
Sbjct  25    STAKFLPGFQ--GPLPFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             SA  A++ EIGPI+  +++Y G +P L LNP++WTK +++LF+D P   GF+Y  T  A+
Sbjct  83    SAFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLAS  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + + K+  Q  +F+RKW  DHPE+L+NPFYVGGDS+SG+TVP + + I++ NE G KPL
Sbjct  143   QTGDFKQVHQVDQFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPL  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +        +IP A+GM LI  +LY+SL+  C G+Y +   SN  C  
Sbjct  203   INLQGYILGNPKTDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLN  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ----------RPVLPPGEF  619
             D   F +L  G++  HILE  C         S+G RRSL+            P LP    
Sbjct  263   DNQAFSELISGLDQNHILEPRCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALP--SI  320

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
               + F Y+ S  W N+  V+ AL +R+G+ G+W  CNY D+ YT ++  +  YH +L+T+
Sbjct  321   GCRSFGYMLSQNWENDYNVRKALQIRQGSKGKWQRCNY-DLPYTEEIGSSFSYHVSLSTK  379

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD++VP + TEAWI +LNYS +D WRPW  H   +AGFTR+YSN MT+A+
Sbjct  380   GYRSLIYSGDHDMVVPFLGTEAWIKTLNYSIIDDWRPWILHSQ-VAGFTRTYSNRMTYAS  438

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KG GHIAP +   EC  MF+RWI+
Sbjct  439   VKGGGHIAPEYRPAECYAMFQRWIN  463



>ref|XP_010277006.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010277007.1| PREDICTED: serine carboxypeptidase-like 1 isoform X1 [Nelumbo 
nucifera]
Length=467

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/439 (48%), Positives = 297/439 (68%), Gaps = 16/439 (4%)
 Frame = -2

Query  1470  KVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCS  1291
             ++  +PG Q  GPLPFELETGY+ V E+E+V +FYYF+KS+ +P  DP + W  GGPGCS
Sbjct  29    RIQSLPGFQ--GPLPFELETGYVSVDESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCS  86

Query  1290  ALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANV  1111
             AL  ++ EIGP+ +E +KY G +P L LNP++WTK S+++F+D P   GF+Y+++ + + 
Sbjct  87    ALSGLLFEIGPLRIETMKYNGSLPSLALNPYSWTKASSIIFLDSPIGTGFSYSSSFQGSQ  146

Query  1110  SSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLI  931
             + ++K  +QAY+F+RKW  DHPE+L+N  Y+GGDS+SG T P++   I +GN+AG +P I
Sbjct  147   TGDIKSCQQAYQFLRKWLMDHPEFLSNAVYIGGDSYSGKTAPLVVIDILNGNDAGEEPFI  206

Query  930   NLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQD  757
             N+KGY+LGNP + ++     ++P A+G+ L+  +LY+S + NC+G Y +   SN  C QD
Sbjct  207   NIKGYLLGNPVTDVSYDSNKQLPHAHGLGLVSDELYQSAKINCQGEYVNINPSNVQCLQD  266

Query  756   MGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSL--SQRPVLPPG----EFCWQMF  604
             M  F +   GIN  HILE  C           G RR L  + R +L P     EFC +  
Sbjct  267   MQAFSECLSGINTAHILEPLCGFASPKPKEKFGDRRYLEDNSREILDPQPSSTEFC-RTD  325

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRAL  424
              YL S  WAN+  V+ AL++RKG+IG W  CNY  + YTA++  +  YH NL+ +G R+L
Sbjct  326   GYLLSYYWANDDNVRKALNIRKGSIGEWRRCNY-GLSYTAEIQSSFSYHVNLSRKGYRSL  384

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             IYSGDHDLIVP ++T+AWI SLNYS VD WR W   DG + G+TR+YSNNMTFAT+KG G
Sbjct  385   IYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVV-DGQVGGYTRTYSNNMTFATVKGGG  443

Query  243   HIAPFFSAYECLIMFERWI  187
             H AP +    CL M++RWI
Sbjct  444   HTAPEYQPKACLAMYKRWI  462



>ref|XP_007018461.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
 gb|EOY15686.1| Serine carboxypeptidase-like 7, putative [Theobroma cacao]
Length=473

 Score =   440 bits (1131),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 302/458 (66%), Gaps = 20/458 (4%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
              V   +A   S V  +PG  ++GPLPFELETGY+GVG++E+VQ+FYYFVKS+ NP  DP 
Sbjct  18    QVCSQLAFAHSAVKFLPG--FEGPLPFELETGYVGVGDSEDVQLFYYFVKSERNPEEDPL  75

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEV-VKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
             + W  GGPGCSA   ++ EIGP++ +  V+Y G +P L LNP++WTKVSN++F+D P   
Sbjct  76    LLWLTGGPGCSAFSGLVFEIGPLNFKADVEYNGSLPTLVLNPYSWTKVSNIIFVDSPVGT  135

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             GF+YA    A ++ + K++ Q ++F+RKW  DHP+++++P YV GDS+SG+ +P++ + I
Sbjct  136   GFSYARNNLAALTGDFKQANQLHQFLRKWLKDHPDFISSPVYVSGDSYSGIPIPVLAQEI  195

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
              +GNE G +P+I+L+GY+LGNPA+  +     +IP A+GM LI  +LY+SL+++C G Y 
Sbjct  196   LNGNEEGIRPIISLQGYVLGNPATVPSLEANLKIPYAHGMGLISDELYESLKRSCDGEYQ  255

Query  786   HF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD--GLRRSLSQR--PVLPPG  625
                 SN  C +D+  F +   GI P  ILE  C          G +R L ++   VL   
Sbjct  256   TVDPSNVECEKDIQYFSKCISGIQPAQILEPICPFASPRPQEIGGKRDLEEQHGEVLLED  315

Query  624   E---------FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTD  472
             E            + + YL    WAN+  VQ ALH+RKG+IG+W  C    + YTAD+  
Sbjct  316   EPPPPPPLPTLGCRTYAYLLCYYWANDNNVQKALHIRKGSIGQWQRCT-LGLPYTADVPS  374

Query  471   ALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFT  292
             + PYHANL+ RG+RALIYSGDHDL VP ++T+AWI SLNY+ VD WRPW    G + G+T
Sbjct  375   SFPYHANLSARGIRALIYSGDHDLTVPFLATQAWIRSLNYTIVDDWRPWVLR-GQVVGYT  433

Query  291   RSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             R+YSN MTFAT+KG GH AP +   ECL MF+RWIS +
Sbjct  434   RTYSNRMTFATVKGGGHTAPEYRPAECLAMFKRWISEE  471



>gb|KDO81474.1| hypothetical protein CISIN_1g012236mg [Citrus sinensis]
Length=467

 Score =   439 bits (1129),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 216/445 (49%), Positives = 294/445 (66%), Gaps = 21/445 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG Q  GPL FELETGY+GVGE+E+ Q+FYYFVKS+ NP  DP + W  GGPGC
Sbjct  25    STVKFLPGFQ--GPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             SA  A++ EIGPI+  +++Y G +P L LNP++WTK +++LF+D P   GF+Y  T  A+
Sbjct  83    SAFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLAS  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + + K+  Q  +F+RKW  DHPE+L+NPFYVGGDS+SG+TVP + + I++ NE G KPL
Sbjct  143   QTGDFKQVHQVDQFLRKWLMDHPEFLSNPFYVGGDSYSGITVPPLVQQISNENEEGIKPL  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +        +IP A+GM LI  +LY+SL+  C G+Y +   SN  C  
Sbjct  203   INLQGYILGNPKTDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLN  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ----------RPVLPPGEF  619
             D   F +L  G++  HILE  C         S+G RRSL+            P LP    
Sbjct  263   DNQAFSELISGLDQNHILEPRCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALP--SI  320

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
               + F Y+ S  W N+  V+ AL +R+G+ G+W  CNY D+ YT ++  +  +H +L+T+
Sbjct  321   GCRSFGYMLSQNWENDYNVRKALQIRQGSKGKWQRCNY-DLPYTQEIGSSFSFHVSLSTK  379

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD++VP + TEAWI SLNYS +D WRPW  H   +AG+TR+YSN MT+AT
Sbjct  380   GYRSLIYSGDHDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQ-VAGYTRTYSNRMTYAT  438

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KG GHIAP +   EC  MF+RWI+
Sbjct  439   VKGGGHIAPEYRPAECYAMFQRWIN  463



>emb|CDP01267.1| unnamed protein product [Coffea canephora]
Length=476

 Score =   437 bits (1125),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 214/456 (47%), Positives = 313/456 (69%), Gaps = 23/456 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             C +  S +    GS+++ +PG  +DG LPF LETGYIGV E+E+VQ+FYYF+KSQ+NP  
Sbjct  27    CFNSNSKLQVWAGSELEFLPG--FDGKLPFHLETGYIGVDESEDVQLFYYFIKSQSNPEM  84

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCS++  ++ EIGP + E V+Y+G +P+L L P++WT+V++++F+D P 
Sbjct  85    DPLVLWMTGGPGCSSISGLVYEIGPFTFEAVEYSGSLPRLVLKPYSWTEVASIIFLDWPV  144

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+YA   +A  S+ ++ S+QAY+F+RK+  DHPE+L+N FY+GGDS+SGL VPII +
Sbjct  145   GTGFSYARNPEALESTTLQASDQAYQFLRKFLIDHPEHLSNSFYIGGDSYSGLPVPIIAQ  204

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
             +I+DGNE G +PLI+LKGY+LGNP ++  + H YR+  A+GM LIP DL++SL +NCKG 
Sbjct  205   LISDGNENGNQPLIDLKGYLLGNPGATPLD-HNYRVQFAHGMGLIPDDLHESLIRNCKGM  263

Query  792   YDHFSNE--LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGE-  622
             Y     E  LC +DM  F+QL   I  ++ILE++C   G  +   ++S +QR  L     
Sbjct  264   YITIDPENFLCMKDMQNFNQLVESIKFSNILENYC---GLRAPKPQKSYAQRRDLDETSQ  320

Query  621   ----------FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTD  472
                       F  +   ++ +++WAN+ +V++AL + K  +G W  CN  ++ YT  +  
Sbjct  321   ELSGHDLLLAFKCREQAFVLAEIWANDQSVREALDIPKKHVGYWHRCN-DNLLYTTTIHS  379

Query  471   ALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFT  292
             ++PYHANL+T G R+L+YSGDHD+++P   T+ WI SLNYS VD WRPW   +G +AG+T
Sbjct  380   SVPYHANLSTLGYRSLVYSGDHDMVLPHFGTQDWIRSLNYSIVDEWRPWFV-EGQVAGYT  438

Query  291   RSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             R+Y+N MTFAT  G+GH AP +   EC  MF+RWIS
Sbjct  439   RTYANRMTFAT--GAGHTAPEYKPVECRAMFQRWIS  472



>ref|XP_003593861.1| Serine carboxypeptidase family protein [Medicago truncatula]
 gb|AES64112.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=465

 Score =   437 bits (1124),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 298/445 (67%), Gaps = 11/445 (2%)
 Frame = -2

Query  1506  SMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDP  1327
             S +   +A  GS V  +PG Q  GPLPF L+TGY+GVGE E+VQVFYYF++S+ NP  DP
Sbjct  24    SNICFQVATCGSIVKFLPGFQ--GPLPFVLKTGYVGVGEQEDVQVFYYFIESERNPKEDP  81

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              + W  GGPGCSAL  ++ EIGPI  +   Y G +P L L P +WTKVS+++F DLP   
Sbjct  82    LLLWLTGGPGCSALSGLVYEIGPIMFKKEYYNGSVPNLILRPASWTKVSSIIFADLPVST  141

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             GFTYATT+     S++ +  QA+EF+RKW  +HP++ +N  Y+ GDS+SG+T+P I + I
Sbjct  142   GFTYATTESGAKRSDLIQVNQAHEFLRKWLVEHPKFQSNEIYIAGDSYSGITIPAIVQEI  201

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
             A GNE G +P INL+GY+LGNP  ++     Y+IP A+GM  +  +LY+SL+KNC G+Y 
Sbjct  202   AQGNEKGLQPKINLQGYVLGNPL-TIRKEKNYQIPYAHGMGFLSDELYESLQKNCNGDYT  260

Query  786   HF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV--LPPGEF  619
             +    N LC++D+  +D++ +GIN  HIL+    R     + LRRSL ++ +  +PP   
Sbjct  261   NVDPKNLLCSRDINSYDEVIKGINTAHILDPTECRWLRPENILRRSLIKKYLSRVPP--I  318

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
                 +  L S  WANN  V+ ALH+R+GTIG+W   +   I YT D++++  YH NL+ +
Sbjct  319   SCPNYPQLLSGYWANNSTVRKALHIREGTIGKWSRRS-DRIPYTGDISNSFDYHVNLSDK  377

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD+ +P + T+AWI SLNYS VD WR W   DG +AG+TR+YSN MTFAT
Sbjct  378   GYRSLIYSGDHDISIPFLDTKAWIKSLNYSIVDDWRQWHT-DGQVAGYTRTYSNGMTFAT  436

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KG GH A  +   ECL MF RWIS
Sbjct  437   VKGGGHTAAEYRPEECLAMFSRWIS  461



>ref|XP_010320337.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=468

 Score =   436 bits (1121),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 288/443 (65%), Gaps = 17/443 (4%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+++PG Q  G LPF LETGY+GVG++E VQ+FYYF++S+T PTTDP + W  GGPGC
Sbjct  26    STVEYLPGWQ--GRLPFPLETGYVGVGKDEAVQLFYYFLESETEPTTDPLLVWLSGGPGC  83

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S++ AI+ EIGPI      Y G MP  +LNPH WTK++N++F+D P   GF+YAT   A 
Sbjct  84    SSVIAIVDEIGPIRFVEQVYNGSMPSFELNPHAWTKIANVIFLDQPVNTGFSYATNSAAY  143

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  E  YEF+RKW NDHP++++NPFYV G+S+SG+ +PIIT++I++GN AG +PL
Sbjct  144   KYTDVQACEYVYEFLRKWLNDHPQFISNPFYVSGNSYSGMIIPIITQLISNGNIAGKEPL  203

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             +NL+GY++GN  +      +Y I   +GM LI  +LYKSLEKNC+G Y + +  N  CA 
Sbjct  204   VNLQGYLIGNAVTISPQDEKYHIVFCHGMGLISDELYKSLEKNCRGEYTNINPKNTGCAN  263

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSD-----GLRRSLSQRPVLPPGEFCWQMFWYL  595
             D   F QL + IN  H+L+ FC       D       RR L  + +    E      W  
Sbjct  264   DFRNFKQLVKNINVEHVLKPFCTNDDDPKDVYQMTSERRLLDDKLISLQREDKCDSDWRK  323

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDI------GYTADMTDALPYHANLTTRGL  433
                 WAN+  VQ+ALHVRKG I  W  C   DI       YT  + + +PYHANL+T+G 
Sbjct  324   HLRYWANDPQVQEALHVRKGIIESWIKCR-RDISEGSHHNYTLTVHNVVPYHANLSTKGY  382

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD +VP   T+ WI SLNYS  D WR W  ++  +AG+TRSYSN MT+AT+K
Sbjct  383   RSLIYSGDHDYMVPFQDTQTWIKSLNYSIDDDWRQWNVNNQ-VAGYTRSYSNKMTYATVK  441

Query  252   GSGHIAPFFSAYECLIMFERWIS  184
             G+GH A      EC +MF+RWIS
Sbjct  442   GAGHTACMDKPEECFVMFKRWIS  464



>ref|XP_006472316.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Citrus 
sinensis]
Length=467

 Score =   436 bits (1121),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 215/445 (48%), Positives = 293/445 (66%), Gaps = 21/445 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG Q  GPL FELETGY+GVGE+E+ Q+FYYFVKS+ NP  DP + W  GGPGC
Sbjct  25    STVKFLPGFQ--GPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             SA  A++ EIGPI+  +++Y G +P L LNP++WTK +++LF+D P   GF+Y  T  A+
Sbjct  83    SAFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLAS  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + + K+  Q  +F+RKW  DHPE+L+N FYVGGDS+SG+TVP + + I++ NE G KPL
Sbjct  143   QTGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPL  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +        +IP A+GM LI  +LY+SL+  C G+Y +   SN  C  
Sbjct  203   INLQGYILGNPKTDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLN  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ----------RPVLPPGEF  619
             D   F +L  G++  HILE  C         S+G RRSL+            P LP    
Sbjct  263   DNQAFSELISGLDQNHILEPHCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALP--SI  320

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
               + F Y+ S  W N+  V+ AL +R+G+ G+W  CNY D+ YT ++  +  +H +L+T+
Sbjct  321   GCRSFGYMLSQNWENDYNVRKALQIRQGSKGKWQRCNY-DLPYTQEIGSSFSFHVSLSTK  379

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD++VP + TEAWI SLNYS +D WRPW  H   +AG+TR+YSN MT+AT
Sbjct  380   GYRSLIYSGDHDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQ-VAGYTRTYSNRMTYAT  438

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KG GHIAP +   EC  MF+RWI+
Sbjct  439   VKGGGHIAPEYRPAECYAMFQRWIN  463



>ref|XP_003604931.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87128.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   436 bits (1121),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 303/443 (68%), Gaps = 17/443 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPF+LETGY+G+GE N+++QVFYYF+KS+ NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWL  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   ++ +IGP   E+ +Y G +P L   P +WTK S+++F+DLP   GF+YA
Sbjct  91    TGGPGCSSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  S+ K    A++F+RKW  DHPE+L+N FY+GGDS+SG+ VP I + I++GNE
Sbjct  151   KNVTAH-RSDWKLVHHAHQFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G  PLINL+GY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y +    
Sbjct  210   KGLLPLINLQGYLLGNPITTYKE-DNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSR  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCW  613
             NELC +D+  FD+   GIN  +IL+ +C     +   + ++ L++S S    +P  E   
Sbjct  269   NELCLRDLQSFDECLSGINTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVP--ELSC  326

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
             Q++ +  +  WAN+  V+ ALH+R+G+IG+W  C  TD  +  ++  ++ +HANL+ +G 
Sbjct  327   QIYGFYLATKWANDENVRKALHIREGSIGKWERCYTTD--FEREIFSSVEFHANLSKKGY  384

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD +VP MST+AWI  LNYS VD WRPW   +G + G+TR+Y+N MTFAT+K
Sbjct  385   RSLIYSGDHDAVVPFMSTQAWIRDLNYSIVDDWRPWFV-NGQVGGYTRTYANRMTFATVK  443

Query  252   GSGHIAPFFSAYECLIMFERWIS  184
             GSGH AP ++  +C  MF RWIS
Sbjct  444   GSGHTAPEYTPEQCFPMFTRWIS  466



>ref|NP_001242803.1| uncharacterized protein LOC100794342 [Glycine max]
 gb|ACU21515.1| unknown [Glycine max]
Length=485

 Score =   436 bits (1122),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 300/443 (68%), Gaps = 16/443 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PGL+  GPLPF LETGY+GVGE+E+VQ FYYF++S+ NP  DP + W  GGPG
Sbjct  47    GSIVKFLPGLE--GPLPFVLETGYVGVGESEDVQAFYYFIESENNPKEDPLMLWLTGGPG  104

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CSA   ++ EIGPI+ +  +Y G +P L L PH+WTKVS+++F+DLP   GFTYATT+ A
Sbjct  105   CSAFSGLVIEIGPIAFKNEEYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEFA  164

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
                S+  +  Q ++F+RKW  +HP +L+   Y+GGDS+SG+T+P I + I+ GNE G +P
Sbjct  165   TQRSDWIQVHQVHQFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQP  224

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNPA++  +   YRI  A+GM LI  +LY+SL+KNCKG Y +    N LC+
Sbjct  225   WINLQGYLLGNPATTRRH-ENYRISFAHGMGLISDELYRSLQKNCKGEYINVDTKNVLCS  283

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP--------VLPPGEFCWQM  607
             +++  F+++T G++  +IL+  C  + T +   R  L + P        +  P   C + 
Sbjct  284   RNIETFNEVTSGLSMVNILDPSCDWLDTETSWRRSLLKKYPRKNFLNTHLKLPSLNC-RS  342

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRA  427
             + Y     WAN+ +V+ ALH+RKGT+G+W  C + +I    D++ +  YH NL+ +G R+
Sbjct  343   YAYFLCGYWANDDSVRSALHIRKGTVGKWRRCTF-NIPNKEDISSSYEYHVNLSRKGYRS  401

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             LIYSGDHD+ +P + T+AWI+SLNYS VD WR W   DG +AG+TR+YSN MTFAT+KG 
Sbjct  402   LIYSGDHDMKIPFLETQAWISSLNYSIVDDWRQWHT-DGQVAGYTRTYSNRMTFATVKGG  460

Query  246   GHIAPFFSAYECLIMFERWISGQ  178
             GH AP +   ECL MF RWIS +
Sbjct  461   GHTAPEYKPEECLAMFRRWISNK  483



>ref|XP_006354895.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=472

 Score =   436 bits (1120),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 296/445 (67%), Gaps = 14/445 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V+++PGLQ  G LPF LETGY+GVG++EE+Q+FYYF++S++ PTTDP + W  G
Sbjct  27    AASHSTVEYLPGLQ--GRLPFPLETGYVGVGKDEELQLFYYFLESESEPTTDPLLIWLSG  84

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA+ AI+  IGP+      Y G MP   LNPH WTK+++++F+D P   GF+Y T 
Sbjct  85    GPGCSAVTAIVNGIGPLRFVEQVYYGSMPSFVLNPHAWTKIASVIFLDQPINTGFSYVTN  144

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             + A   ++++  +  YEF+RKW +DHPEY++NPFY+ G+S++G  +P++ ++I++GN AG
Sbjct  145   EVAYKQTDVQAFDYVYEFLRKWLSDHPEYISNPFYMSGNSYAGKMIPVVAQLISNGNTAG  204

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P +NL+GY++G+P +       Y+I  +YGM LI  +LYKSLEKNC G Y +   +N+
Sbjct  205   KEPFVNLQGYLIGSPGTLRPQEDNYQILFSYGMGLISDELYKSLEKNCGGEYTNIDPNNK  264

Query  771   LCAQDMGKFDQLTRGINPTHILEDFC----IRVGTGSDGLRRSLSQRPVLPPGEFCWQMF  604
              CA D   F QL + IN  HILE FC    ++      G RR L ++ +    +      
Sbjct  265   GCANDFRIFKQLVKNINGEHILEPFCTYDYLQGPYQMSGERRLLDEKLISLQRQDKCASD  324

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACN-YTDIG----YTADMTDALPYHANLTTR  439
             W      WAN+  VQ+ALHVRK  IG W  CN  + +G    YT  + + +PYHANL+T+
Sbjct  325   WRKHMKYWANDPKVQEALHVRKRIIGSWVQCNKISSVGSPPNYTLTIDNVVPYHANLSTK  384

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD  VP  ST+ WI SLNYS VD WRPW  ++  +AG+TRSYSN MTFAT
Sbjct  385   GYRSLIYSGDHDYSVPFQSTQKWIKSLNYSIVDDWRPWNVNNQ-VAGYTRSYSNKMTFAT  443

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KGSGH A  +   EC  MF+RWI+
Sbjct  444   VKGSGHTACRYKPEECFGMFKRWIN  468



>ref|XP_009784016.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
sylvestris]
Length=474

 Score =   436 bits (1120),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 307/452 (68%), Gaps = 24/452 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +   GS V+ +PG  +DGPLPF LETGYIGVG++EEVQ+FYYFVKS+++P  DP + W  
Sbjct  26    LPQNGSIVEFLPG--FDGPLPFYLETGYIGVGKSEEVQLFYYFVKSESDPRKDPLLLWLT  83

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS+   +  E+GP++     Y G +P L   P++WTK +++LF++ P   GF+YAT
Sbjct  84    GGPGCSSFTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYAT  143

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A+  ++++  +  YEF+ KWFN+H E+++NPFYV GDS+SG+TVP+I ++I+DG EA
Sbjct  144   TSAASKCTDLQACDHVYEFLCKWFNNHQEFISNPFYVSGDSYSGITVPVIVQLISDGIEA  203

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G KPLINLKGY LGNP  +      Y+IP  +GM LI  +LY+SL++ CKG+Y +   +N
Sbjct  204   GKKPLINLKGYSLGNPL-TFPEESNYQIPYCHGMGLISDELYESLKETCKGDYQNIDPTN  262

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD--------GLRRSLSQRPV-LPPGE  622
             +LC+++   F +L   IN   ILE FC   GT S+        G RRSL    + L  G+
Sbjct  263   KLCSENFKMFKKLVSRINDQQILEPFC---GTDSESPKPHQLSGERRSLEDNLISLRHGD  319

Query  621   F-CWQMFWYLR--SDLWANNVAVQDALHVRKGTIGR-WCACNYTDIG--YTADMTDALPY  460
             F C +     R  S+ WAN+  VQ+ALHVRKGTI R W  C  + +G  YT    +++PY
Sbjct  320   FICRESRVATRKLSNHWANDPRVQEALHVRKGTIRRPWARCRQSIMGTTYTITFMNSIPY  379

Query  459   HANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYS  280
             H NL+++G R+LIYSGDHD+++P  ST+AWI  LNYS +D WRPW   DG +AG+TRS+S
Sbjct  380   HVNLSSKGYRSLIYSGDHDMVIPFQSTQAWIKYLNYSIIDDWRPWTI-DGQVAGYTRSFS  438

Query  279   NNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             N++T+AT+KG GH AP +   +   MF+RWI+
Sbjct  439   NHITYATVKGGGHTAPEYKREDSFHMFKRWIA  470



>gb|AES87127.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   435 bits (1118),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/445 (49%), Positives = 299/445 (67%), Gaps = 21/445 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+G+ N+++QVFYYFVKS+ NP  DP + W 
Sbjct  32    LEAYGSKVEHLPGFQ--GPLPFELETGYVGLGDSNDDMQVFYYFVKSENNPQKDPLMLWL  89

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   ++ EIGP + E+ +Y G +P L L P +WTK+SN++F+DLP   GF+YA
Sbjct  90    TGGPGCSSFSGLVYEIGPFAFEIKEYNGSVPSLVLRPQSWTKLSNIIFVDLPLGTGFSYA  149

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                  +  S+ K     Y+F+RKW  DHPE+L+N FY+G DS+SG+ VP + + I++GNE
Sbjct  150   KNVTYH-RSDWKLVHNTYQFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAVLQEISNGNE  208

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFS  778
              G +PLINL+GY+LGNP ++ +    Y+I  A+GM LI  +LY SL++NCKG Y    + 
Sbjct  209   KGLQPLINLQGYLLGNPYTT-HKEDNYQIQYAHGMGLISDELYASLQRNCKGEYIDVDYR  267

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQR-------PVLPPGEF  619
             NELC +D+  FD+   GIN  +IL+ FC      S   RRSL Q        P+  P   
Sbjct  268   NELCLRDLRSFDECLSGINKENILDGFC---EDDSRLWRRSLKQELGAPLSSPLTVPKLS  324

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
             C    +YL +  WAN+ +V+ ALH+R+G+IG+W  C  TD  +  ++  ++ +H NL+ +
Sbjct  325   CHIYRFYLATK-WANDESVRKALHIREGSIGKWERCYTTD--FEREIFSSVEFHVNLSKK  381

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGD DL+VP  ST+AWI  LNYS VD WR W   +G +AG+TR+YSN MTFAT
Sbjct  382   GYRSLIYSGDLDLVVPFQSTQAWIRDLNYSIVDDWRSWFV-NGQVAGYTRTYSNRMTFAT  440

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KGSGH AP  +  +CL MF RW S
Sbjct  441   VKGSGHTAPAVTPEQCLAMFTRWTS  465



>gb|KDP41600.1| hypothetical protein JCGZ_16007 [Jatropha curcas]
Length=472

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 299/462 (65%), Gaps = 25/462 (5%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L C S V+V      SKV+ +PG  ++GPLPFELETGYIGVGE+E+VQ+FYYFV+SQ N 
Sbjct  19    LQCWSQVAV----SHSKVEFLPG--FNGPLPFELETGYIGVGESEDVQLFYYFVRSQGNA  72

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCSAL   I EIGP+  EVV+Y G +P L LNP++WTKV++++FID 
Sbjct  73    EKDPLLLWLTGGPGCSALSGFIYEIGPLYFEVVEYNGSLPTLFLNPNSWTKVASIIFIDS  132

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y  T  A+VS +  +  Q  +F+RKW NDHPE+L+NP YVGGDS+SG+ +P +
Sbjct  133   PVGTGFSYPRTPLASVSGDFIQINQTEQFLRKWLNDHPEFLSNPVYVGGDSYSGIPLPGV  192

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G KP INLKGY+LGN  +  +     ++P A+GM LI  +LY+SL++ C 
Sbjct  193   VQKISIGNEEGRKPFINLKGYLLGNAGTDFSFDGNSQVPFAHGMGLISDELYESLKRTCG  252

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL----RRSL-----  652
             G Y     SN  C + M +F   T G++  HILE  C  V      +    RRSL     
Sbjct  253   GEYTFISPSNAECLKHMQEFTNCTSGLDGAHILEPLCAFVSPKPIEISFRERRSLIDSNS  312

Query  651   ----SQRPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTA  484
                    P LP      + + YL S  WAN+ +V+ ALH+R+GT+G W  CNY  I Y  
Sbjct  313   REFVDSDPFLP--TIGCRTYGYLLSIYWANDNSVRKALHIREGTVGEWIRCNY-GINYRR  369

Query  483   DMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGII  304
             +++  + +H  L+ +G R+LIYSGDHD++V  + T+AWI SLN+S VD WRPW   +G +
Sbjct  370   EISSTIKHHLYLSNKGYRSLIYSGDHDMLVSFVGTQAWIRSLNFSIVDDWRPWHL-EGQV  428

Query  303   AGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AG+TRSYSN MT+AT+KG GH AP +   EC  MF+RW S +
Sbjct  429   AGYTRSYSNKMTYATIKGGGHTAPEYKPEECFAMFKRWTSQE  470



>ref|XP_009612197.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Nicotiana 
tomentosiformis]
Length=474

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 306/454 (67%), Gaps = 24/454 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +    S V+ +PG  +DG LPF LETGYIGVG++EEVQ+FYYFVKS++NP  DP + W  
Sbjct  26    LPQNSSTVEFLPG--FDGALPFYLETGYIGVGKSEEVQLFYYFVKSESNPKKDPLLLWLT  83

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS+   +  E+GP++     Y G +P L   P++WTK +++LF++ P   GF+YAT
Sbjct  84    GGPGCSSFTGVAYEVGPLAFGQKAYNGSLPILVSTPYSWTKFASILFLEQPVNTGFSYAT  143

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A+  ++++  +Q YEF+ KWFN+HPE+++NPFYV GDS+SG+TVP+I ++I+DG EA
Sbjct  144   TSAASKCTDLQACDQVYEFLLKWFNNHPEFISNPFYVSGDSYSGITVPVIVQLISDGIEA  203

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G  PLINLKGY LGNP  +      Y+IP  +GM LI  +LY+SL++ CKG+  +   +N
Sbjct  204   GKNPLINLKGYSLGNPL-TFPEESNYQIPFCHGMGLISNELYESLKETCKGDCRNIDPTN  262

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD--------GLRRSLSQRPV-LPPGE  622
             +LC ++   F +L   IN   ILE FC   GT S+        G RRSL +  + L   +
Sbjct  263   KLCLENFKMFKKLVSSINDQQILEPFC---GTDSESPNPRQLSGERRSLEEDFIFLKHDD  319

Query  621   F-CWQMFWYLR--SDLWANNVAVQDALHVRKGTIGR-WCACNYTDIGYTADMT--DALPY  460
             F C +     R  S+ WAN+  VQ+ALHVRKGTI R W  C  + +G T  +T  +++PY
Sbjct  320   FICRESRVATRKLSNHWANDPCVQEALHVRKGTIRRPWARCRQSIMGKTYRVTFMNSIPY  379

Query  459   HANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYS  280
             H NL+++G R+LIYSGDHD++VP  ST+AWI  LNYS +D WRPW   DG +AG+TRS+S
Sbjct  380   HVNLSSKGYRSLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTI-DGQVAGYTRSFS  438

Query  279   NNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             N+MT+AT+KG GH AP +   E   MF+RWI+ Q
Sbjct  439   NHMTYATVKGGGHTAPEYKREESFHMFKRWIAQQ  472



>ref|XP_009626153.1| PREDICTED: serine carboxypeptidase-like 13 [Nicotiana tomentosiformis]
Length=466

 Score =   434 bits (1117),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 221/443 (50%), Positives = 294/443 (66%), Gaps = 15/443 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG  ++G LPF LETGYIGVGE EEVQ+FYYF+KS++ PT DP + W  G
Sbjct  32    AASHSTVQFLPG--FEGRLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPVLVWLSG  89

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+  A++ +IGP+  E  KY G +PKL LNP++WTKV+N++F+D P  +GF+YATT
Sbjct  90    GPGCSSFTALVYQIGPLYFEPNKYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATT  149

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                  S++++  +  Y F+RKW   HPE++ NP Y+GGDS+SG+T+P+IT++I++G EAG
Sbjct  150   STTFKSTDLQACDHIYLFLRKWLIKHPEFIRNPMYIGGDSYSGITLPVITQLISNGIEAG  209

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG---NYDHFSN  775
              KP INLKGYILGNP S+    + Y IP A+GM LI  +LYK L++ C G    Y   SN
Sbjct  210   HKPSINLKGYILGNP-STFPLQYNYWIPYAHGMGLISDELYKLLKETCNGENLQYVDPSN  268

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPG-EFCWQMFWY  598
              LC Q    F+QL  GIN  HILE  C     GSD   R   +R  L        ++  +
Sbjct  269   VLCYQHYQTFEQLISGINKPHILEPSC-----GSDAESRLFGERRSLYENYSIKCRVEVH  323

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT--DALPYHANLTTRGLRAL  424
               S  WAN+  VQ+AL+VRKG I RW  C  + +  T  +T  D++PYH  L+ +  R+L
Sbjct  324   RLSTYWANDPRVQEALNVRKGAIERWTRCRESIVNKTYIITFQDSIPYHVELSKKLYRSL  383

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             IYSGDHD+ +P  ST+ WI  LNYS VD WRPW   D  +AG+TRSYSN MTFAT+KG+G
Sbjct  384   IYSGDHDMGIPFQSTQFWIKFLNYSIVDEWRPWIVDDQ-VAGYTRSYSNQMTFATVKGAG  442

Query  243   HIAPFFSAYECLIMFERWISGQK  175
             H+AP +   EC  MF RW+S ++
Sbjct  443   HVAPEYKPKECFTMFHRWLSHEQ  465



>gb|KHN06942.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=475

 Score =   434 bits (1117),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 301/444 (68%), Gaps = 17/444 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PGL+  GPLPF LETGY+GVGE+E+VQ FYYF++S+ NP  DP + W  GGPG
Sbjct  36    GSIVKFLPGLE--GPLPFVLETGYVGVGESEDVQAFYYFIESENNPKEDPLMLWLTGGPG  93

Query  1296  CSALFAIIQEIG-PISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK  1120
             CSA   ++ EIG PI+ +  +Y G +P L L PH+WTKVS+++F+DLP   GFTYATT+ 
Sbjct  94    CSAFSGLVIEIGSPIAFKNEEYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEF  153

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A   S+  +  Q ++F+RKW  +HP +L+   Y+GGDS+SG+T+P I + I+ GNE G +
Sbjct  154   ATQRSDWIQVHQVHQFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQ  213

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELC  766
             P INL+GY+LGNPA++  +   YRIP A+GM LI  +LY+SL+KNCKG Y +    N LC
Sbjct  214   PWINLQGYLLGNPATTRRH-ENYRIPFAHGMGLISDELYRSLQKNCKGEYINVDTKNVLC  272

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP--------VLPPGEFCWQ  610
             ++++  F+++T G++  +IL+  C  + T +   R  L + P        +  P   C +
Sbjct  273   SRNIETFNEVTSGLSMVNILDPSCDWLDTETSWRRSLLKKYPRKNFLNTHLKLPSLNC-R  331

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
              + Y     WAN+ +V+ ALH+RKGTIG+W  C + +I    D++ +  YH NL+ +G R
Sbjct  332   SYAYFLCGYWANDDSVRSALHIRKGTIGKWRRCTF-NIPNKEDISSSYEYHVNLSRKGYR  390

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LIYSGDHD+ +P + T+AWI+SLNYS VD WR W   DG +AG+TR+YSN MTFAT+KG
Sbjct  391   SLIYSGDHDMKIPFLETQAWISSLNYSIVDDWRQWHT-DGQVAGYTRTYSNRMTFATVKG  449

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH AP +   ECL MF RWIS +
Sbjct  450   GGHTAPEYKPEECLAMFRRWISNK  473



>ref|XP_006594522.1| PREDICTED: serine carboxypeptidase-like 12-like [Glycine max]
Length=469

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 296/454 (65%), Gaps = 14/454 (3%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
              +  S  S  +A  GS V  +PG  + GPLPF LETGY+GVGE+E+VQ FYYF++S+ NP
Sbjct  17    FFLLSQFSFQLAWCGSIVKFLPG--FKGPLPFVLETGYVGVGESEDVQAFYYFIESENNP  74

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCSAL  ++ EIGP++ +  +Y G +P L L PH+WTKVS+++F+DL
Sbjct  75    KKDPLMLWLTGGPGCSALSGLVFEIGPLTFKYEEYNGSLPNLVLRPHSWTKVSSIIFVDL  134

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GFTYATT+ A   S+     Q ++F+RKW  DHP + +N  Y+GGDS+SG+ +P+I
Sbjct  135   PVSTGFTYATTEFAAQRSDWILVHQVHQFLRKWLIDHPNFSSNEVYIGGDSYSGIPIPVI  194

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G +P INL+GY+LGN A++      Y+IP A+GM LI  +LY SL+KNCK
Sbjct  195   VQEISRGNEKGLQPWINLQGYLLGNAATTRRE-KNYQIPFAHGMGLISDELYGSLQKNCK  253

Query  798   GNYDHFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV----  637
               Y +    N LC++D+  F+++T G+N  HIL+  C  + T +   R  L + P     
Sbjct  254   EEYINVDTRNVLCSRDIESFNEVTSGLNSAHILDPSCEWLDTETSWRRSLLKKYPRKNFL  313

Query  636   ---LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                L       + + Y     WAN+  V+ ALH+RKG+IG+W  C + DI    D++ + 
Sbjct  314   NTHLKLAPLNCRSYVYFLCGYWANDDNVRTALHIRKGSIGKWHRCTF-DIPNKKDISSSY  372

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              YH NL+ +G R+LIYSGDHD+ +P ++T+AWI SLNYS VD WR W   +G +AG+TR+
Sbjct  373   EYHVNLSRKGYRSLIYSGDHDMTIPFLATQAWIRSLNYSIVDEWRQWHT-NGQVAGYTRT  431

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             YSN MTFAT+KG GH AP +   EC  MF RWIS
Sbjct  432   YSNRMTFATVKGGGHTAPEYKPDECFAMFSRWIS  465



>gb|AFK49380.1| unknown [Medicago truncatula]
Length=470

 Score =   431 bits (1107),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 302/443 (68%), Gaps = 17/443 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPF+LETGY+G+GE N+++QVFYYF+KS+ NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWL  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   ++ +IGP   E+ +Y G +P L   P +WTK S+++F+DLP   GF+YA
Sbjct  91    TGGPGCSSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  ++ K    A++F+RKW  DHPE+L+N FY+GGDS+SG+ VP I + I++GNE
Sbjct  151   KNVTAH-RNDWKLVHHAHQFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G  PLINL+GY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y +    
Sbjct  210   KGLLPLINLQGYLLGNPITTYKE-DNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSR  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCW  613
             NELC +D+  FD+   GIN  +IL+ +C     +   + ++ L++S S    +P  E   
Sbjct  269   NELCLRDLQSFDECLSGINTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVP--ELSC  326

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
             Q++ +  +  WAN+  V+ ALH+R+G+IG+W  C  TD  +  ++  ++ +HANL+ +G 
Sbjct  327   QIYGFYLATKWANDENVRKALHIREGSIGKWERCYTTD--FEREIFSSVEFHANLSKKGY  384

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD +VP MST+AWI  LNYS VD  RPW   +G + G+TR+Y+N MTFAT+K
Sbjct  385   RSLIYSGDHDAVVPFMSTQAWIRDLNYSIVDDRRPWFV-NGQVGGYTRTYANRMTFATVK  443

Query  252   GSGHIAPFFSAYECLIMFERWIS  184
             GSGH AP ++  +C  MF RWIS
Sbjct  444   GSGHTAPEYTPEQCFPMFTRWIS  466



>ref|XP_010314600.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=463

 Score =   430 bits (1106),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 209/448 (47%), Positives = 298/448 (67%), Gaps = 25/448 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+++PG  +DGPLPF LETGYIG+G++EEVQ+FYYFVKS+++P  DP + W  GGPGC
Sbjct  23    SIVEYLPG--FDGPLPFYLETGYIGIGKSEEVQLFYYFVKSESDPRKDPLVLWLTGGPGC  80

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   +  E+GP+      Y G +P L  +P++WTK +++LF++ P   GF+YATT +A 
Sbjct  81    SSFTGLAYEVGPLDFGQKAYNGSLPILISSPYSWTKFASILFLEQPVNTGFSYATTSEAY  140

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  +  YEF+RKW  +HPE++ NPFYV GDS+SG+T+P+I ++I++G E G +PL
Sbjct  141   KCTDLQACDHVYEFLRKWLVNHPEFILNPFYVSGDSYSGITIPVIVQLISNGIEQGKEPL  200

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INLKGY LGNP  + +    Y++P ++GM LI  +LY+SL + CKG Y +   +N+ C +
Sbjct  201   INLKGYSLGNPL-TFSEESNYQVPYSHGMGLISNELYESLNEICKGEYLNIDPTNKQCVE  259

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMF--WYLR--  592
             +   F  L  GIN   ILE FC     G+D   +  S+R  L    F +Q +  +  R  
Sbjct  260   NFKMFKNLVSGINDQQILEPFC-----GTDSEEQYSSERRSLEEQYFIFQKYDDFICRES  314

Query  591   -------SDLWANNVAVQDALHVRKGTIGR-WCACNYTDI--GYTADMTDALPYHANLTT  442
                    S+ WAN+  VQ+ALHVRKGTI R W  C  + +   YT    +++PYH NL++
Sbjct  315   RVATRKLSNYWANDPRVQEALHVRKGTIRRTWARCRQSILSTSYTVTFMNSIPYHVNLSS  374

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD++VP  ST+AWI  LNYS +D WRPW   DG + G+TRS+SN+MTFA
Sbjct  375   KGYRSLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTV-DGQVEGYTRSFSNHMTFA  433

Query  261   TLKGSGHIAPFFSAYECLIMFERWISGQ  178
             T+KG GH AP +   E   MF+RWI+ Q
Sbjct  434   TIKGGGHTAPEYKRKESFHMFKRWIAQQ  461



>ref|XP_003593859.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES64110.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=469

 Score =   430 bits (1106),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 294/449 (65%), Gaps = 24/449 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG Q  GPLPF LETGY+GVGE E+VQVFYYF++S+ NP  DP I W  
Sbjct  27    VATCGSIVKFLPGFQ--GPLPFALETGYVGVGEKEDVQVFYYFIESEKNPKDDPLILWLT  84

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCSAL  ++ EIGP+ ++  +Y G +P L L  H+WTKVS+++F+DLP   GFTYAT
Sbjct  85    GGPGCSALSGLMLEIGPLELKKEEYNGSLPNLILRQHSWTKVSSIIFVDLPVSTGFTYAT  144

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T+     S+     Q Y+F+RKW  DHP++ +N  Y+ GDS+SG+ +P+I + IA+GNE 
Sbjct  145   TESGTKRSDSILVHQTYQFLRKWLVDHPKFQSNEVYIAGDSYSGIPIPVIVQKIAEGNEK  204

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--N  775
             G +P INL+GY+LGN A +      Y IP A+GM LI  +LY SL+KNC G+Y +    N
Sbjct  205   GVQPWINLQGYLLGNAAIT-GKEKNYVIPFAHGMGLISDELYDSLQKNCNGDYINVETRN  263

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQR------------PVLP  631
              LC++D+  FD++T GI+  HILE  C  +    +  RRSL  +            P+L 
Sbjct  264   VLCSRDISSFDEVTSGIHEPHILEPSCEWLDNTENSPRRSLINKDPTNFLNTNLKLPLLS  323

Query  630   PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
                + + +  Y     WAN+  V+ ALH++KG++ +W  C + +I +  D+ ++  Y  N
Sbjct  324   CRSYTYFLMGY-----WANDDNVRKALHIQKGSVAKWHRCTF-NIPHKKDIPNSYDYLVN  377

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             L+ +G+R+LIYSGDHD+ +P ++T+AWI SLNYS VD WR W  +D  +AG+TR+YSN M
Sbjct  378   LSRKGIRSLIYSGDHDMKIPFLATQAWIRSLNYSIVDDWRQWHTNDQ-VAGYTRTYSNQM  436

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWIS  184
             TFAT+KG GH AP +   EC  MF RWIS
Sbjct  437   TFATVKGGGHTAPEYRPKECFDMFSRWIS  465



>ref|XP_010555479.1| PREDICTED: serine carboxypeptidase-like 7 [Tarenaya hassleriana]
Length=461

 Score =   430 bits (1105),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 295/450 (66%), Gaps = 14/450 (3%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVG-ENEEVQVFYYFVKSQTNPTTDP  1327
             +V +     GS V  +PG  ++GPLPFELETGY+GVG E EEVQ+FYYFVKS+TNP  DP
Sbjct  16    LVMIRHVGSGSVVKSLPG--FEGPLPFELETGYVGVGGEAEEVQLFYYFVKSETNPEEDP  73

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              + W  GGPGC++L  +  EIGP++ +V  Y GG+P L    ++WTK+++++F+D P   
Sbjct  74    LLVWLSGGPGCTSLSGLAYEIGPLAFKVDDYDGGVPSLASTSYSWTKIASIIFLDQPVGT  133

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             GF+Y+ T  AN  S+ +++EQ +EF+RKW  DHPE+++NPFYVGGDS+SG+ VP I + +
Sbjct  134   GFSYSRTPPANTPSDTRQAEQVHEFVRKWLVDHPEFVSNPFYVGGDSYSGIIVPAIVQQV  193

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
             + GNE G  PLIN++GY+LGNP++  +  H YRIP A+GM LI  +LY+SL++ C GNY+
Sbjct  194   SKGNEQGLVPLINIEGYVLGNPSTDDSFDHNYRIPYAHGMGLISDELYESLKRCCGGNYN  253

Query  786   HFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRR-----SLSQRPVLPP  628
             +    N  C + +  +D+    IN   IL   C       +   R      L    +  P
Sbjct  254   NVDPKNSECLRFLRDYDKCVSRINEAFILTPLCEFASPRPNLPERRRYLKGLVNATLSAP  313

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C+  + YL S  WANN  V+ ALHV KG++G+W  CN  D+ Y  D+  ++PYH N 
Sbjct  314   SSDCY-TYRYLLSSYWANNETVRRALHVVKGSVGKWVRCN-QDMPYDKDIESSIPYHVNN  371

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+L++SGDHDL VP + T+AWI SLNYS VD WRPW   D  +AG+TR+Y+N MT
Sbjct  372   SIKGYRSLVFSGDHDLFVPFLGTQAWIRSLNYSVVDDWRPWMITDQ-VAGYTRTYANEMT  430

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             FAT+KG GH    +   E  +MF+RWI+ Q
Sbjct  431   FATIKGCGHTVE-YKPEEGYVMFQRWITRQ  459



>ref|XP_002510077.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52264.1| serine carboxypeptidase, putative [Ricinus communis]
Length=468

 Score =   429 bits (1104),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 300/459 (65%), Gaps = 30/459 (7%)
 Frame = -2

Query  1503  MVSVVMAARG-----SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             M+ V++   G     S + ++PG Q  GPLPF LETGYIGV E+E+VQ+FYYFVKSQ N 
Sbjct  13    MLLVLLIGSGAAVSYSTIKYLPGFQ--GPLPFSLETGYIGVDESEDVQLFYYFVKSQRNA  70

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCS L  ++ EIGP++ EVV+Y G +P L LNPH+WT+V++++FID+
Sbjct  71    KEDPLLLWLTGGPGCSGLSGLLYEIGPLTFEVVEYNGSLPTLILNPHSWTQVASIIFIDI  130

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+YA T+ A  S+++ +  QA+ F+RKW  DHPE+L NP Y+ GDS+SG+T+P I
Sbjct  131   PVGTGFSYAQTQLAAYSTDLTQVHQAHLFLRKWLRDHPEFLANPVYIAGDSYSGITLPAI  190

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I++GNE GT+PLINL+GYI+GNP +  +      +P A+GM LI  +L++SL+++C 
Sbjct  191   VQHISNGNEKGTEPLINLQGYIIGNPVTDSSFDTNSGVPFAHGMGLISDELFESLKRSCG  250

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD------GLRRSLSQR  643
              +Y     SN  C Q +  FD+    +    ILE  C   G  S       G RRSL++ 
Sbjct  251   EDYVSIDPSNTECLQYLQDFDKCRSELQQGQILEPIC---GFASPKPFQLFGKRRSLNEN  307

Query  642   --------PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYT  487
                     P +P      + + Y  S +W ++ +V+ ALH+R+G++ +W  CNY  I Y 
Sbjct  308   SQYFLDIDPSIP--SIGCRTYAYTLSYIWVDDRSVRQALHIREGSVKQWLRCNY-GIPYA  364

Query  486   ADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGI  307
             +D+  ++ YHA L+ +G R+LIYSGDHD+IVP + T+ W+ SLNYS  D WRPW    G 
Sbjct  365   SDIPSSIKYHAYLSKKGYRSLIYSGDHDMIVPFLGTQGWVRSLNYSITDDWRPWKVQ-GQ  423

Query  306   IAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERW  190
             +AG+TR+YSN MTFAT+KG GH AP +   ECL MF+RW
Sbjct  424   VAGYTRTYSNRMTFATVKGGGHTAPEYKPAECLAMFKRW  462



>ref|XP_010320342.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Solanum 
lycopersicum]
Length=458

 Score =   427 bits (1099),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 208/437 (48%), Positives = 292/437 (67%), Gaps = 13/437 (3%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+++PGLQ  G LPF LETGY+G+G++ E+Q FYYF+ S++ PTT+P + W  GGPGC
Sbjct  24    SLVEYLPGLQ--GRLPFHLETGYVGIGKDNELQHFYYFLASESEPTTNPLLIWLTGGPGC  81

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+L AI+ EIGP+    + Y G +P  +LNPH  TK+++++F+D P   GF+YAT   A 
Sbjct  82    SSLSAIVNEIGPLRFAEL-YNGSLPTFELNPHALTKIASVIFLDQPVNTGFSYATNDAAY  140

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  E   EF+RKW +DHP++++NPFYV G+S+SG+T+P+IT++I++ N  G +PL
Sbjct  141   KYTDIQACEYVDEFLRKWLDDHPQFISNPFYVAGNSYSGMTIPVITQLISNRNAEGKEPL  200

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             INL+GY+LGNP  + +    Y IP ++GM LI  +LYKSLEKNCKG Y +    N  CA 
Sbjct  201   INLQGYLLGNPL-TFSQEKNYHIPFSHGMGLISDELYKSLEKNCKGEYTYMDPKNTRCAS  259

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV-LPPGEFCWQMFWYLRSDL  583
             ++  F+Q+   IN   IL   C        G RR L  + + L  G+ C    W      
Sbjct  260   EVRTFNQMISNINTKRILRPNCEEDPRKRSGQRRLLGHKLISLQRGDPC-AFDWRKLVKY  318

Query  582   WANNVAVQDALHVRKGTIGRWCAC----NYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
             WAN+  VQ+ALHVRKG IG W  C    + +   YT  + + +PYHANL+T+G R+LIYS
Sbjct  319   WANDPKVQEALHVRKGIIGSWMRCRRNISMSSGNYTITLNNVIPYHANLSTKGYRSLIYS  378

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD I+P  ST+AWI SLNY+  D WRPW  ++  ++G+TRSYSN MT+AT+KG+GH A
Sbjct  379   GDHDYIIPFQSTQAWIKSLNYTIDDDWRPWNVNNQ-VSGYTRSYSNKMTYATVKGAGHTA  437

Query  234   PFFSAYECLIMFERWIS  184
                   EC +MF+RWIS
Sbjct  438   CTDKPEECFVMFKRWIS  454



>dbj|BAF99694.1| 1-O-acylglucose:anthocyanin-O-acyltransferase [Clitoria ternatea]
Length=487

 Score =   429 bits (1102),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 218/452 (48%), Positives = 293/452 (65%), Gaps = 21/452 (5%)
 Frame = -2

Query  1500  VSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFI  1321
             +   +A+ G+ V+ +PG  +DGPLPF LETGY+GVGE E+VQVFYYFV+S+ NP  DP +
Sbjct  24    ICFQLASCGTIVEFLPG--FDGPLPFVLETGYVGVGEGEDVQVFYYFVESENNPNEDPLM  81

Query  1320  FWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGF  1141
              W  GGPGCSA   +  EIGP+  +  +Y GG+P L L PH+WTKVS+++F+DLP   GF
Sbjct  82    LWLTGGPGCSAFSGLALEIGPLIFKREEYNGGLPNLILRPHSWTKVSSIIFVDLPVSTGF  141

Query  1140  TYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIAD  961
             TYA T  A   S+      A+EF+RKW  DHP++L N  Y+GGDS+SG+ +P+I + I+ 
Sbjct  142   TYARTDAAAQRSDWTLVHHAHEFLRKWLIDHPKFLQNELYIGGDSYSGIPIPVIVQEISQ  201

Query  960   GNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF  781
              NE G +P INL+GYILGN A +      Y IP A+GM LI  +LY+SL KNCKG Y + 
Sbjct  202   ENEKGIQPWINLQGYILGN-AITTRREKGYSIPFAHGMALISDELYESLRKNCKGEYLNV  260

Query  780   --SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP----------V  637
                N LC++D+  + + T  I+  HILE  C   G     LRRS  QR            
Sbjct  261   DPENVLCSRDIDSYSKATSRISFAHILERTC-NSGDIKTSLRRSTIQRHHTKKFLNTNLK  319

Query  636   LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYH  457
             LPP     + +   +  LWAN+  V+ ALH+ KG+IG W  C+   + +T+D+ ++  YH
Sbjct  320   LPP--LTCRTYANFQCGLWANDDNVRSALHIHKGSIGEWHRCS-IRLPFTSDIPNSFEYH  376

Query  456   ANLTTRG-LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYS  280
              NL+ +G  R+LIYSGDHD++VP + T+AWI SLNYS VD WRPW   +G +AG+TR+YS
Sbjct  377   VNLSRKGYYRSLIYSGDHDMMVPFLGTQAWIRSLNYSIVDDWRPWNT-NGQVAGYTRTYS  435

Query  279   NNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             N MT+AT+KG GH AP F   EC  M+ RWIS
Sbjct  436   NRMTYATIKGGGHTAPEFKPEECFAMYSRWIS  467



>ref|XP_006356867.1| PREDICTED: serine carboxypeptidase-like 19-like [Solanum tuberosum]
Length=839

 Score =   440 bits (1131),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 223/445 (50%), Positives = 301/445 (68%), Gaps = 30/445 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG +  GPLPF+LETGY+GVG++E+VQ+FYYF++S+++P +DP + W  G
Sbjct  23    AIAGSPVKFLPGFK--GPLPFQLETGYVGVGDSEDVQLFYYFIESESDPDSDPLMLWITG  80

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSAL  +I EIGPI+ E V+Y G +P + LNP++WTKV        P   GF+YATT
Sbjct  81    GPGCSALSGLIYEIGPITFEAVEYNGSLPTMILNPYSWTKV--------PVGTGFSYATT  132

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A  SS+++ ++ AY+F+RKWF DHPE+L NPFYVGGDS+SG TVP +T++IA  NE  
Sbjct  133   PAALQSSDLQATDHAYQFLRKWFVDHPEFLKNPFYVGGDSYSGRTVPFLTQIIAIKNEME  192

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P INLKGY+LGNP S+      Y+IP  +GM LI  +LY+SL+ +CKG Y +   SN 
Sbjct  193   VEPFINLKGYLLGNP-STFEGEANYKIPFTHGMALISDELYESLKTHCKGEYLNINPSNT  251

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGEFCWQMF-  604
             LC QD+  F +L +GIN  +ILE  C+          G RRSL ++        C Q+  
Sbjct  252   LCFQDVQTFKELLKGINVPYILEPKCVFASPRPHLLLGQRRSLDEK--------CHQLKC  303

Query  603   ---WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
                WY  S  WA++  V+DAL++RKGTIG+W  C   ++ Y   + +++PYH NL+ +G 
Sbjct  304   RTDWYKLSYHWADDDQVRDALNIRKGTIGKWERCA-RNLQYENMIFNSIPYHENLSRKGY  362

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD+ V  +ST++WI SLNYS VD WR W   D  +AG+TRSYSN MTFAT+K
Sbjct  363   RSLIYSGDHDMNVTFLSTQSWIRSLNYSIVDDWRAWTV-DNQVAGYTRSYSNQMTFATVK  421

Query  252   GSGHIAPFFSAYECLIMFERWISGQ  178
             G+GH AP +   ECL M  RW+S Q
Sbjct  422   GAGHTAPEYKPRECLAMLTRWMSYQ  446


 Score =   334 bits (857),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 240/374 (64%), Gaps = 21/374 (6%)
 Frame = -2

Query  1269  EIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA-RAGFTYATTKKANVSSNMKE  1093
             ++GPI+ E V+Y G +P + LNP++WTK     F      R  F YATT  A  SS+++ 
Sbjct  475   KLGPITFEAVEYNGSLPTMILNPYSWTKGGKYYFHRFTGGRLDFPYATTPAALQSSDLQA  534

Query  1092  SEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYI  913
             ++ AY+F+ KWF DHPE+L NPFYVGGDS+SG  VP + ++IA  NE   +P INLKGY+
Sbjct  535   TDHAYQFLHKWFVDHPEFLKNPFYVGGDSYSGRIVPFLAQIIAIKNEMEVEPFINLKGYL  594

Query  912   LGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDMGKFDQ  739
             LGNP  +      Y+IP A+GM LI  +LY+SL+ +CKG Y +   +N LC QD+  F +
Sbjct  595   LGNPL-TFEGEANYKIPFAHGMALISDELYESLKSHCKGEYLNINPNNTLCLQDVQTFKE  653

Query  738   LTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGEFCWQMF----WYLRSDLW  580
             L +GIN  +ILE  C+          G RRSL ++        C Q+     WY  S  W
Sbjct  654   LLKGINVHYILEPKCVFASPRPYLLFGQRRSLDEK--------CRQLKCRHDWYKLSYHW  705

Query  579   ANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDL  400
             A++  V+DAL++RKGTIG+W  C   ++ Y   + +++PYH NL+++  R+LIYSGDHD+
Sbjct  706   ADDDQVRDALNIRKGTIGKWERCA-RNLQYEKMIFNSIPYHENLSSKVYRSLIYSGDHDM  764

Query  399   IVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSA  220
              V  +ST++WI SLNYS VD WR W   D  +AG+TRSYSN MTFAT+KG+GH AP +  
Sbjct  765   NVTFLSTQSWIRSLNYSIVDDWRAWTV-DNQVAGYTRSYSNQMTFATVKGAGHTAPEYKP  823

Query  219   YECLIMFERWISGQ  178
              ECL M  RW+S Q
Sbjct  824   RECLAMLTRWMSYQ  837



>ref|XP_010320340.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Solanum 
lycopersicum]
Length=474

 Score =   428 bits (1100),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 206/445 (46%), Positives = 294/445 (66%), Gaps = 14/445 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V+++PGL   G LPF LETGYIGVG++EE+Q+FYYF++S++ PTTDP + W  G
Sbjct  29    AVSHSTVEYLPGLP--GRLPFPLETGYIGVGKDEELQLFYYFLESESEPTTDPLLIWLPG  86

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA+ AI+  IGP+      Y   MP   +NPH WTK+++++F+D P   GF+Y T 
Sbjct  87    GPGCSAVTAIVNGIGPLRFVEQVYDESMPSFVVNPHAWTKIASVIFLDQPINTGFSYVTN  146

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             + A   ++++  +  YEF+RKW NDHP+Y++NPFY+ G+S++G  +P++ ++I++GN AG
Sbjct  147   EAAYKQTDVQAFDYVYEFIRKWLNDHPKYISNPFYMSGNSYAGKMIPVVAQLISNGNTAG  206

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P +NL+GY++G+P +       Y++  +YGM LI  +LYKSLEKNC G Y +   +++
Sbjct  207   EEPFVNLQGYLMGSPGTFRPQEDNYQVLFSYGMGLISNELYKSLEKNCGGEYTNIDPNDK  266

Query  771   LCAQDMGKFDQLTRGINPTHILEDFC----IRVGTGSDGLRRSLSQRPVLPPGEFCWQMF  604
              CA D   F QL + IN  HILE FC    ++      G RR L  + +    +      
Sbjct  267   GCANDFLIFKQLVKNINGEHILEPFCTYDYLQGPYQMSGERRLLDDKLISSQSQDKCASD  326

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACN-YTDIG----YTADMTDALPYHANLTTR  439
             W      WAN+  VQ+ALH++KG+IG W  CN  + +G    YT  + + +PYHANL+ +
Sbjct  327   WRKHMKYWANDPKVQEALHIQKGSIGSWVQCNKISSVGSPPNYTLMIDNVVPYHANLSIK  386

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD  VP  ST+ WI SLNYS VD WRPW  ++  +AG+TRSYSN MTFAT
Sbjct  387   GYRSLIYSGDHDYSVPFQSTQKWIKSLNYSIVDDWRPWNVNNQ-VAGYTRSYSNKMTFAT  445

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KGSGH A  +   EC +MF+RWI+
Sbjct  446   VKGSGHTACRYKPEECFVMFKRWIN  470



>gb|KFK44962.1| hypothetical protein AALP_AA1G326200 [Arabis alpina]
Length=463

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 304/456 (67%), Gaps = 17/456 (4%)
 Frame = -2

Query  1521  QLYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN  1342
             Q+Y  S +SV  A   S + ++PG  ++GPLPF LETGYIGVGE E V++FYYF+KS+ N
Sbjct  15    QMYLLSQLSVESA---SVISYLPG--FEGPLPFHLETGYIGVGEGERVKLFYYFIKSENN  69

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P  DP + W  GGPGCS+L A+  EIGP+S++   Y GG+P L   P++WTK +N++F+D
Sbjct  70    PEKDPLLIWLTGGPGCSSLSALAFEIGPLSLKNEGYNGGLPSLISTPYSWTKEANIIFLD  129

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
              P   GF+Y+TT  A+  S+  E++QAYEF++KW   +PE+ +NPFY+GGDS SG+ VP+
Sbjct  130   QPVGTGFSYSTTPLADKPSDTGEAKQAYEFLQKWLVKYPEFASNPFYIGGDSHSGMVVPV  189

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             I ++I++GNE   KPLINLKGY+LGNP+++      YRIP A+ M LI  +LY+SL++ C
Sbjct  190   IVQLISNGNEHSYKPLINLKGYVLGNPSTNYEAYINYRIPFAHRMGLISDELYESLKRRC  249

Query  801   KGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFC--IRVGTGSDGLRRSLSQ---R  643
             KGNY     +N  C + M  +++    IN   IL   C        +D  RR L +    
Sbjct  250   KGNYVQIDPTNTQCLKLMDYYNKCVSRINEALILTPLCEFALPNPFTDIGRRDLKEFVHS  309

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
              +  P   C+  + YL +  WAN+  V+ ALHV KG+IG+W  C  TD+ Y  D+   +P
Sbjct  310   NLSLPSSHCYT-YRYLLATKWANDEDVRRALHVVKGSIGKWARCA-TDMAYDKDIKSTVP  367

Query  462   YHANLTTRG-LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             YH + + +G LR+LIYSGDHD++VP + T+AWI SLNYS +D WRPW  ++ ++ G+TR+
Sbjct  368   YHRSNSIKGNLRSLIYSGDHDMLVPYIGTQAWIKSLNYSIIDEWRPWLVNNQVM-GYTRT  426

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             Y+NNMTFAT+KG GH A  +   E  IMF+RWI GQ
Sbjct  427   YANNMTFATIKGGGHTAE-YKPEESFIMFQRWIRGQ  461



>ref|XP_003604928.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87125.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=470

 Score =   425 bits (1092),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 211/443 (48%), Positives = 296/443 (67%), Gaps = 17/443 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+ +PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS++NP  DP + W 
Sbjct  33    LEAYGSKVEQLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSESNPQKDPLMLWL  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+  A+  +IGP++ E+ +Y G MP L   P +WTK+ +++F+DLP   GF+YA
Sbjct  91    SGGPGCSSFSALFYQIGPVAFEIKEYDGSMPGLVSRPQSWTKLCSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                  +  S+ K   Q ++F+RKW  +HPE+L+N FY+GGDS+SG+ VP I + I++GNE
Sbjct  151   KN-VTDHRSDWKLVHQTHQFLRKWLIEHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINL+GY+LGNP ++      Y+I  A+GM LI  +LY SL++NCKG Y      
Sbjct  210   KGHQPLINLQGYLLGNPITTYRE-ENYQIQYAHGMGLISDELYASLQRNCKGEYIDVDSG  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCW  613
             NELC +D+  F +    IN  +IL+  C     +   + +  L  SLS R  +P  E   
Sbjct  269   NELCLRDLQYFHECLSAINEFNILDSNCEDDEHLWRRSLTQELNESLSSRLTVP--ELSC  326

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
             +++ Y  +  W +N +V+ ALH+R+GTIG+W  C   D  Y  D+  +  +HANL+ +G 
Sbjct  327   KIYGYYLATKWISNESVRKALHIREGTIGKWERCYMNDFEY--DIFGSFEFHANLSKKGY  384

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGD D +VP +ST+AWI +LNYS VD WRPW   D  + G+TR+YSN MTFAT+K
Sbjct  385   RSLIYSGDQDAVVPFISTQAWIRNLNYSIVDDWRPWFVKDQ-VGGYTRTYSNRMTFATVK  443

Query  252   GSGHIAPFFSAYECLIMFERWIS  184
             GSGH AP ++  +C  MF RWIS
Sbjct  444   GSGHTAPEYTPEQCFPMFTRWIS  466



>ref|XP_007159376.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
 gb|ESW31370.1| hypothetical protein PHAVU_002G233100g [Phaseolus vulgaris]
Length=480

 Score =   424 bits (1089),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 294/455 (65%), Gaps = 16/455 (4%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L   S     +A  GS V  +PG  ++GPLPF LETGY+GVGE+E+VQ FYYF++S+ NP
Sbjct  28    LLVQSTFFFQLARCGSTVKFLPG--FEGPLPFVLETGYVGVGESEDVQAFYYFIESENNP  85

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCSAL  ++ EIGP+  +  +Y G +P L    ++WTKVSN++F+DL
Sbjct  86    KEDPLLLWLTGGPGCSALSGLVFEIGPLGFKHEEYNGTLPNLFYRSYSWTKVSNIIFVDL  145

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GFTYATT+ A   S+     Q ++F+RKW  DHP +L+N  Y+GGDS+SG+ +P+I
Sbjct  146   PVFTGFTYATTESAAQRSDWMLVHQVHQFLRKWLIDHPTFLSNEVYIGGDSYSGIPIPVI  205

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G +P INL+GY+LGN A +    +  RIP ++GM LI  +LY SL+ NCK
Sbjct  206   VQEISQGNEKGVQPWINLQGYLLGN-ALTTRRENNSRIPFSHGMGLISDELYNSLQNNCK  264

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-----  640
             G Y      N LC +DM  F++ T GI+ ++IL   C  + T +   R  + + P     
Sbjct  265   GEYIDVDTKNVLCTRDMELFNETTSGISSSYILGPSCEVLDTETSWRRSLIRKYPSRNFL  324

Query  639   ---VLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDA  469
                +  P   CW   ++L S  WAN+  V+ ALH+R+G+IG+W  C+   I    D+  +
Sbjct  325   NSRLKLPSLSCWSYVYFLCS-FWANDDNVRTALHIRQGSIGQWRRCS-MHIPQKHDIPSS  382

Query  468   LPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTR  289
               YH NL+  G R+LIYSGDHDL++P ++T+AWI SLNYS VD WR W   DG +AG+TR
Sbjct  383   FEYHVNLSKMGYRSLIYSGDHDLLIPFLATQAWIRSLNYSIVDDWRQWHT-DGQVAGYTR  441

Query  288   SYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             +YSN MTFAT+KG+GH AP +   ECL M+ RW+S
Sbjct  442   TYSNRMTFATVKGAGHTAPEYKPKECLDMYSRWLS  476



>ref|XP_009761854.1| PREDICTED: serine carboxypeptidase-like 18 [Nicotiana sylvestris]
Length=429

 Score =   421 bits (1083),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 286/444 (64%), Gaps = 49/444 (11%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG  + GPLPFELETGYIGVG++E+VQ+FYYF+KS++NP +DP + W  
Sbjct  22    LAIAGSPVKLLPG--FKGPLPFELETGYIGVGDSEDVQLFYYFIKSESNPESDPLLLWIT  79

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCSAL  +I +IGPI+ E V+Y G +P +KLNP++WTKV++++F+DLP   GF+YA 
Sbjct  80    GGPGCSALSGLIYDIGPITFEPVEYNGSVPTMKLNPYSWTKVASIIFLDLPVGTGFSYAR  139

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A  SSN++ S+QAYEF+ KWF DHPE+L NP YVGGDS+SG+ VPIIT++IA  N+ 
Sbjct  140   TPAALQSSNLQASDQAYEFLYKWFLDHPEFLKNPLYVGGDSYSGMLVPIITQIIATKNKM  199

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G KP ++L                                  KSL +NCKG Y +   SN
Sbjct  200   GIKPFMDL----------------------------------KSLTRNCKGEYQNTDPSN  225

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGEF----C  616
               C QD+  F +L + IN  HIL+  C           G RR      +  P +F    C
Sbjct  226   TQCLQDVHTFQELLKRINNPHILDPKCQFASPKPHLLFGQRRYEKSDELNNPQQFPALKC  285

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              +  WY  S  WA++  V++ALH+RKGTIG+W  C    + Y   +  ++PYHANL+ +G
Sbjct  286   -RNDWYKHSTHWADDGQVREALHIRKGTIGKWVRC--ASLQYQKTVMSSIPYHANLSAKG  342

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHD +V ++ST+AWI SLNYS +D WRPW   D  +AG+TRSYSN MTFAT+
Sbjct  343   YRSLIYSGDHDKVVISLSTQAWIKSLNYSIIDDWRPWVI-DNQVAGYTRSYSNRMTFATV  401

Query  255   KGSGHIAPFFSAYECLIMFERWIS  184
             KG+GH AP +   ECL M +RW+S
Sbjct  402   KGAGHTAPEYKPRECLAMLKRWMS  425



>gb|KDO81471.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=468

 Score =   422 bits (1085),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 288/448 (64%), Gaps = 19/448 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+ + Q+FYYFVKS+ NP  DP + W  G
Sbjct  22    AASYSTVKFLPGFQ--GPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI+  VV+Y G +P L LNP++WTK +++LF+D P   G++YA T
Sbjct  80    GPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+ +Q  +F+RKW  DHPE L+NP Y+GGDS+SGL VP + + I++ NE  
Sbjct  140   PLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEED  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGN A+        +IP A+GM LI  +LY+SL+  C G Y +    NE
Sbjct  200   IKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNE  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSL-----SQRPVLP----P  628
             +C  D+  F +LT  I   HILE  C         S   RRSL     SQ  ++P    P
Sbjct  260   VCLNDIQAFSKLTSEIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLP  319

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C + + YL S  W N+  V+ AL +R G+ G W  CN+  + Y  ++  +  YH +L
Sbjct  320   TIGC-RTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNF-GLPYAREIHSSFSYHVSL  377

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             +T+G R+LIYSGDHD++VP + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN MT
Sbjct  378   STKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNRMT  436

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             +AT+KG GH AP +   EC  MF+RWI+
Sbjct  437   YATVKGGGHTAPEYRPAECYAMFQRWIN  464



>emb|CDP21038.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   422 bits (1086),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 225/472 (48%), Positives = 296/472 (63%), Gaps = 42/472 (9%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG  ++GPLPFELETGYIGV E+E+VQ+FYYFVKS++ P TDP + W  
Sbjct  22    LATAGSTVRFLPG--FEGPLPFELETGYIGVEESEDVQLFYYFVKSESIPETDPLVLWLS  79

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GG  C++   +  +IGPI  E V Y G +PKL LNP++WTK+ +++F+DLP  +GF+YA 
Sbjct  80    GGNCCTSFSGLAYQIGPIKFEEVLYNGTLPKLLLNPYSWTKLVSIIFVDLPVASGFSYAR  139

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T KA+ S+  +   QAYEF+RKW  DHPE++++P Y+GGDS +G+ VPI+T++I+DGNE 
Sbjct  140   TAKASQSTVSQACNQAYEFLRKWLVDHPEFISSPVYIGGDSKAGIRVPIVTQLISDGNEV  199

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G +P I LKGYILGNP ++  +   Y I   +GM LI  +LY+SL+ +CKG Y +   SN
Sbjct  200   GIEPHIYLKGYILGNPVTTPGD-GNYAIQFTHGMGLISDELYESLKLSCKGEYQNIDPSN  258

Query  774   ELCAQDMGKFD---------------------QLTRGINPTHILEDFCIRVGTGSDGL--  664
              LC Q+M  ++                     QL   IN  HILE  C       + L  
Sbjct  259   ALCLQNMQAYNQASNHFSASFVLLYFEKLVTIQLLSNINKAHILEPDCPYASPKPNNLFI  318

Query  663   -RRSLSQRPVLPPGE---------FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCA  514
              RRS  Q       E         F  +M  Y     WAN+ +VQ ALHVRK +IG W  
Sbjct  319   GRRSTIQVFCEKTRELKIQELAAPFTCRMDGYRLVYHWANDESVQKALHVRKESIGEWIR  378

Query  513   CNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSW  334
             CN     Y  ++ ++LPYHANL+ RG R+LIYSGDHD+IVP   T+AWI SLNYS +D W
Sbjct  379   CN-CRYPYIRNIGNSLPYHANLSIRGYRSLIYSGDHDMIVPHFGTQAWIKSLNYSIIDDW  437

Query  333   RPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             R W    G +AG+TR+Y+N MTFAT  G GHIAP +   EC  MFERWIS Q
Sbjct  438   RQWILQ-GQVAGYTRTYANKMTFAT--GGGHIAPEYKPAECQAMFERWISHQ  486



>gb|KDP41601.1| hypothetical protein JCGZ_16008 [Jatropha curcas]
Length=478

 Score =   422 bits (1084),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 216/476 (45%), Positives = 306/476 (64%), Gaps = 36/476 (8%)
 Frame = -2

Query  1521  QLYCSSMVSVVM------AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYF  1360
             + +CS    +V+      A   S V+++PG  ++G LPF+LETGY+GV E EEVQ+FYYF
Sbjct  5     KCFCSVFAVIVLQVGSGLAGSYSTVEYLPG--FEGELPFQLETGYVGVDEAEEVQLFYYF  62

Query  1359  VKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVS  1180
             +KS+ N   DP + W  GGPGCSAL  ++ EIGP++ EVV+Y G +PKL LNPH+WTK +
Sbjct  63    IKSEGNVKEDPLLLWLTGGPGCSALSGLLYEIGPLTFEVVEYNGSLPKLILNPHSWTKAA  122

Query  1179  NMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFS  1000
             +++F+D+P   GF+YA T+ A  SS++ +  QA +F+RKW  DHPE+L +P Y+ GDS+S
Sbjct  123   SIIFVDMPVGTGFSYAKTQPAYHSSDLIQVHQADQFLRKWLRDHPEFLPSPVYIAGDSYS  182

Query  999   GLTVPIITKMIADGNEAGTKPLIN-----------LKGYILGNPASSLNNVHEYRIPAAY  853
             G+ +P I + I++GNE G +PLIN           LKGYILGNP +  N     ++  A+
Sbjct  183   GIPLPAIVQQISNGNEEGMEPLINLKVLFKKKKKNLKGYILGNPITDPNFDTNSKVSYAH  242

Query  852   GMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGT  679
             GM LI  +LY+SL+++C+GNY     SN  C ++M  F++   G+   +ILE  C     
Sbjct  243   GMGLISDELYESLKRSCRGNYVDIEPSNTECLRNMQGFNKCVEGLQTGYILEPSCGFASP  302

Query  678   GSDGL---RRSLSQR--------PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGT  532
                 +   RRSL Q         P  P   F    + Y+ S +W N+ +V++ALH+R+G+
Sbjct  303   KPFEIFDKRRSLIQNSPDFLQIDPTYP--SFGCPAYGYVLSYIWVNDSSVREALHIREGS  360

Query  531   IGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNY  352
             I +W  CN T++ YT+D+  +L YH +L  +G R+LIYSGD D++VP + T+AWI SLNY
Sbjct  361   IEQWVRCN-TELSYTSDIPISLVYHVSLGKKGYRSLIYSGDQDMVVPFLGTQAWIRSLNY  419

Query  351   STVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             S VD WRPW    G IAG+TR+YSN MTFAT+KG GH AP +    C  MF+RW S
Sbjct  420   SIVDDWRPWLVR-GQIAGYTRTYSNQMTFATVKGGGHTAPTYKPEVCFAMFKRWKS  474



>ref|XP_004486284.1| PREDICTED: serine carboxypeptidase-like 12-like [Cicer arietinum]
Length=464

 Score =   421 bits (1083),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 290/453 (64%), Gaps = 27/453 (6%)
 Frame = -2

Query  1506  SMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDP  1327
             S +S  +A  GS V  +PG Q  GPLPF LETGY+GVGE E+V+VFYYF++S+ NP  DP
Sbjct  27    SHISFQLATCGSVVKFLPGFQ--GPLPFVLETGYVGVGEREDVEVFYYFIESEKNPKEDP  84

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              + W  GGPGCSAL  ++ EIGP+  +  +Y G +P L + PH+WTKVSN++F+DLP   
Sbjct  85    VMLWLTGGPGCSALSGLVFEIGPLEFKKEEYNGSLPNLIVRPHSWTKVSNIIFVDLPVFT  144

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             GFTYA T+ A   S+ K   Q ++F+RKW  DHP++ +N           + VP+I + I
Sbjct  145   GFTYAKTESATQRSDWKLIHQTHQFLRKWLVDHPKFQSNE----------IPVPVIVQEI  194

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
               GN+ G +P INL+GY+LGNP ++ N    Y IP A+GM LI  +LY+SL+KNC G+Y 
Sbjct  195   VQGNKKGVQPWINLQGYLLGNPITTRNE-RNYAIPFAHGMGLISDELYESLQKNCHGDYV  253

Query  786   HFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV--------  637
             +    N +C++D+  FD+ T G+N  HIL+  C  +       R  + + P         
Sbjct  254   NVETKNVVCSRDISSFDEATSGLNTAHILDPLCEWLDVEEAPRRSLIKKYPSKLFNTNLN  313

Query  636   LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYH  457
             LPP  +C + + Y     WAN+  V+ ALHVRKG+IG+W  C Y DI   +D+ ++  YH
Sbjct  314   LPP-LYC-RSYPYFLCGFWANDDNVRKALHVRKGSIGKWHRCTY-DIPRKSDVPNSYDYH  370

Query  456   ANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSN  277
              NL+ +G R+LIYSGDHD+ VP ++T+AWI SLNYS VD WR W  +D  +AG+ R+YSN
Sbjct  371   VNLSRKGYRSLIYSGDHDMTVPFLATQAWIRSLNYSIVDDWRQWRTNDQ-VAGYKRTYSN  429

Query  276   NMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
              MTFAT+KG GH AP F   EC  MF RWIS +
Sbjct  430   QMTFATVKGGGHTAPEFKPKECFEMFSRWISKK  462



>dbj|BAO04183.1| putative acyl-glucose-dependent anthocyanin acyltransferase [Delphinium 
grandiflorum]
Length=470

 Score =   421 bits (1083),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/441 (47%), Positives = 288/441 (65%), Gaps = 15/441 (3%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V ++PG  +DGPLPF LETGY+ +G+ +  ++FYYF +S+  P+ DP +FW  GGPGC
Sbjct  30    SIVRYLPG--FDGPLPFHLETGYVSIGDADGAELFYYFFQSENKPSDDPILFWFTGGPGC  87

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S L A+  E GP+S ++ KY G +P LKLNP++WTKVSN++F+D P   GF+Y+   K  
Sbjct  88    SGLSAVTFENGPLSFKISKYNGSLPTLKLNPYSWTKVSNIVFLDAPPGTGFSYSRNLKG-  146

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               S+ K S+Q Y F+RKW  DH ++L+NP Y+ GDS+SG+T+P I + I DG E+G + L
Sbjct  147   YPSDKKSSKQGYIFIRKWLVDHQKFLSNPLYISGDSYSGITIPPIGQYIFDGIESGDELL  206

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             IN KGY+LGNP + L   H  +IP A+GM L+ T+L++S++KNC G Y +    N  C +
Sbjct  207   INFKGYLLGNPKTDLYYDHNSKIPFAHGMALLSTELFESVKKNCGGEYYNADPENVQCRK  266

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSD-------GLRRSLSQRPVLPPG--EFCWQM  607
             D+    + T+G+N  HILE  C+ V   S+        L  +L      P G  EF  + 
Sbjct  267   DLQLVSECTKGVNDPHILEPKCLLVTPKSNKWNKRRSSLEMTLPNNLRFPFGIPEFGCRS  326

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRA  427
             + Y+ S  WAN+  VQ ALH+RK T+  W  CN   + Y  D   ++ YH  L+ +G R+
Sbjct  327   YGYMLSYYWANDKEVQKALHIRKDTVPEWIRCNQEGLNYLYDNISSIGYHLYLSRKGCRS  386

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             LIYSGDHD +VP +STE WITSLNYS  D WRPW    G +AG+TRSY+NNMTFAT+KG+
Sbjct  387   LIYSGDHDFLVPFLSTETWITSLNYSITDDWRPWFV-GGQVAGYTRSYANNMTFATVKGA  445

Query  246   GHIAPFFSAYECLIMFERWIS  184
             GH AP +  YEC  M ++W+S
Sbjct  446   GHTAPEYKPYECFSMMKKWLS  466



>ref|XP_006472322.1| PREDICTED: serine carboxypeptidase-like 18-like [Citrus sinensis]
Length=468

 Score =   421 bits (1083),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 215/448 (48%), Positives = 289/448 (65%), Gaps = 19/448 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+ + Q+FY+FVKS+ NP  DP + W  G
Sbjct  22    AASYSTVKFLPGFQ--GPLPFELETGYVGVGESGDAQLFYFFVKSEKNPREDPLLLWLTG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI+ +VV+Y G +P L LNP++WTK +++LF+D P   G++YA T
Sbjct  80    GPGCSAFSGLAYEIGPINFKVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+ +Q  +F+RKW  DHPE L+NP Y+GGDS+SGL VP + + I++ NE  
Sbjct  140   PLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEED  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGN A+        +IP A+GM LI  +LY+SL+  C G Y +    NE
Sbjct  200   IKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNE  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSL-----SQRPVLP----P  628
             +C  D+  F +LT  I   HILE  C         S   RRSL     SQ  ++P    P
Sbjct  260   VCLNDIQAFSKLTSEIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLP  319

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C + + YL S  W N+  V+ AL +R G+ G W  CN+  + Y  ++  +  YH +L
Sbjct  320   TIGC-RTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNF-GLPYAREIHSSFSYHVSL  377

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             +T+G R+LIYSGDHD++VP + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN MT
Sbjct  378   STKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNRMT  436

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             +AT+KG GH AP +   EC  MF+RWI+
Sbjct  437   YATVKGGGHTAPEYRPAECYAMFQRWIN  464



>dbj|BAF99698.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=484

 Score =   422 bits (1084),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 210/457 (46%), Positives = 298/457 (65%), Gaps = 17/457 (4%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             LY    +  V AA  + V  +PG +  GPLPFELETGYIGV + E VQ+FYYFVKS ++ 
Sbjct  29    LYLQHSLLQVEAADSTTVKFLPGFK--GPLPFELETGYIGVDKGENVQLFYYFVKSYSDY  86

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCSAL A   EIGPI+ E V   G +P+L LNP++WT+ ++++F+D 
Sbjct  87    QIDPLVLWMTGGPGCSALTAFAYEIGPIAFEEVFSNGDVPRLVLNPYSWTQEASIVFVDA  146

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y  + +A  S+ ++   Q Y+F++K+   HPE+L+NP YVGGDS++GL VP++
Sbjct  147   PVGTGFSYPRSXEAFRSTGLQTCNQIYQFLKKFLVHHPEFLSNPLYVGGDSYAGLFVPVV  206

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              ++IA GNE G +P INLKGY+LGNP ++  +V +YR+P ++GM +I  +LY+SL+ NC 
Sbjct  207   AELIAHGNENGIEPSINLKGYVLGNPLTTPYDV-DYRVPFSHGMGIISDELYESLKLNCN  265

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL----RRSLSQRPV  637
             G Y     +N  C  D+  F Q+  GI  +HILE +C+ V      L    +RSL +  +
Sbjct  266   GVYHDVDPTNTKCLNDIDTFKQVFHGIRRSHILEPYCVSVLPEQQMLSTERQRSLHENNL  325

Query  636   LPPGEFCWQMFWYLRSD------LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT  475
               P        +  R+D       WAN+  V++ALH+ KG+I  W  CN + + +   + 
Sbjct  326   RIPDVLNMHHTFRCRTDGYIPAYYWANDDRVREALHIHKGSIKNWVRCNRS-LPFEDSIR  384

Query  474   DALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGF  295
             + +PYHANL+ +G R+LIYSGDHD +VP M+T+AWI SLNYS VD WR W   +G +AG+
Sbjct  385   NVVPYHANLSKKGYRSLIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQWIV-EGQVAGY  443

Query  294   TRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             TR+Y+N MTFAT+KG GH AP +   EC  MF+RWI+
Sbjct  444   TRTYANQMTFATVKGGGHTAPEYKPKECKAMFKRWIT  480



>ref|XP_006433654.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
 gb|ESR46894.1| hypothetical protein CICLE_v10001055mg [Citrus clementina]
Length=468

 Score =   421 bits (1082),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 215/448 (48%), Positives = 287/448 (64%), Gaps = 19/448 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+ + Q+FYYFVKS+ NP  DP + W  G
Sbjct  22    AASYSTVKFLPGFQ--GPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI+  VV+Y G +P L LNP++WTK +++LF+D P   G++YA T
Sbjct  80    GPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+ +Q  +F+RKW  DHPE L+NP Y+GGDS+SGL VP + + I++ NE  
Sbjct  140   PLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEED  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              KPLINL+GYILGN A+        +IP A+GM LI  +LY+SL+  C G Y +    NE
Sbjct  200   IKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNE  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSL-----SQRPVLP----P  628
             +C  D+  F +LT  I   HILE  C         S   RRSL     SQ  ++P    P
Sbjct  260   VCLNDIQAFSKLTSEIEGAHILEPRCPFSSPKPRESSRKRRSLNVNEQSQEFLVPEPPLP  319

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C + + YL S  W N+  V+ AL +R G+ G W  CN+  + Y  ++  +  YH +L
Sbjct  320   TIGC-RTYGYLLSYYWNNDYNVRKALRIRLGSKGEWQRCNF-GLPYAREIHSSFSYHVSL  377

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             +T+G R+LIYSGDHD++VP + TEAWI SLNYS  D WRPW  H   +AG+TR+YSN MT
Sbjct  378   STKGYRSLIYSGDHDMMVPFLGTEAWIKSLNYSIADDWRPWILHSQ-VAGYTRTYSNRMT  436

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             +AT+KG GH AP +   EC  MF+RWI+
Sbjct  437   YATVKGGGHTAPEYRPAECYAMFQRWIN  464



>ref|XP_006342727.1| PREDICTED: uncharacterized protein LOC102585123 [Solanum tuberosum]
Length=913

 Score =   432 bits (1112),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/444 (48%), Positives = 297/444 (67%), Gaps = 16/444 (4%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+++PG  +DGPLPF LETGYIG+G++EEVQ+FYYF+KS+++P  DP + W  GGPGC
Sbjct  22    SIVEYLPG--FDGPLPFYLETGYIGIGKSEEVQLFYYFIKSESDPRKDPLLLWLTGGPGC  79

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   +  E+GP+      Y G +P L  + ++WTK +++LF+D PA  GF+YATT +A 
Sbjct  80    SSFTGLAYEVGPLDFGQKAYNGSLPILVSSSYSWTKFASILFLDQPANTGFSYATTSEAC  139

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  +QAYEF+RKW  +HPE++ NPFYV GDS+SG+TVP+I ++I+DG EAG +PL
Sbjct  140   KCTDLQACDQAYEFLRKWLINHPEFILNPFYVSGDSYSGITVPVIVQLISDGIEAGKEPL  199

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INLKGY LGNP  +      YRIP  +GM LI  +LY+SL + CKG+Y +   +N+LC +
Sbjct  200   INLKGYSLGNPV-TFPEEDNYRIPFCHGMGLISDELYESLNEFCKGDYINIGPTNKLCVE  258

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQRPVLPPGE--FCWQMFWYL  595
             +   F  L  GIN   ILE FC +       L   RRSL +  +    +   C +     
Sbjct  259   NFKMFKNLVSGINEQQILEPFCGKDSNRPHQLSSERRSLEEDFIFQKYDDLICRESRVAT  318

Query  594   R--SDLWANNVAVQDALHVRKGTIGR-WCACNYT--DIGYTADMTDALPYHANLTTRGLR  430
             R  S  WAN+  VQ+ALHVRKGTI R W  C  +     YT    +++PYH N++++G R
Sbjct  319   RKLSTYWANDPRVQEALHVRKGTIRRPWARCRQSIMSTSYTVTFMNSIPYHVNISSKGYR  378

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LIYSGDHD++VP  ST+AWI  LNYS +D WRPW   DG +AG+TRS+SN+MT+AT+KG
Sbjct  379   SLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWTI-DGQVAGYTRSFSNHMTYATVKG  437

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH  P +   E   MF+RWI+ Q
Sbjct  438   GGHTTPEYKREESFHMFKRWIAQQ  461


 Score =   422 bits (1084),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 213/445 (48%), Positives = 297/445 (67%), Gaps = 26/445 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+ +PG  +DGPLPF L+TGYIGVG++EEVQ+FYYFVKS+++P+ DPF+ W  GGPGC
Sbjct  480   SIVEFLPG--FDGPLPFYLQTGYIGVGKSEEVQLFYYFVKSESDPSQDPFLLWLTGGPGC  537

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   +  E+GP+      Y G +P L  +P++WTK +++LF++ P   GF+YATT  A 
Sbjct  538   SSFSGLAYEVGPLEFGQKAYNGSLPILVSSPYSWTKFASILFLEQPVNTGFSYATT-SAY  596

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  +  YEF+RKWF +HPE+++NPFYV GDS+SG+T+P+I ++I++G EAG +PL
Sbjct  597   KCTDLQACDHVYEFLRKWFVNHPEFISNPFYVSGDSYSGITIPVIVQLISNGIEAGKEPL  656

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INLKGY LGNP +     + Y+IP ++GM LI  +LY+SL + CKG+Y +   +N+ C +
Sbjct  657   INLKGYSLGNPITFFEESN-YQIPYSHGMGLISDELYESLNEFCKGDYINIDPTNKQCVE  715

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSD-------GLRRSLSQRPVLPPGEFCWQMFW  601
             +   F  L  GIN  HILE  C   GT +D         RRSL +  +            
Sbjct  716   NFKIFKNLVSGINNAHILEPEC---GTDTDFHPPQSSNERRSLEEDFICQESRVATNKL-  771

Query  600   YLRSDLWANNVAVQDALHVRKGTIGR-WCACNYTDIGYTA---DMTDALPYHANLTTRGL  433
                +  WAN+  VQ+ALHVRK TI R W  C  T I YT+      +++PYH NL+T+G 
Sbjct  772   ---ATYWANDQRVQEALHVRKDTIRRPWTRCKQT-IAYTSYKITFRNSIPYHVNLSTKGY  827

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD+IVP  ST+AWI  LNYS +D WRPW   DG + G+T+SYSN+MT+AT+K
Sbjct  828   RSLIYSGDHDMIVPFQSTQAWIKYLNYSIIDDWRPWMV-DGQVGGYTKSYSNHMTYATIK  886

Query  252   GSGHIAPFFSAYECLIMFERWISGQ  178
             G GH AP +   E   MF+RWI+ Q
Sbjct  887   GGGHTAPEYKREESFHMFKRWIAQQ  911



>gb|AES73172.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=496

 Score =   419 bits (1077),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 212/462 (46%), Positives = 296/462 (64%), Gaps = 23/462 (5%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENE----EVQVFYYFVKS  1351
             L  SS   V   ++ + V ++PG Q  GPLPF LETGY+GVGE E      ++FYYF++S
Sbjct  37    LQNSSTNLVFATSQFNIVKYLPGFQ--GPLPFVLETGYVGVGETETDENSAELFYYFLES  94

Query  1350  QTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNML  1171
             + NP  DP + W  GGPGCSA   +  EIGPI+ +  +Y G +P L L PH+WTKVSN++
Sbjct  95    ENNPKQDPLLLWLTGGPGCSAFSGLAFEIGPITFKNEEYNGSLPNLILRPHSWTKVSNII  154

Query  1170  FIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLT  991
             F+DLP   GF+Y  T+ A   S  K    A++F+RKW  DHP++++N  Y+ GDS+SGL 
Sbjct  155   FLDLPVGTGFSYPKTEGAAQQSTWKLVHNAHQFLRKWLIDHPKFISNEVYIAGDSYSGLP  214

Query  990   VPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
             +PII + I+ GNE G +P INL+GYILGNP +   +   Y+IP  +GM LI  +LY+SL+
Sbjct  215   IPIIVQEISYGNEGGLQPWINLQGYILGNPVTWPAHDDNYKIPFNHGMGLISDELYESLQ  274

Query  810   KNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGSDGLRRSLSQ  646
             KNC+G Y +    N  C +D+  + +   G+   HILE  C   +     ++G RR L  
Sbjct  275   KNCRGEYKNIDPQNVFCLEDIQSYQETISGVYEVHILESKCEFGLPNPLEANGRRRLLIH  334

Query  645   RP--------VLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGY  490
             +          LPP   C    ++L +  WAN+  VQ+ALH+RKG+IG+W  CN+ DI +
Sbjct  335   KANTIFTSSLTLPPLN-CRSHAYFLGA-YWANDANVQNALHIRKGSIGKWKRCNF-DIPF  391

Query  489   TADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDG  310
               ++ ++  YH NL+ +G R+LIYSGDHD+ VP ++T+AWI SLNYS VD WR W ++  
Sbjct  392   KHEIDNSFEYHVNLSRKGYRSLIYSGDHDMKVPFVATQAWIRSLNYSIVDDWRQWYSNSQ  451

Query  309   IIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
              +AG+TR+YSN MTFAT+KG+GH AP +   ECL M  RWIS
Sbjct  452   -VAGYTRTYSNRMTFATVKGAGHTAPEYKREECLAMLSRWIS  492



>ref|XP_003604929.1| Serine carboxypeptidase [Medicago truncatula]
Length=923

 Score =   432 bits (1110),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 297/444 (67%), Gaps = 19/444 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS++NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSESNPQKDPLMLWI  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS++  ++ +IGP++ E  +Y G +P L   P +WTK+ +++F+DLP   GF+YA
Sbjct  91    TGGPGCSSISGLLYQIGPVAFENKEYDGSVPSLVSRPQSWTKLCSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  S+ K    A++F+RKW  DHPE+L+N FY+  DS+SG+ VP + + I++GNE
Sbjct  151   KNVTAH-RSDWKLVRDAHQFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINLKGY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y      
Sbjct  210   KGLQPLINLKGYLLGNPLTTFKE-QNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSG  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPG------EFC  616
             NELC +D+  F +   GIN  +IL+ +C          RRSL Q     P       E  
Sbjct  269   NELCLRDLQYFHECLSGINTFNILDSYC---EDDPHLWRRSLIQELKSSPSSHLKVPELS  325

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              Q++ +  +  WAN  +V+ ALH+R+GTIG+W  C   D  Y  D+  ++ +HANL+ +G
Sbjct  326   CQIYSFYLTTKWANEESVRKALHIREGTIGKWERCYMNDFEY--DIFGSVEFHANLSKKG  383

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHD +VP +ST+AWI +LNYS VD WRPW   +G + G+TR+YSN MTF T+
Sbjct  384   YRSLIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPWFV-NGQVGGYTRTYSNQMTFVTV  442

Query  255   KGSGHIAPFFSAYECLIMFERWIS  184
             KGSGH AP ++  +C  MF RWIS
Sbjct  443   KGSGHTAPEYTPDQCFGMFTRWIS  466


 Score =   401 bits (1031),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 208/444 (47%), Positives = 288/444 (65%), Gaps = 32/444 (7%)
 Frame = -2

Query  1449  LQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAII  1273
             L + GPLPFELETGY+G+GE ++++QVFYYFVKS+ NP  DP I W  GGPGCS+   + 
Sbjct  486   LVFQGPLPFELETGYVGLGETDDDMQVFYYFVKSENNPQKDPLILWLSGGPGCSSFSGLA  545

Query  1272  QEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKE  1093
              +IGP + E+ +Y G +P L L PH+WTK+S+++F+DLP  +GF+YA    A+  S+ K 
Sbjct  546   HQIGPFAFEIKEYNGSVPSLVLRPHSWTKLSSIMFVDLPLGSGFSYAKNVTAH-RSDWKL  604

Query  1092  SEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYI  913
                 ++F+RKW  DHPE+L N FY+G DS+SG+ VP I + I++GNE G +PLINL+GY+
Sbjct  605   VHHTHQFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYL  664

Query  912   LGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDMGKFDQ  739
             LGNP ++ +  + YRI  A+GM LI  +LY    +NCKG Y H    NELC++D+  FD+
Sbjct  665   LGNPFTT-HKEYNYRIQYAHGMGLISDELYS---RNCKGEYIHVDSKNELCSKDLRSFDE  720

Query  738   --------------LTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFC  616
                           L  GIN  +IL+  C      R    +  L  SLS    +P  E  
Sbjct  721   ASKPIIKRILCFSLLLSGINMDNILDSLCEDDMRRRRRPLTRELIPSLSSHLTVP--EIS  778

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
               ++ +  S  W+NN +V+ ALH+R+GT+G+W  C  TD  +  ++  ++ +HANL+ +G
Sbjct  779   CYIYGFYLSATWSNNESVRQALHIREGTVGKWYRCYNTD--FEKEIFSSVEFHANLSKKG  836

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSG  D IVP MST+AWI  LNYSTVD WRPW   +G + G+TR+ SN MTFAT+
Sbjct  837   YRSLIYSGVLDAIVPFMSTQAWIRDLNYSTVDDWRPWFV-NGQVGGYTRTCSNRMTFATV  895

Query  255   KGSGHIAPFFSAYECLIMFERWIS  184
             KGSGH AP  +  +C  MF RWIS
Sbjct  896   KGSGHTAPADAPEQCFAMFTRWIS  919



>ref|XP_010936155.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=476

 Score =   417 bits (1073),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 205/454 (45%), Positives = 294/454 (65%), Gaps = 22/454 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             C S VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS++ P  
Sbjct  30    CPSPVSAL-----NTITHLPG--FHGALPFYLETGYVKVDEVNDAQLFYYFIKSESKPEE  82

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCSA   ++ EIGP+  +V  YT G+P L  +P++WTKV N++F+D P 
Sbjct  83    DPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYHPYSWTKVCNIIFLDSPV  142

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++ +K+  + + K + Q + F+RKW  DHPE+L+NP Y+GGDS+SG+ VP++ +
Sbjct  143   GTGFSYSSVEKSYETGDTKAARQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQ  202

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G+  G + L NLKGYI+GNP +     +   +P A+GM LI  +LY+S +K+C G 
Sbjct  203   EIAKGDRDGDELLYNLKGYIVGNPGTDAKFDNGAFVPYAHGMGLISDELYESTKKSCGGE  262

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFC--------IRVGTGSDGLRRSLSQRPV  637
             Y    NE CA  +   ++   GIN   ILE  C        I        L+  + + P+
Sbjct  263   YASPRNEQCANHLQSINECIEGINTGQILEPLCFFASPKPSIVAAYSRRLLKEDIKEFPL  322

Query  636   LP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
             L    P E C + + YL S +WA+N  V++AL++ KGT+ +W  CNY  + Y  D+  +L
Sbjct  323   LKADLPLE-C-RTYGYLLSYIWADNDTVREALNIHKGTVQQWQRCNY-GLPYAHDVPSSL  379

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              +H NLT+ G RAL+YSGDHD+IVP + T+AWI SLN+S VD WRPW+A DG +AGFTR+
Sbjct  380   KFHLNLTSIGYRALVYSGDHDMIVPFVGTQAWIRSLNFSIVDDWRPWSA-DGQVAGFTRT  438

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             YSNN+TFAT+KG+GH AP +   ECL+M +RW+S
Sbjct  439   YSNNLTFATVKGAGHTAPEYRPKECLVMLQRWLS  472



>ref|XP_006356850.1| PREDICTED: serine carboxypeptidase-like 18-like [Solanum tuberosum]
Length=481

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/448 (47%), Positives = 290/448 (65%), Gaps = 27/448 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              + V  +PG  +DGPLPF LETGY+GVG+ E+ Q+FYYF+KS+++P  DP I W  GGPG
Sbjct  40    AATVKFLPG--FDGPLPFHLETGYVGVGKEEKHQLFYYFIKSESDPGNDPLILWLTGGPG  97

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+   ++ EIGP+  +  KY G +P L + P++WTKV+N++F++ P   GF+YATT +A
Sbjct  98    CSSFNGVVYEIGPLYYKQKKYNGSLPTLGVTPNSWTKVANIIFLEQPVNTGFSYATTPEA  157

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
                 ++   +  YEF+ KW  DHPE+ +N FY+GGDS+SG+ +P + + I+DG EAG+KP
Sbjct  158   MHVIDVDACKHVYEFLLKWLVDHPEFSSNNFYLGGDSYSGIVLPRVVQQISDGIEAGSKP  217

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY-DHF--SNELC  766
             LINLKGY+LGNP  +      + IP   GM ++P +LY+S+ +NCKG Y + F  +N  C
Sbjct  218   LINLKGYLLGNPL-TFPEEKNFVIPFLLGMGIVPNELYQSMVQNCKGEYREEFAPTNAQC  276

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSD----------GLRRSLSQRPVLPPGEFC  616
              QD+   D+L   IN  H+LE  C   G+ ++          G RRSL +  + P    C
Sbjct  277   TQDLDIVDELLNNINDQHVLEPMC---GSETELKSPFPSIFRGRRRSLQENAISPS---C  330

Query  615   WQMF--WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG--YTADMTDALPYHANL  448
             +      +  S+ WAN+  VQ ALHVRKGTI  W  C    I   YT    +++ YH N 
Sbjct  331   YGKLVDRHEISNYWANDPRVQKALHVRKGTIDHWARCKQNGIKKYYTFTSMESISYHVNH  390

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+LIYSGDHD+ VP  STEAWI SLNYS VD+WR W   +G +AG+TRSY+N MT
Sbjct  391   SAKGYRSLIYSGDHDMGVPFQSTEAWIKSLNYSIVDNWRQWIV-NGQVAGYTRSYANKMT  449

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             FAT+KG+GH+AP +   E   MF+RWIS
Sbjct  450   FATVKGAGHVAPEYKREESFNMFKRWIS  477



>ref|XP_003604927.1| Serine carboxypeptidase [Medicago truncatula]
Length=624

 Score =   421 bits (1083),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/443 (47%), Positives = 296/443 (67%), Gaps = 19/443 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+GE ++++QVFYYF+KS+ +P  DP + W 
Sbjct  33    IEAYGSKVEHLPGFQ--GPLPFELETGYVGLGETDDDMQVFYYFIKSENDPQKDPLMLWL  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   +  +IGP++ E+ +Y G +P L L P +WTK+ +++F++LP   GF+YA
Sbjct  91    TGGPGCSSFSGLAYQIGPVAFEIKEYDGSVPSLVLRPQSWTKLCSIIFVNLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                  +  S+ K     ++F+RKW  DHPE+L+N FY+G DS+SG+ VP I + I+ GNE
Sbjct  151   KN-VTDHRSDWKLVHHTFQFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAILQEISIGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINLKGY+LGNP ++ +    Y+IP  +GM LI  +LY SL++NCKG Y      
Sbjct  210   KGLQPLINLKGYLLGNPITT-HREKNYQIPFTHGMGLISDELYASLQRNCKGEYVDVDSR  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCW  613
             NELC +D+  +D+    ++  HIL+ FC     +   + +  L+ SL  R  +P  E   
Sbjct  269   NELCLRDLRSYDEAR--LDMFHILDRFCDDDPRLWRRSLTRELKESLISRLTVP--ELNC  324

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
             Q + +  S  WAN+  V+ ALH+R+GTIG+W  C   D  +  ++  +  +H NL+ +G 
Sbjct  325   QFYSFYLSTKWANDECVRKALHIREGTIGKWERCYSND--FENEILGSFEFHVNLSKKGY  382

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD +VP MST+AWI +LNYS VD WRPW   +G + G+TR+YSN MTFAT+K
Sbjct  383   RSLIYSGDHDAVVPFMSTQAWIRNLNYSIVDDWRPWFV-NGQVGGYTRTYSNRMTFATVK  441

Query  252   GSGHIAPFFSAYECLIMFERWIS  184
             GSGH AP ++  +C  MF RWIS
Sbjct  442   GSGHTAPEYTPEQCFAMFTRWIS  464



>ref|XP_003520964.1| PREDICTED: serine carboxypeptidase-like 11-like [Glycine max]
Length=462

 Score =   416 bits (1068),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 206/448 (46%), Positives = 297/448 (66%), Gaps = 20/448 (4%)
 Frame = -2

Query  1491  VMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFW  1315
             + +  GSKV+ +PG  ++GPLPFELETGY+G+GE ++++QVFYYFVKS+ +P  DP + W
Sbjct  19    ISSQLGSKVEVLPG--FEGPLPFELETGYVGLGEKDDDMQVFYYFVKSENDPQKDPLMLW  76

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS+   +  +IGP+  ++ +Y G +P L L P +WTKV N++F+DLP   GF+Y
Sbjct  77    LTGGPGCSSFSGLAFQIGPLRFKIEEYDGSVPNLILRPQSWTKVCNIIFVDLPFGTGFSY  136

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A    A   S+ K     ++F+RKW  DHPE+L+N FY+G DS+SG+  P I + I++GN
Sbjct  137   AKNLTAQ-RSDWKLVHHTHQFLRKWLIDHPEFLSNEFYMGADSYSGIPAPAIVQEISNGN  195

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS-  778
             E G +P INL+GY+LGNP ++ N  ++ +IP A+GM LI  +LY SL++NCKG Y++   
Sbjct  196   EKGLQPRINLQGYLLGNPITTRNEGND-QIPFAHGMGLISDELYASLQRNCKGEYENRDS  254

Query  777   -NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL--RRSLSQR-------PVLPP  628
              N LC +D+  +D+   GIN  +IL+ +C            RRSL+Q+        +  P
Sbjct  255   RNVLCLRDLKHYDECLSGINTFYILDRYCKSDSPKKHEAQWRRSLTQKFEASLNSHLRVP  314

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C Q+F +  +  WAN+ +V+ +LH+R+GTIG+W  C  TD  +   +  +  +H NL
Sbjct  315   DIRC-QIFGFFLATQWANDESVRKSLHIREGTIGKWERCYTTD--FEEQIFSSFEFHVNL  371

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+LIYSGDHD +VP MST+AWI +LNYS V+ WRPW   D  +AG+TR+YSN MT
Sbjct  372   SGKGYRSLIYSGDHDAVVPFMSTQAWIRALNYSIVEDWRPWLLEDQ-VAGYTRTYSNQMT  430

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             FAT+KGSGH AP +   E   MF RWI+
Sbjct  431   FATVKGSGHTAPEYKPEEGFAMFSRWIA  458



>gb|AES87130.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=470

 Score =   416 bits (1068),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 299/453 (66%), Gaps = 18/453 (4%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTN  1342
             L+   M++ + A+R SKV+H+PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS+ N
Sbjct  24    LFSLQMLTPLEASR-SKVEHLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSENN  80

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P  DP + W  GGPGCS+  A+  +IGP + E+ +Y G +P L   P +WTK+ N++F+D
Sbjct  81    PKKDPLMLWISGGPGCSSFSALAYQIGPFAFEIKEYNGSLPSLVSRPQSWTKLCNIIFVD  140

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
             LP   GF+YA   K +  S+ K     ++F+RKW  DHPE+L N FY+G DS+SG+ VP 
Sbjct  141   LPLGTGFSYAKNVK-DYRSDWKLVHNTHQFLRKWLIDHPEFLPNEFYIGADSYSGIPVPA  199

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             I + I++GNE G +PLINL+GY+LGNP ++      Y+I  A+GM LI  +LY SL++NC
Sbjct  200   ILQEISNGNEEGHQPLINLQGYLLGNPWTTYKE-DNYQIQYAHGMGLISDELYASLQRNC  258

Query  801   KGNYDHFS--NELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGS--DGLRRSLSQR  643
             KG Y      NELC +D+  F +   GIN  +IL   C   +R+   S    L  SLS R
Sbjct  259   KGEYIDVDSGNELCLRDLQYFHECLSGINKFNILASICKDDLRMWRRSLTQELNASLSSR  318

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
               +P  E   + + +  +  W ++ +V+ ALH+R+GTIG W  C  TD  +  ++   + 
Sbjct  319   LTVP--ELSCRDYGFYLATKWISDESVRKALHIREGTIGTWERCYTTD--FKREIFSTVE  374

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             +HANL+ +G R+LIYSGD DLIVP  ST+AWI  LNYS ++ WR W   +G +AG+TR+Y
Sbjct  375   FHANLSKKGYRSLIYSGDLDLIVPFRSTQAWIRDLNYSIIEDWRSWYV-NGQVAGYTRTY  433

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             SN MT+AT+KGSGHIAP ++   C  MF RWIS
Sbjct  434   SNRMTYATVKGSGHIAPEYTPELCFPMFSRWIS  466



>ref|XP_003604930.1| Serine carboxypeptidase family protein [Medicago truncatula]
Length=981

 Score =   431 bits (1109),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 216/445 (49%), Positives = 298/445 (67%), Gaps = 23/445 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+G+ N+++QVFYYFVKS+ NP  DP + W 
Sbjct  117   LEAYGSKVEHLPGFQ--GPLPFELETGYVGLGDSNDDMQVFYYFVKSENNPQKDPLMLWL  174

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   ++ EIGP + E+ +Y G +P L L P +WTK+SN++F+DLP   GF+YA
Sbjct  175   TGGPGCSSFSGLVYEIGPFAFEIKEYNGSVPSLVLRPQSWTKLSNIIFVDLPLGTGFSYA  234

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                  +  S+ K     Y+F+RKW  DHPE+L+N FY+G DS+SG+ VP + + I++GNE
Sbjct  235   KNVTYH-RSDWKLVHNTYQFLRKWLIDHPEFLSNEFYIGADSYSGIPVPAVLQEISNGNE  293

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFS  778
              G +PLINL+GY+LGNP ++ +    Y+I  A+GM LI  +LY SL++NCKG Y    + 
Sbjct  294   KGLQPLINLQGYLLGNPYTT-HKEDNYQIQYAHGMGLISDELYASLQRNCKGEYIDVDYR  352

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQR-------PVLPPGEF  619
             NELC +D+  FD+    IN  +IL+ FC      S   RRSL Q        P+  P   
Sbjct  353   NELCLRDLRSFDEAR--INKENILDGFC---EDDSRLWRRSLKQELGAPLSSPLTVPKLS  407

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
             C    +YL +  WAN+ +V+ ALH+R+G+IG+W  C  TD  +  ++  ++ +H NL+ +
Sbjct  408   CHIYRFYLATK-WANDESVRKALHIREGSIGKWERCYTTD--FEREIFSSVEFHVNLSKK  464

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGD DL+VP  ST+AWI  LNYS VD WR W   +G +AG+TR+YSN MTFAT
Sbjct  465   GYRSLIYSGDLDLVVPFQSTQAWIRDLNYSIVDDWRSWFV-NGQVAGYTRTYSNRMTFAT  523

Query  258   LKGSGHIAPFFSAYECLIMFERWIS  184
             +KGSGH AP  +  +CL MF RW S
Sbjct  524   VKGSGHTAPAVTPEQCLAMFTRWTS  548



>ref|XP_009382032.1| PREDICTED: serine carboxypeptidase-like 7 [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   415 bits (1066),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 203/438 (46%), Positives = 279/438 (64%), Gaps = 12/438 (3%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             + H+PG  +DGPLPF LETGY+ V E  +VQ+FYYF+KS+  P  DP + W  GGPGCS 
Sbjct  42    ITHLPG--FDGPLPFYLETGYVNVDEANDVQLFYYFIKSEREPKDDPLLLWLTGGPGCSG  99

Query  1287  LFAIIQEIGPISMEVVKYTGGM-PKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANV  1111
             L  +I EIGP+  +V  YT G+ P L   P +WTKVS+++F+D P   GF+Y T K+A  
Sbjct  100   LSGLIYEIGPLEFDVDGYTEGLLPSLLYKPTSWTKVSSIIFLDSPVGTGFSYTTCKQALK  159

Query  1110  SSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLI  931
             +S++K S   + F+RKW+ DHP ++ NP Y+ GDS+SG TVP++ + IADGNEAG    +
Sbjct  160   TSDIKSSVDVHTFLRKWYVDHPSFIANPLYIAGDSYSGFTVPVVAQYIADGNEAGYGVHL  219

Query  930   NLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQDMG  751
             NLKGY++GNP +  N   +  +  A+G   I  +LY+S +K+C G Y + SN  CA+ + 
Sbjct  220   NLKGYLVGNPCTDANYDGDAIVAYAHGFGFISDELYESAKKSCGGRYQNPSNAECARWVD  279

Query  750   KFDQLTRGINPTHILEDFCIR--------VGTGSDGLRRSLSQRPVLPPGEFCWQMFWYL  595
                Q   GIN   ILE  C          +      L  +LS+ P     +   + +WYL
Sbjct  280   TVKQDLSGINAAQILEPQCSFPESPKPNIITADRRRLLEALSELPTSNTNDPLCRNYWYL  339

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
              S  WANN  V+ AL +R+G++  W  C+     YT D+  ++ YH +LT+RG RAL+YS
Sbjct  340   LSHAWANNDTVRQALGIREGSVQIWLRCDIGLNNYTYDVLSSIKYHLSLTSRGYRALVYS  399

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHDL VP + T+AWI SLN+S VD WRPW+  +G +AGFTRSYSNN+TFAT+KG GH A
Sbjct  400   GDHDLTVPFLGTQAWIRSLNFSIVDDWRPWSV-EGQVAGFTRSYSNNLTFATVKGGGHTA  458

Query  234   PFFSAYECLIMFERWISG  181
             P +   EC  M +RW+SG
Sbjct  459   PEYQPKECFAMVQRWLSG  476



>ref|XP_010556479.1| PREDICTED: serine carboxypeptidase-like 19 [Tarenaya hassleriana]
Length=456

 Score =   414 bits (1064),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 295/446 (66%), Gaps = 15/446 (3%)
 Frame = -2

Query  1491  VMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             V+   GS V H+PG  +DGPLPFELETGY+GVGE+++VQ+FYYF+KS+ NP  DP + W 
Sbjct  16    VLVVSGSVVKHLPG--FDGPLPFELETGYVGVGESDDVQLFYYFIKSERNPQDDPLMIWL  73

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGP CS++  ++ E GP++ +  +Y G +P L     +WTKV++++++D PA +G++YA
Sbjct  74    TGGPACSSICGMLFENGPLAFKGEEYNGSVPTLVKTSFSWTKVASIIYLDSPAGSGYSYA  133

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
              T +A  SS+ K+  Q  +F+RKW  DH E+++NPFYVGGDS+SG  VP + + I+ GN 
Sbjct  134   RTTRAFESSDTKQMRQIDQFLRKWLTDHLEFVSNPFYVGGDSYSGKVVPGVVQQISRGNG  193

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFS  778
              G  PLINL+GY+LGNP +  N  + +RIP A+GM LI  +LY+SL+++C  +Y   H S
Sbjct  194   KGITPLINLQGYLLGNPLTDDNFDYNHRIPFAHGMGLISDELYESLQRSCGNDYFNMHPS  253

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGSDG---LRRSLSQRPVLPPGEFC  616
             N  C   +  +D     I    IL   C     + T  DG   L+ S +    LPP   C
Sbjct  254   NAECLNGLRAYDTCVSDIYTEQILLPNCEVDYVMPTRPDGRRELKESRANESSLPPPS-C  312

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
             +   ++L S  WAN+  V+ ALHV+KG IG+W  CN  +I YT D+  ++PYH N + +G
Sbjct  313   FTYRYFL-SAFWANDENVRRALHVKKG-IGKWKRCNTVNIPYTYDVASSVPYHLNNSRQG  370

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHDL+VP M+TEAWI  LN+  VD WRPW  +D  IAG+TR+YSN MTFAT+
Sbjct  371   FRSLIYSGDHDLMVPFMATEAWIRDLNFPIVDRWRPWMINDQ-IAGYTRTYSNKMTFATI  429

Query  255   KGSGHIAPFFSAYECLIMFERWISGQ  178
             KG GH A  +   EC +MF+RWI G+
Sbjct  430   KGGGHTAD-YRPDECGVMFKRWIDGE  454



>emb|CDP17360.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   414 bits (1063),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 214/466 (46%), Positives = 299/466 (64%), Gaps = 41/466 (9%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG  ++GPLPFELETGYIGVGE+E+VQ+FY+FVKS++NP TDP + W  
Sbjct  28    LAVAGSVVKFLPG--FEGPLPFELETGYIGVGESEDVQLFYHFVKSESNPQTDPLLIWLT  85

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS+   +   IGP+  + V   G +  L  NP++WTKV++++F+D P  AGF+YA 
Sbjct  86    GGPGCSSFGGLTSGIGPVKFQPVLCNGTLTALVTNPYSWTKVASIIFLDSPVGAGFSYAR  145

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T KA+ S++++ SE  YEF+RKW +D+PEY++N FY+GG S++G+TVPI+ +++++GN A
Sbjct  146   TAKASQSTDLQASEHNYEFLRKWLHDNPEYISNSFYIGGGSYAGITVPILAQLVSNGNVA  205

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G +P I+LKGY+LGNPA +      + IP A+   LI  +LY+SL+  CKG Y +   SN
Sbjct  206   GIEPHIHLKGYLLGNPAPTTQGDGNHAIPFAHRTALISDELYESLKVTCKGEYVNIDPSN  265

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRS--------------LSQ  646
               C +++  +++L   IN  H+LE  C  V    + L   RRS              L  
Sbjct  266   APCLKNIQAYNKLIDNINIEHVLEPTCPDVSPKPNSLFSGRRSTVETFYKKFEELDVLEF  325

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
              PV        ++ +Y     WAN+++VQ+ALH   GTI  W  CNY+ I YT +    +
Sbjct  326   NPVQCRAATAEKLIYY-----WANDMSVQEALH---GTIKEWVGCNYS-ILYTKNAGSVV  376

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYHANL+T+G R+LIYSGDHD+I P + TE WI SLNY  +D WR W  H G +AG+TR+
Sbjct  377   PYHANLSTKGYRSLIYSGDHDMISPYLGTEEWIRSLNYPIIDDWRQW-IHQGQVAGYTRT  435

Query  285   YSNNMTFATLK----------GSGHIAPFFSAYECLIMFERWISGQ  178
             Y+N MTFAT+K          G+GHIA +    EC  MF RWIS Q
Sbjct  436   YANKMTFATVKARNPSFSCFSGAGHIASYNKPAECRSMFGRWISYQ  481



>ref|XP_009771129.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Nicotiana 
sylvestris]
Length=437

 Score =   412 bits (1058),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 207/438 (47%), Positives = 280/438 (64%), Gaps = 33/438 (8%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V+ +PG  ++GPLPF LETGYIGVGE EEVQ+FYYF+KS++ PT DP + W  G
Sbjct  29    AASHSTVEFLPG--FEGPLPFHLETGYIGVGEYEEVQLFYYFLKSESEPTKDPILIWLSG  86

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+  A++ +IGP+  E  +Y G +PKL LNP++WTKV+N++F+D P  +GF+YATT
Sbjct  87    GPGCSSFTALVYQIGPLYFEPNEYNGSLPKLTLNPNSWTKVANIIFLDQPVNSGFSYATT  146

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                  S++++     Y+F+RKW   H E++ NP Y+GGDS+SG+TVP+IT++I++G EAG
Sbjct  147   STTFKSTDLQACHHIYQFLRKWLIKHQEFIRNPMYIGGDSYSGITVPVITQLISNGIEAG  206

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELC  766
              KP INLKGYILGNP S+    + Y +P A+GM LI  +LY                   
Sbjct  207   HKPSINLKGYILGNP-STFPLQYNYWVPYAHGMGLISDELY-------------------  246

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
                     QL  GIN  HILE  C          R    +R +        ++  +  S 
Sbjct  247   --------QLISGINKPHILEPSCGSDAESKRSFRLFGKRRSLYENYSTKCRVEVHRLST  298

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIG--YTADMTDALPYHANLTTRGLRALIYSG  412
              WAN+  VQ+AL+VRKG I RW  C  + +   YT    D++PYH  L+ +  R+LIYSG
Sbjct  299   YWANDPRVQEALNVRKGAITRWTRCRESIVNKTYTITFQDSIPYHVELSKKLYRSLIYSG  358

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+ +P  ST+ WI SLNYS VD WRPW + DG +AG+TRSYSN MTFAT+KG+GH+AP
Sbjct  359   DHDMGIPFQSTQFWIKSLNYSIVDEWRPW-SFDGQVAGYTRSYSNQMTFATVKGAGHVAP  417

Query  231   FFSAYECLIMFERWISGQ  178
              +   EC  MF+RW+S +
Sbjct  418   EYKPKECFTMFQRWLSHE  435



>ref|XP_010061646.1| PREDICTED: serine carboxypeptidase-like 2 [Eucalyptus grandis]
 gb|KCW68630.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=477

 Score =   413 bits (1062),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 204/447 (46%), Positives = 285/447 (64%), Gaps = 15/447 (3%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             V ++  GS++  +PG  ++GPLPF LETGY+ VGE+EE+Q+FYYF +S+ N   D    W
Sbjct  32    VQLSCCGSRLAFLPG--FEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLW  89

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCSAL  +I EIGP++  +  Y   +P+  LNP++WTK S+++F+D P   GF+Y
Sbjct  90    LTGGPGCSALSGLIYEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSY  149

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A    A  + + ++ +  ++F+R+W   HPE+++NP Y+GGDS+SGLT+PI+ + I DGN
Sbjct  150   AENPLAYETGDFRQVQHLHQFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGN  209

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HF  781
             + G  P IN++GY+LGNP +         +  A+GM LI  +LY+SL++ CKG+Y     
Sbjct  210   DEGKSPAINIQGYVLGNPLTDPAFDQNAPVLFAHGMGLISDELYESLKRTCKGHYQFSES  269

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVL--PPGEF-  619
             S+  C  D+  F Q T G+    ILE  C           G RRSL +   L   P +  
Sbjct  270   SDADCMNDLMAFHQCTSGLQTAQILEPLCGYASMKPGEMFGDRRSLLENFFLVREPTDLD  329

Query  618   --CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C + + Y  S  W N+  V++ALH+RKG+IG W  CN  ++ YT D++  L YHA L+
Sbjct  330   LGC-RTYGYRLSYSWTNDDNVREALHIRKGSIGDWQRCN-NELNYTNDISSTLQYHAKLS  387

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              RG R+LIYSGDHD+IVP M T+AWI SLNYS +D WR W    G +AG+TR+YSN MTF
Sbjct  388   ARGCRSLIYSGDHDMIVPFMGTQAWIRSLNYSIIDDWRSWMVR-GQVAGYTRTYSNGMTF  446

Query  264   ATLKGSGHIAPFFSAYECLIMFERWIS  184
             AT+KG GH AP +   EC  MFERWIS
Sbjct  447   ATVKGGGHTAPEYKPEECFAMFERWIS  473



>dbj|BAF99697.1| 1-O-acylglucose:anthocyanin-O-acyltransferase- like protein [Gentiana 
triflora]
Length=494

 Score =   414 bits (1063),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 210/467 (45%), Positives = 298/467 (64%), Gaps = 27/467 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             LY    +  V AA  + V  +PG +  GPLPFELETGYIGV + E VQ+FYYFVKS ++ 
Sbjct  29    LYLQHSLLQVEAADSTTVKFLPGFK--GPLPFELETGYIGVDKGENVQLFYYFVKSYSDY  86

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCSAL A   EIGPI+ E V   G +P+L LNP++WT+ ++++F+D 
Sbjct  87    QIDPLVLWMTGGPGCSALTAFAYEIGPIAFEEVFSNGDVPRLVLNPYSWTQEASIVFVDA  146

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y  + +A  S+ ++   Q Y+F++K+   HPE+L+NP YVGGDS++GL VP++
Sbjct  147   PVGTGFSYPRSXEAFRSTGLQTCNQIYQFLKKFLVHHPEFLSNPLYVGGDSYAGLFVPVV  206

Query  978   TKMIADGNEAGTKPLINLK----------GYILGNPASSLNNVHEYRIPAAYGMNLIPTD  829
              ++IA GNE G +P INLK          GY+LGNP ++  +V +YR+P ++GM +I  +
Sbjct  207   AELIAHGNENGIEPSINLKIFPSECFFDLGYVLGNPLTTPYDV-DYRVPFSHGMGIISDE  265

Query  828   LYKSLEKNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---  664
             LY+SL+ NC G Y     +N  C  D+  F Q+  GI  +HILE +C+ V      L   
Sbjct  266   LYESLKLNCNGVYHDVDPTNTKCLNDIDTFKQVFHGIRRSHILEPYCVSVLPEQQMLSTE  325

Query  663   -RRSLSQRPVLPPGEFCWQMFWYLRSD------LWANNVAVQDALHVRKGTIGRWCACNY  505
              +RSL +  +  P        +  R+D       WAN+  V++ALH+ KG+I  W  CN 
Sbjct  326   RQRSLHENNLRIPDVLNMHHTFRCRTDGYIPAYYWANDDRVREALHIHKGSIKNWVRCNR  385

Query  504   TDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPW  325
             + + +   + + +PYHANL+ +G R+LIYSGDHD +VP M+T+AWI SLNYS VD WR W
Sbjct  386   S-LPFEDSIRNVVPYHANLSKKGYRSLIYSGDHDAMVPFMATQAWIRSLNYSIVDEWRQW  444

Query  324   AAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
                +G +AG+TR+Y+N MTFAT+KG GH AP +   EC  MF+RWI+
Sbjct  445   IV-EGQVAGYTRTYANQMTFATVKGGGHTAPEYKPKECKAMFKRWIT  490



>ref|XP_006597032.1| PREDICTED: uncharacterized protein LOC100794342 isoform X1 [Glycine 
max]
Length=461

 Score =   412 bits (1060),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 206/435 (47%), Positives = 293/435 (67%), Gaps = 24/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PGL+  GPLPF LETGY+GVGE+E+VQ FYYF++S+ NP  DP + W  GGPG
Sbjct  47    GSIVKFLPGLE--GPLPFVLETGYVGVGESEDVQAFYYFIESENNPKEDPLMLWLTGGPG  104

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CSA   ++ EIGPI+ +  +Y G +P L L PH+WTKVS+++F+DLP   GFTYATT+ A
Sbjct  105   CSAFSGLVIEIGPIAFKNEEYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEFA  164

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
                S+  +  Q ++F+RKW  +HP +L+   Y+GGDS+SG+T+P I + I+ GNE G +P
Sbjct  165   TQRSDWIQVHQVHQFLRKWLIEHPNFLSTDVYIGGDSYSGITIPAIVQEISLGNEKGLQP  224

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNPA++  +   YRI  A+GM LI  +LY+SL+KNCKG Y +    N LC+
Sbjct  225   WINLQGYLLGNPATTRRH-ENYRISFAHGMGLISDELYRSLQKNCKGEYINVDTKNVLCS  283

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             +++  F+++T G++  +IL+  C  + T +   RRSL ++              Y R + 
Sbjct  284   RNIETFNEVTSGLSMVNILDPSCDWLDTETS-WRRSLLKK--------------YPRKNF  328

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
                ++ +  +L+ R GTIG+W  C + +I    D++ +  YH NL+ +G R+LIYSGDHD
Sbjct  329   LNTHLKLP-SLNCR-GTIGKWRRCTF-NIPNKEDISSSYEYHVNLSRKGYRSLIYSGDHD  385

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P + T+AWI+SLNYS VD WR W   DG +AG+TR+YSN MTFAT+KG GH AP + 
Sbjct  386   MKIPFLETQAWISSLNYSIVDDWRQWHT-DGQVAGYTRTYSNRMTFATVKGGGHTAPEYK  444

Query  222   AYECLIMFERWISGQ  178
               ECL MF RWIS +
Sbjct  445   PEECLAMFRRWISNK  459



>ref|XP_006415267.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
 gb|ESQ33620.1| hypothetical protein EUTSA_v10007571mg [Eutrema salsugineum]
Length=464

 Score =   412 bits (1059),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 202/444 (45%), Positives = 296/444 (67%), Gaps = 18/444 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + ++PG  ++GPLPF LETGYI VGE E+V++FYYF+KS+ NP  DP + W  GGPG
Sbjct  26    ASVISYLPG--FEGPLPFHLETGYIAVGEEEKVKLFYYFIKSENNPEEDPLLIWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             C++L A+  EIGP++ +     GG+  L    ++WTKV++++F+D P   GF+Y+TT  A
Sbjct  84    CTSLSALAFEIGPLTFKTEGNNGGLTSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPLA  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E++Q YEF+RKW  DHPE+++NPFYVGGDS++G+ VP I + I+ GNE G KP
Sbjct  144   DKPSDTGEAKQTYEFLRKWLVDHPEFVSNPFYVGGDSYAGVVVPAIVQQISIGNEHGYKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
             LINLKGY+LGNP +  ++ + YRIP A+GM LI  +LY+SL+++C+G+Y     SN  C 
Sbjct  204   LINLKGYVLGNPTTDYDSDYNYRIPYAHGMGLISDELYESLKRSCEGSYLKVDPSNTQCL  263

Query  762   QDMGKFDQLTRGINPTHILEDFC--------IRVGTGSDGLRRSLSQRPVLPPGEFCWQM  607
             + +  +D+    IN   IL   C         +   G   LR  +     L P + C+  
Sbjct  264   KLVEDYDKCISRINLALILTPLCDLESLNSFSKYHLGRRDLRELVHSHLPLQPRD-CYS-  321

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-R  430
             + YL +  WAN+  V+ ALHV KG+I +W  C++ D+ Y  D+  ++P+H N++ +G+ R
Sbjct  322   YRYLLATNWANDEDVRRALHVVKGSIAKWVRCDW-DMAYEKDIKSSIPFHQNISIKGIYR  380

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +L+YSGDHD++VP + T AWI SLNYS +D WRPW   + +I G+TR+Y+NNMTFAT+KG
Sbjct  381   SLVYSGDHDMMVPFLGTHAWIKSLNYSIIDHWRPWFVDNQVI-GYTRTYANNMTFATIKG  439

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH A  +   E  +MF++WI GQ
Sbjct  440   GGHTAE-YKPDESFMMFQKWIRGQ  462



>gb|KEH29042.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=887

 Score =   426 bits (1094),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 210/442 (48%), Positives = 295/442 (67%), Gaps = 19/442 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS++NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSESNPQKDPLMLWI  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS++  ++ +IGP++ E  +Y G +P L   P +WTK+ +++F+DLP   GF+YA
Sbjct  91    TGGPGCSSISGLLYQIGPVAFENKEYDGSVPSLVSRPQSWTKLCSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  S+ K    A++F+RKW  DHPE+L+N FY+  DS+SG+ VP + + I++GNE
Sbjct  151   KNVTAH-RSDWKLVRDAHQFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINLKGY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y      
Sbjct  210   KGLQPLINLKGYLLGNPLTTFKE-QNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSG  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPG------EFC  616
             NELC +D+  F +   GIN  +IL+ +C          RRSL Q     P       E  
Sbjct  269   NELCLRDLQYFHECLSGINTFNILDSYC---EDDPHLWRRSLIQELKSSPSSHLKVPELS  325

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              Q++ +  +  WAN  +V+ ALH+R+GTIG+W  C   D  Y  D+  ++ +HANL+ +G
Sbjct  326   CQIYSFYLTTKWANEESVRKALHIREGTIGKWERCYMNDFEY--DIFGSVEFHANLSKKG  383

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHD +VP +ST+AWI +LNYS VD WRPW   +G + G+TR+YSN MTF T+
Sbjct  384   YRSLIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPWFV-NGQVGGYTRTYSNQMTFVTV  442

Query  255   KGSGHIAPFFSAYECLIMFERW  190
             KGSGH AP ++  +C  MF R+
Sbjct  443   KGSGHTAPEYTPDQCFGMFTRY  464


 Score =   403 bits (1036),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 206/427 (48%), Positives = 284/427 (67%), Gaps = 27/427 (6%)
 Frame = -2

Query  1449  LQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAII  1273
             L + GPLPFELETGY+G+GE ++++QVFYYFVKS+ NP  DP I W  GGPGCS+   + 
Sbjct  479   LVFQGPLPFELETGYVGLGETDDDMQVFYYFVKSENNPQKDPLILWLSGGPGCSSFSGLA  538

Query  1272  QEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKE  1093
              +IGP + E+ +Y G +P L L PH+WTK+S+++F+DLP  +GF+YA    A+  S+ K 
Sbjct  539   HQIGPFAFEIKEYNGSVPSLVLRPHSWTKLSSIMFVDLPLGSGFSYAKNVTAH-RSDWKL  597

Query  1092  SEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYI  913
                 ++F+RKW  DHPE+L N FY+G DS+SG+ VP I + I++GNE G +PLINL+GY+
Sbjct  598   VHHTHQFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYL  657

Query  912   LGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDMGKFDQ  739
             LGNP ++ +  + YRI  A+GM LI  +LY SL++NCKG Y H    NELC++D+  FD+
Sbjct  658   LGNPFTT-HKEYNYRIQYAHGMGLISDELYSSLQRNCKGEYIHVDSKNELCSKDLRSFDE  716

Query  738   LTRGINPTHILEDFCIRVGTGSDGLRRSLS--QRPVLPPGEFCWQMFWYLRSDLWANNVA  565
             L  GIN  +IL+  C       D +RR      R ++P           L S L    ++
Sbjct  717   LLSGINMDNILDSLC------EDDMRRRRRPLTRELIPS----------LSSHLTVPEIS  760

Query  564   VQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTM  385
                ALH+R+GT+G+W  C  TD  +  ++  ++ +HANL+ +G R+LIYSG  D IVP M
Sbjct  761   CY-ALHIREGTVGKWYRCYNTD--FEKEIFSSVEFHANLSKKGYRSLIYSGVLDAIVPFM  817

Query  384   STEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLI  205
             ST+AWI  LNYSTVD WRPW   +G + G+TR+ SN MTFAT+KGSGH AP  +  +C  
Sbjct  818   STQAWIRDLNYSTVDDWRPWFV-NGQVGGYTRTCSNRMTFATVKGSGHTAPADAPEQCFA  876

Query  204   MFERWIS  184
             MF RWIS
Sbjct  877   MFTRWIS  883



>ref|XP_007136774.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
 gb|ESW08768.1| hypothetical protein PHAVU_009G072900g [Phaseolus vulgaris]
Length=464

 Score =   412 bits (1058),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 214/449 (48%), Positives = 294/449 (65%), Gaps = 18/449 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQ---VFYYFVKSQTNPTTDPFIF  1318
              A   S V  +PG  + GPLPF L+TGY+ VGE E  +   +FYYF+ S+ NP  DP + 
Sbjct  20    FATSHSTVRFLPG--FKGPLPFLLQTGYVEVGEGEAEENAELFYYFIHSENNPKEDPLLL  77

Query  1317  WKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFT  1138
             W  GGPGCSA   ++ EIGP+S E  +Y G +P LKL P +WTKVS+++F+DLPA  GF+
Sbjct  78    WLTGGPGCSAFSGLVFEIGPLSFENEEYNGSLPNLKLKPQSWTKVSSIIFLDLPAATGFS  137

Query  1137  YATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADG  958
             Y  T++A   S +K    A++F+RKW  DHPE+L+N  Y+ GDS+ GL +PI+ + I+ G
Sbjct  138   YPKTERAAPQSTLKLVRHAHQFLRKWLMDHPEFLSNEVYIAGDSYCGLPIPILVQEISYG  197

Query  957   NEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS  778
             N+ G +P INL+GY+LGNP ++ +    Y IP  +GM+LI  +LY+SL+KNC+G Y    
Sbjct  198   NQGGIQPWINLQGYLLGNPITT-STEKNYEIPFNHGMSLISDELYESLQKNCRGEYQKID  256

Query  777   --NELCAQDMGKFDQLTRGINPTHILEDFC----IRVGT-GSDGLRRSLSQR--PVLPPG  625
               N  CA+DM  +++   GI   H+LE  C    +R  T  S   RRSL+    P+  P 
Sbjct  257   PRNTFCARDMQSYEESISGIEIGHVLEPHCEESALRNPTEDSWNWRRSLAHETSPLTLPP  316

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C +   Y+ S  WAN+  V+ ALHVRKG+IG+W  CN+ DI +  D+  +  YH NL+
Sbjct  317   LSC-RNHAYVLSTYWANDDNVRKALHVRKGSIGKWKRCNH-DIPFETDIYTSFEYHLNLS  374

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R+LIYSGDHD++VP +ST+AWI +LNYS V  WR W  ++G +AG+TR+YSN MTF
Sbjct  375   RKGYRSLIYSGDHDMVVPLLSTQAWIRALNYSIVSDWRQW-YYNGQVAGYTRTYSNRMTF  433

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AT+KG GH AP F   ECL MF RWIS +
Sbjct  434   ATVKGGGHTAPEFRPEECLAMFMRWISNR  462



>gb|AES87126.2| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=905

 Score =   426 bits (1094),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 210/442 (48%), Positives = 295/442 (67%), Gaps = 19/442 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS++NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSESNPQKDPLMLWI  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS++  ++ +IGP++ E  +Y G +P L   P +WTK+ +++F+DLP   GF+YA
Sbjct  91    TGGPGCSSISGLLYQIGPVAFENKEYDGSVPSLVSRPQSWTKLCSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  S+ K    A++F+RKW  DHPE+L+N FY+  DS+SG+ VP + + I++GNE
Sbjct  151   KNVTAH-RSDWKLVRDAHQFLRKWLIDHPEFLSNEFYIAADSYSGIPVPALVQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINLKGY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y      
Sbjct  210   KGLQPLINLKGYLLGNPLTTFKE-QNYQIPYAHGMGLISDELYASLQRNCKGEYIDVDSG  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPG------EFC  616
             NELC +D+  F +   GIN  +IL+ +C          RRSL Q     P       E  
Sbjct  269   NELCLRDLQYFHECLSGINTFNILDSYC---EDDPHLWRRSLIQELKSSPSSHLKVPELS  325

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
              Q++ +  +  WAN  +V+ ALH+R+GTIG+W  C   D  Y  D+  ++ +HANL+ +G
Sbjct  326   CQIYSFYLTTKWANEESVRKALHIREGTIGKWERCYMNDFEY--DIFGSVEFHANLSKKG  383

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHD +VP +ST+AWI +LNYS VD WRPW   +G + G+TR+YSN MTF T+
Sbjct  384   YRSLIYSGDHDAVVPFISTQAWIRNLNYSIVDDWRPWFV-NGQVGGYTRTYSNQMTFVTV  442

Query  255   KGSGHIAPFFSAYECLIMFERW  190
             KGSGH AP ++  +C  MF R+
Sbjct  443   KGSGHTAPEYTPDQCFGMFTRY  464


 Score =   420 bits (1080),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 210/430 (49%), Positives = 291/430 (68%), Gaps = 15/430 (3%)
 Frame = -2

Query  1449  LQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAII  1273
             L + GPLPFELETGY+G+GE ++++QVFYYFVKS+ NP  DP I W  GGPGCS+   + 
Sbjct  479   LVFQGPLPFELETGYVGLGETDDDMQVFYYFVKSENNPQKDPLILWLSGGPGCSSFSGLA  538

Query  1272  QEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKE  1093
              +IGP + E+ +Y G +P L L PH+WTK+S+++F+DLP  +GF+YA    A+  S+ K 
Sbjct  539   HQIGPFAFEIKEYNGSVPSLVLRPHSWTKLSSIMFVDLPLGSGFSYAKNVTAH-RSDWKL  597

Query  1092  SEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYI  913
                 ++F+RKW  DHPE+L N FY+G DS+SG+ VP I + I++GNE G +PLINL+GY+
Sbjct  598   VHHTHQFLRKWLIDHPEFLPNEFYIGADSYSGIPVPPILQEISNGNEKGLQPLINLQGYL  657

Query  912   LGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDMGKFDQ  739
             LGNP ++ +  + YRI  A+GM LI  +LY SL++NCKG Y H    NELC++D+  FD+
Sbjct  658   LGNPFTT-HKEYNYRIQYAHGMGLISDELYSSLQRNCKGEYIHVDSKNELCSKDLRSFDE  716

Query  738   LTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWAN  574
             L  GIN  +IL+  C      R    +  L  SLS    +P  E    ++ +  S  W+N
Sbjct  717   LLSGINMDNILDSLCEDDMRRRRRPLTRELIPSLSSHLTVP--EISCYIYGFYLSATWSN  774

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
             N +V+ ALH+R+GT+G+W  C  TD  +  ++  ++ +HANL+ +G R+LIYSG  D IV
Sbjct  775   NESVRQALHIREGTVGKWYRCYNTD--FEKEIFSSVEFHANLSKKGYRSLIYSGVLDAIV  832

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P MST+AWI  LNYSTVD WRPW   +G + G+TR+ SN MTFAT+KGSGH AP  +  +
Sbjct  833   PFMSTQAWIRDLNYSTVDDWRPWFV-NGQVGGYTRTCSNRMTFATVKGSGHTAPADAPEQ  891

Query  213   CLIMFERWIS  184
             C  MF RWIS
Sbjct  892   CFAMFTRWIS  901



>ref|XP_011006024.1| PREDICTED: serine carboxypeptidase-like 3 isoform X2 [Populus 
euphratica]
Length=463

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/446 (47%), Positives = 283/446 (63%), Gaps = 19/446 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PGL+  GPLPF LETGY+GV E E+VQ+FYYF+KSQ NP  DP + W  G
Sbjct  19    AAARSIVKFLPGLK--GPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   ++ EIGPIS EV +Y G +P L LNP++WT+VS+++F+DLPA  GF+YA T
Sbjct  77    GPGCSAFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYART  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A   S+ K+   A +F+RKW  DH E+L NP Y+ GDS+SG  VP I + I++GN  G
Sbjct  137   PLALQRSDFKQVSHAEQFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDG  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +PL+N+KGYILGNP +        RIP A+GM LI  +LY+SL+K+C G Y     SN 
Sbjct  197   IEPLLNVKGYILGNPITDPTFDFNSRIPFAHGMGLISDELYESLKKSCAGEYQTIKPSNA  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ--------RPVLPPG  625
              C +++  FD+    I   HILE  C         + G RR L +        +P LP  
Sbjct  257   ECLKNVEAFDKCISDIEDAHILERKCPSDAPRLIETLGKRRYLRENPRELLHFKPDLP--  314

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
                 + + ++ +  WAN+  V+ ALHVR+G+I  W  CNY  + YT ++  ++ YH +L 
Sbjct  315   TIGCRAYGHVLAAYWANDDNVRKALHVREGSIEEWKRCNYK-LPYTYEIKSSIKYHIDLG  373

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R LIYSGDHD+  P + T+AWI  LNYS VD W+PW  + G +AG+TR+YS+ + F
Sbjct  374   IKGYRRLIYSGDHDMEAPFLGTQAWIRYLNYSVVDDWQPW-HYQGQVAGYTRTYSSQLAF  432

Query  264   ATLKGSGHIAPFFSAYECLIMFERWI  187
             AT+KG GH AP +   EC  MF RWI
Sbjct  433   ATVKGGGHTAPAYRPAECFAMFGRWI  458



>dbj|BAO04182.1| hypothetical protein [Delphinium grandiflorum]
Length=475

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 212/447 (47%), Positives = 286/447 (64%), Gaps = 18/447 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGV-GENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             A   S V ++PG  +DGPLPFELETGY  V  E   V++FYYF+ S++ P+ DP +FW  
Sbjct  30    ALAQSIVRYLPG--FDGPLPFELETGYTSVVDEYGGVEMFYYFISSESKPSDDPLLFWFT  87

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS   +I  E GP+S ++ KY G +P LKLNP +WTKVSN++F D P   GF+Y+ 
Sbjct  88    GGPGCSGFSSIAFENGPVSFKITKYNGSLPTLKLNPFSWTKVSNIVFFDAPIGTGFSYSN  147

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
                 +  S+ K S+QAY  +RKW  DHP++L+N  YVGGDS+SG TVPI  + I++G EA
Sbjct  148   NLN-DYPSDKKSSKQAYNVIRKWLIDHPKFLSNAMYVGGDSYSGKTVPITVQHISNGIEA  206

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--N  775
             G K LIN KGY+LGNP +  +      I  A+GM +I  +L++S+ KNCKG Y + +  N
Sbjct  207   GDKLLINFKGYLLGNPITDPDLGEYSTIQFAHGMGIISEELFESITKNCKGEYVNINPDN  266

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQR-------PVLPPG  625
               C +D+ +  + T G+N  HILE  C+ V    + +   RR L +        P + PG
Sbjct  267   VKCTKDIQRVSKCTNGLNRAHILEPHCLLVTPKPNEIIKERRLLEKNSPTTFALPPVDPG  326

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C + + Y+ S  WAN+  VQ AL +RKG +  W  CN  D+ Y  D+  +  YH NL+
Sbjct  327   FEC-RSYGYMLSYYWANDKEVQKALKIRKGMVQEWVRCNKEDLHYVYDVKASTGYHLNLS  385

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R+LIYSGDHD+IVP M TEAWI SLNYS +D WR W    G +AG+TR+Y+NNMTF
Sbjct  386   RKGYRSLIYSGDHDMIVPYMGTEAWIKSLNYSIIDDWRSWFV-GGQVAGYTRTYANNMTF  444

Query  264   ATLKGSGHIAPFFSAYECLIMFERWIS  184
             AT+KG GH AP +   ECL M +RW+S
Sbjct  445   ATVKGGGHTAPEYKPCECLAMLKRWLS  471



>ref|XP_010936150.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
 ref|XP_010936151.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=476

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 290/455 (64%), Gaps = 22/455 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             C S VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS++ P  
Sbjct  30    CPSPVSAL-----NTITHLPG--FHGTLPFYLETGYVKVDEVNDAQLFYYFIKSESKPEE  82

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCSA   ++ EIGP+  +V  YT G+P L  NP++WTKV N++F+D P 
Sbjct  83    DPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNIIFLDSPV  142

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++ +K+  + + K ++Q + F+RKW  DHPE+L+NP Y+GGDS+SG+ VP++ +
Sbjct  143   GTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQ  202

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G+  G + L NLKGY++GNP +     +   +P A+GM LI  +LY+S +K+C G 
Sbjct  203   EIAKGDRDGDELLYNLKGYLVGNPVTDEKFDNGAFVPYAHGMGLISDELYESTKKSCGGE  262

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFC--------IRVGTGSDGLRRSLSQRPV  637
             Y    NE CA  +   ++   GIN   ILE  C        I        L+  + +  +
Sbjct  263   YASPRNEQCANYLQSINECIEGINEGQILEPVCFFVSPKPHIVAAYSRRLLKEDIKEFSL  322

Query  636   LP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
             L    P E C +   YL S  WA+N  V++ L++ KGT+  W  CNY  + Y  D+  +L
Sbjct  323   LKSDLPLE-C-RSSGYLLSYFWADNDTVREVLNIHKGTVQHWQRCNY-GLPYAHDIPSSL  379

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              +H NLT+RG RAL+YSGDHD++VP + T+AWI SLN+S VD WR W+A DG +AGFTR+
Sbjct  380   KFHLNLTSRGYRALVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWSA-DGQVAGFTRT  438

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISG  181
             YSNN+TFAT+KG GH AP +   ECL+M +RW+SG
Sbjct  439   YSNNLTFATVKGGGHTAPEYRPKECLVMLQRWLSG  473



>gb|KHN45135.1| Serine carboxypeptidase-like 19 [Glycine soja]
Length=471

 Score =   411 bits (1057),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 294/459 (64%), Gaps = 26/459 (6%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE---NEEVQVFYYFVKSQTNPTT  1333
             ++S  +A   + V  +PG Q  GPLPF LETGY+ VGE    E  ++FYYF++S+ +P  
Sbjct  16    LISSKLAECHNIVRFLPGFQ--GPLPFLLETGYVEVGETEAEEHAELFYYFIESENDPKG  73

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             +P + W  GGPGCSA   ++ EIGP++ +  +Y G +P L L P +WTKVS+++F+DLPA
Sbjct  74    NPLLLWLTGGPGCSAFSGLVFEIGPLTFKNEEYNGSLPNLTLKPQSWTKVSSIIFVDLPA  133

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y  T++A   S+ K    A++F+RKW  DHPE+L+N  Y+ GDS+ G+ VP+I +
Sbjct  134   GTGFSYPKTERAVQQSSSKLVRHAHQFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQ  193

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              I++GNE G +P I ++GY+LGNP ++ +    Y IP  +GM LI  +LY+SL+KNC+G 
Sbjct  194   EISNGNEGGMQPWIYIQGYLLGNPITT-STEKNYEIPFNHGMALISDELYESLQKNCRGE  252

Query  792   YDHFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRS---------  655
             Y +    N LC +DM  +++   GI   H+L   C      +D     RRS         
Sbjct  253   YRNIDPRNALCLRDMQSYEESISGIETGHVLAPLCDESDLRNDMEVTWRRSSLAHKTSAF  312

Query  654   LSQRPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI--GYTAD  481
              S R  LPP  +C +   Y+    WAN+  V+ ALHVRKG+IG+W  CN  D+   + AD
Sbjct  313   FSPRLTLPP-LYC-RSHAYVLCSYWANDDNVRKALHVRKGSIGKWTRCN-DDLKSKFNAD  369

Query  480   MTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIA  301
             +  +  YH NL+ +G R+LIYSGDHD++VP ++T+AWI SLNYS V  WR W  +DG +A
Sbjct  370   IPSSFQYHVNLSRKGYRSLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQW-YYDGQVA  428

Query  300   GFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             G+TR+YSN MTFAT+KG GH AP +   ECL MF RWIS
Sbjct  429   GYTRTYSNRMTFATVKGGGHTAPEYKPEECLAMFSRWIS  467



>ref|XP_003604933.1| Serine carboxypeptidase [Medicago truncatula]
Length=469

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 214/453 (47%), Positives = 299/453 (66%), Gaps = 19/453 (4%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTN  1342
             L+   M++ + A+R SKV+H+PG Q  GPLPFELETGY+G+GE N+++QVFYYFVKS+ N
Sbjct  24    LFSLQMLTPLEASR-SKVEHLPGFQ--GPLPFELETGYVGLGEANDDMQVFYYFVKSENN  80

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P  DP + W  GGPGCS+  A+  +IGP + E+ +Y G +P L   P +WTK+ N++F+D
Sbjct  81    PKKDPLMLWISGGPGCSSFSALAYQIGPFAFEIKEYNGSLPSLVSRPQSWTKLCNIIFVD  140

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
             LP   GF+YA   K +  S+ K     ++F+RKW  DHPE+L N FY+G DS+SG+ VP 
Sbjct  141   LPLGTGFSYAKNVK-DYRSDWKLVHNTHQFLRKWLIDHPEFLPNEFYIGADSYSGIPVPA  199

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             I + I++GNE G +PLINL+GY+LGNP ++      Y+I  A+GM LI  +LY SL++NC
Sbjct  200   ILQEISNGNEEGHQPLINLQGYLLGNPWTTYKE-DNYQIQYAHGMGLISDELY-SLQRNC  257

Query  801   KGNYDHFS--NELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGS--DGLRRSLSQR  643
             KG Y      NELC +D+  F +   GIN  +IL   C   +R+   S    L  SLS R
Sbjct  258   KGEYIDVDSGNELCLRDLQYFHECLSGINKFNILASICKDDLRMWRRSLTQELNASLSSR  317

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
               +P  E   + + +  +  W ++ +V+ ALH+R+GTIG W  C  TD  +  ++   + 
Sbjct  318   LTVP--ELSCRDYGFYLATKWISDESVRKALHIREGTIGTWERCYTTD--FKREIFSTVE  373

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             +HANL+ +G R+LIYSGD DLIVP  ST+AWI  LNYS ++ WR W   +G +AG+TR+Y
Sbjct  374   FHANLSKKGYRSLIYSGDLDLIVPFRSTQAWIRDLNYSIIEDWRSWYV-NGQVAGYTRTY  432

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             SN MT+AT+KGSGHIAP ++   C  MF RWIS
Sbjct  433   SNRMTYATVKGSGHIAPEYTPELCFPMFSRWIS  465



>emb|CDY59210.1| BnaA09g54030D [Brassica napus]
Length=468

 Score =   411 bits (1056),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 207/445 (47%), Positives = 295/445 (66%), Gaps = 20/445 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + H+PG  ++GPLPF LETGYIGVGE E+V++FYYF+KS+  P  DP + W  GGP 
Sbjct  30    ASVISHLPG--FEGPLPFHLETGYIGVGEEEKVKLFYYFIKSENKPEEDPLLIWLTGGPA  87

Query  1296  CSALFAIIQEIG-PISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK  1120
             C+AL A+  EIG P++ +   Y GG+P L    ++WTKV++++F+D P   GF+Y+TT  
Sbjct  88    CTALSALAFEIGRPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPL  147

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S+  E++Q YEF++KW  +HPE+++NP YVGGDS++G+ VP I + I+ GNE   K
Sbjct  148   ADKPSDTGEAKQTYEFLQKWLVEHPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNENSNK  207

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY---DHFSNEL  769
             P INLKGY+LGNP++ L+  H  +IP A+GM LI  +L++SL+ +C GNY   DH +N  
Sbjct  208   P-INLKGYVLGNPSTELDKDHNAKIPYAHGMGLISDELFESLKISCNGNYVNIDH-TNTQ  265

Query  768   CAQDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLRRSLS---QRPVLPPGEFCWQ  610
             C + +  +D+    IN   IL   C        +  +  RRSL    Q  +  P   C+ 
Sbjct  266   CLKLVEDYDKCVSRINEGSILIPLCDLASPNPFSMENAGRRSLERLVQSDLYLPTPGCY-  324

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-  433
             M+ Y+ +  WAN+  V+ AL V KG+IG+W  C++ D+ Y  D+  +LPYH N++ +GL 
Sbjct  325   MYRYVLATYWANDEDVRKALRVEKGSIGKWMRCDW-DMAYEKDIKSSLPYHMNISRKGLY  383

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+L+YSGDHD++VP + T AWI SLNYS +D WRPW   + +I G+TRSY NNMTFAT+K
Sbjct  384   RSLVYSGDHDMMVPYVGTVAWIRSLNYSIIDQWRPWFVDNQVI-GYTRSYVNNMTFATIK  442

Query  252   GSGHIAPFFSAYECLIMFERWISGQ  178
             G GH A  +  YE  +MF+RWI  Q
Sbjct  443   GGGHTAE-YKPYESFMMFQRWIRNQ  466



>emb|CDP06925.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   410 bits (1054),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 207/439 (47%), Positives = 286/439 (65%), Gaps = 56/439 (13%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG  ++GPLPFELETGYIGVGE+E+VQ+FY F+KS++NP +DP I W  
Sbjct  64    LAMAGSIVKFLPG--FEGPLPFELETGYIGVGESEDVQLFYAFIKSESNPQSDPLILWLD  121

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS+  ++   IGP+ +E + + G +PKL LNP TWTKV +++F+D PA  GF+YA 
Sbjct  122   GGPGCSSFSSLFFGIGPVILEPLSFDGTVPKLVLNPSTWTKVVSIIFLDSPAGTGFSYAK  181

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T +A+ SS+   S+QAYEF+RKW +DHPEY +NPFYVGG S+ G+ VPI+T++I++GNE 
Sbjct  182   TAQASQSSDFLASDQAYEFIRKWLHDHPEYKSNPFYVGGISYGGIPVPILTQLISNGNED  241

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HFSN  775
             G +P I+LKGYILGNP + ++ +  YR+P AYGM LI  +LY+SL+ +CKG Y+    SN
Sbjct  242   GIEPRIDLKGYILGNPVTKVSGLLNYRVPFAYGMGLISDELYESLKVSCKGEYEITDPSN  301

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYL  595
              +C+++M  +++ +      HI   F                                  
Sbjct  302   PVCSKNMQGYNEAS-----NHIYAIFI---------------------------------  323

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
                       VQ+ALHV + TIG+W +C    + YT +    +PYHANL+T+G R+LIYS
Sbjct  324   ----------VQEALHVLRETIGQWVSCR-DALPYTKNAGSVVPYHANLSTKGYRSLIYS  372

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHDL+VP + T+AWI SL+Y  +D WR W  H+G +AG+TR+Y+N MTFAT  G GH+A
Sbjct  373   GDHDLMVPHIETQAWIRSLHYPIIDDWRQW-IHEGQVAGYTRTYANKMTFAT--GGGHVA  429

Query  234   PFFSAYECLIMFERWISGQ  178
                   EC  M ERWIS Q
Sbjct  430   YELKPAECRTMLERWISHQ  448



>ref|XP_009114926.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Brassica rapa]
Length=468

 Score =   410 bits (1055),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 207/445 (47%), Positives = 295/445 (66%), Gaps = 20/445 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + H+PG  ++GPLPF LETGYIGVGE E+VQ+FYYF+KS+  P  DP + W  GGP 
Sbjct  30    ASVISHLPG--FEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENKPEEDPLLIWLTGGPA  87

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             C+AL A+  EIGP++ +   Y GG+P L    ++WTKV++++F+D P   GF+Y+TT  A
Sbjct  88    CTALSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPLA  147

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E++Q YEF++KW  +HPE+++NP YVGGDS++G+ VP I + I+ GNE   KP
Sbjct  148   DKPSDTGEAKQTYEFLQKWLVEHPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNENSNKP  207

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY---DHFSNELC  766
             + NLKGY+LGNP++ L+  H  +IP A+GM LI  +L++SL+ +C GNY   DH +N  C
Sbjct  208   M-NLKGYVLGNPSTELDKDHNAKIPYAHGMGLISDELFESLKISCNGNYVNIDH-TNTQC  265

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLRRSLS--QRPVLPPGEFCWQMF  604
              + +  +D+    IN   IL   C        +  +  RRSL   Q  +  P   C+ M+
Sbjct  266   LKLVEDYDKCVSRINEGSILIPLCDLASPNPFSMENAGRRSLERXQSDLYLPTPGCY-MY  324

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-RA  427
              Y+ +  WAN+  V+ ALHV KG+IG+W  C++ D+ Y  ++  +LPYH N++ +GL R+
Sbjct  325   RYVLATYWANDEDVRKALHVEKGSIGKWMRCDW-DMAYEKNIKSSLPYHMNISRKGLYRS  383

Query  426   LIY--SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             L+Y  SGDHD++VP + T AWI SLNYS +D WRPW   + +I G TRSY NNMTFAT+K
Sbjct  384   LVYSVSGDHDMMVPYVGTVAWIRSLNYSIIDQWRPWFVDNQVI-GNTRSYVNNMTFATIK  442

Query  252   GSGHIAPFFSAYECLIMFERWISGQ  178
             G GH A  +  YE  +MF+RWI  Q
Sbjct  443   GGGHTAE-YKPYESFMMFQRWIRNQ  466



>ref|XP_006581276.1| PREDICTED: serine carboxypeptidase-like 19-like isoform X2 [Glycine 
max]
Length=491

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 294/459 (64%), Gaps = 26/459 (6%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE---NEEVQVFYYFVKSQTNPTT  1333
             ++S  +A   + V  +PG Q  GPLPF LETGY+ VGE    E  ++FYYF++S+ +P  
Sbjct  36    LISSKLAECHNIVRFLPGFQ--GPLPFLLETGYVEVGETEAEEHAELFYYFIESENDPKG  93

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             +P + W  GGPGCSA   ++ EIGP++ +  +Y G +P L L P +WTKVS+++F+DLPA
Sbjct  94    NPLLLWLTGGPGCSAFSGLVFEIGPLTFKNEEYNGSLPNLTLKPQSWTKVSSIIFVDLPA  153

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y  T++A   S+ K    A++F+RKW  DHPE+L+N  Y+ GDS+ G+ VP+I +
Sbjct  154   GTGFSYPKTERAVQQSSSKLVRHAHQFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQ  213

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              I++GNE G +P I ++GY+LGNP ++ +    Y IP  +GM LI  +LY+SL+KNC+G 
Sbjct  214   EISNGNEGGMQPWIYIQGYLLGNPITT-STEKNYEIPFNHGMALISDELYESLQKNCRGE  272

Query  792   YDHFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRS---------  655
             Y +    N LC +DM  +++   GI   H+L   C      +D     RRS         
Sbjct  273   YRNIDPRNALCLRDMQSYEESISGIETGHVLAPLCDESDLRNDMEVTWRRSSLAHKTSAF  332

Query  654   LSQRPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI--GYTAD  481
              S R  LPP  +C +   Y+    WAN+  V+ ALHVRKG+IG+W  CN  D+   + AD
Sbjct  333   FSPRLTLPP-LYC-RSHAYVLCSYWANDDNVRKALHVRKGSIGKWTRCN-DDLKSKFNAD  389

Query  480   MTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIA  301
             +  +  YH NL+ +G R+LIYSGDHD++VP ++T+AWI SLNYS V  WR W  +DG +A
Sbjct  390   IPSSFQYHVNLSRKGYRSLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQW-YYDGQVA  448

Query  300   GFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             G+TR+YSN MTFAT+KG GH AP +   ECL MF RWIS
Sbjct  449   GYTRTYSNRMTFATVKGGGHTAPEYKPEECLAMFSRWIS  487



>ref|XP_010277008.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   409 bits (1052),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 284/439 (65%), Gaps = 35/439 (8%)
 Frame = -2

Query  1470  KVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCS  1291
             ++  +PG Q  GPLPFELETGY+ V E+E+V +FYYF+KS+ +P  DP + W  GGPGCS
Sbjct  29    RIQSLPGFQ--GPLPFELETGYVSVDESEDVHLFYYFIKSERDPKHDPLMLWLTGGPGCS  86

Query  1290  ALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANV  1111
             AL  ++ EIGP+ +E +KY G +P L LNP++WTK S+++F+D P   GF+Y+++ + + 
Sbjct  87    ALSGLLFEIGPLRIETMKYNGSLPSLALNPYSWTKASSIIFLDSPIGTGFSYSSSFQGSQ  146

Query  1110  SSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLI  931
             + ++K  +QAY+F+RKW  DHPE+L+N  Y+                   GN+AG +P I
Sbjct  147   TGDIKSCQQAYQFLRKWLMDHPEFLSNAVYI-------------------GNDAGEEPFI  187

Query  930   NLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQD  757
             N+KGY+LGNP + ++     ++P A+G+ L+  +LY+S + NC+G Y +   SN  C QD
Sbjct  188   NIKGYLLGNPVTDVSYDSNKQLPHAHGLGLVSDELYQSAKINCQGEYVNINPSNVQCLQD  247

Query  756   MGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSL--SQRPVLPPG----EFCWQMF  604
             M  F +   GIN  HILE  C           G RR L  + R +L P     EFC +  
Sbjct  248   MQAFSECLSGINTAHILEPLCGFASPKPKEKFGDRRYLEDNSREILDPQPSSTEFC-RTD  306

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRAL  424
              YL S  WAN+  V+ AL++RKG+IG W  CNY  + YTA++  +  YH NL+ +G R+L
Sbjct  307   GYLLSYYWANDDNVRKALNIRKGSIGEWRRCNY-GLSYTAEIQSSFSYHVNLSRKGYRSL  365

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             IYSGDHDLIVP ++T+AWI SLNYS VD WR W   DG + G+TR+YSNNMTFAT+KG G
Sbjct  366   IYSGDHDLIVPFLATQAWIHSLNYSIVDGWRSWVV-DGQVGGYTRTYSNNMTFATVKGGG  424

Query  243   HIAPFFSAYECLIMFERWI  187
             H AP +    CL M++RWI
Sbjct  425   HTAPEYQPKACLAMYKRWI  443



>ref|XP_007138067.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
 gb|ESW10061.1| hypothetical protein PHAVU_009G177800g [Phaseolus vulgaris]
Length=495

 Score =   411 bits (1057),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 289/449 (64%), Gaps = 20/449 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A+  S V  +PG  + G LPF LETGY+GVGE+E+VQ FYYF++S+ NP  DP + W  G
Sbjct  52    ASCASTVKFLPG--FPGSLPFVLETGYVGVGESEDVQTFYYFIESENNPKDDPLMLWLSG  109

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  +  +IGP++++  +Y G  P L     +WTKVS+++F+DLP   GFTYA T
Sbjct  110   GPGCSSLAGLFLQIGPVALKHEEYNGSTPNLISRTQSWTKVSSIIFVDLPVNTGFTYART  169

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             + A   S+     QA++F+RKW  DHP++L+N  Y+ GDS+SG+ VP I + IA GNE G
Sbjct  170   ELAAERSDTLLVHQAHQFLRKWLVDHPKFLSNEVYIAGDSYSGIPVPAIVQEIAQGNEKG  229

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P INL+GY+LGN  ++ +    +RIP A+GM LI  +LY+SL+++CKG+Y +    N 
Sbjct  230   VQPWINLQGYLLGNGFTTRSE-KNFRIPFAHGMGLISDELYESLQRSCKGDYINVDPKNL  288

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIR-VGTGSDGLRRSLSQR----------PVLPPG  625
              C +DM  F++L  GI   +ILE  C R  G     LRRSL ++            LPP 
Sbjct  289   PCHRDMESFNELLSGIFVYNILEPLCERDRGNKETSLRRSLLKKFPRKNFLKTHLKLPP-  347

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
              F    +       WAN+  V+ ALH+R+G+IG W  C  +DI +  D+  +  YH NL+
Sbjct  348   -FNCSSYEEFLCGYWANDHNVRTALHIREGSIGTWRRCP-SDIPFKYDILSSFEYHVNLS  405

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R+LIYSGDHD+ VP +ST+AWI SLNYS VD WRPW   +G +AG+TRSYSN MTF
Sbjct  406   RKGYRSLIYSGDHDMAVPFLSTQAWIRSLNYSIVDDWRPWHT-NGQVAGYTRSYSNQMTF  464

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AT+KG  HIAP     EC  M+ RWIS +
Sbjct  465   ATVKGGSHIAPMNKPEECFAMYTRWISKR  493



>gb|KEH29044.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=466

 Score =   410 bits (1054),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 294/448 (66%), Gaps = 27/448 (6%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GS+V+H+PG Q  GPLPFELETGY+G+GE ++++QVFYYFVKS+ NP  DP + W 
Sbjct  29    LEASGSRVEHLPGFQ--GPLPFELETGYLGLGETDDDMQVFYYFVKSENNPQKDPLMLWL  86

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   +  EIGP + E+ +Y G +P L L P +WTK+ +++F+DLP   GF+YA
Sbjct  87    SGGPGCSSFSGLAYEIGPFAFEIKEYDGSVPSLVLRPQSWTKICSIIFVDLPLGTGFSYA  146

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                  +  S+ K     ++F+RKW  DHPE+L+N FY+  DS++G+ VP I + I++GNE
Sbjct  147   KNVTDH-RSDWKLVYHTHQFLRKWLIDHPEFLSNEFYIVADSYAGIPVPAILQEISNGNE  205

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G +PLINL+GY+LGNP +S      YRI  A+GM LI  +LY SL+++CKG Y      
Sbjct  206   KGLQPLINLQGYLLGNPLTSYRE-DNYRIQYAHGMGLISDELYASLQRSCKGEYIDVDSR  264

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQR-------PVLPP  628
             NELC  D+  F +   GIN  +I+  FC       D L   RRSL+Q         +  P
Sbjct  265   NELCLGDLEYFHECLSGINLFNIVGSFC------EDDLHMWRRSLTQELNASLNSRLTVP  318

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C    +YL +  W ++ +V+ ALH+R+GTIG+W  C  TD  +  ++  ++ +HANL
Sbjct  319   ELRCRNYGFYLATK-WFSDESVRKALHIREGTIGKWERCYRTD--FEREIFSSVEFHANL  375

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+LIYSGDHD++VP +ST+AWI  LNYS VD WR W   +G + G+TR+YSN MT
Sbjct  376   SKKGYRSLIYSGDHDVVVPFISTQAWIRDLNYSIVDDWRSWFV-NGQVGGYTRTYSNQMT  434

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             +AT+KGSGHIAP ++   C  MF RWIS
Sbjct  435   YATVKGSGHIAPEYTPELCFPMFTRWIS  462



>emb|CDP21040.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   411 bits (1056),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 292/458 (64%), Gaps = 40/458 (9%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A+ GS V  +PG  ++GPLPFELETGYIGV E+E+VQ+FYYFVKS+++P TDP + W  
Sbjct  39    LASAGSPVKFLPG--FEGPLPFELETGYIGVDESEDVQLFYYFVKSESSPETDPLVLWLT  96

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GG  C++   +  EIGPI  E V Y G +PKL  NP++WTKV++++F+DLP  +GF+YA 
Sbjct  97    GGNCCTSFSGLAFEIGPIKFEQVLYHGTLPKLLSNPYSWTKVASIIFVDLPVASGFSYAR  156

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T KA+ S+ ++   QAYEF+RKW  DHPE++++P Y+GGDS+SG+TVPI+T++I+DGNE 
Sbjct  157   TAKASQSTVLQACNQAYEFLRKWLVDHPEFISSPVYIGGDSYSGITVPIVTQIISDGNEV  216

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G +P I+LKGY+LGNP ++  +   Y I  A+GM LI  +LY+SL+ +CKG Y +   SN
Sbjct  217   GIEPHIDLKGYLLGNPTTTPGD-GNYAIQFAHGMGLISDELYESLKLSCKGEYQNIDPSN  275

Query  774   ELCAQDMGKFD---------------------QLTRGINPTHILEDFCIRVGTGSDGL--  664
              LC Q+M  ++                     QL   I+  HILE  C       + L  
Sbjct  276   ALCLQNMEAYNQASNHFSASFVLLYFEKLVTIQLLSNIDTAHILEPDCPYASPKPNNLFI  335

Query  663   -RRSLSQ---------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCA  514
              RRS  Q         + +     F  +M  Y     WAN+ +VQ+ALHVRKG+IG W  
Sbjct  336   GRRSTIQVFCKKTRELKILELAAPFTCRMDGYRLVYHWANDESVQEALHVRKGSIGEWIR  395

Query  513   CNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSW  334
             CN     Y  ++ ++LPYHANL+ RG R+LIYSGDHD+IVP   T+AWI SLNYS +D W
Sbjct  396   CN-CRYPYIRNIGNSLPYHANLSIRGYRSLIYSGDHDMIVPHFGTQAWIKSLNYSIIDDW  454

Query  333   RPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSA  220
             R W    G +AG+TR+Y+N MTFAT+K      P    
Sbjct  455   RQWILR-GQVAGYTRTYANKMTFATVKARNSHFPLLQC  491



>ref|XP_006404766.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
 gb|ESQ46219.1| hypothetical protein EUTSA_v10000651mg [Eutrema salsugineum]
Length=435

 Score =   408 bits (1049),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 204/435 (47%), Positives = 280/435 (64%), Gaps = 26/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  23    GSVVKFLPG--FEGPLPFELETGYIGLGEEEEVQLFYYFIKSEKNPQEDPLLIWLTGGPG  80

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+LFA++ E GP++++   Y G +P L    ++WTK++N++F+D P   GF+Y+ T  A
Sbjct  81    CSSLFALLFENGPLALKFEVYNGSLPSLVSTSYSWTKMANIIFLDQPVGGGFSYSKTPLA  140

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E +  +EF++KW + HPE+ +NPFYV GDS+SG+ VP + + I+ GN    KP
Sbjct  141   NKVSDTGEVKIIHEFLQKWLSKHPEFFSNPFYVAGDSYSGMIVPPLVQEISKGNYLCCKP  200

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
             LINL+GYILGNP + + +   Y IP A GM LI  +LY+S+++ CK NY++    N  C 
Sbjct  201   LINLQGYILGNPITDIESERNYYIPYANGMALISDELYESMKRICKENYENVDSRNTECL  260

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             +    + + T  +N  HIL   C                  +  P  F ++   YL    
Sbjct  261   KLTEIYHKCTDKLNIYHILLPDC-----------------DMTSPDCFLYK---YLLLSK  300

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++ L V KG+IG W  CNY  I Y  D+   +PYH N +  G R+LIYSGDHD
Sbjct  301   WANDERVREVLLVNKGSIGEWRRCNYDIIPYNYDIKSTVPYHKNNSINGFRSLIYSGDHD  360

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             ++VP M+T+AWI SLNYS +D WRPW  +D  IAG+TR+Y+N MTFAT+KG GH A  + 
Sbjct  361   MVVPFMATQAWIRSLNYSIIDDWRPWMVNDQ-IAGYTRTYANKMTFATVKGGGHTAE-YK  418

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  419   PNETFIMFQRWISGQ  433



>ref|XP_006342726.1| PREDICTED: serine carboxypeptidase-like 11-like [Solanum tuberosum]
Length=466

 Score =   409 bits (1052),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 207/450 (46%), Positives = 297/450 (66%), Gaps = 25/450 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+++PG  +DGPLPF LETGYIGV ++EEVQ+FYYFVKS+++P  DP + W  GGPGC
Sbjct  22    SIVEYLPG--FDGPLPFYLETGYIGVAKSEEVQLFYYFVKSESDPKKDPILLWISGGPGC  79

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   ++ E+GP++     Y G +P L   P++WTK ++++F+D P   GF+YATT   +
Sbjct  80    SSFTGLVYEVGPLAFGQKAYNGSLPFLVSRPYSWTKFASIIFLDEPLNTGFSYATTSTGH  139

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++   Q YEF+RKWF +HPE+++N FYV GDS++G+TVP++ ++I++G E G +PL
Sbjct  140   NYTDLQACGQVYEFLRKWFINHPEFISNSFYVSGDSYAGITVPVMVQLISNGIEVGKEPL  199

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INLKGY LGNP +    V+ Y+IP  +GM LI  +LY+SL++ CKG Y +   ++  C++
Sbjct  200   INLKGYSLGNPKTFPEEVN-YKIPFCHGMGLISDELYESLKQTCKGEYLNIKSTHTPCSE  258

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSD--------GLRRSLSQRPV-LPPGEFCWQM  607
             ++  F +L  GI    +LE +C   GT S+          RRSL +  + L   +F ++ 
Sbjct  259   NLKIFKELVSGICDEQVLEPYC---GTYSEEPKLCQSSSERRSLEENFIFLNRDDFIYRR  315

Query  606   FWYLR----SDLWANNVAVQDALHVRKGTIGR-WCACNYT--DIGYTADMTDALPYHANL  448
                +     S  WAN+  VQ+ALHVRKGTI R W  C  +  D  Y     +++PYH NL
Sbjct  316   ISRVDTHNLSVYWANDPKVQEALHVRKGTIKRTWARCRQSIGDKSYAITFMNSIPYHTNL  375

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             +T+G R+LIYSGDHD++VP  ST+AWI  LNY  +D WRPW   D  + G+TRSYSN+MT
Sbjct  376   STKGYRSLIYSGDHDMVVPFQSTQAWIKFLNYPIIDDWRPWMV-DEQVGGYTRSYSNHMT  434

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +AT+KG GH AP     E   MF+RWIS Q
Sbjct  435   YATVKGGGHTAPEDRPEESFHMFKRWISQQ  464



>ref|XP_009784017.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Nicotiana 
sylvestris]
Length=457

 Score =   409 bits (1051),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 203/425 (48%), Positives = 288/425 (68%), Gaps = 22/425 (5%)
 Frame = -2

Query  1407  YIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTG  1228
             YIGVG++EEVQ+FYYFVKS+++P  DP + W  GGPGCS+   +  E+GP++     Y G
Sbjct  34    YIGVGKSEEVQLFYYFVKSESDPRKDPLLLWLTGGPGCSSFTGVAYEVGPLAFGQKAYNG  93

Query  1227  GMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDH  1048
              +P L   P++WTK +++LF++ P   GF+YATT  A+  ++++  +  YEF+ KWFN+H
Sbjct  94    SLPILVSTPYSWTKFASILFLEQPVNTGFSYATTSAASKCTDLQACDHVYEFLCKWFNNH  153

Query  1047  PEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYR  868
              E+++NPFYV GDS+SG+TVP+I ++I+DG EAG KPLINLKGY LGNP  +      Y+
Sbjct  154   QEFISNPFYVSGDSYSGITVPVIVQLISDGIEAGKKPLINLKGYSLGNPL-TFPEESNYQ  212

Query  867   IPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFC  694
             IP  +GM LI  +LY+SL++ CKG+Y +   +N+LC+++   F +L   IN   ILE FC
Sbjct  213   IPYCHGMGLISDELYESLKETCKGDYQNIDPTNKLCSENFKMFKKLVSRINDQQILEPFC  272

Query  693   IRVGTGSD--------GLRRSLSQRPV-LPPGEF-CWQMFWYLR--SDLWANNVAVQDAL  550
                GT S+        G RRSL    + L  G+F C +     R  S+ WAN+  VQ+AL
Sbjct  273   ---GTDSESPKPHQLSGERRSLEDNLISLRHGDFICRESRVATRKLSNHWANDPRVQEAL  329

Query  549   HVRKGTIGR-WCACNYTDIG--YTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMST  379
             HVRKGTI R W  C  + +G  YT    +++PYH NL+++G R+LIYSGDHD+++P  ST
Sbjct  330   HVRKGTIRRPWARCRQSIMGTTYTITFMNSIPYHVNLSSKGYRSLIYSGDHDMVIPFQST  389

Query  378   EAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMF  199
             +AWI  LNYS +D WRPW   DG +AG+TRS+SN++T+AT+KG GH AP +   +   MF
Sbjct  390   QAWIKYLNYSIIDDWRPWTI-DGQVAGYTRSFSNHITYATVKGGGHTAPEYKREDSFHMF  448

Query  198   ERWIS  184
             +RWI+
Sbjct  449   KRWIA  453



>ref|XP_006343161.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X2 [Solanum 
tuberosum]
Length=449

 Score =   408 bits (1049),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 202/403 (50%), Positives = 275/403 (68%), Gaps = 17/403 (4%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V ++PG    G LPF+L+TGYIGVGE EEVQ+FYYFVKS+++P TDP I W  GGPGC
Sbjct  42    SSVKYLPGF---GFLPFQLDTGYIGVGEGEEVQLFYYFVKSESDPETDPLILWITGGPGC  98

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+L  +  E GP+  + ++Y G +P L LN H+WTKV++++F+DLP + GF+YATT+KAN
Sbjct  99    SSLEGLTMEFGPLHFDDMEYNGSLPTLSLNTHSWTKVASIIFLDLPVKTGFSYATTEKAN  158

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              ++N++  E AY+F++KW  +H ++L NP Y+GGDS+SG TVPI+ + I++GN+A TKP+
Sbjct  159   QTNNLQTGEHAYQFLQKWLANHSKFLQNPIYIGGDSYSGTTVPIVVQTISNGNDAKTKPM  218

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             INLKGYILGNP +   +   YRIP A+GM L+  DLYK+L  NC G Y + +  N  C+ 
Sbjct  219   INLKGYILGNPLTINPDELNYRIPFAHGMGLLSDDLYKALVSNCGGEYQNIAPNNSACSN  278

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTG---SDGLRRSLS------QRPVLPPGEFCWQM  607
              +  F++L  GIN  HILE  C  V      S G R SL       +  ++ PG  C + 
Sbjct  279   SVQTFNKLCEGINKEHILEPLCDSVSLKRYRSVGRRTSLYAKLHKLENSMVLPGVKCLED  338

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRA  427
              W   S  WAN+ +VQ+ALHVRKGTI  W  C   D+ +T ++ + +PYHANL+ +G R+
Sbjct  339   -WRKLSVHWANDDSVQEALHVRKGTIQNWTRCR-GDLSFTYNVYNVVPYHANLSAKGYRS  396

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAG  298
             LIYSGDHDL +P +STEAWI SLNYS  D WR W   +G +AG
Sbjct  397   LIYSGDHDLTIPFISTEAWIGSLNYSVTDDWRKWIV-NGQVAG  438



>ref|XP_008644916.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Zea mays]
Length=481

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/458 (44%), Positives = 288/458 (63%), Gaps = 23/458 (5%)
 Frame = -2

Query  1497  SVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQ--TNPTTDPF  1324
             +++  + G  + H+PG Q  GPLPF L+TGY+ V E+  V +FYYFV+S+   +P  DP 
Sbjct  27    NLISNSSGGVITHLPGFQ--GPLPFHLQTGYVEVDEDNGVHLFYYFVRSEREDSPGDDPV  84

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             + W  GGPGCS L  +  EIGP+S ++  Y GG+PKL     +WTKVSN++F+D P  AG
Sbjct  85    VLWLTGGPGCSVLTGLAYEIGPLSFDLNGYVGGLPKLVYKQDSWTKVSNVIFLDSPVGAG  144

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T++   SS+ +   Q   F++KWF+ +P++ ++P Y+ GDS+SG+ VP +T  IA
Sbjct  145   FSYSHTEEGYKSSDTRAVNQILVFLKKWFDKYPQFFSSPLYIAGDSYSGMIVPTVTSEIA  204

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
              G E G++P +NLKGY++GNP +  N     RIP A+GM LI  ++Y++ EK+C      
Sbjct  205   RGKEEGSQPNLNLKGYLVGNPVTDFNFDGPSRIPFAHGMGLISDEIYEAYEKSCSVGDSR  264

Query  783   FSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTG----SDGLRRSLSQRPV-------  637
               +  C   +G  D+  +GI+P H+LE  C          S G R  L Q PV       
Sbjct  265   RQSIECINSLGAIDECIKGISPNHVLEPLCAFASPKPKLISSGAREML-QLPVPVHTEEE  323

Query  636   ---LPPGEFCWQ--MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTD  472
                L   E   Q     Y+ S +WAN+ +V+ AL + KGT+  W  CNY DI YT D+  
Sbjct  324   EEELRLSEISLQCRTAGYMMSSMWANDASVRQALGIHKGTVPSWSRCNY-DIPYTNDIPS  382

Query  471   ALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFT  292
             A+ YH ++TT+G R+L+Y+GDHD++VP + T+AWI SLN+STVD WRPW   DG +AGFT
Sbjct  383   AVKYHLDVTTKGYRSLVYNGDHDMVVPFIGTQAWIRSLNFSTVDEWRPWFV-DGQVAGFT  441

Query  291   RSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             RSYSNN+TFAT+KG GH AP +   +C  MF RW+SG 
Sbjct  442   RSYSNNLTFATVKGGGHTAPEYMPRQCFAMFVRWVSGD  479



>emb|CDY22581.1| BnaC05g24190D [Brassica napus]
Length=467

 Score =   409 bits (1050),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/446 (46%), Positives = 295/446 (66%), Gaps = 23/446 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + H+PG  ++GPLPF LETGY+ VGE E+V++FYYF+KS+  P  DP + W  GGP 
Sbjct  30    ASVISHLPG--FEGPLPFHLETGYMVVGEEEKVKLFYYFIKSENKPEEDPLLIWLTGGPA  87

Query  1296  CSALFAIIQEIG-PISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK  1120
             C+AL A+  EIG P++ +   Y GG+P L    ++WTKV++++F+D P   GF+Y+TT  
Sbjct  88    CTALSALAFEIGRPLTFKTEDYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGFSYSTTPL  147

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S+  E++Q YEF++KW  +HPE+++NP YVGGDS++G+ VP I + I+ GNE   +
Sbjct  148   ADKPSDTGEAKQTYEFLQKWLVEHPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNENSNR  207

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY---DHFSNEL  769
             P+ NLKGY+LGNP++ L+  H  +IP A+GM LI  +L++SL+ +CKGNY   DH +N  
Sbjct  208   PM-NLKGYVLGNPSTELDKDHNAKIPYAHGMGLISDELFESLKLSCKGNYVNIDH-TNTQ  265

Query  768   CAQDMGKFDQLTRGINPTHILEDFC-------IRVGTGSDGLRRSLSQRPVLP-PGEFCW  613
             C + +  +D+    IN   IL   C         +      L R +     LP PG  C+
Sbjct  266   CLKLVEDYDKCVSRINEGSILIPLCDLASPNPFSIENAGRSLERLVQSDLYLPTPG--CY  323

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
              M+ Y+ +  WAN+  V+ ALHV KG+IG+W  C++ D+ Y  D+  +LPYH N + +GL
Sbjct  324   -MYRYVLATYWANDEDVRKALHVEKGSIGKWMRCDW-DMAYEKDIKSSLPYHMNNSRKGL  381

Query  432   -RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+L+YSGDHD++VP + T AWI SLNYS +D WRPW  ++ +I G+TRSY NNMTFAT+
Sbjct  382   YRSLVYSGDHDMMVPYVGTVAWIRSLNYSIIDQWRPWFVNNQVI-GYTRSYVNNMTFATI  440

Query  255   KGSGHIAPFFSAYECLIMFERWISGQ  178
             KG GH A  +  YE  +MF+RWI  Q
Sbjct  441   KGGGHTAE-YKPYESFMMFQRWIRNQ  465



>emb|CDP17658.1| unnamed protein product [Coffea canephora]
Length=457

 Score =   408 bits (1048),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 292/451 (65%), Gaps = 37/451 (8%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A  GS V  +PG  ++ PLPF LETGYIGVGE+E+VQ+FYYFVKS++NP  DP + W  
Sbjct  28    LAVAGSVVKFLPG--FESPLPFVLETGYIGVGESEDVQLFYYFVKSESNPQIDPLLIWLT  85

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS++  +  EIGP+  + V Y G +PKL  NP++WTK+++++F+D P   GF+YA 
Sbjct  86    GGPGCSSISGLAYEIGPVKFQRVLYDGTLPKLMTNPYSWTKLASIIFLDSPVGTGFSYAR  145

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T KA+ SS+++ SE  YEF+RKW +D+PEY++N FY+GGDS++G+ VPI+ +++++GN+A
Sbjct  146   TAKASQSSDLQASEHTYEFLRKWLHDNPEYMSNSFYIGGDSYAGINVPILAQLVSNGNDA  205

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G +P I+LKGYILGNPA +      + IP A+ M LI  +LY+SL+  CKG Y +   SN
Sbjct  206   GIEPHIHLKGYILGNPAPTTQGDGNHVIPFAHRMALISDELYESLKATCKGEYVNIDPSN  265

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQR-----PVLPPGEF  619
               C +++  +++L   IN  H+LE  C  V +  + L   RRS  +        L   EF
Sbjct  266   APCLKNIQAYNKLIDNINIEHVLEPTCPDVSSKPNNLFSGRRSTVETFYKKFEELDVLEF  325

Query  618   ----CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
                 C ++ +Y     WAN+               +W  CNY+ I YT +   A+PYHAN
Sbjct  326   NPVQCRELLYY-----WAND--------------RKWIRCNYS-ILYTKNAGSAVPYHAN  365

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             L+T+G R+LIYSGDHD+I P + TE WI SLNY T+D WR W  H G +AG+TR+Y+N M
Sbjct  366   LSTKGYRSLIYSGDHDMISPYLGTEEWIRSLNYPTIDDWRQW-IHQGQVAGYTRTYANKM  424

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             TFAT+K        FS  EC  MF RWIS Q
Sbjct  425   TFATVKARNSSFSCFSPAECRSMFGRWISYQ  455



>ref|XP_009131550.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=449

 Score =   407 bits (1047),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/438 (45%), Positives = 296/438 (68%), Gaps = 10/438 (2%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPF+LETGYIGVG+ E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANCGSIVKFLPG--FEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++ +V  Y GG P L    ++WTKV+N++F+D P  +GF+YATT
Sbjct  76    GPGCSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+RKW ++H E+++NPFYV GDS+SG  +P + + I+ GN+ G
Sbjct  136   QILDTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+G+++GNP +     H  RIP A+GM LI  +LY+SL+++CKGNYD+    N 
Sbjct  196   FKPQINLEGFVIGNPVTDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNT  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C +   +F +    IN  +IL   C +  +    +    +  P     + C++ +  L 
Sbjct  256   ECLKHFDEFLKCISRINFANILIPRCDQALSPRRYILLPNTSAPST--DDDCYE-YTDLL  312

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             S LWAN+ +V++ALHV KG+I +W  C+ +   Y +D+  ++PYH N + +G R+LI+SG
Sbjct  313   SSLWANDESVREALHVVKGSIDKWVRCS-SGKPYDSDIKSSVPYHMNNSIKGYRSLIFSG  371

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHDL+ P +ST+AWI SLNYS V+ WRPW  H+  +AG+T++Y+N MT+AT+KG GH  P
Sbjct  372   DHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQ-VAGYTQTYANKMTYATVKGGGH-TP  429

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWISGQ
Sbjct  430   EYKPKESFIMFQRWISGQ  447



>ref|XP_008790304.1| PREDICTED: uncharacterized protein LOC103707550 [Phoenix dactylifera]
Length=982

 Score =   424 bits (1089),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 207/455 (45%), Positives = 296/455 (65%), Gaps = 22/455 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             CSS+VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS+  P  
Sbjct  536   CSSLVSAL-----NTITHLPG--FHGTLPFHLETGYVTVDEANDAQLFYYFIKSERKPEE  588

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W+ GGPGCSA   ++ EIGP+  +V  Y  G+P L  NPHTWTKV N++F+D P 
Sbjct  589   DPLMVWQSGGPGCSAFSGLVFEIGPLKFDVAGYIDGLPTLVYNPHTWTKVCNIIFLDSPV  648

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++  K+  + + K + Q + F+RKWF DHP++L+NP Y+GGDS+SG+ VP++ +
Sbjct  649   GVGFSYSSVGKSYETGDTKTARQVHTFLRKWFIDHPKFLSNPLYIGGDSYSGIIVPVVAQ  708

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G++ G +   NLKGY++GNP +     +   +P A+GM LI  +LY+S +K+C G 
Sbjct  709   KIAKGDQDGDELPYNLKGYLVGNPVTDEKFDNGAVVPYAHGMGLISDELYESTKKSCGGE  768

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDG--------LRRSLSQRPV  637
             Y    NE CA  +   ++ T+GIN   ILE  C       +         L+  + + P+
Sbjct  769   YASPRNEQCANYLQSVNECTKGINSEQILEPLCFSASPKPNMVAAYSRRLLKEDIKKFPL  828

Query  636   LP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
             L    P E C + F YL S  WA+N  V++AL++RKGT+  W  CN+ D+ YT D+  ++
Sbjct  829   LNSDLPLE-C-RSFGYLLSYFWADNDTVREALNIRKGTVQHWQRCNH-DLLYTYDIPSSI  885

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              +H NLT+RG RAL+YSGDHD+ VP + T+ WI SLN+S VD WRPW+  DG +AGFTR+
Sbjct  886   KFHLNLTSRGYRALVYSGDHDMGVPFVGTQGWIRSLNFSIVDDWRPWSV-DGQVAGFTRT  944

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISG  181
             YSNN+TFAT+KG+GH AP +   ECL M +RW+SG
Sbjct  945   YSNNLTFATVKGAGHTAPEYRPKECLAMLQRWLSG  979


 Score =   418 bits (1075),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 208/455 (46%), Positives = 297/455 (65%), Gaps = 22/455 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             CSS+VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS+  P  
Sbjct  30    CSSLVSAL-----NTITHLPG--FHGTLPFYLETGYVTVDEANDAQLFYYFIKSERKPEE  82

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCSA   ++ EIGP+  +V  YT G+P L  +P+TWTKV +++F+D P 
Sbjct  83    DPLMVWLSGGPGCSAFSGLVFEIGPLKFDVAGYTDGLPTLVYHPYTWTKVCSIIFLDSPV  142

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++  K+  + + K + Q + F+RKWF DHPE+L+NP YVGGDS+SG+ VP++ +
Sbjct  143   GTGFSYSSMGKSYETGDTKAARQVHTFLRKWFIDHPEFLSNPLYVGGDSYSGIVVPVVAQ  202

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G++ G +   NLKGY++GNP++     +   +P A+GM LI  +LY+S +K+C G 
Sbjct  203   EIAKGDQDGDELPYNLKGYMVGNPSTDEKFDNGAFVPYAHGMGLISDELYESTKKSCGGE  262

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRV--------GTGSDGLRRSLSQRPV  637
             Y    NE CA  +   ++   GIN   ILE  C  V          G   L+  + + P+
Sbjct  263   YASPRNEQCANYLQSINECIEGINGAQILEPVCFFVSPKPNMVAAYGRRLLKEDIKEFPL  322

Query  636   LP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
             L    P E C +   YL S  WA+N  V++AL++RKGT+  W  CN +D+ YT ++  +L
Sbjct  323   LNSDLPLE-C-RSSAYLLSYFWADNDTVREALNIRKGTVQHWQRCN-SDLLYTHNVPSSL  379

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              +H NLT+RG RAL+YSGDHD++VP + T+ WI SLN+S VD WRPW+A DG +AGFTR+
Sbjct  380   KFHLNLTSRGYRALVYSGDHDMLVPFLGTQGWIRSLNFSIVDDWRPWSA-DGQVAGFTRT  438

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISG  181
             YSNN+TFAT+KG+GH AP +   ECL M +RW+SG
Sbjct  439   YSNNLTFATVKGAGHTAPEYRPKECLAMLQRWLSG  473



>ref|XP_006472315.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X1 [Citrus 
sinensis]
Length=487

 Score =   408 bits (1048),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 202/423 (48%), Positives = 277/423 (65%), Gaps = 21/423 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG Q  GPL FELETGY+GVGE+E+ Q+FYYFVKS+ NP  DP + W  GGPGC
Sbjct  25    STVKFLPGFQ--GPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             SA  A++ EIGPI+  +++Y G +P L LNP++WTK +++LF+D P   GF+Y  T  A+
Sbjct  83    SAFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLAS  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + + K+  Q  +F+RKW  DHPE+L+N FYVGGDS+SG+TVP + + I++ NE G KPL
Sbjct  143   QTGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPL  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +        +IP A+GM LI  +LY+SL+  C G+Y +   SN  C  
Sbjct  203   INLQGYILGNPKTDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLN  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ----------RPVLPPGEF  619
             D   F +L  G++  HILE  C         S+G RRSL+            P LP    
Sbjct  263   DNQAFSELISGLDQNHILEPHCPFFSPKPRDSNGKRRSLNDNEKSQEFLDPEPALP--SI  320

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
               + F Y+ S  W N+  V+ AL +R+G+ G+W  CNY D+ YT ++  +  +H +L+T+
Sbjct  321   GCRSFGYMLSQNWENDYNVRKALQIRQGSKGKWQRCNY-DLPYTQEIGSSFSFHVSLSTK  379

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD++VP + TEAWI SLNYS +D WRPW  H   +AG+TR+YSN MT+AT
Sbjct  380   GYRSLIYSGDHDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQ-VAGYTRTYSNRMTYAT  438

Query  258   LKG  250
             +K 
Sbjct  439   VKA  441



>ref|XP_009140440.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=434

 Score =   405 bits (1042),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 204/438 (47%), Positives = 282/438 (64%), Gaps = 26/438 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIGVG+ E++Q+FYYFVKS+ NP  DP + W  G
Sbjct  19    AESGSIVKFLPG--FEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+LFAI+ E GP++++   Y G +P L    ++WTK++N++F+D P  AGF+Y+ T
Sbjct  77    GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                N  S+  E +  +EF++KW + HPE+ +NPFYV GDS+SG  VP + + I+ GN   
Sbjct  137   PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYIC  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP IN++GYILGNP + + +    +IP A+GM LI  +LY+SL++ CKGNY++    N 
Sbjct  197   CKPPINIQGYILGNPITQIKSEDNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNT  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + +  +++ T  +N  HIL   C                  +  P  F   ++ Y  
Sbjct  257   ECLKHIEMYNKCTDKLNRYHILLPDC-----------------DMTSPDCF---LYNYFL  296

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
              D WANN  V+ AL V KG+IG W  CNY  I Y  D+   +PYH N +  G R+LIYSG
Sbjct  297   LDKWANNERVRRALQVTKGSIGEWKRCNYDVIPYNYDIQSTVPYHMNNSISGFRSLIYSG  356

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD++VP ++T+AWI SLNYS VD WRPW  +D  IAG+TR Y+N MT+AT+KG GH A 
Sbjct  357   DHDMVVPFIATQAWIRSLNYSIVDDWRPWMVNDQ-IAGYTRGYANKMTYATIKGGGHTAE  415

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  +MF+RWISGQ
Sbjct  416   -YKPNETFVMFQRWISGQ  432



>ref|XP_010422959.1| PREDICTED: serine carboxypeptidase-like 19 [Camelina sativa]
Length=470

 Score =   407 bits (1045),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 205/466 (44%), Positives = 299/466 (64%), Gaps = 27/466 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             LY  ++ S+ + A    V ++PG  ++GPLPFELETGY+ +GE+ +V +FYYFVKS+ NP
Sbjct  11    LYLLTISSIHVDACSLLVKYLPG--FEGPLPFELETGYVSIGESGDVDLFYYFVKSERNP  68

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DPF+ W  GGPGCS++  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ 
Sbjct  69    ENDPFMIWLTGGPGCSSICGLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLES  128

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             PA +G++YA T++A  SS+ K+  Q  +F+R WF DHPE+++NPFYVGGDSFSG  VP +
Sbjct  129   PAGSGYSYARTRRAFESSDTKQIYQIDQFLRTWFVDHPEFISNPFYVGGDSFSGFIVPGV  188

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G  PLIN++GY+LGNP +  N    YR+  A+GM LI  +L++SLE++C+
Sbjct  189   VQQISLGNEKGLTPLINIQGYVLGNPLTDKNLESNYRVSFAHGMGLISDELFQSLERSCE  248

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHIL-----------EDFCIRVGTGSDGLRR  658
             G + H   SN  C+ ++  +D     I   HIL           E+        SD  RR
Sbjct  249   GKFFHVDPSNARCSNNLQAYDHCMSEIYSEHILLRNCEVDYIIPEELQTLPNIRSD-RRR  307

Query  657   SLSQ------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI  496
              L +        + PP  F ++   Y  S  WAN+  V+ AL V+K  +G+W  CN  +I
Sbjct  308   ELKEFSGNDSSSLPPPSCFTYK---YFLSAFWANDENVRKALGVKK-EVGKWNRCNIQNI  363

Query  495   GYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAH  316
              YT ++ +A PYH N + +G R+LIYSGDHD +VP  ST+AWI +LNYS VD WRPW   
Sbjct  364   PYTFEIFNAFPYHVNNSRKGFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMS  423

Query  315   DGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +  +AG+TR+Y+N MTFAT+KG GH A  ++  +C +MF RWI G+
Sbjct  424   NNQVAGYTRTYANKMTFATIKGGGHTAE-YNPDQCSLMFRRWIDGE  468



>ref|XP_010936154.1| PREDICTED: serine carboxypeptidase-like 18 [Elaeis guineensis]
Length=499

 Score =   407 bits (1046),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/450 (44%), Positives = 288/450 (64%), Gaps = 25/450 (6%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS+  P  DP I W  GGPGCSA
Sbjct  51    ITHLPG--FHGTLPFYLETGYVKVDEVNDAQLFYYFIKSEGKPEEDPLIVWLTGGPGCSA  108

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
                ++ EIGP+  ++  YT G+P L  NP++WTKV +++F+D P   GF+Y++ +K+  +
Sbjct  109   FSGLVFEIGPLKFDIAGYTEGLPTLVYNPYSWTKVCSIIFLDSPVGTGFSYSSVEKSYET  168

Query  1107  SNMKESEQAYEFMRK------------WFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
              + K + Q + F++K            W  DHPE+L+NP Y+GGDS+SG+ VP++ + IA
Sbjct  169   GDTKAARQVHIFLKKCDRFTSSQVVMQWLIDHPEFLSNPLYIGGDSYSGIVVPVVVQEIA  228

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
              G++ G + L NLKGY++GNP +     +   +P A+GM LI  +LY+S +K+C G Y  
Sbjct  229   KGDQDGDELLYNLKGYLVGNPVTDEKFDNGAFVPYAHGMGLISDELYESTKKSCGGEYAS  288

Query  783   FSNELCAQDMGKFDQLTRGINPTHILEDFCI----RVGTGSDGLRRSLSQR----PVLPP  628
              +NE CA  +   ++   GIN   ILE  C     + G  +   RR L +     P+L  
Sbjct  289   PTNEQCASHLQSINKCIEGINTVQILEPVCFFASPKPGIVAAYSRRLLKEDIKGFPLLKA  348

Query  627   G-EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
                   +   YL S  WA+N  V++AL++ KGT+ +W  CNY  + Y  D+  +L +H N
Sbjct  349   DLSLECRTSGYLLSYFWADNDTVREALNIHKGTVQQWQRCNY-GLPYAHDIPSSLKFHLN  407

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
             LT+RG RAL+YSGDHDL+VP + T+AWI SLN+S VD WRPW+A DG +AGFTR+YSNN+
Sbjct  408   LTSRGYRALVYSGDHDLLVPFVGTQAWIRSLNFSIVDDWRPWSA-DGQVAGFTRTYSNNL  466

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWISG  181
             TFAT+KG+GH AP +   ECL+M +RW+SG
Sbjct  467   TFATVKGAGHTAPEYRPKECLVMLQRWLSG  496



>ref|XP_009139971.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brassica 
rapa]
Length=436

 Score =   404 bits (1039),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/444 (45%), Positives = 278/444 (63%), Gaps = 26/444 (6%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +V    A   S V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP 
Sbjct  15    LVLRYFADSASVVKFLPG--FEGPLPFELETGYIGLGEEEELQMFYYFIKSENNPQEDPL  72

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             + W  GGPGCS++F ++ E GP++++   Y G +P L    ++WTK++N++F+D P  +G
Sbjct  73    LIWLTGGPGCSSIFGLLFENGPLALKFEVYNGSLPSLVSTTYSWTKMANIIFLDQPVGSG  132

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T   +  S+  E ++ +EF++KW + HP++  NPFYV GDS+SG+ VP + + I+
Sbjct  133   FSYSRTPLVDKISDTGEVKRIHEFLQKWLSKHPQFYANPFYVAGDSYSGMIVPPVVQEIS  192

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
             +GN    KPLINL+GYILGNP +     H   IP AYGM LI  +LY+S+++ CKG+Y  
Sbjct  193   EGNYICCKPLINLQGYILGNPVTDTKLEHNSLIPFAYGMALISEELYESMKRICKGSYGK  252

Query  783   FS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQ  610
                 N  C +    + + T  +N  HIL   C +                          
Sbjct  253   VDSLNTDCLKLTEIYQKCTDRLNKYHILLPDCHKTSPDC--------------------H  292

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
             ++ Y   + WANN  V  ALHV KG+IG W  CNY  I Y  D+  ++PYH N +  G R
Sbjct  293   LYKYFLLEKWANNERVHKALHVNKGSIGEWRQCNYDGISYNYDIQSSVPYHKNNSINGFR  352

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LI+SGDHD+ VP ++T+AWI SLNYS +D WRPW  +D  IAG+TR+Y+N MTFAT+KG
Sbjct  353   SLIFSGDHDMTVPFLATQAWIRSLNYSIIDDWRPWMMNDQ-IAGYTRTYANKMTFATVKG  411

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH A  +   E  IMF+RWISGQ
Sbjct  412   GGHTAD-YKPDETFIMFKRWISGQ  434



>emb|CDY53115.1| BnaCnng24430D [Brassica napus]
Length=436

 Score =   404 bits (1039),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/444 (44%), Positives = 278/444 (63%), Gaps = 26/444 (6%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +V    A   S V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP 
Sbjct  15    LVLRYFADSASVVKLLPG--FEGPLPFELETGYIGLGEEEEIQMFYYFIKSENNPREDPL  72

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             + W  GGPGCS++F ++ E GP++++   Y G +P L    ++WTK++N++F+D P  +G
Sbjct  73    LIWLTGGPGCSSIFGLLFENGPLALKFEVYNGSIPSLVSTTYSWTKMANIIFLDQPVGSG  132

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T   +  S+  E ++ +EF++KW + HP++  NPFYV GDS+SG+ VP + + I+
Sbjct  133   FSYSRTPLVDKISDTGEVKRIHEFLQKWLSKHPKFYANPFYVAGDSYSGMVVPPVVQEIS  192

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
             +GN    KPLINL+GYILGNP +     H Y IP AYGM LI  +LY+S+++ CKG+Y +
Sbjct  193   EGNYICCKPLINLQGYILGNPVTDTKLEHNYLIPFAYGMALISEELYESMKRICKGSYGN  252

Query  783   FS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQ  610
                 N  C +    + + T  +N  HIL   C +                          
Sbjct  253   LDSLNTECLKLTEIYQKCTDRLNKYHILLPDCDKTSPDC--------------------H  292

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
             ++ Y   + WANN  V  ALHV KG IG W  CNY  I Y  D+  ++PYH N +  G R
Sbjct  293   LYKYFLLEKWANNERVHKALHVNKGGIGEWRQCNYDGISYKYDIQSSVPYHKNNSINGFR  352

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LI+SGDHD+ VP ++T+AWI SLNYS +D WRPW  +D  IAG+TR+Y+N MTFAT+K 
Sbjct  353   SLIFSGDHDMTVPFLATQAWIRSLNYSIIDDWRPWMMNDQ-IAGYTRTYANKMTFATVKA  411

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
             SGH A  +   E  IMF++WIS Q
Sbjct  412   SGHTAD-YKPDETFIMFKKWISSQ  434



>ref|XP_010314652.1| PREDICTED: serine carboxypeptidase-like 11 [Solanum lycopersicum]
Length=677

 Score =   412 bits (1058),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 207/445 (47%), Positives = 292/445 (66%), Gaps = 25/445 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V+ +PG  +DGPLPF L+TGYIGVG++EEVQ+FYYFVKS+++P  DP + W  GGPGC
Sbjct  22    SIVEFLPG--FDGPLPFYLQTGYIGVGKSEEVQLFYYFVKSESDPKKDPILLWLTGGPGC  79

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   +  EIGP+      Y G +P L  +PH+WTK +++LF++ P   GF++A T +A 
Sbjct  80    SSFSGLAYEIGPLEFGQKAYNGSLPILVSSPHSWTKFASILFLEQPVNTGFSHAITSEAY  139

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               ++++  +  YEF+RKWF +H E+++NPFYV GDS+SG+T+PII ++I++G EAG +PL
Sbjct  140   KCTDLQACDHVYEFLRKWFVNHSEFISNPFYVSGDSYSGITIPIIVQLISNGIEAGKEPL  199

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INLKGY LGNP +     + Y+IP ++ M LI  +LY+SL + CKG+Y +   +N+ C +
Sbjct  200   INLKGYSLGNPITFFEESN-YQIPYSHSMGLISNELYESLNEFCKGDYINIDPTNKQCVE  258

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTG-------SDGLRRSLSQRPVLPPGEFCWQMFW  601
             +   F  L  GIN   ILE  C   GT        S   RRSL +  +            
Sbjct  259   NFKMFKNLVSGINNGQILEPEC---GTDIEFYPPQSSNERRSLEEDLICQESRIA----T  311

Query  600   YLRSDLWANNVAVQDALHVRKGTIGR-WCACNYTDIGYTA---DMTDALPYHANLTTRGL  433
             Y  +  W N++ VQ++LHV KGTI R W  C  T IGYT+    + +++PYH NL+ +G 
Sbjct  312   YKLATYWMNDLRVQESLHVTKGTIRRTWTRCKRT-IGYTSYKVTLKNSIPYHVNLSIKGY  370

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLK  253
             R+LIYSGDHD++VP  ST+AWI  LNYS +D WRPW   +G + G+T SYSN+MT+AT+K
Sbjct  371   RSLIYSGDHDMVVPFQSTQAWIKYLNYSIIDDWRPWMV-NGQVGGYTMSYSNHMTYATIK  429

Query  252   GSGHIAPFFSAYECLIMFERWISGQ  178
             G GH AP +   E   MF+RWI+ Q
Sbjct  430   GGGHTAPEYKREESFHMFKRWITQQ  454


 Score =   158 bits (399),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 96/141 (68%), Gaps = 4/141 (3%)
 Frame = -2

Query  591  SDLWANNVAVQDALHVRKGTIGR-WCACNYT--DIGYTADMTDALPYHANLTTRGLRALI  421
            S  WAN+  VQ+ALHVRKGTI R W  C  +  D  Y     +++PYHANL+ +G R+LI
Sbjct  536  SAYWANDPKVQEALHVRKGTIKRTWARCRASIGDKSYAITFMNSIPYHANLSKKGYRSLI  595

Query  420  YSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGH  241
            YSGDH+++VP  ST+AWI  LNYS +D WRPW   D  + G+TRSYSN+M +AT+KG GH
Sbjct  596  YSGDHEMVVPFQSTQAWIKYLNYSIIDDWRPWMV-DEQVGGYTRSYSNHMAYATVKGGGH  654

Query  240  IAPFFSAYECLIMFERWISGQ  178
             AP     E   MF+RWIS Q
Sbjct  655  TAPEDRPEESFYMFKRWISQQ  675


 Score = 52.8 bits (125),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = -2

Query  1407  YIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIG---PISMEVVK  1237
             YIGV ++EEVQ+FYYFVKS+  P     +     G G + L  I+  IG   P++     
Sbjct  457   YIGVAKSEEVQLFYYFVKSEIRPEERSDL---AMGSGRTRLL-ILHRIGVRSPLAFGQKA  512

Query  1236  YTGGMPKLKLNPHTWTKV  1183
             Y G +P L   P++WTKV
Sbjct  513   YNGSLPFLVSRPYSWTKV  530



>ref|XP_006415266.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
 gb|ESQ33619.1| hypothetical protein EUTSA_v10007559mg [Eutrema salsugineum]
Length=465

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 204/444 (46%), Positives = 295/444 (66%), Gaps = 18/444 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + H+PG  ++GPLPF LETGYIGVGE E+VQ+FYYFVKS+ NP  DP + W  GGP 
Sbjct  27    ASVISHLPG--FEGPLPFHLETGYIGVGEGEKVQLFYYFVKSENNPEEDPLLIWLSGGPA  84

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++ A+  EIGP++      +GG+P L    ++WTK+++++F+D P   GF+Y+T    
Sbjct  85    CSSISALAFEIGPLTFNTEGNSGGLPSLVSTSYSWTKIASIIFLDQPVGTGFSYSTNPLV  144

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E++Q YEF++KW  +HPE+++N FYVGGDS++G+ VP I + I+ GNE G KP
Sbjct  145   DKPSDTGEAKQTYEFLQKWLVEHPEFVSNHFYVGGDSYAGVIVPAIVQQISIGNEHGYKP  204

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
             LINLKGY+LGNP++     + YRIP A+GM LI  +LY+SL+++C+GNY +   SN  C 
Sbjct  205   LINLKGYVLGNPSTDSYIDYNYRIPYAHGMGLISDELYESLKRSCEGNYVNIDPSNTQCL  264

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV-------LP-PGEFCWQM  607
             + M  +D+    +N   IL   C  +   +   ++ + +R V       LP P   C+  
Sbjct  265   KLMQDYDKCVSRLNYALILTPLC-DLSLPNPFSKKHIGRRDVRELVHSDLPLPTHDCY-T  322

Query  606   FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-R  430
             + YL +  WAN+  V+ ALHV KG+I +W  C++ D+ Y  D+  ++PYH N + +G  R
Sbjct  323   YRYLLATNWANDEDVRRALHVVKGSIEKWVRCDW-DMAYEKDIKSSVPYHLNNSMKGFYR  381

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +L+YSGDHD+ VP   T+AWI SLNYS +D WRPW  ++ I+ G+TR+Y+NNMTFAT+KG
Sbjct  382   SLVYSGDHDMFVPFPGTQAWIRSLNYSIIDQWRPWFINNQIM-GYTRTYANNMTFATIKG  440

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH    +   E  IMFERWI+GQ
Sbjct  441   GGHTVE-YKPEEGFIMFERWINGQ  463



>emb|CDX70702.1| BnaC03g07860D [Brassica napus]
Length=432

 Score =   403 bits (1035),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 289/435 (66%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPF+LETGYIGVG+ E+VQ+FYYF+KS+ NPT DP + W  GGPG
Sbjct  21    GSIVKFLPG--FEGPLPFQLETGYIGVGDQEQVQLFYYFIKSEKNPTEDPLLIWLTGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++ +V  Y GG P L    ++WTKV+N++F+D P  +GF+YATT+  
Sbjct  79    CSSITGLLFENGPVTFKVEGYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATTQFL  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E+++ +EF+RKW ++H E+++NPFYV GDS+SG  +P + + I+ GN+ G KP
Sbjct  139   DSPSDSGEAKRIHEFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLGFKP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+G+++GNP +     H  RIP A+GM LI  +LY+SLE++ KGNYD+    N  C 
Sbjct  199   QINLEGFVIGNPVTDTEFEHNQRIPFAHGMALISDELYESLERSGKGNYDNIDPHNTECL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             +   +F +    IN  +IL    +R    S+                     +  L S L
Sbjct  259   KHFDEFLKCISRINFANILIPRTVRSSLVSN--------------------EYTDLLSSL  298

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V++ALHV KG+I +W  C+ +   Y +D+  ++PYH N + +G R+LI+SGDHD
Sbjct  299   WANDESVREALHVVKGSIDKWVRCS-SGKPYDSDIKSSVPYHINNSIKGYRSLIFSGDHD  357

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L+ P +ST+AWI SLNYS V+ WRPW  H+  +AG+T++Y+N MT+AT+K SGH  P + 
Sbjct  358   LMAPFISTQAWIRSLNYSIVEKWRPWMIHNQ-VAGYTQTYANKMTYATVKASGH-TPEYK  415

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  416   PKESFIMFQRWISGQ  430



>ref|XP_010499905.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18 [Camelina sativa]
Length=467

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 203/446 (46%), Positives = 289/446 (65%), Gaps = 19/446 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V ++PG  +DG LPF LETGYIGVGE E+VQ+FYYF+KS+ +P  DP I W  GGP 
Sbjct  26    ASVVSYLPG--FDGLLPFHLETGYIGVGEEEQVQLFYYFIKSENHPEEDPLILWLTGGPA  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVS---NMLFIDLPARAGFTYATT  1126
             CSAL A++ EIGP++ +   Y GG+P L    ++W KV+    ++F+D P   GF+Y+T 
Sbjct  84    CSALSALVFEIGPLTFKTEGYNGGLPSLVSTSYSWRKVTIIKQIIFLDQPVGTGFSYSTN  143

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                +  S+  E++Q YEF +KW  ++PE+++NP YVGGDS++G+ VP I + I+ GNE G
Sbjct  144   PLVHKPSDTGEAKQTYEFFQKWLVENPEFVSNPLYVGGDSYAGIVVPAIVQQISIGNEHG  203

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
               P INLKGY+LGNP++ L++ H  +IP A+GM LI  +LY+SLE+ CKGNY     +N 
Sbjct  204   YNPQINLKGYVLGNPSTDLDSDHNSKIPYAHGMGLISDELYESLERTCKGNYVKVDPTNT  263

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGT-------GSDGLRRSLSQRPVLPPGEFCW  613
              C + +  +D+    +N   IL   C            G     ++L Q  +  P   C+
Sbjct  264   QCLKFVDDYDKCVSRLNEGFILIALCDLASPNPYSGEHGGKNYLKTLVQSDLSLPTPDCY  323

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG-  436
              MF YL +  WAN+  V+ ALHV K +IG W  CN+ D+ Y  D+  ++PYH N + +G 
Sbjct  324   -MFRYLLASHWANDEDVRRALHVVKESIGEWVRCNW-DLPYDKDIKSSVPYHLNNSIKGE  381

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+L+YSGDHD++VP + T+AWI SLNYS  D WRPW  ++ +I G+TR+Y+N+MTFAT+
Sbjct  382   YRSLVYSGDHDMMVPFVGTKAWIKSLNYSITDDWRPWLVNNQVI-GYTRTYANDMTFATV  440

Query  255   KGSGHIAPFFSAYECLIMFERWISGQ  178
             KG GH A  +   E  +MF++WISGQ
Sbjct  441   KGGGHTAE-YKPEESFMMFQKWISGQ  465



>gb|KFK25883.1| hypothetical protein AALP_AA8G174700 [Arabis alpina]
Length=454

 Score =   403 bits (1036),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/448 (46%), Positives = 291/448 (65%), Gaps = 17/448 (4%)
 Frame = -2

Query  1491  VMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             +    GS V  +PG  +D PLPFELETGYIGVGE EEV++FYYF+KS+ NP  DP + W 
Sbjct  12    ISTVAGSTVKFLPG--FDDPLPFELETGYIGVGEGEEVKLFYYFIKSEKNPEEDPLLVWI  69

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS++  ++   GP++ +   Y GG P L    ++WTKV++++F+D P   GF+YA
Sbjct  70    SGGPGCSSINGLLFGNGPLTFKTDGYNGGNPTLVSTTYSWTKVASIIFLDQPVGVGFSYA  129

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
             TT+  +  S+  E+++  EF+RKW + H EY++NP YVGGDS+SG  +P   + I+ GN+
Sbjct  130   TTQLLDSPSDTGEAKRMDEFLRKWLSKHTEYISNPIYVGGDSYSGKVIPAAVQEISKGND  189

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--S  778
              G KP INL+GY+LGNP + +   +  R+P A+GM LI  +LY+S ++ C+GN ++   S
Sbjct  190   LGFKPQINLQGYVLGNPVTDIELEYNDRVPFAHGMALISDELYESFKRTCRGNIENVDSS  249

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-IRVGTGSDG-------LRRSLSQRPVLPPGE  622
             N  C + + +F + T  +N  HIL+  C I + T           LRR L   P++    
Sbjct  250   NIKCLKFVQEFRKCTSNLNEEHILKPTCDIELPTLLSSNDVPRTYLRRLLPANPLV-SSP  308

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
              C  ++  L S LWAN+ +V+ ALHV KG+IG W  C +  + Y  ++  ++PYH N + 
Sbjct  309   VC-VLYNDLLSSLWANDESVRKALHVAKGSIGEWTRC-FPFVTYNYNIESSVPYHMNNSI  366

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LI+SGDHDL+VP MST+AWI SL Y+ +D WRPW  H+  IAG+TRSY+N MTFA
Sbjct  367   KGYRSLIFSGDHDLLVPVMSTQAWIKSLKYAIIDDWRPWMIHNQ-IAGYTRSYANKMTFA  425

Query  261   TLKGSGHIAPFFSAYECLIMFERWISGQ  178
             T+KG GH +      E  IMF+RWISGQ
Sbjct  426   TVKGGGHTSQ-TKPEESFIMFQRWISGQ  452



>emb|CDP01266.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   403 bits (1036),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 289/449 (64%), Gaps = 23/449 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
              A  GS V  +PG  ++GPLPFELETGYIGVGE+E+VQ+FYYFVKS++NP  DP + W  
Sbjct  36    FAVAGSAVKFLPG--FEGPLPFELETGYIGVGESEDVQLFYYFVKSESNPEVDPLVLWLT  93

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS L A++ E GPI  E V+Y G +P+L LN ++WT+V++ +F+D P   GF+YA 
Sbjct  94    GGPGCSTLTALLYEFGPIKFEEVEYNGSLPRLILNTNSWTEVASFIFLDFPVGTGFSYAR  153

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T  A  S+ ++   QA EF+RK+  DHPE+++NPFYVGGDSFSGL VPIIT++I++G   
Sbjct  154   TPDALQSNTLQACNQALEFLRKFLIDHPEFISNPFYVGGDSFSGLIVPIITELISEGKNF  213

Query  948   G---TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF-  781
                 ++ +    GY++GNP ++  +   YR+P A+GM LI  +LY+SL++NCKG Y    
Sbjct  214   KRLFSQIVRPKSGYLIGNPVTTPTD-DNYRVPFAHGMGLISDELYESLKRNCKGKYQDID  272

Query  780   -SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLS-QRPVLPPGEFCWQM  607
              SN  C+QD+    QL   I   +ILE  C         L    S  +  L    F   +
Sbjct  273   PSNFPCSQDL----QLLDNIQVANILEPTCDFWAPNPRNLFLEGSLDKTFLGLNRFERFL  328

Query  606   FWYLRSD------LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
              +  R+D       WAN+  V +AL + K +IG W  CNY  + YT  + D +PYHANL+
Sbjct  329   AFRCRADGYKLSYAWANDDNVHEALQIHKESIGYWRRCNY-GLPYTTTVQDCVPYHANLS  387

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
             ++G R+L+YSGDHD +VP  +T+AWI SLNY  +D WR W   +G +AG+TRSY+N MTF
Sbjct  388   SKGYRSLMYSGDHDFVVPFFATQAWIRSLNYPIIDDWRQWVV-EGQVAGYTRSYANRMTF  446

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AT  G GH AP +   EC  MF+RWIS +
Sbjct  447   AT--GGGHTAPEYRPAECKAMFKRWISHE  473



>ref|XP_006295774.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
 gb|EOA28672.1| hypothetical protein CARUB_v10024896mg [Capsella rubella]
Length=436

 Score =   402 bits (1033),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 200/435 (46%), Positives = 287/435 (66%), Gaps = 23/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             G+ V  +PG  ++GPLPFELETGY+G+GE E+VQVFYYF+KS+ NP  DP + W  GGPG
Sbjct  21    GTIVKFLPG--FEGPLPFELETGYVGIGEEEDVQVFYYFIKSEKNPKEDPLLLWLDGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  ++ E GP++++   Y G  P L   P++WTK++N++++D P  AGF+Y+ T   
Sbjct  79    CSSLGGLLFENGPLALKSKVYNGSTPSLVSTPYSWTKMANIIYLDQPVGAGFSYSRTPLG  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               +S+  E ++ ++F++KW + HP++++N FYV GDS+SG+ VP + + I+ GN     P
Sbjct  139   K-TSDTSEVKRIHKFLQKWLSKHPQFMSNSFYVTGDSYSGMIVPALVQEISKGNYICCNP  197

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNP +   +   YRIP A+GM+LI  +LYKSL++ CKGNY++   SN  C 
Sbjct  198   PINLQGYVLGNPITYAEHEKNYRIPFAHGMSLISDELYKSLKRACKGNYENVDPSNTKCL  257

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  H L   C + G G                   C+   ++L  + 
Sbjct  258   KLVEEYHKCTDKINSQHTLLPDCDKKGMGETSPD--------------CYYYLYFL-IER  302

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++ALH+RKGT G+W  CN+T I Y  ++  ++PYHAN + RG R+LIYSGDHD
Sbjct  303   WANDEKVREALHIRKGTKGQWDRCNWT-IPYDNNILSSVPYHANNSFRGYRSLIYSGDHD  361

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P  +T+AWI SLNYS V  WRPW   D  IAG+TR+YSN MTFAT+KG GH A +  
Sbjct  362   ITMPFQATQAWIKSLNYSIVHDWRPWMIQDQ-IAGYTRTYSNKMTFATIKGGGHTAEYLP  420

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  421   N-ETSIMFQRWISGQ  434



>sp|Q9C7Z9.2|SCP18_ARATH RecName: Full=Serine carboxypeptidase-like 18; Flags: Precursor 
[Arabidopsis thaliana]
Length=464

 Score =   403 bits (1035),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 203/443 (46%), Positives = 293/443 (66%), Gaps = 16/443 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + ++PG  ++G LPF LETGYIGVGE E+VQ+FYYF+KS+ NP  DP I W  GGP 
Sbjct  26    ASVISYLPG--FEGLLPFHLETGYIGVGEGEKVQLFYYFIKSENNPEEDPLIIWLTGGPA  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             C+AL A+  EIGP++ +   Y GG+P L    ++WTKV++++F+D P   G++Y+TT  +
Sbjct  84    CTALSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPVGTGYSYSTTPLS  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
                S+  E++Q YEF++KW  ++P++++NP YVGGDS++G+ VP I + I+ GNE G KP
Sbjct  144   YKPSDTGEAKQTYEFLQKWLVENPQFVSNPIYVGGDSYAGIVVPAIVQQISIGNEHGYKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INLKGYILGNP++ L++ H  +IP A+ M LI  +LY+SL++ C+GNY     +N  C 
Sbjct  204   QINLKGYILGNPSTDLDSDHNSKIPYAHRMGLISDELYESLKRTCQGNYVKVDPTNTKCL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLR---RSLSQRPVLPPGEFCWQMF  604
             + M  + +    IN   IL   C        +G  G R   ++L Q  +  P   C+ M+
Sbjct  264   KLMEDYGKCVSRINEGLILIALCDLASPNPYSGEHGGRSYLQTLVQSDLSLPTPDCY-MY  322

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG-LRA  427
              YL +  WAN+  V+  LHV KG+IG+W  CN+ D+ Y  D+  ++PYH N +  G  R+
Sbjct  323   RYLLASHWANDEDVRRELHVVKGSIGKWMRCNW-DLPYEKDIKSSVPYHRNNSIIGDYRS  381

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             L+YS DHD++VP + TEAWI SLNYS  D WRPW  ++ +I G+TR+Y+NNMTFAT+KG 
Sbjct  382   LVYSSDHDMMVPYIGTEAWIKSLNYSITDDWRPWFVNNQVI-GYTRTYANNMTFATIKGG  440

Query  246   GHIAPFFSAYECLIMFERWISGQ  178
             GH A  +   E  +MF+RWISG+
Sbjct  441   GHTAE-YKPEESFMMFQRWISGR  462



>ref|XP_006290031.1| hypothetical protein CARUB_v10003665mg [Capsella rubella]
 gb|EOA22929.1| hypothetical protein CARUB_v10003665mg [Capsella rubella]
Length=467

 Score =   402 bits (1034),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 200/448 (45%), Positives = 291/448 (65%), Gaps = 25/448 (6%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V ++PG  ++GPLPFELETGY+ +GE+++V++FYYFVKS+ NP  DPF+ W  GGPGCS+
Sbjct  25    VKYLPG--FEGPLPFELETGYVSIGESKDVELFYYFVKSERNPENDPFMIWLTGGPGCSS  82

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++   GP++ +  +Y G +P L+L   +W KV+N+L+++ PA +G++YA  ++A  S
Sbjct  83    ICGLLFANGPLAFKGDEYNGTVPPLELTSFSWAKVANILYLESPAGSGYSYARNRRALES  142

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R WF DHPE+++NPFYVGGDS+SG  VP + + I+ GNE G  PLIN
Sbjct  143   SDTKQIYQIDQFLRSWFVDHPEFISNPFYVGGDSYSGKVVPGVVQQISFGNEKGLTPLIN  202

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             ++GY+LGNP +  N    YRI  A+GM LI  +L++SLE++C+G + +   SN  C+ ++
Sbjct  203   IQGYVLGNPLTDTNLECNYRISFAHGMGLISDELFESLERSCEGKFFNVDPSNARCSNNL  262

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGL----------RRSLSQ------RPVLPPGE  622
               +D     I   HIL   C       D L          RR L +        + PP  
Sbjct  263   QTYDHCMSEIYTEHILLRNCEVDYVLGDTLQTLPNIRADRRRELKEFSGNDSSSLPPPTC  322

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
             F ++   Y  S  WAN+  V+ AL V+K  +G+W  CN  +I YT D+ +A PYH N + 
Sbjct  323   FTYK---YFLSAFWANDENVRKALGVKK-ELGKWNRCNIQNIPYTYDIHNAFPYHVNNSR  378

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD +VP  ST+AWI +LNYS V+ WRPW  H   +AG+TR+Y+NNMTFA
Sbjct  379   KGFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVEDWRPWMMHSDQVAGYTRTYANNMTFA  438

Query  261   TLKGSGHIAPFFSAYECLIMFERWISGQ  178
             T+KG GH A  ++  +C +MF RWI G+
Sbjct  439   TVKGGGHTAE-YNPDQCSLMFRRWIDGE  465



>ref|XP_008790306.1| PREDICTED: uncharacterized protein LOC103707552 [Phoenix dactylifera]
Length=972

 Score =   418 bits (1074),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 207/455 (45%), Positives = 295/455 (65%), Gaps = 22/455 (5%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             CSS+VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS+  P  
Sbjct  30    CSSIVSAL-----NTITHLPG--FHGTLPFYLETGYVKVDEVNDAQLFYYFIKSERKPEE  82

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP I W  GGPGCS   A++ EIGP+  +V  YT G+P L  NPHTWTKV N++F+D P 
Sbjct  83    DPLIVWLTGGPGCSGFSALVFEIGPLKFDVAGYTEGLPALVYNPHTWTKVCNIIFLDSPV  142

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++  K+    + K + Q + F+RKWF DH E+L+NP Y+GGDS+SG+ VP++ +
Sbjct  143   GTGFSYSSMGKSYEMGDTKAARQVHTFLRKWFIDHLEFLSNPLYIGGDSYSGIVVPVVAQ  202

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G++ G +   NLKGY++GNP +     +E  +P A+GM LI  +LY+S +K+C G 
Sbjct  203   EIAKGDQDGDELSYNLKGYLVGNPVTDEKFDNEAFVPYAHGMGLISDELYESTKKSCGGE  262

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFC--------IRVGTGSDGLRRSLSQRPV  637
             Y    NE CA  +   ++ T G+N   ILE  C        +        L+  + + P+
Sbjct  263   YASPRNEQCANYLQSVNECTEGLNIMQILEPVCFFASPKPNMVAAYSRRLLKEDVKEFPL  322

Query  636   LP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
             L    P E C +   YL S +WA+N  V++AL++ KGT+  W  CN+ D+ YT D+  ++
Sbjct  323   LKSDLPLE-C-RSSGYLLSYIWADNDTVREALNIHKGTVQHWQRCNH-DLLYTYDIPSSI  379

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
              +H NLT+RG RAL+YSGDHDL++P + T+ WI SLN+S VD WRPW+A DG +AGFTR+
Sbjct  380   KFHLNLTSRGYRALVYSGDHDLLIPFLGTQGWIRSLNFSIVDDWRPWSA-DGQVAGFTRA  438

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISG  181
             YSNN+TFAT+KG+GH+AP +   E L M +RW+SG
Sbjct  439   YSNNLTFATVKGAGHLAPEYRPKESLAMLQRWLSG  473


 Score =   413 bits (1061),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 213/467 (46%), Positives = 296/467 (63%), Gaps = 35/467 (7%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             CSS+VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS+ NP  
Sbjct  515   CSSIVSAL-----NTITHLPG--FHGTLPFHLETGYVEVDEVNDAQLFYYFIKSERNPEE  567

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP I W  GGPGCS L A+  +IGP+  +V  YTGG+P L  NP+TWTKV N++F+D P 
Sbjct  568   DPLIVWLTGGPGCSGLSALAIQIGPLKFDVASYTGGLPTLVYNPYTWTKVCNIIFLDSPV  627

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++  K+  + + K + Q + F+RKWF DHPE+L+NP YVGGDS+SG+ VP+  +
Sbjct  628   GTGFSYSSVGKSYKTGDTKAARQVHTFLRKWFIDHPEFLSNPLYVGGDSYSGIVVPVAAQ  687

Query  972   MIADGNEAGTKPLINLK-----------GYILGNPASSLNNVHEYRIPAAYGMNLIPTDL  826
              IA G++ G +   NLK           GY++GNP +         +P A+GM LI  +L
Sbjct  688   EIAKGDQDGDELSYNLKVGEPYQKIYLNGYLVGNPRTDEKFDKGAVVPYAHGMALISDEL  747

Query  825   YKSLEKNCKGNYDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQ  646
             Y+S +K+C G Y    NE CA  +   ++   GIN   ILE  C  V +   G+  + S+
Sbjct  748   YESTKKSCGGEYTSPRNEQCANYLQAVNECIEGINIFQILEPVCF-VASPKPGMVAAYSR  806

Query  645   R---------PVLP---PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYT  502
             R         P+L    P E C +   YL S  WA+N  V++AL++ KGT+  W  CN+ 
Sbjct  807   RLLKEDIKKFPLLKSDLPLE-C-RSSGYLLSYFWADNDTVREALNIHKGTVQHWQRCNH-  863

Query  501   DIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWA  322
             D+ YT D+  ++ +H NLT+RG RAL+YSGDHD+ VP + T+ WI SLN+S VD WRPW+
Sbjct  864   DLLYTYDIPSSIKFHLNLTSRGYRALVYSGDHDMAVPFVGTQGWIRSLNFSIVDDWRPWS  923

Query  321   AHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISG  181
             A DG +AGFTR+YSNN+TFAT+KG+GH AP +   ECL M +RW+SG
Sbjct  924   A-DGQVAGFTRTYSNNLTFATVKGAGHTAPEYRPKECLAMLQRWLSG  969



>ref|XP_009103431.1| PREDICTED: serine carboxypeptidase-like 10 [Brassica rapa]
Length=440

 Score =   401 bits (1031),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 203/435 (47%), Positives = 287/435 (66%), Gaps = 22/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE E++Q+FYYF+KS+ NP  DP + W  GGPG
Sbjct  24    GSIVKFLPG--FEGPLPFELETGYIGIGEKEDIQLFYYFIKSEKNPIEDPLLIWLNGGPG  81

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  ++ E GP++ +   Y G +  L    ++WT+V+N+LF+D P  +GF+Y+ T   
Sbjct  82    CSSLLGLLFENGPLAFKFEVYNGNLASLFSTTYSWTQVANILFLDQPVGSGFSYSRT-PL  140

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + +S+  E +  +EF++KW + HP++ +NPFYV GDS+SG  VP + + I+ GN    KP
Sbjct  141   DKTSDTNEVKMIHEFLQKWLSKHPQFFSNPFYVIGDSYSGKIVPALVQKISKGNYICCKP  200

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
             LINL+GY+LGNP +       YRIP ++GM+LI  +LY+SL +NCKG Y++    N  C 
Sbjct  201   LINLQGYVLGNPVTYPEFELNYRIPFSHGMSLISDELYESLNRNCKGVYENVDPRNTKCL  260

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  INP +IL   C      +DG   ++S          C+   +YL    
Sbjct  261   ELVAEYHKCTDKINPHNILLPDC-----DNDGNSENISPD--------CYYYLYYLIES-  306

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WANN  V++ALHV+KGT G W  CN T I Y+ D+  ++PYH N +  G R+LIYSGDHD
Sbjct  307   WANNERVREALHVQKGTKGHWKRCNRT-IPYSPDIISSVPYHMNNSISGYRSLIYSGDHD  365

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP+++T+AWI SLNYS +D WRPW      IAG+TR+YSN MTF+T+KGSGH A  + 
Sbjct  366   MTVPSIATQAWIKSLNYSIIDDWRPWMIKTQ-IAGYTRTYSNKMTFSTIKGSGHTAE-YK  423

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  424   PNETFIMFQRWISGQ  438



>emb|CDX85493.1| BnaA02g03200D [Brassica napus]
Length=452

 Score =   402 bits (1032),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 206/442 (47%), Positives = 287/442 (65%), Gaps = 15/442 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ACSGSIVKFLPG--FEGPLPFELETGYIGVGEEEQVQLFYYFIKSEKNPKEDPLLIWLSG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVK--YTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
             GPGCS+   +  E GP++  V +    G  P L    H+WTKV+N++F+D P   GF+YA
Sbjct  76    GPGCSSATGLFFENGPVTFNVEEGYNEGSGPALLSTTHSWTKVANIIFLDQPVGTGFSYA  135

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
             TT+  +  S+  E++Q +EF+RKW + H E+++NPFYV GDS+SG  +P   + I+ GN+
Sbjct  136   TTQLLDTPSDSGEAKQIHEFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGND  195

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G KP +NL+GY+LGNP +     H + IP A+GM LI  +LY+SL++NCKGNY++    
Sbjct  196   LGFKPQVNLEGYVLGNPVTDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPH  255

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP--GEFCWQMF  604
             N  C +   K+ +    IN  HIL   C          RR +  R V  P   + C+ ++
Sbjct  256   NTECLKHHDKYLKCISSINVVHILMPRC---DPPLFLQRRFILLRNVSAPLIADGCY-IY  311

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRAL  424
               L + LWAN+ +V+ ALHV KG+I +W  C+ +   Y  D+  ++PYH N + +G R++
Sbjct  312   TDLIASLWANDESVRKALHVVKGSIEKWVRCS-SGKPYDFDIKSSVPYHMNNSIKGYRSI  370

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             I+SGDHDL+VP  ST+AWI SL YS +D WRPW  H+  IAG+TR+Y+NNMT+AT+K SG
Sbjct  371   IFSGDHDLVVPFPSTQAWIRSLGYSIIDEWRPWMVHNQ-IAGYTRTYANNMTYATVKASG  429

Query  243   HIAPFFSAYECLIMFERWISGQ  178
             H    F   E  IMF+RWISGQ
Sbjct  430   HTLE-FKPNESFIMFQRWISGQ  450



>ref|XP_008452660.1| PREDICTED: serine carboxypeptidase-like 7 [Cucumis melo]
Length=468

 Score =   402 bits (1033),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 204/442 (46%), Positives = 284/442 (64%), Gaps = 17/442 (4%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V H+PG  + GPLPFELETGY+ VG+++EV++FYYFVKSQ NP TDP + W  GGPGCS 
Sbjct  30    VKHLPG--FSGPLPFELETGYVSVGDSDEVELFYYFVKSQGNPQTDPLMSWFDGGPGCSG  87

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
                +  EIGP++++V  Y G +P++ LNPHTWTK +++LF+D    +GF+Y  T      
Sbjct  88    FTGLFVEIGPLNLKVEPYNGSLPQIILNPHTWTKNTSILFVDSVVYSGFSYPRTPHGAKK  147

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
              +  +  Q+++F+RKW   HPE+++NPFYVGG S++G+ VP IT+ I++GN+ G  P+IN
Sbjct  148   GDFIQINQSHQFLRKWLAAHPEFISNPFYVGGVSYAGMIVPPITQAISEGNKYGV-PVIN  206

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             L+GYI+GNP S         IP A+GMNLIPT LY+SL  +CKG Y     +N  C + +
Sbjct  207   LQGYIVGNPVSVRGRNENLAIPFAHGMNLIPTQLYESLTSSCKGEYVKVDPNNVDCIKHV  266

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLR--------RSLSQRP--VLPPGEFCWQMF  604
               + +    IN   IL  FC       +  R        + L Q P   LP      + +
Sbjct  267   STYKKCVSRINVWCILRRFCKPPSERPEPRRSLYNSFDDQQLLQLPQKTLPQYAIDCEEY  326

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRAL  424
                    WAN+  VQ+ALH+RKGTI  W  CN TD  Y  ++++ +PYHANL+ +G R+L
Sbjct  327   KGNLGYYWANDDRVQEALHIRKGTIPEWDRCNTTD-DYEYEISNVVPYHANLSLKGYRSL  385

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             ++SGDHD+ VPT+ T+ W+ SLNYS VD WRPW   D  + G+T +Y+NNMTFAT+KG G
Sbjct  386   VFSGDHDMRVPTIDTKEWVDSLNYSIVDDWRPWFILDDQVLGYTMTYANNMTFATIKGGG  445

Query  243   HIAPFFSAYECLIMFERWISGQ  178
             H  P ++AY+  IMF RWI G+
Sbjct  446   H-TPQYTAYQSGIMFNRWIVGE  466



>ref|XP_002878651.1| hypothetical protein ARALYDRAFT_900758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54910.1| hypothetical protein ARALYDRAFT_900758 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   401 bits (1030),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 285/432 (66%), Gaps = 23/432 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V  +PGL+  G LPFELETGYIG+GE+E++Q FYYF+KS+ NP  DP + W  GGPGCS+
Sbjct  25    VKSLPGLE--GSLPFELETGYIGIGEDEDIQFFYYFIKSENNPREDPLLLWLDGGPGCSS  82

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             L  ++ E GP++++   Y G  P L    ++WTK++N++++D P  +GF+Y+ T     +
Sbjct  83    LGGLLFENGPVALKSAVYNGSTPSLFSTTYSWTKMANIIYLDQPVGSGFSYSRT-PIEKT  141

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+  E ++ +EF++KW + HP++ +NPFYV GDS+SG+ VP + + I+ GN    KPLIN
Sbjct  142   SDTSEVKRIHEFLQKWLSKHPQFFSNPFYVTGDSYSGMIVPALVQEISKGNYICCKPLIN  201

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDM  754
             L+GY+LGNP +   +   YRIP A+GM+LI  +LY+SL++ CKGNY++    N  C + +
Sbjct  202   LQGYVLGNPITYAEHEKNYRIPFAHGMSLISDELYESLKRTCKGNYENVDPRNTKCLKLV  261

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWAN  574
              ++ + T  IN  HIL   C + G G            +  P   C+   ++L  + WAN
Sbjct  262   EEYHKCTDKINTQHILIPDCDKKGHG------------ITSPD--CYYYLYFL-IECWAN  306

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
             N  V++ALHVRKGT G+W  CN+T I Y  ++  ++PYH N +  G R+LIYSGDHD+ +
Sbjct  307   NERVREALHVRKGTKGQWQRCNWT-ISYDNNIISSVPYHMNNSISGYRSLIYSGDHDITM  365

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P  +T+AWI SLNYS +  WRPW   D  IAG+TR+YSN MTFAT+KG GH A +    E
Sbjct  366   PFQATQAWIKSLNYSIIHDWRPWMIKDQ-IAGYTRTYSNKMTFATIKGGGHTAEYLPN-E  423

Query  213   CLIMFERWISGQ  178
               IMF+RWISGQ
Sbjct  424   TFIMFQRWISGQ  435



>ref|XP_008452664.1| PREDICTED: serine carboxypeptidase-like 2 [Cucumis melo]
Length=489

 Score =   402 bits (1034),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 280/439 (64%), Gaps = 17/439 (4%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V H+PG  + GPLPFELETGY+GVGE EE+Q+FYYFVKS+ NP  DP I W  GGPGCS+
Sbjct  53    VKHLPG--FSGPLPFELETGYVGVGEREEIQLFYYFVKSEGNPKNDPLIVWLTGGPGCSS  110

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +     E GP++ ++ +Y G +P+L+LNP++WTK  +++F+D P  +GF+Y  T ++  S
Sbjct  111   VSGFAFENGPLNFKIEEYNGSLPQLQLNPYSWTKNCSIIFLDSPVGSGFSYGKTLQSLNS  170

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
              ++ +    ++F+RKW  +HPE+ +NPFYVGGDS+SG+TVP I   I +GNE    P IN
Sbjct  171   GDLTQVHHIHQFVRKWLIEHPEFTSNPFYVGGDSYSGITVPAIAYEILEGNEH-ILPAIN  229

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             L+GYILGNP +  N    Y IP A+ M LI  +L++SL  +CKG Y +   SN  C +  
Sbjct  230   LQGYILGNPVTDTNTNDNYAIPFAHSMTLISDELFESLTSSCKGEYMNIDPSNTECLRHY  289

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLS------QRPVLPPGEFCWQMFW  601
               +++    IN  HIL   C        G    RRSL       + P  P        + 
Sbjct  290   DTYEKTISEINIGHILFRHCPPDSAKPQGFSRRRRSLYNSNQVLEEPKPPLPTLGCPTYP  349

Query  600   YLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALI  421
             Y+    W NN  V++ALH+R+GTIG W  CN     YT D+T+++PYHANL++RG R+LI
Sbjct  350   YVLGSYWLNNNQVREALHIREGTIGEWIRCNLQG-EYTYDITNSVPYHANLSSRGCRSLI  408

Query  420   YSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGH  241
             YSGDHD +VPT++T  WI SLNY  V  WRPW   D  + G+TR+Y+N MTFAT+KG GH
Sbjct  409   YSGDHDFMVPTLNTLTWIKSLNYPIVKDWRPWFIKDQ-VGGYTRTYANGMTFATIKGGGH  467

Query  240   IAPFFSAYECLIMFERWIS  184
              A  ++   C ++F RWI+
Sbjct  468   TAD-YAPEPCSVVFRRWIT  485



>ref|XP_009126130.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Brassica 
rapa]
Length=452

 Score =   401 bits (1031),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/442 (47%), Positives = 287/442 (65%), Gaps = 15/442 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ACSGSIVKFLPG--FEGPLPFELETGYIGVGEEEQVQLFYYFIKSEKNPKEDPLLIWLSG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVK--YTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
             GPGCS+   +  E GP++  V +    G  P L    H+WTKV+N++F+D P   GF+YA
Sbjct  76    GPGCSSATGLFFENGPVTFNVEEGYNEGSGPALLSTTHSWTKVANIIFLDQPVGTGFSYA  135

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
             TT+  +  S+  E++Q +EF+RKW + H E+++NPFYV GDS+SG  +P   + I+ GN+
Sbjct  136   TTQLLDTPSDSGEAKQIHEFIRKWLSKHTEFISNPFYVAGDSYSGKIIPATVQEISKGND  195

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G KP +NL+GY+LGNP +     H + IP A+GM LI  +LY+SL++NCKGNY++    
Sbjct  196   LGFKPQVNLEGYVLGNPVTDFELDHNHCIPFAHGMALISDELYESLKRNCKGNYENIDPH  255

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP--GEFCWQMF  604
             N  C +   K+ +    IN  HIL   C          RR +  R V  P   + C+ ++
Sbjct  256   NTECLKHHDKYLKCISSINVVHILMPRC---DPPLFLQRRFILLRNVSAPLIADGCY-IY  311

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRAL  424
               L + LWAN+ +V+ ALHV KG+I +W  C+ +   Y  D+  ++PYH N + +G R++
Sbjct  312   TDLIASLWANDESVRKALHVVKGSIEKWVRCS-SGKPYDFDIKSSVPYHMNNSIKGYRSI  370

Query  423   IYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSG  244
             I+SGDHDL+VP  ST+AWI SL YS +D WRPW  H+  IAG+TR+Y+NNMT+AT+KG G
Sbjct  371   IFSGDHDLVVPFPSTQAWIRSLGYSIIDEWRPWMVHNQ-IAGYTRTYANNMTYATVKGGG  429

Query  243   HIAPFFSAYECLIMFERWISGQ  178
             H    F   E  IMF+RWISGQ
Sbjct  430   HTLE-FKPNESFIMFQRWISGQ  450



>ref|XP_009131551.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=447

 Score =   401 bits (1030),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 197/438 (45%), Positives = 295/438 (67%), Gaps = 12/438 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPF+LETGYIGVG+ E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANCGSIVKFLPG--FEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++ +V  Y GG P L    ++WTKV+N++F+D P  +GF+YATT
Sbjct  76    GPGCSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+RKW ++H E+++NPFYV GDS+SG  +P + + I+ GN+ G
Sbjct  136   QILDTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+G+++GNP +     H  RIP A+GM LI  +LY+SL+++CKGNYD+    N 
Sbjct  196   FKPQINLEGFVIGNPVTDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNT  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C +   +F +    IN  +IL   C +  +    +    +  P     + C++ +  L 
Sbjct  256   ECLKHFDEFLKCISRINFANILIPRCDQALSPRRYILLPNTSAPST--DDDCYE-YTDLL  312

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             S LWAN+ +V++ALHV  G+I +W  C+ +   Y +D+  ++PYH N + +G R+LI+SG
Sbjct  313   SSLWANDESVREALHV--GSIDKWVRCS-SGKPYDSDIKSSVPYHMNNSIKGYRSLIFSG  369

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHDL+ P +ST+AWI SLNYS V+ WRPW  H+  +AG+T++Y+N MT+AT+KG GH  P
Sbjct  370   DHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQ-VAGYTQTYANKMTYATVKGGGH-TP  427

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWISGQ
Sbjct  428   EYKPKESFIMFQRWISGQ  445



>ref|XP_009125362.1| PREDICTED: serine carboxypeptidase-like 19 [Brassica rapa]
Length=464

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 295/458 (64%), Gaps = 22/458 (5%)
 Frame = -2

Query  1503  MVSVVMAARGS-KVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDP  1327
             ++S++++   S  V ++PGL+  GPLPFELETGY+ VGE+ +V++FYYFVKS+ NP  DP
Sbjct  11    LLSILISIHASLHVKYLPGLE--GPLPFELETGYVSVGESGDVELFYYFVKSERNPDKDP  68

Query  1326  FIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARA  1147
              + W  GGPGCS++ A++   GP++ +   Y G +P L+L  ++WTKV+N+L+++ PA +
Sbjct  69    LMIWLTGGPGCSSICALLFGNGPLAFKGDVYNGTVPPLELTSYSWTKVANILYLESPAGS  128

Query  1146  GFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMI  967
             G++YA T++A  +S+ K+  Q  +F R WF DHPE+++NPFYVGGDS+ G  VP + + I
Sbjct  129   GYSYAKTRRAAETSDTKQLHQIDQFPRSWFVDHPEFISNPFYVGGDSYYGKIVPGVVQQI  188

Query  966   ADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD  787
               GNE G  PLIN++GY+LGNP  S N    +R+  A+ M LI  +L++SLE+NC G + 
Sbjct  189   LLGNEKGLTPLINIQGYVLGNPTVSANFESNHRVSFAHRMGLISDELHESLERNCGGKFF  248

Query  786   HF--SNELCAQDMGKFDQLTRGINPTHILEDFC--------IRVGTGSDGLRRSLSQ---  646
             +   SN  C+  +  +DQ    I    IL   C        I +       RR L +   
Sbjct  249   NVDPSNAKCSNGLQAYDQCISEIYIEQILLPNCKVDYVLPDISLPNIRTSRRRELKEFSG  308

Query  645   --RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTD  472
                  LPP   C+   ++L S  WAN+  V+ AL V+KG  G+W  CN  +I YT D+ D
Sbjct  309   NDSSSLPPPR-CFTYSYFL-SAFWANDENVRSALGVKKG-FGKWSRCNTLNIPYTYDIHD  365

Query  471   ALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFT  292
             A+PYH N + +G R+LIYSGDHD++VP  STEAWI SLNYS VD WRPW      +AG+T
Sbjct  366   AIPYHVNNSRKGFRSLIYSGDHDMMVPFSSTEAWIKSLNYSIVDDWRPWMMTSNQVAGYT  425

Query  291   RSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             RSY+N MTFAT+KG GH A  ++  +C +MF+RWI  +
Sbjct  426   RSYANKMTFATIKGGGHTAE-YNQDQCSLMFKRWIDAE  462



>ref|XP_004163543.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
18-like [Cucumis sativus]
Length=466

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 290/459 (63%), Gaps = 17/459 (4%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L  S    +  AA    VD +PG  + G LPFELETGY+GVG+ EEVQ+FYYFVKS+ NP
Sbjct  11    LLVSVFQIIFGAASHWTVDFLPG--FPGRLPFELETGYVGVGDMEEVQLFYYFVKSEGNP  68

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
              TDP +FW  GGPGCSAL  +  E+GPI+ ++ +Y G +P++ LNP++WTK S++LF+DL
Sbjct  69    KTDPLLFWLTGGPGCSALTGLAFELGPINFKIEEYNGSLPQIILNPYSWTKKSSILFVDL  128

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y TT ++    +  +   + +F +KW   HPE+L+NPFYVGGDS+SG+ +P+I
Sbjct  129   PVGTGFSYGTTPQSLNIGDFTQVHHSIQFFKKWLIRHPEFLSNPFYVGGDSYSGIVIPVI  188

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I  G E    P INL+GYILGNP +       + IP A+ M LI  +L++SL  +CK
Sbjct  189   AEEILKGRENNHAPYINLQGYILGNPVTLRTTSQNFAIPFAHRMTLISDELFESLISSCK  248

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVG--TGSDGL--RRSLSQRP-  640
             G Y +   SN  C +    + +    ++  +IL   C         D +  RRSL   P 
Sbjct  249   GEYVNIDPSNVDCLRHYNTYQKCISKVHKANILLPRCSLQSPKKQKDAVFDRRSLYNNPK  308

Query  639   -VLPPGEFCWQM----FWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT  475
              +L PG     +    + +L S  WAN+  V+ ALHVR+G+IG W  C+   + Y  D+ 
Sbjct  309   MLLDPGPSIPALDCPTYKFLLSXYWANDDQVRKALHVREGSIGEWRRCS-DKLNYNYDIE  367

Query  474   DALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGF  295
             +A PYH NL+++G R+LIYSGDHD++V  + T+AWI SLNYS V+ WRPW   D  +AG+
Sbjct  368   NAFPYHVNLSSKGYRSLIYSGDHDMVVSHLDTQAWIKSLNYSIVEDWRPWFIADQ-VAGY  426

Query  294   TRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             TRSY+N MTFAT+KG GH A  ++  EC I+F RWI+ +
Sbjct  427   TRSYANKMTFATIKGGGHTAE-YTLKECSIVFSRWIARE  464



>ref|NP_187656.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
 sp|Q9SQX6.1|SCP7_ARATH RecName: Full=Serine carboxypeptidase-like 7; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG51371.1|AC011560_3 putative glucose acyltransferase; 97813-95037 [Arabidopsis thaliana]
 gb|AAF76347.1| glucose acyltransferase, putative [Arabidopsis thaliana]
 gb|AAM67067.1| putative glucose acyltransferase [Arabidopsis thaliana]
 gb|AEE74908.1| serine carboxypeptidase-like 7 [Arabidopsis thaliana]
Length=437

 Score =   400 bits (1028),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/435 (46%), Positives = 280/435 (64%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  26    ASIVKSLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPQEDPLLLWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP+++++  Y G +P L    ++WTKVS+++++D P   GF+Y+ TK  
Sbjct  84    CSSISGLLYENGPVNVKIEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTKLV  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF+ KW   H E+ +NPFYVGGDS+ G+ +P + + I+ GN    KP
Sbjct  144   NKPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYVGGDSYCGMVIPALVQEISKGNYVCCKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GYILGNP++       YRIP A+GM LI  +LY+S+++ CKG Y++    N  C 
Sbjct  204   PINLQGYILGNPSTENEVDINYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + +G++ + T+ IN   I+   C  V T  D                 C+ M+ YL +  
Sbjct  264   KLVGEYQKCTKRINKALIITPEC--VDTSPD-----------------CY-MYRYLLTTY  303

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  VQ ALHV KG+IG W  C Y +I Y  D+  ++PYH N +  G  +LI+SGDHD
Sbjct  304   WANDENVQRALHVNKGSIGEWVRC-YFEIPYNHDIKSSVPYHMNNSIDGYASLIFSGDHD  362

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N M FAT+KG GH  P + 
Sbjct  363   MEVPYLGTQAWIRSLNYSLIDDWRPWMIGDQ-IAGYTRTYANKMAFATIKGGGH-TPEYK  420

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  421   PEESYIMFQRWISGQ  435



>ref|XP_006415268.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
 gb|ESQ33621.1| hypothetical protein EUTSA_v10007570mg [Eutrema salsugineum]
Length=464

 Score =   400 bits (1029),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 198/443 (45%), Positives = 291/443 (66%), Gaps = 17/443 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + H+PG  ++GPLPF LETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  GGP 
Sbjct  27    ASVISHLPG--FEGPLPFHLETGYIGVGEEEKVQLFYYFIKSENNPEEDPLLIWLTGGPA  84

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             C+AL A+  EIGP++ +   Y G +P L    ++WTKV+N++F+D P   GF+Y+TT+  
Sbjct  85    CTALSALAFEIGPLTFKTEGYNGSLPSLISTSYSWTKVANIIFLDQPVGTGFSYSTTRLT  144

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
                S+  E++Q Y+F++KW  ++PE+++NP YVGGDS++G+ VP I + I+ GNE   KP
Sbjct  145   YKPSDTGEAKQTYQFLQKWLVEYPEFVSNPLYVGGDSYAGIVVPAIVQQISKGNEHSYKP  204

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
             + NLKGYILGNP++ L+  H  +IP A+GM LI  +L++ L+++C+GNY     +N  C 
Sbjct  205   M-NLKGYILGNPSTDLDQDHNSKIPYAHGMGLISDELFELLKRSCQGNYVKVDPTNTQCL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL----RR---SLSQRPVLPPGEFCWQMF  604
             + M  +++    IN   IL   C         +    RR   SL +  +  P   C+ M+
Sbjct  264   KLMEDYNKCVSRINEGFILIPLCDLASPNPFSMENVGRRNLGSLVRSDLSLPTPDCY-MY  322

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-RA  427
              Y+ +  WAN+  V+ ALHV KG+I  W  C++ D+ Y  D+  ++PYH N + +G  R+
Sbjct  323   RYVLATHWANDEDVRKALHVVKGSIREWVRCDW-DMAYEKDIKSSVPYHLNNSMKGFYRS  381

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             L+YSGDHD++VP + T+AWI SLNYS +D WRPW  ++ +I G+TR+Y+NNMTFAT+KG 
Sbjct  382   LVYSGDHDMMVPFLGTQAWIKSLNYSIIDEWRPWFVNNQVI-GYTRTYANNMTFATIKGG  440

Query  246   GHIAPFFSAYECLIMFERWISGQ  178
             GH A  +   E  ++F RWI GQ
Sbjct  441   GHTAE-YKPEESFMLFRRWIRGQ  462



>ref|XP_010429239.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   399 bits (1026),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 200/435 (46%), Positives = 290/435 (67%), Gaps = 23/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             G+ V  +PG  ++GPLPFELETGYIG+GE E++QVFYYF+KS+ NP  DP + W  GGPG
Sbjct  20    GTIVKFLPG--FEGPLPFELETGYIGIGEEEDMQVFYYFIKSEKNPKEDPLLLWLDGGPG  77

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  ++ E GP++++   Y G  P L    ++WTK++N++++D P  AGF+Y+ T   
Sbjct  78    CSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRTPIG  137

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               S  + E ++ ++F++KW + HP++++N FYV GDS+SG+ VP + + I++GN    KP
Sbjct  138   KTSDTI-EVKRIHDFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISEGNYICCKP  196

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +   +   YRIP AYGM+LI  +LY+S+++ CKGNY++    +  C 
Sbjct  197   PINLQGYVLGNPITYAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCL  256

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C + G G            + PP   C+   ++L  + 
Sbjct  257   KLVEEYHKCTDKINTQHILLPDCDKKGKG------------ITPPD--CYYYLYFL-IEC  301

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++ALHV KGT G+W  CN+T I Y  D+  ++PYHAN + RG R+LIYSGDHD
Sbjct  302   WANDERVREALHVSKGTKGQWDRCNWT-IPYDNDIISSVPYHANNSFRGYRSLIYSGDHD  360

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P  +T+AWI SLNYS VD WRPW  +   IAG+TR+YSN MTFAT+KG GH A +  
Sbjct  361   ITMPFQATQAWIKSLNYSIVDDWRPWMINHQ-IAGYTRTYSNKMTFATVKGGGHTAEYLP  419

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  420   N-ETSIMFQRWITGQ  433



>ref|XP_002510076.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF52263.1| serine carboxypeptidase, putative [Ricinus communis]
Length=453

 Score =   400 bits (1027),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 282/430 (66%), Gaps = 25/430 (6%)
 Frame = -2

Query  1422  ELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEV  1243
             E   GYIGV ++E+VQ+FYYFVKSQ N   DP + W  GGPGCSAL  ++ EIGP+  + 
Sbjct  28    EFLPGYIGVDKSEDVQLFYYFVKSQGNAKEDPLLLWLTGGPGCSALSGLLYEIGPLHFKA  87

Query  1242  VKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRK  1063
             V+Y G +P L LNP++WT+V++++F+D P   GF+YA  + A++S + ++ EQ  +F+RK
Sbjct  88    VEYNGSLPTLILNPYSWTQVASIIFVDSPVGTGFSYARNQLASLSGDFRQIEQLDQFLRK  147

Query  1062  WFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNN  883
             W  DH E+L+NP YVGGDS+SG+ +P + + I +GNE G+KP +NLKGY+LGN A+    
Sbjct  148   WLIDHTEFLSNPVYVGGDSYSGMPLPPLVQRILNGNEEGSKPSVNLKGYLLGNAATDYTF  207

Query  882   VHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHI  709
                 ++P A+GM LI  +L++SL + C G Y     SN  C + M +F+++T G+N   I
Sbjct  208   DGNSQVPFAHGMGLISDELFESLRRTCGGEYVIIDPSNADCMKHMQEFNKVTSGLNTAQI  267

Query  708   LEDFC-------IRVGTGSDGLRRSLSQR--------PVLPPGEFCWQMFWYLRSDLWAN  574
             LE  C       I +   S   RRSL  +        P +P G  C + + YL S  W N
Sbjct  268   LEPLCNFAFPKPIEI---SFRRRRSLYAKSGDFADPDPSIPIG--C-RTYAYLLSKYWVN  321

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
             + +V+ ALH+R+G+IG W  CNY  + YT ++  A+ YH  L  +G R+LIYSGDHD++V
Sbjct  322   DKSVRKALHIREGSIGEWTRCNY-GLTYTYEVFSAIKYHLYLGKKGYRSLIYSGDHDMLV  380

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P + T+AWI SLN+S VD W+PW   +G +AG+TRSYSN MT+AT+KG GH AP +   E
Sbjct  381   PFVGTQAWIRSLNFSIVDDWQPWHI-EGQVAGYTRSYSNQMTYATVKGGGHTAPEYKQAE  439

Query  213   CLIMFERWIS  184
             C  MF+RWIS
Sbjct  440   CFAMFKRWIS  449



>emb|CDX76889.1| BnaC08g34750D [Brassica napus]
Length=438

 Score =   399 bits (1025),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 203/435 (47%), Positives = 283/435 (65%), Gaps = 22/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  22    GSIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSKKNPKEDPLLIWLNGGPG  79

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  +  E GP+ ++   Y G +  L  + ++WT+V N++++D P  AGF+Y+ T   
Sbjct  80    CSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVVNIIYLDQPVGAGFSYSRT-PL  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + +S+  E++  +EF++KW + HP++L+NPFYV GDS+SG T+P + + I+ GN    KP
Sbjct  139   DKTSDTNEAKMIHEFLQKWLSKHPQFLSNPFYVTGDSYSGKTIPALVQEISKGNYICCKP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
             LINL+GY+LGNP +       YRIP ++GM+LI  +LY+SL++NC+GNY +    N  C 
Sbjct  199   LINLQGYVLGNPVTYPEIEENYRIPFSHGMSLISDELYESLKRNCEGNYGNVDPRNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C       D    S +  P       C+   +YL  + 
Sbjct  259   KLVEEYHKCTDKINTQHILLPDC-------DDKSNSSNTSPD------CYYYLYYL-IEC  304

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WANN  V++ALHV KGT G W  CN+T I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  305   WANNERVREALHVEKGTKGHWQRCNWT-IPYNQDIISSVPYHMNNSISGYRSLIYSGDHD  363

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P   T+AWI SLNYS +D WRPW   D  IAG+TR+YSN MT+AT+KG GH A  + 
Sbjct  364   ITMPFQGTQAWIKSLNYSIIDDWRPWMIEDQ-IAGYTRTYSNKMTYATIKGGGHTAE-YK  421

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISG 
Sbjct  422   PNETFIMFQRWISGH  436



>ref|XP_004163541.1| PREDICTED: serine carboxypeptidase-like 19-like [Cucumis sativus]
Length=467

 Score =   399 bits (1026),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 204/444 (46%), Positives = 285/444 (64%), Gaps = 22/444 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG  + GPLPF LETGY+GVGE EE+Q+FYYFVKS+ NP  DP I W  GGPGC
Sbjct  28    SPVKFLPG--FSGPLPFSLETGYVGVGEREEIQLFYYFVKSEGNPQKDPLIVWLTGGPGC  85

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S++     E GP++ ++ +Y G +P+L LNP++WTK  +++F+D P  +GF+Y  T +A 
Sbjct  86    SSISGFAFENGPLNFKIEEYNGSLPQLHLNPYSWTKNCSIIFLDSPVGSGFSYGKTLQAF  145

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + ++ +    ++F+RKW  +HPE+++NPFYV GDS+SG+TVP IT  I +GN+    P 
Sbjct  146   NTGDVTQVHHIHQFLRKWLVEHPEFISNPFYVSGDSYSGITVPAITYEILEGNKHILPP-  204

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +  N    Y IP A+ M L+P +L++SL  +CKG Y +   SN  C +
Sbjct  205   INLQGYILGNPVTDTNTNDNYAIPFAHSMTLVPDELFESLTSSCKGEYMNIDPSNTECLR  264

Query  759   DMGKFDQLTRGINPTHILEDFCIR----VGTGSDGLRRSL--------SQRPVLPPGEFC  616
                 +++    IN  HIL   C R    +   S G RRSL          +P LP     
Sbjct  265   HYDTYEKTISKINTGHILSRHCPRDPGKLHWFSRG-RRSLYNTNQVLDEPKPSLP--TLG  321

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
               ++ YL    W NN  V++ALH+R+GTIG W  CN     Y  ++T+++ YHA L+++G
Sbjct  322   CPLYPYLLGYYWLNNNQVREALHIREGTIGEWVRCNIVG-EYNYEITNSVSYHAKLSSQG  380

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              R+LIYSGDHDLIVPT +T  WI SLNYSTV+ WRPW      + G+TR+Y+N MTFAT+
Sbjct  381   YRSLIYSGDHDLIVPTSNTLTWIKSLNYSTVEDWRPWFVKKDQVGGYTRTYANGMTFATI  440

Query  255   KGSGHIAPFFSAYECLIMFERWIS  184
             KG GH A  ++  +C I+F RWI+
Sbjct  441   KGGGHTAD-YAPEQCAIVFRRWIT  463



>ref|XP_006399445.1| hypothetical protein EUTSA_v10015495mg [Eutrema salsugineum]
 gb|ESQ40898.1| hypothetical protein EUTSA_v10015495mg [Eutrema salsugineum]
Length=469

 Score =   399 bits (1026),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/466 (44%), Positives = 297/466 (64%), Gaps = 26/466 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGS-KVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN  1342
             L+  S+ S+      S  V ++PG  +DGPLPF+LETGY+ VGE+E+V++FYYFVKS++N
Sbjct  9     LFLLSIPSIYHLVDASLHVRYLPG--FDGPLPFQLETGYVSVGESEDVELFYYFVKSESN  66

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P  DP + W  GGPGCS++   +   GP+  +  +Y G +P L+L   +WTKV+N+L+++
Sbjct  67    PEKDPLMIWLTGGPGCSSICGFLFANGPLVFKGDEYNGTVPPLELTSFSWTKVANILYLE  126

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
              PA +G++YA T +A  +S+ K+  Q   F+R WF DHPE+++NPFYVGGDS+SG  VP 
Sbjct  127   SPAGSGYSYARTPRAFETSDTKQIHQIDLFLRNWFMDHPEFISNPFYVGGDSYSGKIVPG  186

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             + + I+ GNE G  PLIN++GY+LGNP S      ++++  A+ M LI  +L++SLE++C
Sbjct  187   VVQQISLGNEKGLTPLINIQGYVLGNPTSDKKFEIDHKVSFAHRMGLISDELFESLERSC  246

Query  801   KGNYDHF--SNELCAQDMGKFDQLTRGI----------NPTHILEDFCIRVGTGSDGLRR  658
              G + +   SN  C+ D+  +DQ    I             ++L D  +       G RR
Sbjct  247   GGKFFNVDPSNAKCSNDLQDYDQCISEIYIEQILLPNCKVDYVLGDIPLNSPNIRSGSRR  306

Query  657   SLSQ------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI  496
              L +        + PP  F ++   Y  S  WAN+  V+ AL V+KG IG+W  CN  +I
Sbjct  307   ELKEFSGNDSSSLPPPSCFTYK---YFLSAFWANDENVRRALGVKKG-IGKWSRCNTENI  362

Query  495   GYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAH  316
              YT D+ +A+PYH N + +G R+LIYSGDHD++VP  STEAWI SLNYS +D WRPW   
Sbjct  363   PYTYDINNAIPYHVNNSRKGFRSLIYSGDHDMMVPFSSTEAWIKSLNYSILDDWRPWMMS  422

Query  315   DGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
                +AG+TR+Y+N MTFAT+KG GH A  ++  +C +MF+RWI G+
Sbjct  423   TNQVAGYTRTYANKMTFATIKGGGHTAE-YNPDQCSLMFKRWIDGK  467



>gb|AAQ91191.1| 1-O-sinapoylglucose:choline sinapoyltransferase [Brassica napus]
 gb|AAQ91192.1| 1-O-sinapoylglucose:choline sinapoyltransferase [Brassica napus]
Length=466

 Score =   399 bits (1025),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 292/456 (64%), Gaps = 23/456 (5%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             +++      V ++PGL+  GPLPFELETGY+ VGE+ +V++FYYFVKS++NP  DP + W
Sbjct  15    LILVDASLHVKYLPGLE--GPLPFELETGYVSVGESGDVELFYYFVKSESNPDKDPLMIW  72

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS++  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++Y
Sbjct  73    LTGGPGCSSICGLLFANGPLAFKGDEYNGTLPPLELTSFSWTKVANILYLESPAGSGYSY  132

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A T++A  +S+ K+  Q  +F+R WF DHPE+++N FYVGGDS+SG  VP + + I+ GN
Sbjct  133   AKTRRAAETSDTKQIHQIDQFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQISLGN  192

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--  781
             E G  PLIN+KGY+LGNPA   N    +R+  A+ M LI  +L++SLE+NC G + +   
Sbjct  193   EKGLTPLINIKGYVLGNPAVRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVDP  252

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFC---------------IRVGTGSDGLRRSLSQ  646
             SN  C+  +  + Q    I    IL   C               IR     +    S + 
Sbjct  253   SNAKCSNGLLAYHQCISEIYIEQILLPNCKVDYVLADISQTLPNIRTSRRRELKEFSRND  312

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                LPP   C+   ++L S  WAN+  V+ AL V+KG  G+W  CN  +I YT D+ +A+
Sbjct  313   SSSLPPPS-CFTYRYFL-SAFWANDENVRRALGVKKG-FGKWSRCNTQNIPYTYDIHNAI  369

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH N + +G RALIYSGDHD+++P  STEAWI SLNYS VD WRPW  +   +AG+TR+
Sbjct  370   PYHVNNSRKGFRALIYSGDHDMMIPFSSTEAWIKSLNYSIVDDWRPWMMNSNQVAGYTRT  429

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             Y+N MTFAT+KG GH A  ++  +C +MF+RWI G+
Sbjct  430   YANKMTFATIKGGGHTAE-YNPDQCSLMFKRWIDGE  464



>emb|CDX69437.1| BnaA10g17860D [Brassica napus]
Length=433

 Score =   398 bits (1022),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/440 (43%), Positives = 283/440 (64%), Gaps = 30/440 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V ++PG  ++GPLPFELETGYIGVG+ E++Q+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANSGSIVKYLPG--FEGPLPFELETGYIGVGKEEQLQLFYYFIKSERNPKEDPLLLWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA+ A++ E GP+   V  Y GG P L    ++WTK+++++++D P   GF+Y+ T
Sbjct  76    GPGCSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTKIASIIYLDQPVGTGFSYSKT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+ KW + H E+++NPFYV G+S++G  +P   + I+ GN+ G
Sbjct  136   QLLDTPSDSGEAKRIHEFLLKWLDKHIEFISNPFYVTGNSYAGKVIPATVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+GY++GNP +     + +R+P A+GM LI  +LY+SL+K C GNY+     N 
Sbjct  196   FKPQINLQGYVIGNPTTDQEFDYNHRVPFAHGMALISDELYESLKKTCNGNYEKVDPGNI  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFW--Y  598
              C Q + ++ +   GI   H+L   C                  V  PG     +FW  +
Sbjct  256   ECLQFVEEYHECIAGIYLGHVLAPICA-----------------VAAPG-----LFWPKH  293

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIY  418
             L++ +WAN+ +VQ ALHV KG+IG+W  C+  D  Y  D+  ++PYH N + +G  +LI+
Sbjct  294   LQASMWANDESVQKALHVAKGSIGKWIRCSSEDKPYNKDIKSSVPYHLNNSIKGYPSLIF  353

Query  417   SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHI  238
             SGDHD+ +P  +T+ WI SLNYS +D WRPW  H+  + G+T++Y+N MTFAT+KG GH 
Sbjct  354   SGDHDMTIPFTATQTWIRSLNYSIIDKWRPWMIHNQ-VTGYTKTYANKMTFATVKGGGHT  412

Query  237   APFFSAYECLIMFERWISGQ  178
             +  F   E  IMF+RWISGQ
Sbjct  413   SK-FKPEESFIMFQRWISGQ  431



>ref|XP_006376417.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|ERP54214.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=433

 Score =   397 bits (1021),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 270/438 (62%), Gaps = 27/438 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A+  S V  +PG Q  G LPF LETGY+GV E E+VQ+FYYF+KSQ NP  DP + W  G
Sbjct  19    ASAHSIVKFLPGFQ--GALPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI  E  +Y G +P L  NP++WT+VS+++F+DLP   GF+YA  
Sbjct  77    GPGCSAFSGLAFEIGPIRFEEKEYNGSLPTLVFNPYSWTQVSSIIFLDLPVSTGFSYARA  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A   S+ K+  QA +F+RKW  DH E+L+NP Y+ GDS+SG+ VP + + I++GN  G
Sbjct  137   PLALQRSDFKQVSQAEQFLRKWLMDHQEFLSNPVYISGDSYSGIIVPAVVQKISNGNNDG  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPLINLKGY LGNP +        RIP ++GM LI  +LY+SL+K+C G Y      N 
Sbjct  197   IKPLINLKGYTLGNPFTDFTFDLNSRIPFSHGMGLISDELYESLKKSCGGQYQTIDPKNS  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C +++   D+    I  +HIL             LR+  S  P+      C+  + +L 
Sbjct  257   ECLENLEARDKCISEIEESHIL-------------LRKCPSDAPL------CFLNYGFLL  297

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
                WAN+  V+ ALHVR+G+IG W  CNY    YT ++   + YH +L  +G R LIYSG
Sbjct  298   GSYWANDDKVRKALHVREGSIGEWKRCNYN---YTYEINSCIKYHIDLGIKGYRRLIYSG  354

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+  P + T+AWI SLNYS V+ W PW    G +AG+TR+YS+ +TFAT++  GH AP
Sbjct  355   DHDMEAPFLGTQAWIRSLNYSIVNDWHPWHFQ-GQVAGYTRTYSSQLTFATVRDGGHTAP  413

Query  231   FFSAYECLIMFERWISGQ  178
                  EC  MF+RWI+ +
Sbjct  414   ADRPAECFAMFKRWINQE  431



>ref|NP_179881.3| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 sp|Q8H780.2|SCP13_ARATH RecName: Full=Serine carboxypeptidase-like 13; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; AltName: 
Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17815.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15008.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07385.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=430

 Score =   397 bits (1019),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/438 (45%), Positives = 277/438 (63%), Gaps = 31/438 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  20    AHSGSIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  ++ E GP++++   Y G +P L    ++WTK++N++F+D P  +GF+Y+ T
Sbjct  78    GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKMANIIFLDQPVGSGFSYSRT  137

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                +  S+  E ++ YEF++KW + H ++ +NPFYVGGDS+SG+ VP + + I  GN   
Sbjct  138   PLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIGKGNYQ-  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
                 INL+GYILGNP +   +   Y+IP A+GM LI  +LYKS+E+ CKGNY      N 
Sbjct  197   ----INLQGYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVKVDSLNT  252

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + +  + +    +N  HIL   C                  +  P  F ++   Y  
Sbjct  253   KCYKLIKDYQKCIHKLNKYHILLPDC-----------------DITSPDCFLYR---YTL  292

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
                WANN +V++AL V KG+IG+W  CNY +I Y  D+  ++ YH   +  G R+LIY+G
Sbjct  293   ITFWANNKSVREALQVNKGSIGKWVQCNYKNISYNYDIKSSVAYHMKNSIDGYRSLIYNG  352

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD++VP ++T+AWI SLNYS  D W+PW  +D  IAG+TRSYSN MTFAT+KGSGH A 
Sbjct  353   DHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQ-IAGYTRSYSNKMTFATIKGSGHTAE  411

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWIS Q
Sbjct  412   -YKPKETSIMFKRWISAQ  428



>ref|XP_008452662.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   398 bits (1022),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 204/461 (44%), Positives = 292/461 (63%), Gaps = 23/461 (5%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L  S    +  AA    V+ +PG  + G LPFELETGY+GVG+ EEVQ+FYYFVKS+ NP
Sbjct  11    LLVSVFQIISAAASHWTVEFLPG--FPGRLPFELETGYVGVGDLEEVQLFYYFVKSEGNP  68

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
              TDP +FW  GGPGCSAL A+  E+GPI+ ++ +Y G +P++ LNP++WTK S++LF+DL
Sbjct  69    KTDPLLFWLTGGPGCSALTALAFEVGPINFKIKEYDGSLPEVILNPYSWTKKSSILFVDL  128

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y TT ++  + +  +   + +F++KW   HPE+L+NPFYVGGDS+SG+ +P+I
Sbjct  129   PVGTGFSYGTTPQSIKTGDFSQVHHSVQFLKKWLIRHPEFLSNPFYVGGDSYSGIVIPVI  188

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I + N+    P IN +GYILGNP +       + IP A+ M LIP +L++SL  +CK
Sbjct  189   AQEILEENKHA--PYINQQGYILGNPVTVGTTYQNFAIPFAHRMTLIPDELFESLTSSCK  246

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHIL------------EDFCIRVGTGSDGLR  661
             G Y +   SN  C +    + +    I+  +IL            ED      +  +  +
Sbjct  247   GEYVNIDPSNVDCLRHYNTYQKCISKIHKANILLPKCSFHSPKRQEDAIFDGRSLYNTPK  306

Query  660   RSLSQRPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTAD  481
               L   P +P  + C   + +L S  WANN  V+ ALH+RKG+IG W  C+     Y  D
Sbjct  307   VLLDPEPSIPSLD-C-PAYKFLLSSYWANNDQVRKALHIRKGSIGEWTRCS-DGQNYNYD  363

Query  480   MTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIA  301
             + +A PYH NL+++G R+LIYSGDHD++V  + T+AWI SLNYS V+ WRPW   D  +A
Sbjct  364   IENAFPYHVNLSSKGYRSLIYSGDHDMVVSHLDTQAWIKSLNYSIVEDWRPWFIADQ-VA  422

Query  300   GFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             G+TRSY+NNMTFAT+KG GH A  ++  EC ++F RWI+ +
Sbjct  423   GYTRSYANNMTFATIKGGGHTAE-YTLKECSVIFSRWIARE  462



>gb|KDO81472.1| hypothetical protein CISIN_1g012205mg [Citrus sinensis]
Length=414

 Score =   396 bits (1017),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/436 (45%), Positives = 267/436 (61%), Gaps = 49/436 (11%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PG Q  GPLPFELETGY+GVGE+ + Q+FYYFVKS+ NP  DP + W  G
Sbjct  22    AASYSTVKFLPGFQ--GPLPFELETGYVGVGESGDAQLFYYFVKSEKNPREDPLLLWLTG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI+  VV+Y G +P L LNP++WTK +++LF+D P   G++YA T
Sbjct  80    GPGCSAFSGLAYEIGPINFNVVEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGYSYAKT  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A+ + + K+ +Q  +F+RKW  DHPE L+NP Y+GGDS+SGL VP + + I++ NE  
Sbjct  140   PLASQAGDFKQVQQVDQFLRKWLLDHPELLSNPVYIGGDSYSGLVVPALVQQISNENEED  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPLINL+GYILGN A+        +IP A+GM LI  +LY+SL+  C G Y +    NE
Sbjct  200   IKPLINLQGYILGNAATEPTVEENSKIPFAHGMGLISNELYESLKMGCGGEYVNVDPKNE  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
             +C  D+  F                                            + + YL 
Sbjct  260   VCLNDIQAFS-------------------------------------------KTYGYLL  276

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             S  W N+  V+ AL +R G+ G W  CN+  + Y  ++  +  YH +L+T+G R+LIYSG
Sbjct  277   SYYWNNDYNVRKALRIRLGSKGEWQRCNF-GLPYAREIHSSFSYHVSLSTKGYRSLIYSG  335

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD++VP + TEAWI SLNYS VD WRPW  H   +AG+TR+YSN MT+AT+KG GH AP
Sbjct  336   DHDMMVPFLGTEAWIKSLNYSIVDDWRPWILHSQ-VAGYTRTYSNRMTYATVKGGGHTAP  394

Query  231   FFSAYECLIMFERWIS  184
              +   EC  MF+RWI+
Sbjct  395   EYRPAECYAMFQRWIN  410



>ref|NP_568215.2| serine carboxypeptidase-like 19 [Arabidopsis thaliana]
 sp|Q8VZU3.1|SCP19_ARATH RecName: Full=Serine carboxypeptidase-like 19; AltName: Full=Protein 
SINAPOYLGLUCOSE ACCUMULATOR 2; AltName: Full=Sinapoylglucose--choline 
O-sinapoyltransferase; Short=SCT; Contains: 
RecName: Full=Serine carboxypeptidase-like 19 chain A; Contains: 
RecName: Full=Serine carboxypeptidase-like 19 chain B; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36189.1| putative carboxypeptidase [Arabidopsis thaliana]
 gb|AAM14248.1| putative carboxypeptidase [Arabidopsis thaliana]
 gb|AED91420.1| serine carboxypeptidase-like 19 [Arabidopsis thaliana]
Length=465

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 286/444 (64%), Gaps = 21/444 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V  +PG  ++GPLPFELETGY+ +GE+ +V++FYYFVKS+ NP  DP + W  GGPGCS+
Sbjct  27    VKSLPG--FEGPLPFELETGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSS  84

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++YA T++A  S
Sbjct  85    ICGLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFES  144

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R WF  HPE+++NPFYVGGDS+SG  VP   + I+ GNE G  PLIN
Sbjct  145   SDTKQMHQIDQFLRSWFVKHPEFISNPFYVGGDSYSGKIVPGAVQQISLGNEKGLTPLIN  204

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             ++GY+LGNP +  N    YR+P A+GM LI  +L++SLE++C G + +   SN  C+ ++
Sbjct  205   IQGYVLGNPVTDKNIETNYRVPFAHGMGLISDELFESLERSCGGKFFNVDPSNARCSNNL  264

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVL------------PPGEFCWQ  610
               +D     I   HIL   C      +D       +R V+            PP  F ++
Sbjct  265   QAYDHCMSEIYSEHILLRNCKVDYVLADTPNIRTDRRRVMKEFSVNDSSSLPPPSCFTYR  324

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
                Y  S  WAN+  V+ AL V+K  +G+W  CN  +I YT ++ +A+PYH N + +G R
Sbjct  325   ---YFLSAFWANDENVRRALGVKK-EVGKWNRCNSQNIPYTFEIFNAVPYHVNNSLKGFR  380

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LIYSGDHD +VP  ST+AWI +LNYS VD WRPW      +AG+TR+Y+N MTFAT+KG
Sbjct  381   SLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKG  440

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH A  ++  +C +MF RWI G+
Sbjct  441   GGHTAE-YTPDQCSLMFRRWIDGE  463



>ref|NP_179883.1| sinapoylglucose:anthocyanin sinapoyltransferase [Arabidopsis 
thaliana]
 sp|O64810.1|SCP10_ARATH RecName: Full=Serine carboxypeptidase-like 10; AltName: Full=Sinapoylglucose--anthocyanin 
acyltransferase; AltName: Full=Sinapoylglucose--anthocyanin 
sinapoyltransferase; Short=SAT; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17817.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07395.1| serine carboxypeptidase-like 10 [Arabidopsis thaliana]
Length=437

 Score =   397 bits (1019),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 199/432 (46%), Positives = 286/432 (66%), Gaps = 23/432 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V  +PGL+  G LPFELETGYIG+GE E++Q+FYYF+KS+ NP  DP + W  GGPGCS+
Sbjct  25    VKSLPGLE--GRLPFELETGYIGIGEEEDIQLFYYFIKSENNPKEDPLLLWLDGGPGCSS  82

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             L  ++ E GP++++   Y G  P L    ++WTK++N++++D P  +GF+Y+ T     S
Sbjct  83    LGGLLFENGPVALKSAVYNGSNPSLFSTTYSWTKMANIIYLDQPVGSGFSYSRTPIGK-S  141

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+  E ++ +EF++KW + HP++ +NPFYV GDS+SG+ VP + + I+ GN    K LIN
Sbjct  142   SDTSEVKRIHEFLQKWLSKHPQFFSNPFYVTGDSYSGMIVPALVQEISKGNYICCKHLIN  201

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDM  754
             L+GY+LGNP +   +   YRIP ++GM+LI  +LY+SL++NCKGNY++    N  C + +
Sbjct  202   LQGYVLGNPITYAEHEKNYRIPFSHGMSLISDELYESLKRNCKGNYENVDPRNTKCVRLV  261

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWAN  574
              ++ + T  IN  HIL   C + G G            +  P   C+   ++L  + WAN
Sbjct  262   EEYHKCTDKINTQHILIPDCDKKGHG------------ITSPD--CYYYLYFL-IECWAN  306

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
             N  V++ALHV KGT G+W  CN+T I Y  ++  ++PYH + +  G R+LIYSGDHD+ +
Sbjct  307   NERVREALHVTKGTKGQWQRCNWT-IPYDNNIISSVPYHMDNSINGYRSLIYSGDHDITM  365

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P  +T+AWI SLNYS VD WRPW  +D  IAG+TR+YSN MTFAT+KG GH A +    E
Sbjct  366   PFQATQAWIKSLNYSIVDDWRPWMINDQ-IAGYTRTYSNKMTFATVKGGGHTAEYLPN-E  423

Query  213   CLIMFERWISGQ  178
               IMF+RWISGQ
Sbjct  424   SSIMFQRWISGQ  435



>ref|XP_010556471.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
7 [Tarenaya hassleriana]
Length=432

 Score =   396 bits (1018),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 196/456 (43%), Positives = 292/456 (64%), Gaps = 36/456 (8%)
 Frame = -2

Query  1521  QLYCSSMVSVV--------MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFY  1366
             +LY SS+ S+          A  GS V  +PG  ++GPLPFELETGY+GVGE+E+ Q+FY
Sbjct  3     KLYRSSIASLFLLLLLAGHQADSGSIVRFLPG--FEGPLPFELETGYVGVGESEDAQLFY  60

Query  1365  YFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTK  1186
             YF+KS+ NP  DP +    GGPGCS+L A + EIGP++ ++  Y GGMP L    ++WTK
Sbjct  61    YFIKSEGNPREDPLLVSLTGGPGCSSLTAFLYEIGPLAFKLEDYYGGMPSLVSTTYSWTK  120

Query  1185  VSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDS  1006
              ++++F+D P   GF+Y+   +AN  S+   ++Q YEF+RK+  DHPE+++NPFYV GDS
Sbjct  121   FASIIFLDQPVGTGFSYSRNPRANRRSDTISAKQVYEFVRKFLIDHPEFISNPFYVFGDS  180

Query  1005  FSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDL  826
             ++G  VP I + I+ GNE G KPL+NL+GY++GNP +  N    YR+P A+GM LI  +L
Sbjct  181   YAGKIVPAIVQQISKGNEEGLKPLVNLQGYVVGNPVTDPNFDINYRVPFAHGMGLISDEL  240

Query  825   YKSLEKNCKGNYDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQ  646
             Y+SL++ C GNY    N  C + +  ++++T  I   H   D  + + T +   RR    
Sbjct  241   YESLKRTCGGNYIVPRNSECTKFIQDYEEVTXFICSLH---DCMLLLFTRTQEYRR----  293

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                             L S +WA++ +VQ ALHV +G+   W  C + D+ Y  D+  ++
Sbjct  294   ----------------LLSSVWASDESVQRALHVAEGSEKEWIRCRW-DLPYDHDIESSI  336

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH N + +G R+L++SGDHD++VP + T+AW+ SLNYS +D WRPW  ++ ++ G+T++
Sbjct  337   PYHVNNSIKGYRSLVFSGDHDMLVPFLGTQAWVRSLNYSVIDDWRPWMMNNNVL-GYTKT  395

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             Y+N MT+AT+KG GH  P +   E  +MF+RWISGQ
Sbjct  396   YANKMTYATVKGCGH-TPEYKPEESSVMFQRWISGQ  430



>emb|CDY49647.1| BnaC09g41250D [Brassica napus]
Length=433

 Score =   396 bits (1017),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 191/440 (43%), Positives = 281/440 (64%), Gaps = 30/440 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V ++PG  ++GPLPFELETGYI VGE E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANSGSIVKYLPG--FEGPLPFELETGYIRVGEAEQVQLFYYFIKSERNPKEDPLLLWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA+ A++ E GP+   V  Y GG P L    ++WT++++++++D P   GF+Y+ T
Sbjct  76    GPGCSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTQIASIIYLDQPVGTGFSYSKT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+ KW   H ++++NPFYV G+S++G  +P   + I+ GN+ G
Sbjct  136   QLLDTPSDSGEAKRIHEFLLKWLAKHEKFISNPFYVTGNSYAGKVIPATVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+GY++GNP +     + +R+P A+GM LI  +LY+SL+K C GNY+     N 
Sbjct  196   FKPQINLQGYVIGNPTTDQEFDYNHRVPFAHGMALISDELYESLKKTCNGNYEKVDPGNI  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFW--Y  598
              C Q + ++ +   GI   H+L   C                  V  PG     +FW  +
Sbjct  256   ECLQFVEEYHECIAGIYLGHVLAQICA-----------------VAAPG-----LFWPKH  293

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIY  418
             L++ +WAN+ +V+ ALHV KG+IG+W  C+  D  Y  D+  ++PYH N + +G  +LI 
Sbjct  294   LQASMWANDESVRKALHVAKGSIGKWLRCSSEDKPYNKDIKSSVPYHLNNSIKGYPSLIS  353

Query  417   SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHI  238
             SGDHD+I+P  +T+ WI SLNYS +D WRPW  HD  +AG+T++Y+N MTFAT+KG GH 
Sbjct  354   SGDHDMIIPFTATQTWIRSLNYSIIDKWRPWMIHDQ-VAGYTKTYANKMTFATVKGGGHT  412

Query  237   APFFSAYECLIMFERWISGQ  178
             +  F   E  IMF RWISGQ
Sbjct  413   SK-FKPEESFIMFRRWISGQ  431



>ref|XP_009121469.1| PREDICTED: serine carboxypeptidase-like 7 [Brassica rapa]
Length=459

 Score =   397 bits (1019),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 193/449 (43%), Positives = 286/449 (64%), Gaps = 22/449 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V ++PG  ++GPLPFELETGYIGVG+ E++Q+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANSGSIVKYLPG--FEGPLPFELETGYIGVGKEEQLQLFYYFIKSERNPKEDPLLLWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA+ A++ E GP+   V  Y GG P L    ++WTK+++++++D P   GF+Y+ T
Sbjct  76    GPGCSAVSALLFENGPVKFRVEGYNGGTPTLLSTTYSWTKIASIIYLDQPVGTGFSYSKT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+ KW + H E+++NPFYV G+S++G  +P   + I+ GN+ G
Sbjct  136   QLLDTPSDSGEAKRIHEFLLKWLDKHIEFISNPFYVTGNSYAGKVIPATVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+GY++GNP +     + +R+P A+GM LI  +LY+SL+K C GNY+     N 
Sbjct  196   FKPQINLQGYVIGNPTTDQEFDYNHRVPFAHGMALISDELYESLKKTCNGNYEKVDPGNI  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTG----SDGLRRSLSQRPVLP-------PG  625
              C Q + ++ +   GI   H+L   C     G       L+R L  R  LP       P 
Sbjct  256   ECLQFVEEYHECIAGIYLGHVLAPICAVAAPGLFWPKHVLKRDL--RETLPTNFSVSFPN  313

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
                +     L++ +WAN+ +VQ ALHV KG+IG+W  C+  D  Y  D+  ++PYH N +
Sbjct  314   CIAYSE---LQASMWANDESVQKALHVAKGSIGKWIRCSSEDKPYNKDIKSSVPYHLNNS  370

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G  +LI+SGDHD+ +P  +T+ WI SLNYS +D WRPW  H+  + G+T++Y+N MTF
Sbjct  371   IKGYPSLIFSGDHDMTIPFTATQTWIRSLNYSIIDKWRPWMIHNQ-VTGYTKTYANKMTF  429

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AT+KG GH +  F   E  IMF+RWISGQ
Sbjct  430   ATVKGGGHTSK-FKPEESFIMFQRWISGQ  457



>ref|XP_010936152.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=452

 Score =   397 bits (1019),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 279/447 (62%), Gaps = 30/447 (7%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             C S VS +     + + H+PG  + G LPF LETGY+ V E  + Q+FYYF+KS++ P  
Sbjct  30    CPSPVSAL-----NTITHLPG--FHGTLPFYLETGYVKVDEVNDAQLFYYFIKSESKPEE  82

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCSA   ++ EIGP+  +V  YT G+P L  NP++WTKV N++F+D P 
Sbjct  83    DPLMVWLTGGPGCSAFSGLVYEIGPLKFDVAGYTEGLPTLVYNPYSWTKVCNIIFLDSPV  142

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y++ +K+  + + K ++Q + F+RKW  DHPE+L+NP Y+GGDS+SG+ VP++ +
Sbjct  143   GTGFSYSSVEKSYETGDTKAAQQVHTFLRKWLIDHPEFLSNPLYIGGDSYSGIVVPVVAQ  202

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              IA G+  G + L NLKGY++GNP +     +   +P A+GM LI  +LY+S +K+C G 
Sbjct  203   EIAKGDRDGDELLYNLKGYLVGNPVTDEKFDNGAFVPYAHGMGLISDELYESTKKSCGGE  262

Query  792   YDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVLPPGE  622
             Y    NE CA  +   ++   GIN   ILE  C  V           R L +  +     
Sbjct  263   YASPRNEQCANYLQSINECIEGINEGQILEPVCFFVSPKPHIVAAYSRRLLKEDI-----  317

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
                + F  L+SDL          L  R GT+  W  CNY  + Y  D+  +L +H NLT+
Sbjct  318   ---KEFSLLKSDL---------PLECR-GTVQHWQRCNY-GLPYAHDIPSSLKFHLNLTS  363

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             RG RAL+YSGDHD++VP + T+AWI SLN+S VD WR W+A DG +AGFTR+YSNN+TFA
Sbjct  364   RGYRALVYSGDHDMVVPFLGTQAWIRSLNFSIVDDWRSWSA-DGQVAGFTRTYSNNLTFA  422

Query  261   TLKGSGHIAPFFSAYECLIMFERWISG  181
             T+KG GH AP +   ECL+M +RW+SG
Sbjct  423   TVKGGGHTAPEYRPKECLVMLQRWLSG  449



>gb|AAK52316.1| sinapoylglucose:choline sinapoyltransferase [Arabidopsis thaliana]
Length=464

 Score =   397 bits (1019),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 285/444 (64%), Gaps = 22/444 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V  +PG  ++GPLPFELETGY+ +GE+ +V++FYYFVKS+ NP  DP + W  GGPGCS+
Sbjct  27    VKSLPG--FEGPLPFELETGYVSIGESGDVELFYYFVKSERNPENDPLMIWLTGGPGCSS  84

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++YA T++A  S
Sbjct  85    ICGLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLEAPAGSGYSYAKTRRAFES  144

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R WF  HPE+++NPFYVGGDS+SG  VP   + I  GNE G  PLIN
Sbjct  145   SDTKQMHQIDQFLRSWFVKHPEFISNPFYVGGDSYSGKIVPGAVQQILLGNEKGLTPLIN  204

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             ++GY+LGNP +  N    YR+P A+GM LI  +L++SLE++C G + +   SN  C+ ++
Sbjct  205   IQGYVLGNPVTDKNIETNYRVPFAHGMGLISDELFESLERSCGGKFFNVDPSNARCSNNL  264

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVL------------PPGEFCWQ  610
               +D     I   HIL   C      +D       +R V+            PP  F ++
Sbjct  265   QAYDHCMSEIYSEHILLRNCKVDYVLADTPNIRTDRRRVMKEFSVNDSSSLPPPSCFTYR  324

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
                Y  S  WAN+  V+ AL V+K  +G+W  CN  +I YT ++ +A+PYH N + +G R
Sbjct  325   ---YFLSAFWANDENVRRALGVKK--VGKWNRCNSQNIPYTFEIFNAVPYHVNNSLKGFR  379

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LIYSGDHD +VP  ST+AWI +LNYS VD WRPW      +AG+TR+Y+N MTFAT+KG
Sbjct  380   SLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSSNQVAGYTRTYANKMTFATIKG  439

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH A  ++  +C +MF RWI G+
Sbjct  440   GGHTAE-YTPDQCSLMFRRWIDGE  462



>ref|XP_010491604.1| PREDICTED: serine carboxypeptidase-like 19 [Camelina sativa]
Length=472

 Score =   397 bits (1020),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 289/447 (65%), Gaps = 23/447 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V ++PG  ++GPLPFELETGY+ +GE+ +V++FYYFVKS+ NP  DP + W  GGPGCS+
Sbjct  30    VKYLPG--FEGPLPFELETGYVSIGESGDVELFYYFVKSERNPKNDPLMIWLTGGPGCSS  87

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++YA T++A  S
Sbjct  88    ICGLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLESPAGSGYSYARTRRAFES  147

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R WF DHPE+++NPFYVGGDSFSG  VP + + I+ GNE G  PLIN
Sbjct  148   SDTKQIYQIDQFLRSWFVDHPEFISNPFYVGGDSFSGKIVPGVVQQISLGNEKGLTPLIN  207

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             ++GY+LGNP +  N    Y +  A+GM LI  +L++SLE++C+G + +   SN  C+ ++
Sbjct  208   IQGYVLGNPLTDKNLESNYIVSFAHGMGLISDELFESLERSCEGQFFNVDPSNARCSNNL  267

Query  753   GKFDQLTRGINPTHILEDFC---------------IRVGTGSDGLRRSLSQRPVLPPGEF  619
               FD     I   HIL   C               IR     +    S +    LPP   
Sbjct  268   QTFDHCMSEIYSEHILLRNCEVDYIIPETLQTLPNIRTNRRRELKEFSGNDSSSLPPPS-  326

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
             C+  + Y  S  WAN+  V+ AL V+K  +G+W  CN  +I YT ++ +A+PYH N + +
Sbjct  327   CF-TYKYFLSAFWANDENVRKALGVKK-EVGKWNRCNIQNIPYTFEIFNAVPYHVNNSRK  384

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G R+LIYSGDHD +VP  ST+AWI +LNYS VD WRPW   +  +AG+TR+Y+N MTFAT
Sbjct  385   GFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSNNQVAGYTRTYANKMTFAT  444

Query  258   LKGSGHIAPFFSAYECLIMFERWISGQ  178
             +KG GH A  ++  +C +MF RWI G+
Sbjct  445   IKGGGHTAE-YNPDQCSLMFRRWIDGE  470



>ref|XP_007134008.1| hypothetical protein PHAVU_010G011400g [Phaseolus vulgaris]
 gb|ESW06002.1| hypothetical protein PHAVU_010G011400g [Phaseolus vulgaris]
Length=469

 Score =   397 bits (1019),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 201/448 (45%), Positives = 291/448 (65%), Gaps = 19/448 (4%)
 Frame = -2

Query  1491  VMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFW  1315
             + +  GSKV+ +PG  ++GPLPFELETGY+G+GE +++ QVFYYF+KS+ +P  DP + W
Sbjct  25    ISSQLGSKVEVLPG--FEGPLPFELETGYVGLGETDDDKQVFYYFIKSENDPAKDPLMLW  82

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS+   +  +IGP   +  +Y G +P L L P +WTKV +++F+DLP   GF+Y
Sbjct  83    LTGGPGCSSFSGLAFQIGPFGFKREEYDGRVPNLFLRPQSWTKVCSIVFVDLPFGTGFSY  142

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
              T   A    + K     ++F+RKW  DHPE+L+N FY G DS+SG+  P I + I+ GN
Sbjct  143   TTNVTA-YRKDWKLVHHTHQFLRKWLIDHPEFLSNDFYFGADSYSGIPGPAIVQEISKGN  201

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS-  778
             E G +P INL+GY+LGNP ++    ++ +IP A+GM LI  +LY SL++NCKG Y     
Sbjct  202   EIGLQPPINLQGYLLGNPMTTRKEKND-KIPFAHGMGLISDELYVSLKRNCKGEYIDVDS  260

Query  777   -NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQR------PVLPP  628
              NELC++D+  +D+   GIN  +IL+ +C    T +      RRSL+Q+        L  
Sbjct  261   RNELCSRDLNYYDECLSGINEFNILDLYCKDDSTKNHDQGPWRRSLTQKFESSLNSHLTE  320

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
              +   Q++ +  +  WAN+ +V+ ALH+R+GT G+W  C   D  +  +++ +  +H NL
Sbjct  321   LDTRCQIYGFFLATQWANDESVRKALHIREGTKGKWERCWTGDFEF--EISSSFEFHLNL  378

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+LIYSGDHD +VP MST+ WI +LNYS VD WRPW   +G +AG+TR+YSN MT
Sbjct  379   SAKGYRSLIYSGDHDAVVPFMSTQTWIRALNYSIVDDWRPWLL-EGQVAGYTRTYSNQMT  437

Query  267   FATLKGSGHIAPFFSAYECLIMFERWIS  184
             FAT+KGSGH AP +   E   MF RWI+
Sbjct  438   FATVKGSGHTAPEYKPDEGYAMFSRWIA  465



>emb|CAM91989.1| sinapoylglucose:choline sinapoyltransferase [Brassica rapa subsp. 
oleifera]
Length=465

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 291/456 (64%), Gaps = 24/456 (5%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             +++      V ++PGL+  GPLPFELETGY+ VGE+ +V++FYYFVKS+ NP  DP + W
Sbjct  15    LILVDASLHVKYLPGLE--GPLPFELETGYVSVGESGDVELFYYFVKSERNPDKDPLMIW  72

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS++   +   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++Y
Sbjct  73    LTGGPGCSSICGFLFANGPLAFKGNEYNGTLPPLELTSFSWTKVANILYLESPAGSGYSY  132

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A T++A  +S+ K+  Q  +F+R WF DHPE+++N FYVGGDS+SG  VP + + I+ GN
Sbjct  133   AKTRRAAETSDTKQIHQIDQFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQISLGN  192

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--  781
             E G  PLIN++GY+LGNPA   N    +R+  A+ M LI  +L++SLE+NC G + +   
Sbjct  193   EKGLTPLINIQGYVLGNPAVRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVDP  252

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFC---------------IRVGTGSDGLRRSLSQ  646
             SN  C+  +  + Q    I    IL   C               IR     + L+ S + 
Sbjct  253   SNAKCSNGLLAYHQCISEIYIEQILLPNCKVDYVLADISQTLPNIRTSRRRE-LKESRND  311

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                LPP   C+   ++L S  WAN+  V+ AL V+KG  G+W  CN  +I YT D+ +A+
Sbjct  312   SSSLPPPS-CFTYRYFL-SAFWANDENVRRALGVKKG-FGKWSRCNTQNIPYTYDIHNAI  368

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH N + +G RALIYSGDHD+++P  STEAWI SLNYS VD WRPW      +AG+TR+
Sbjct  369   PYHVNNSRKGFRALIYSGDHDMMIPFSSTEAWIKSLNYSIVDDWRPWMMTSNQVAGYTRT  428

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             Y+N MTFAT+KG GH A  ++  +C +MF+RWI G+
Sbjct  429   YANKMTFATIKGGGHTAE-YNPDQCSLMFKRWIDGE  463



>ref|XP_010461188.1| PREDICTED: serine carboxypeptidase-like 18 [Camelina sativa]
Length=464

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/443 (45%), Positives = 289/443 (65%), Gaps = 16/443 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V ++PG  +DG LPF LETGYIGVGE E VQ++YYF+KS+ NP  DP I W  GGP 
Sbjct  26    ASVVSYLPG--FDGLLPFHLETGYIGVGEEENVQLYYYFIKSENNPEEDPVILWLTGGPA  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS L A+  EIGP++ +   Y GG+P L    ++WTKV++++F+D PA AGF+Y+T   A
Sbjct  84    CSVLSALAFEIGPLTFKTEGYNGGLPSLVSTSYSWTKVASIIFLDQPAGAGFSYSTNPLA  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E++ AYEF++KW  ++PE+++NP YVGGDS++G+ VP I + I+ GNE G  P
Sbjct  144   HKPSDTGEAKHAYEFLQKWLVENPEFVSNPLYVGGDSYAGMVVPAIVQHISIGNEHGYNP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INLKGY+LGNP +  ++ +  RI  A+GM  I  +LY+SL++ C+ NY     +N  C 
Sbjct  204   RINLKGYLLGNPVTDHDSDNNSRIQYAHGMGFISDELYESLKRTCQRNYVKVDPTNTQCF  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLR---RSLSQRPVLPPGEFCWQMF  604
             + +  + +    IN   I    C        +G    R   ++L Q  +  P   C+ M+
Sbjct  264   KLLEDYQKCVSRINEGFISIPLCDLASPNPYSGEHNGRSYLKTLVQSDLSLPTPDCY-MY  322

Query  603   WYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL-RA  427
              YL +  WAN+  V+ ALHV KG++G+W  C++ D+ Y  D+  ++PYH N + +G+ R+
Sbjct  323   RYLIAAYWANDEDVRRALHVVKGSVGKWARCDW-DLPYEEDIQSSVPYHRNNSIKGVYRS  381

Query  426   LIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             L+YSGDHDL+VP + TEAWI SLNYS  D WRPW  ++ +I GFTR+Y+NNMTFAT+KG 
Sbjct  382   LVYSGDHDLMVPFLGTEAWIKSLNYSITDDWRPWLVNNQVI-GFTRTYANNMTFATIKGG  440

Query  246   GHIAPFFSAYECLIMFERWISGQ  178
             GH    +   E  +MF++WI+GQ
Sbjct  441   GHTTE-YKPEESFMMFQKWITGQ  462



>ref|XP_009365383.1| PREDICTED: serine carboxypeptidase-like 13 [Pyrus x bretschneideri]
Length=473

 Score =   396 bits (1017),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 285/455 (63%), Gaps = 31/455 (7%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTT  1333
             CS M+ V   +    V  +PG Q  GPLPFELETGY+GVGE EEVQ+FYYFVK++  P  
Sbjct  32    CSQMLPV---SNSQLVKFLPGFQ--GPLPFELETGYVGVGEEEEVQLFYYFVKTERKPEE  86

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             DP + W  GGPGCS+L A++ EIGP++  + +Y G +P L LNP+ WTKVS+++F+D P 
Sbjct  87    DPLMLWLTGGPGCSSLTALLYEIGPLNFNIEQYNGSLPTLTLNPYAWTKVSSIIFVDSPV  146

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+YA    A+  S+ ++   A +F+RKW  DHPE+++NPF+          +P++ +
Sbjct  147   GTGFSYARGSFASQPSDSEQVGHALQFLRKWLVDHPEFMSNPFF----------LPVLAQ  196

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
             +I+DGN+ G  P INL+GYILGNP +   +    +I  A+GM LIP DL++SLE++C G 
Sbjct  197   LISDGNQEGVIPAINLQGYILGNPLTVPQDERNSQITFAHGMGLIPDDLFESLERSCGGE  256

Query  792   YDHFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD----GLRRSLSQR----  643
             Y      N  C +    +      IN  HILE  C  V           RR LS +    
Sbjct  257   YQTIDPRNAECLKHKQAYHTCISQINLVHILEWNCELVSPKPPLHMLDKRRYLSNKDYNV  316

Query  642   --PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDA  469
                  PP   C + + YL S+ W N+  V++ALH+RKG+I RW  C+Y D  Y  D+  +
Sbjct  317   FSESTPPTLDC-RSYGYLLSEYWTNDQYVREALHIRKGSIRRWQRCSY-DRPYEYDIHTS  374

Query  468   LPYHANLTTRG-LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFT  292
             + +HA L+ +G  R+LIYSGDHD++VP M+T+AWI SLNYS V+ WRPW    G +AG+T
Sbjct  375   IQFHAKLSAQGYYRSLIYSGDHDMMVPFMATQAWIRSLNYSIVNDWRPWFV-KGQVAGYT  433

Query  291   RSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWI  187
             R+YSN MT+AT+KG+GH AP +   EC  M+ +W+
Sbjct  434   RTYSNRMTYATVKGAGHTAPEYKPEECSTMYTKWL  468



>ref|XP_002882669.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58928.1| hypothetical protein ARALYDRAFT_478377 [Arabidopsis lyrata subsp. 
lyrata]
Length=437

 Score =   394 bits (1013),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 195/434 (45%), Positives = 280/434 (65%), Gaps = 27/434 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG  +DGPLPFELETGYIGVG+ EEVQ+FYYF+KS+ +P  DP + W  GGPGC
Sbjct  27    SIVKSLPG--FDGPLPFELETGYIGVGKEEEVQLFYYFIKSERSPQEDPLLLWLSGGPGC  84

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S++  ++ E GP+++++  Y G +P L    ++WTKVS+++++D P   GF+Y+ T+  N
Sbjct  85    SSISGLLYENGPVTVKLEVYNGTLPSLVATTYSWTKVSSIIYLDQPVGTGFSYSRTQLVN  144

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               S+  E+++ +EF+ KW   H E+ +NPFYVGGDS+ G+ +P + + I+ GN    KP 
Sbjct  145   KPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYVGGDSYCGMVIPALVQEISKGNYVCCKPP  204

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             IN++GYILGNP++     + YRIP A+GM LI  +LY+S+++ CKG Y++    N  C +
Sbjct  205   INIQGYILGNPSTENEVDNSYRIPYAHGMALISDELYESMKRICKGKYENVDPRNTKCLK  264

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLW  580
              +G++ +    IN   I+   C+   T  D                 C+ M+ YL +  W
Sbjct  265   LVGEYQKCINRINKALIITPECVE--TSPD-----------------CY-MYRYLLTTYW  304

Query  579   ANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDL  400
             AN+ +VQ ALHV KG+IG W  C Y +I Y  D+  ++PYH N +  G  +LI+SGDHD+
Sbjct  305   ANDESVQRALHVNKGSIGEWVRC-YREIPYNHDIKSSVPYHMNNSIDGYPSLIFSGDHDM  363

Query  399   IVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSA  220
              VP + T+AWI SLNYS +D WRPW   D  I G+TR+Y+N MTFAT+KG GH  P +  
Sbjct  364   EVPYLGTQAWIRSLNYSLIDDWRPWMIGDQ-ITGYTRTYANKMTFATIKGGGH-TPEYKP  421

Query  219   YECLIMFERWISGQ  178
              E  IMF+RWISGQ
Sbjct  422   EETYIMFQRWISGQ  435



>ref|XP_010452962.1| PREDICTED: serine carboxypeptidase-like 19 [Camelina sativa]
Length=470

 Score =   395 bits (1016),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 199/465 (43%), Positives = 295/465 (63%), Gaps = 25/465 (5%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L+  ++ S+ + A    V ++PG  ++GPLPFELETGY+ +GE+ +V++FYYFVKS+ NP
Sbjct  11    LFLLTISSIHVDASSLLVKYLPG--FEGPLPFELETGYVSIGESGDVELFYYFVKSERNP  68

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DPF+ W  GGPGCS++  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ 
Sbjct  69    KNDPFMIWLTGGPGCSSICGLLFANGPLAFKGDEYNGTVPPLELTSFSWTKVANILYLES  128

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             PA +G++YA T++A  SS+ K+  Q  +F R WF DH E++++PFYVGGDSFSG  VP +
Sbjct  129   PAGSGYSYARTRRAFESSDTKQINQIDQFRRSWFVDHQEFISSPFYVGGDSFSGFIVPGV  188

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G  PLIN++GY+LGNP +  N    YR+  A+GM LI  +L++SLE++C+
Sbjct  189   VQQISLGNEKGLTPLINIQGYVLGNPLTDRNLESNYRVSFAHGMGLISDELFESLERSCE  248

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHIL-----EDFCI-----RVGTGSDGLRRS  655
             G + +   SN  C+ ++  +D     I   HIL      D+ I      +       RR 
Sbjct  249   GKFFNVDPSNARCSNNLQTYDHCMSEIYAEHILLRNCEVDYVIPETLQTISNIRTDRRRV  308

Query  654   LSQ------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG  493
             L +        + PP  F ++   Y  S  WAN+  V+ AL V+K  +G+W  CN  +I 
Sbjct  309   LKEFSRNDSSSLPPPSCFTYK---YFLSAFWANDENVRKALGVKK-EVGKWNRCNIQNIP  364

Query  492   YTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHD  313
             YT  + +A PYH N++  G R+LIYSGDHD +VP  ST+AWI +LNYS VD WRPW    
Sbjct  365   YTFQIFNAFPYHVNISRIGFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVDDWRPWMMSS  424

Query  312   GIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
               +AG+TR+Y+N MTFAT+KG GH A  ++  +  +MF RWI G+
Sbjct  425   NQVAGYTRTYANKMTFATIKGGGHTAE-YNPDQSAVMFRRWIDGE  468



>ref|XP_009125363.1| PREDICTED: serine carboxypeptidase-like 19 [Brassica rapa]
 emb|CAM91991.1| sinapoylglucose:choline sinapoyltransferase [Brassica napus var. 
napus]
Length=466

 Score =   395 bits (1015),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 200/456 (44%), Positives = 289/456 (63%), Gaps = 23/456 (5%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             +++      V ++PGL+  GPLPFELETGY+ VGE+ +V++FYYFVKS+ NP  DP + W
Sbjct  15    LILVDASLHVKYLPGLE--GPLPFELETGYVSVGESGDVELFYYFVKSERNPDKDPLMIW  72

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS++   +   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++Y
Sbjct  73    LTGGPGCSSICGFLFANGPLAFKGNEYNGTLPPLELTSFSWTKVANILYLESPAGSGYSY  132

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A T++A  +S+ K+  Q  +F+R WF DHPE+++N FYVGGDS+SG  VP + + I+ GN
Sbjct  133   AKTRRAAETSDTKQIHQIDQFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQISLGN  192

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--  781
             E G  PLIN++GY+LGNPA   N    +R+  A+ M LI  +L++SLE+NC G + +   
Sbjct  193   EKGLTPLINIQGYVLGNPAVRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVDP  252

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFC---------------IRVGTGSDGLRRSLSQ  646
             SN  C+  +  + Q    I    IL   C               IR     +    S + 
Sbjct  253   SNAKCSNGLLAYHQCISEIYIEQILLPNCKVDYVLADISQTLPNIRTSRRRELKEFSRND  312

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
                LPP   C+   ++L S  WAN+  V+ AL V+KG  G+W  CN  +I YT D+ +A+
Sbjct  313   SSSLPPPS-CFTYRYFL-SAFWANDENVRRALGVKKG-FGKWSRCNTQNIPYTYDIHNAI  369

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH N + +G RALIYSGDHD+++P  STEAWI SLNYS VD WRPW      +AG+TR+
Sbjct  370   PYHVNNSRKGFRALIYSGDHDMMIPFSSTEAWIKSLNYSIVDDWRPWMMTSNQVAGYTRT  429

Query  285   YSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             Y+N MTFAT+KG GH A  ++  +C +MF+RWI G+
Sbjct  430   YANKMTFATIKGGGHTAE-YNPDQCSLMFKRWIDGE  464



>ref|XP_009133994.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Brassica 
rapa]
Length=436

 Score =   394 bits (1012),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 284/438 (65%), Gaps = 22/438 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIG+GE E +Q+FYYF+KS+ NP  DP + W  G
Sbjct  17    ADSGSIVKFLPG--FEGPLPFELETGYIGIGEEENLQLFYYFIKSEKNPKEDPLLLWLNG  74

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  ++ E G ++++V  Y G +  L    ++WT+++N++++D P  AGF+Y+ T
Sbjct  75    GPGCSSLEGLLFENGLVAVKVEVYNGSLVSLVSTTYSWTQMANIIYLDQPIGAGFSYSRT  134

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                  +S+  E++  +EF++KW + HP++ +NPFY  GDS+SG TVP + + I+ GN   
Sbjct  135   PLGK-TSDTNEAKMIHEFLQKWLSKHPQFFSNPFYATGDSYSGKTVPALVQEISQGNYKC  193

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPLINL+GY+LGNP +       YRIP ++GM+LI  +L++SL+ NCKGNY +    N 
Sbjct  194   CKPLINLQGYVLGNPVTYPEFEENYRIPFSHGMSLISDELHESLKINCKGNYGNVDPRNT  253

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + ++ + T  IN  HIL   C       D  R   +  P       C+   +Y+ 
Sbjct  254   KCLKLVEEYHKCTDKINTQHILLPDC-------DDKRNPKNTSPD------CYYYLYYI-  299

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
              + WANN  V++ALHV+KGT G W  CN+T I Y  D+  ++PYH N++  G R+L+YSG
Sbjct  300   IECWANNERVREALHVKKGTKGHWQRCNWT-IPYDHDIISSVPYHMNISLSGYRSLVYSG  358

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+ +P + T+AWI SLNYS +D WRPW   D  IAG+TR+YSN MTFAT+KG GH A 
Sbjct  359   DHDITMPFLGTQAWIKSLNYSIIDDWRPWKIKDQ-IAGYTRTYSNKMTFATIKGGGHTAE  417

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWISG 
Sbjct  418   -YKPNETFIMFQRWISGH  434



>emb|CAM91988.1| sinapoylglucose:choline sinapoyltransferase [Brassica oleracea 
var. medullosa]
 emb|CAM91990.1| sinapoylglucose:choline sinapoyltransferase [Brassica napus var. 
napus]
Length=466

 Score =   395 bits (1015),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 200/457 (44%), Positives = 290/457 (63%), Gaps = 25/457 (5%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             +++      V ++PGL+  GPLPFELETGY+ VGE+ +V++FYYFVKS+ NP  DP + W
Sbjct  15    LILVDASLHVKYLPGLE--GPLPFELETGYVSVGESGDVELFYYFVKSERNPDKDPLMIW  72

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCS++  ++   GP++ +  +Y G +P L+L   +WTKV+N+L+++ PA +G++Y
Sbjct  73    LTGGPGCSSICGLLFANGPLAFKGDEYNGTLPPLELTSFSWTKVANILYLESPAGSGYSY  132

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A T++A  +S+ K+  Q  +F+R WF DHPE+++N FYVGGDS+SG  VP + + I+ GN
Sbjct  133   AKTRRAAETSDTKQIHQIDQFLRSWFVDHPEFISNSFYVGGDSYSGKIVPGVVQQISLGN  192

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--  781
             E G  PLIN++GY+LGNPA   N    +R+  A+ M LI  +L++SLE+NC G + +   
Sbjct  193   EKGLAPLINIQGYVLGNPAVRTNLEPNHRVSFAHRMGLISDELHESLERNCGGKFFNVDP  252

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD----------GLRRSLSQ-----  646
             SN  C+  +  + +    I    IL   C      SD            RR L +     
Sbjct  253   SNAKCSNGLLAYHRCISEIYIEQILLPNCKVDYVLSDISQTLPNIRTSRRRELKEFSRND  312

Query  645   -RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDA  469
                + PP  F ++   Y  S  WAN+  V+ AL V+KG  G+W  CN  +I YT D+ +A
Sbjct  313   SSSLPPPSCFTYR---YFLSAFWANDENVRRALGVKKG-FGKWSRCNTQNIPYTYDIHNA  368

Query  468   LPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTR  289
             +PYH N + +G RALIYSGDHD+++P  STEAWI SLNYS VD WRPW      +AG+TR
Sbjct  369   IPYHVNNSRKGFRALIYSGDHDMMIPFSSTEAWIKSLNYSIVDDWRPWMMSSNQVAGYTR  428

Query  288   SYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +Y+N MTFAT+KG GH A  ++  +C +MF+RWI G+
Sbjct  429   TYANKMTFATIKGGGHTAE-YNPDQCSLMFKRWIDGE  464



>ref|XP_003573757.1| PREDICTED: serine carboxypeptidase-like 13 [Brachypodium distachyon]
Length=483

 Score =   395 bits (1015),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 191/440 (43%), Positives = 272/440 (62%), Gaps = 14/440 (3%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             + H+PG  +DGPLPF+L+TGY+ V E+  V++FYYF++S+  P  DP + W  GGPGCSA
Sbjct  46    ISHLPG--FDGPLPFQLQTGYVEVDESNGVRLFYYFIRSERKPEEDPVMLWLTGGPGCSA  103

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
                ++ EIGP++ +      G PKL   P +WT+VSN++F+D P   GF+Y+ T++   S
Sbjct  104   FSGLVYEIGPLTFDRHSSIDGTPKLLYKPDSWTRVSNVIFLDSPVGTGFSYSKTEQGYKS  163

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K   Q   F++KWF++HPE+L+NP Y+ GDS+ G+ VP IT  +A G E G    +N
Sbjct  164   SDTKAVNQIVVFLKKWFDEHPEFLSNPLYIAGDSYCGMIVPAITLELAKGKEDGNISALN  223

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQDMGK  748
             LKGY++GNP +  N     +IP A+GM LI  ++YK+ + +C    +   +  C   +  
Sbjct  224   LKGYLVGNPVTDGNFDSPAKIPFAHGMGLISDEMYKAYKDSCSAQQNSQQSFQCTNSLDV  283

Query  747   FDQLTRGINPTHILEDFCIRVG---TGSDGLRRSL-------SQRPVLPPGEFCWQMFWY  598
              D+    I   HILE  C        G  G R+ +         R  L       +   Y
Sbjct  284   IDKCVEDICTNHILEPLCTFASPHPNGDSGARQVIQLHDYAAEARLQLSDISTECRTAEY  343

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIY  418
             + S  WANN AV+DAL + KGT+  W  CNY DI YT D+  ++ +H ++TTRG R+L+Y
Sbjct  344   IMSRTWANNDAVRDALGIHKGTVPSWLRCNY-DILYTNDIRSSVEHHLDVTTRGYRSLVY  402

Query  417   SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHI  238
             SGDHD+++P + T+AWI SLN+S VD WRPW   D  +AG+TRSYSNN+TFAT+KG GH 
Sbjct  403   SGDHDMVIPFIGTQAWIRSLNFSVVDEWRPWYV-DTQVAGYTRSYSNNLTFATVKGGGHT  461

Query  237   APFFSAYECLIMFERWISGQ  178
             AP +   +CL MF RW+SG 
Sbjct  462   APEYMPKQCLAMFARWVSGD  481



>ref|XP_010472298.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Camelina 
sativa]
Length=435

 Score =   394 bits (1011),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 285/435 (66%), Gaps = 23/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             G+ V  +PG  ++GPLPFELETGYIG+GE E +QVFYYF+KS+ NP  DP + W  GGPG
Sbjct  20    GTTVKFLPG--FEGPLPFELETGYIGIGEEENIQVFYYFIKSEKNPKEDPLLLWLDGGPG  77

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  ++ E GP++++   Y G  P L    ++WTK++N++++D P  AGF+Y+ T   
Sbjct  78    CSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRTPIG  137

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               S  + E ++ ++F++KW + HP++++N FYV GDS+SG+ VP + + I+ GN    KP
Sbjct  138   KTSDTI-EVKRIHDFLQKWLSKHPQFISNSFYVTGDSYSGMIVPALVQEISKGNYICCKP  196

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +   +   YRIP AYGM+LI  +LY+S+++ CKGNY++    +  C 
Sbjct  197   PINLQGYVLGNPITYAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCL  256

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C + G G            V  P   C+   ++L  + 
Sbjct  257   KLVEEYHKCTDKINTQHILLPDCDKKGKG------------VTSPD--CYYYVYFL-IEC  301

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++ALHV KGT G+W  CN+T I Y  D+  ++PYHAN + RG R+LIYSGDHD
Sbjct  302   WANDERVREALHVTKGTKGQWDRCNWT-IPYDNDIISSVPYHANNSIRGYRSLIYSGDHD  360

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P  +T+AWI SLNYS V  WRPW   D  IAG+TR+YSN MT+ T+KG GH A +  
Sbjct  361   ITMPFQATQAWIKSLNYSIVHDWRPWMIKDQ-IAGYTRTYSNKMTYVTIKGGGHTAEYLP  419

Query  222   AYECLIMFERWISGQ  178
               E  I+F+RWISGQ
Sbjct  420   N-ETSIVFQRWISGQ  433



>ref|XP_004983497.1| PREDICTED: serine carboxypeptidase-like 18-like [Setaria italica]
Length=486

 Score =   395 bits (1015),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 201/471 (43%), Positives = 285/471 (61%), Gaps = 29/471 (6%)
 Frame = -2

Query  1518  LYCSSMVS------VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFV  1357
             L C S  S      +  ++ G  + H+PG Q  GPLPF L+TGY+ V ++  V++FYYFV
Sbjct  19    LLCCSYASRPSRPPISNSSGGGAITHLPGFQ--GPLPFHLQTGYVEVDQSNGVRLFYYFV  76

Query  1356  KSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSN  1177
             +S+ +P  DP + W  GGPGCS L  +  EIGP+S ++     G PKL  N  +WTKVSN
Sbjct  77    RSERSPADDPLMLWLTGGPGCSVLSGLAYEIGPLSFDIKGNVDGFPKLMYNQDSWTKVSN  136

Query  1176  MLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSG  997
             ++F+D P  AGF+Y+ T +  VSS+ K   Q   F+RKWF +HPE+L+NP Y+ GDS+SG
Sbjct  137   VIFLDSPVGAGFSYSDTDRGYVSSDTKAVNQILIFLRKWFEEHPEFLSNPLYIAGDSYSG  196

Query  996   LTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKS  817
               VP +   IA G E G +   NLKGY++GNP +  N     +IP A+GM +I  ++Y+S
Sbjct  197   KIVPTVASEIARGKEGGHELNFNLKGYLVGNPVTDSNFDDPSKIPFAHGMGIISDEIYES  256

Query  816   LEKNCK-GNYDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRR----SL  652
              +K+C  G+  H S E C   +    +  +GI P H+LE  C      +  +      + 
Sbjct  257   YKKSCSVGDNSHQSIE-CINSLYAIQECLKGICPNHVLEPVCAFASPHAHKMETKPNLNS  315

Query  651   SQRPVLPPGEFC-------------WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCAC  511
               R +L   E+               +   Y+ S +WANN +V++AL + KGT+  W  C
Sbjct  316   GPREMLQLQEYTADAQLNLSEISLQCRTAGYIMSSVWANNASVREALGIHKGTVPSWSRC  375

Query  510   NYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWR  331
             NY+ I YT+D+   + YH ++TT+  R+L+YSGDHD+I+P + T+AWI SLN+S +D WR
Sbjct  376   NYS-IPYTSDIPSTVKYHLDVTTKDYRSLVYSGDHDMIIPHIGTQAWIKSLNFSIMDHWR  434

Query  330   PWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             PW   DG +AGFTRSYSNN+TFAT+KG GH AP +   +C  MF RWISG 
Sbjct  435   PWFV-DGQVAGFTRSYSNNLTFATVKGGGHTAPEYMPRQCFAMFARWISGD  484



>ref|NP_001077946.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
 gb|AEC07387.1| serine carboxypeptidase-like 13 [Arabidopsis thaliana]
Length=432

 Score =   393 bits (1010),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 199/440 (45%), Positives = 277/440 (63%), Gaps = 33/440 (8%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  20    AHSGSIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPEEDPLLLWLSG  77

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKV--SNMLFIDLPARAGFTYA  1132
             GPGCS+L  ++ E GP++++   Y G +P L    ++WTKV  +N++F+D P  +GF+Y+
Sbjct  78    GPGCSSLTGLLFENGPVALKFEVYNGSVPSLVSTTYSWTKVKMANIIFLDQPVGSGFSYS  137

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
              T   +  S+  E ++ YEF++KW + H ++ +NPFYVGGDS+SG+ VP + + I  GN 
Sbjct  138   RTPLVDKISDTGEVKRIYEFLQKWLSKHQQFFSNPFYVGGDSYSGMIVPPLVQEIGKGNY  197

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
                   INL+GYILGNP +   +   Y+IP A+GM LI  +LYKS+E+ CKGNY      
Sbjct  198   Q-----INLQGYILGNPITDTESEQNYQIPYAHGMALISDELYKSMERICKGNYVKVDSL  252

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWY  598
             N  C + +  + +    +N  HIL   C                  +  P  F ++   Y
Sbjct  253   NTKCYKLIKDYQKCIHKLNKYHILLPDC-----------------DITSPDCFLYR---Y  292

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIY  418
                  WANN +V++AL V KG+IG+W  CNY +I Y  D+  ++ YH   +  G R+LIY
Sbjct  293   TLITFWANNKSVREALQVNKGSIGKWVQCNYKNISYNYDIKSSVAYHMKNSIDGYRSLIY  352

Query  417   SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHI  238
             +GDHD++VP ++T+AWI SLNYS  D W+PW  +D  IAG+TRSYSN MTFAT+KGSGH 
Sbjct  353   NGDHDMMVPFLATQAWIRSLNYSITDDWKPWMINDQ-IAGYTRSYSNKMTFATIKGSGHT  411

Query  237   APFFSAYECLIMFERWISGQ  178
             A  +   E  IMF+RWIS Q
Sbjct  412   AE-YKPKETSIMFKRWISAQ  430



>ref|XP_010556480.1| PREDICTED: serine carboxypeptidase-like 1 [Tarenaya hassleriana]
Length=440

 Score =   393 bits (1010),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 191/434 (44%), Positives = 279/434 (64%), Gaps = 22/434 (5%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S  + +PG  + G LPFELETGY+GVGE+EEVQ+FYYF+KS+  P+ DP + W  GGPGC
Sbjct  25    SVTNSLPG--FHGTLPFELETGYVGVGESEEVQLFYYFIKSERKPSEDPVLVWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+   +  EIGP+  E+ +Y G  P L   P +WTK ++++F+D PA AGF+Y+TT +  
Sbjct  83    SSFSGLALEIGPLKFELTEYNGTTPTLLPTPDSWTKSASIIFVDQPAGAGFSYSTTPRGY  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              +S+ + +    +F+RKW   HPE+++NP Y+ GDS+SG+ VP  T  I+DGN+ G +P 
Sbjct  143   QASDTRSALLVDQFVRKWMLLHPEFISNPLYIAGDSYSGMIVPPTTLRISDGNDRGVQPR  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             +NLKGY+LGNP ++    H   IP A+GM LI  ++Y+SL  +CKGNY     SN  CA+
Sbjct  203   VNLKGYVLGNPLTNEETNHNAGIPYAHGMGLISDEIYESLVSSCKGNYHIVDPSNRECAR  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLW  580
              + ++++   GIN + I +D C      +D           LP      + ++Y  S  W
Sbjct  263   ALERYNECITGINLSMITDDAC-----DAD-----------LPNPRPKCKTYYYTLSSYW  306

Query  579   ANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDL  400
             +N+ +V+ +L +R+GTIG W  CN  +I Y  D+  + PYH NL+ +G R+LIYSGDHD+
Sbjct  307   SNDESVRRSLGIREGTIGEWVRCNGDNIPYNNDVISSFPYHVNLSMKGYRSLIYSGDHDM  366

Query  399   IVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSA  220
             IVP ++T+ W+ +LNYS +D WRPW      + G+TR+Y+N MTFAT+KG GH A F   
Sbjct  367   IVPHVATQEWVRALNYSIIDHWRPWMDRHQ-VQGYTRTYANQMTFATIKGGGHTAEFKRG  425

Query  219   YECLIMFERWISGQ  178
                 +MF RWI+G+
Sbjct  426   -PYGVMFNRWINGE  438



>ref|XP_010429230.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 197/435 (45%), Positives = 279/435 (64%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP + W  GGPG
Sbjct  21    GSIVKFLPG--FEGPLPFELETGYIGIGEKEEMQLFYYFIKSENNPKEDPLLLWLNGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+   +  E GP++++   Y G +P L    ++WTK++N++++D P R GF+Y+ T   
Sbjct  79    CSSNTGLFFENGPLALKSEVYNGSVPSLVSTTYSWTKMANIIYLDQPVRTGFSYSRTPLI  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E ++  EF++KW N HP++ +NPFY  GDS+SG+TVP + + I+ GN    +P
Sbjct  139   DKPSDTGEVKRIREFLQKWLNKHPQFSSNPFYAAGDSYSGMTVPALVQEISKGNYICCEP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNP +      +YR+P ++GM LI ++LY+S+   CKGNY +   SN  C 
Sbjct  199   PINLQGYVLGNPITHYEEDEKYRVPFSHGMGLISSELYESIRSACKGNYFNVDPSNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ +    +N  HIL   C    T SD                 C+   +YL S  
Sbjct  259   KLVEEYHKCIDKLNEYHILLPDCNM--TSSD-----------------CFLYPYYLLS-F  298

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V+DALH++KG+IG W  CN ++  Y  D+  ++PYH N +  G R+LIY GDHD
Sbjct  299   WANDESVRDALHIKKGSIGEWVRCNRSN-PYNKDIKSSVPYHMNNSISGYRSLIYIGDHD  357

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L+VP ++TEAWI SLNYS +  WRPW   D  IAG+TR+YSN MTFAT+KG GH      
Sbjct  358   LVVPFLATEAWIKSLNYSIIHEWRPWMIKDQ-IAGYTRTYSNKMTFATVKGGGHTVE-NK  415

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  416   PNESFIMFQRWISGQ  430



>emb|CDY49438.1| BnaA09g42290D [Brassica napus]
Length=438

 Score =   392 bits (1008),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 199/435 (46%), Positives = 282/435 (65%), Gaps = 22/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFEL+TGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  22    GSIVKFLPG--FEGPLPFELQTGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLIWLNGGPG  79

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  +  E GP+ ++   Y G +  L  + ++WT+V+N++++D P  AGF+Y+ T   
Sbjct  80    CSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVANIIYLDQPVGAGFSYSRT-PL  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + +S+  E++  ++F++KW + HP++L+NPFYV GDS+SG T+P + + I+ GN    KP
Sbjct  139   DKTSDTNEAKMIHQFLQKWLSKHPQFLSNPFYVSGDSYSGKTIPALVQEISKGNYICCKP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       YRIP ++GM+LI  +LY+SL++NCKGNY +    N  C 
Sbjct  199   PINLQGYVLGNPVTHPEIDENYRIPFSHGMSLISDELYESLKRNCKGNYRNVDPRNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C       D    S +  P       C+   +YL  + 
Sbjct  259   KLVEEYHKCTDKINTQHILLPDC-------DDKSNSSNTSPD------CYYYLYYL-IEC  304

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WANN  V++ALHV KGT G W  CN+T I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  305   WANNERVREALHVEKGTKGHWQRCNWT-IPYNQDIISSVPYHMNNSISGYRSLIYSGDHD  363

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +    T+AWI SLNYS +D WRPW   +  IAG+TR+YSN MT+AT+KG GH A  + 
Sbjct  364   ITMTFQGTQAWIKSLNYSIIDDWRPWMI-EAQIAGYTRTYSNKMTYATIKGGGHTAE-YK  421

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISG 
Sbjct  422   PNETFIMFQRWISGH  436



>gb|KDP32094.1| hypothetical protein JCGZ_12555 [Jatropha curcas]
Length=472

 Score =   394 bits (1011),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/449 (44%), Positives = 278/449 (62%), Gaps = 19/449 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
              A  S + ++PG  + GPLPF+LETGY+ VG+  +VQ+FYYF++S+ NP  DP + W  G
Sbjct  28    VASFSTIKNLPG--FSGPLPFKLETGYVEVGKKGDVQLFYYFIESERNPREDPLLLWLTG  85

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  +I EIGP+   +V+Y G +P LKLNPH+WTKVS+++F+D P   GF+Y+ +
Sbjct  86    GPGCSSLSGLIFEIGPLQFNIVEYNGSLPTLKLNPHSWTKVSSIIFLDAPVGTGFSYSRS  145

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               ++ + +  ++   Y F++KW   HPE++ NP Y+ GDS+SG+ VP+ITK I+ G E G
Sbjct  146   YHSSETGDTIQAIHTYTFLKKWLLSHPEFIKNPLYIAGDSYSGMVVPVITKQISIGIELG  205

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY---DHFSN  775
              +P INLKGY+LGNPA+        RIP A+ M LI  +LY+S ++NCKG Y   DH  N
Sbjct  206   VQPQINLKGYLLGNPATDYKFDENARIPFAHRMALISDELYESAKRNCKGEYVDVDH-KN  264

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGSDGLRRSL---SQRPVLPPGEF--  619
               C  D+    +    I  THILE  C    R+    D  RR L   ++  +L P  F  
Sbjct  265   IKCKNDLQSISECISRIEITHILEPQCNITFRLLNQIDKFRRYLIDNNEDFLLIPPRFPH  324

Query  618   --CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C + +  L  ++WAN+ +VQ AL   KG +  W  CN + + Y  D+   + +H  L 
Sbjct  325   PGC-RNYNSLLCNIWANDASVQIALQASKGKLREWMRCNQS-LYYMHDVQSTIGHHLYLN  382

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
             TRG RALIYSGDHD+I+P + T +WI S+N S V+ WRPW   DG +AG+   +SN   F
Sbjct  383   TRGYRALIYSGDHDMIIPYLGTLSWIKSMNLSIVEHWRPWLV-DGQVAGYLMEFSNQFMF  441

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
              T+KG GH  P +   EC   F+RWISG+
Sbjct  442   VTVKGGGHTPPEYRPRECFATFKRWISGE  470



>ref|XP_009122528.1| PREDICTED: serine carboxypeptidase-like 19 [Brassica rapa]
Length=469

 Score =   393 bits (1010),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/450 (44%), Positives = 284/450 (63%), Gaps = 30/450 (7%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V ++PG  ++GPLPF LETGY+ VGE+E+V++FYYFVKS+ NP  DP + W  GGPGCS+
Sbjct  28    VKYLPG--FEGPLPFALETGYVSVGESEDVELFYYFVKSERNPKKDPLMIWLTGGPGCSS  85

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             L A++   GP++ +  +Y G +P L+L   +WTKV+N+L ++ P   G++YA T  A+ +
Sbjct  86    LSALLFANGPLAFKKDEYNGTLPPLELASFSWTKVANILLLESPVGTGYSYAKTPLASEA  145

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R+W  DHPE++++PFYVGGDS++G  VP + + I+ GNE G KP I+
Sbjct  146   SDTKQFHQIDQFLRRWLVDHPEFISSPFYVGGDSYAGHIVPGVVQQISLGNEKGLKPFIS  205

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFSNELCAQDM  754
             L+GY+LGNP ++L     +R+  A+GM LI  +L++SLEK+C GNY   H SN  C +D+
Sbjct  206   LQGYVLGNPVTNLKVETNHRVSFAHGMGLISNELFESLEKSCGGNYMDVHPSNAKCVKDL  265

Query  753   GKFDQLTRGINPTHIL------------EDFCIRVGTGSDGLRRSLSQ-----RPVL-PP  628
               +      I    IL              F   + TGS   RR L +      P L PP
Sbjct  266   QTYKNCISEIYTEQILLPNCPVDYVPQKLQFLSNIKTGS---RRELKEFSGYDTPSLPPP  322

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
             G F +  F    +  WAN+  V+ AL V+K  +G+W  CN+ +I YT D+   +PYH N 
Sbjct  323   GCFTYGQFL---ASFWANDENVRRALGVKK-ELGKWTRCNFQNIPYTYDIDSPIPYHVNN  378

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + +G R+LIYSGDHD+ +P  STE WI  LNYS VD WRPW      + G+TR+Y+N MT
Sbjct  379   SRKGFRSLIYSGDHDMSIPFSSTEEWIKGLNYSIVDDWRPWMMSSYQVGGYTRTYANKMT  438

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             FAT+KG GH    +S  +CL MF RWI G+
Sbjct  439   FATIKGGGHTCA-YSPDQCLPMFNRWIDGE  467



>ref|NP_179880.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
 sp|Q2V465.2|SCP11_ARATH RecName: Full=Serine carboxypeptidase-like 11; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC17814.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAK62651.1| T20K9.18/T20K9.18 [Arabidopsis thaliana]
 gb|AAM15007.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM47382.1| At2g22970/T20K9.18 [Arabidopsis thaliana]
 gb|AAN31888.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEC07382.1| serine carboxypeptidase-like 11 [Arabidopsis thaliana]
Length=433

 Score =   391 bits (1005),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/435 (45%), Positives = 277/435 (64%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  22    GSIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPG  79

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ + GP++++   Y G +P L    ++WTK +N++F+D P  AGF+Y+     
Sbjct  80    CSSITGLLFQNGPLALKSEVYNGSVPSLVSTTYSWTKTANIIFLDQPVGAGFSYSRAPLI  139

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  ++  E ++ +EF++KW + HP++ +N FY GGDS+SG+ VP + + I+ GN     P
Sbjct  140   DTPTDTGEVKRIHEFLQKWLSKHPQFSSNHFYAGGDSYSGMIVPALVQEISKGNYICCNP  199

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INLKGY+LGNP +  ++ + YRIP ++GM LI  +LY+S+ + CKGNY +    N  C 
Sbjct  200   PINLKGYVLGNPITHEDDPN-YRIPFSHGMALISDELYESIREACKGNYFNVDPRNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + +F + T  +N  HIL   C                         C+   +YL S  
Sbjct  259   KLVEEFHKCTDKLNEFHILSPDCDTASPD-------------------CYLYPFYLIS-F  298

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V+DALHV K +IG+W  CNY    Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  299   WANDESVRDALHVNKRSIGKWERCNYLSKPYNKDIKSSVPYHMNNSVSGYRSLIYSGDHD  358

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L+VP ++T+AWI SLNYS +D WRPW   D  I G+TR+YSN MTFAT+KGSGH A    
Sbjct  359   LVVPFLATQAWIKSLNYSIIDEWRPWMIRDQ-ITGYTRTYSNKMTFATVKGSGHTAE-NK  416

Query  222   AYECLIMFERWISGQ  178
               E  IMF RWI+GQ
Sbjct  417   PQESFIMFRRWINGQ  431



>ref|XP_010939016.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Elaeis 
guineensis]
Length=498

 Score =   394 bits (1011),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 190/444 (43%), Positives = 279/444 (63%), Gaps = 13/444 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S + H+PG Q  GPLPF LETGY+ V E   V++FYYF++S+ NP+ DP + W  G
Sbjct  58    ALSASIITHLPGFQ--GPLPFYLETGYVSVDEENGVELFYYFIESERNPSEDPLLLWLTG  115

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   ++ EIGP+     +Y G +P L  +P++WTKV+N++F+D P   GF+++  
Sbjct  116   GPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTKVANVIFLDSPVGTGFSFSRK  175

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
              K     ++  S Q Y+F+RKWF DH  +L+N  Y+ GDS++G  VP+I K I++  EA 
Sbjct  176   PKGYAVGDISSSMQVYKFLRKWFVDHARFLSNSLYISGDSYAGKVVPVIAKAISEDIEAD  235

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG-NYDHFSNEL  769
              +  +NLKGY++GNP + L      R+P A+G+ +I   LY+ ++KNC+G +Y++     
Sbjct  236   QQSSLNLKGYLIGNPVTGLKIDMNARVPYAHGVGIISDALYELIQKNCEGEDYENPVRAK  295

Query  768   CAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQ----RPVLPPGEFCWQ  610
             C   +  F +    I+  +IL+  C R     +   G RRSL +     P   P   C +
Sbjct  296   CVTKLDAFHKFYSEIHAGYILDPKCTRASPKPEDMIGDRRSLEELELHSPPPHPALKC-R  354

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
              + Y  S  WAN+   + ALH++KGT+  W  CN  D+GY  D+ + + YH +LT++G R
Sbjct  355   TYAYFLSYYWANSNVTRKALHIKKGTVREWQRCN-DDLGYIKDIPNNINYHLSLTSKGYR  413

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             ALIYSGDHDL++P + T+AWI+SLN+S VD WR W    G +AG+T +YSNN+TFAT+KG
Sbjct  414   ALIYSGDHDLMIPFLGTQAWISSLNFSVVDEWRSWHV-GGQVAGYTTTYSNNLTFATVKG  472

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
             +GH AP +   ECL M +RWIS +
Sbjct  473   AGHTAPEYKPEECLAMLQRWISSR  496



>ref|XP_010426467.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=441

 Score =   390 bits (1003),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/438 (45%), Positives = 276/438 (63%), Gaps = 27/438 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  27    ADSASIVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSG  84

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++++   Y G +P L    ++WTKVS+++++D P   GF+Y+ T
Sbjct  85    GPGCSSISGLLYENGPVTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRT  144

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  N  S+  E+++ +EF+ KW   H E+L+NPFYVGGDS+SG  +P + + ++ GN   
Sbjct  145   QLVNKPSDSGEAKRIHEFLYKWLGKHQEFLSNPFYVGGDSYSGKVIPALVQEVSKGNYIC  204

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              +P INL+GY+LGNP++   N   +RIP A+GM LI  +LY+S+++ CKG Y +    N 
Sbjct  205   CEPPINLQGYVLGNPSTESGNDKNHRIPYAHGMALISDELYESMKRICKGEYINVDPRNT  264

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + ++++    IN   IL   C          R                     L 
Sbjct  265   ECLKLVEEYEKCIDRINQPLILTPNCEETSLDCYAYRS--------------------LL  304

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             +  WAN+ +V  ALHV KG+IG W  CN+ +I YT D+  ++PYH N +  G  +LI+SG
Sbjct  305   TTYWANDESVHRALHVNKGSIGEWVRCNW-EIPYTHDIKSSVPYHMNNSIDGYHSLIFSG  363

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD++VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P
Sbjct  364   DHDMMVPFLGTQAWIRSLNYSIIDDWRPWMIGDQ-IAGYTRTYANKMTFATIKGGGH-TP  421

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWISGQ
Sbjct  422   EYKPEESYIMFQRWISGQ  439



>ref|XP_009120822.1| PREDICTED: serine carboxypeptidase-like 15 isoform X1 [Brassica 
rapa]
Length=441

 Score =   390 bits (1002),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 281/439 (64%), Gaps = 24/439 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V ++PG Q  GPLPFELETGYIGVGE EE Q+FYYF+KS+ NP  DP + W  G
Sbjct  22    ACSRSTVRYLPGFQ--GPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  ++ E GP+S  +    G +P L    ++WTKV+N++++D PA  GF+Y+  
Sbjct  80    GPGCSSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFSYSRN  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A++ S+++ ++   EF+  W   HPEY +NPFYV G+S+SG+ VP I + I++     
Sbjct  140   PLADIPSDLRSAKLVNEFVHNWLAKHPEYYSNPFYVTGNSYSGIVVPAIVQEISNEYGLC  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPL+NL+GY+LGNP +  +N   +RIP A+GM LI  + Y+ L ++C+GNY      N 
Sbjct  200   CKPLVNLQGYVLGNPVTDFDNNDNWRIPFAHGMALISDENYQLLRRSCRGNYIIVDPLNT  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-VLPPGEFCWQMFWYL  595
              C + + +F+    G++ T+IL            GL+   +  P V  P E        +
Sbjct  260   DCLKSVKEFENCVSGLDVTYIL------------GLKYVNASDPYVSNPSEHRMS----V  303

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
             +S+ WAN+ +V+ ALHV KG+IG W  C Y +I Y  D+  ++PYH N + +G R+LI+S
Sbjct  304   QSNCWANDESVRRALHVEKGSIGEWLRC-YREIPYKFDIRSSVPYHKNNSIQGYRSLIFS  362

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD+ VP ++T+ WI SLNYS +D WRPW  H+  +AG+TR+Y+NNMTF T+KG GH  
Sbjct  363   GDHDMYVPFLATQDWIRSLNYSIIDDWRPWMIHNQ-VAGYTRTYANNMTFVTVKGGGHTM  421

Query  234   PFFSAYECLIMFERWISGQ  178
               +   EC +MFERWI+GQ
Sbjct  422   -VYKPEECSVMFERWINGQ  439



>ref|XP_004292112.1| PREDICTED: serine carboxypeptidase-like 18-like [Fragaria vesca 
subsp. vesca]
Length=497

 Score =   392 bits (1007),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 199/452 (44%), Positives = 286/452 (63%), Gaps = 21/452 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             + +  S ++ +PG  + G LPF+LETGY+GVG+ ++VQ+FYYF++S+ +P  DP + W  
Sbjct  46    IVSSTSIINTLPG--FSGDLPFKLETGYVGVGDLDDVQLFYYFIESEGSPEYDPLVLWLT  103

Query  1308  GGPGCSALFAIIQE-IGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
             GGPGCS   A++ E IGP+S +    TG  P+LKLNP++WTKV+N++F+D P   G++YA
Sbjct  104   GGPGCSGFSALVYESIGPLSFDAANSTGNKPQLKLNPYSWTKVANIIFLDAPVGTGYSYA  163

Query  1131  TTKK--ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADG  958
              T +  +N+S  +  +E  YEF RKW  DHP++L NP YV GDS+SG+ VPI+ + I+DG
Sbjct  164   KTWEGYSNMSDTLSAAE-IYEFFRKWLMDHPKFLENPLYVAGDSYSGIIVPIVVQEISDG  222

Query  957   NEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF-  781
             NEAG  P +N++GY+LGNPA+ L+    YR+P A+   LI  +LY+S++ NCKG Y +  
Sbjct  223   NEAGRHPPMNIQGYVLGNPATDLDVDENYRVPFAFRKALISDELYQSMKTNCKGEYVNVD  282

Query  780   -SNELCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSD----GLRRSLSQRPVLPPG  625
              +N LC  D+ ++++    IN   ILE +C        GSD     LR+       LP  
Sbjct  283   PNNALCVDDLDQYNECIAEINTPQILEPYCTVSSPNPLGSDWESSDLRKDSVNLLSLPQL  342

Query  624   EFCW-QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYT-DIGYTADMTDALPYHAN  451
                W + + Y  S +WAN+  VQDALHVR+G+I  W  CN T    Y +D++ +L YH N
Sbjct  343   SRPWCRSYIYRFSYIWANDKTVQDALHVREGSIKDWQRCNKTLSASYISDVSSSLVYHQN  402

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYS---  280
             L  +G R LIYSGDHD+++P + T AWI SLN +    W+PW   +G IAG+   Y+   
Sbjct  403   LIKKGYRVLIYSGDHDMVIPYLGTVAWIESLNLTVDSGWKPWFV-NGQIAGYRVQYTYEK  461

Query  279   NNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
               +TF T+KG GH AP +   ECL M  RW +
Sbjct  462   YQLTFTTIKGGGHTAPEYRPEECLAMLSRWFA  493



>ref|XP_006390568.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
 gb|ESQ27854.1| hypothetical protein EUTSA_v10018572mg [Eutrema salsugineum]
Length=438

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/449 (43%), Positives = 281/449 (63%), Gaps = 27/449 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             ++   ++ +  A   S V  +PG  +DGPLPFELETGYIGVGE EEVQ FYYF+KS+ NP
Sbjct  13    MFLQLVLLIQHAESASIVKFLPG--FDGPLPFELETGYIGVGEEEEVQSFYYFIKSERNP  70

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
               DP + W  GGPGCS++  ++ E GP++M++  Y G +P L    ++WTK S+++F+D 
Sbjct  71    QEDPLLLWLSGGPGCSSISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQ  130

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P R GF+Y+ T      S+  E+++ +EF++KW   H E+ +NPFY+ GDS+SG+ VP +
Sbjct  131   PVRTGFSYSRTHLTTKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYIAGDSYSGMVVPAL  190

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GN     P INL+GY+LGNP +     +  RIP A+GM LI  +LY+SL++ CK
Sbjct  191   VQEISKGNYQCCNPPINLQGYVLGNPVTEFKIDYNSRIPYAHGMALISDELYESLKRICK  250

Query  798   GNYDH--FSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPG  625
             G Y +    N  C + + ++ + T  IN   I    C              ++ P     
Sbjct  251   GEYANIDLRNAECLKLVEEYTKCTERINKYLISTPLC-------------KTENPD----  293

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C+ M+ YL S  WAN+  V+ AL + + +IG W  CN+  I YT D+  ++PYH N +
Sbjct  294   --CY-MYRYLLSTYWANDETVRKALQINEKSIGEWVRCNWY-IAYTHDILSSVPYHKNNS  349

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
               G R+LI+SGDHD++VP + T+AWI SLNYS +D WRPW  +D  IAG+TR+Y+N MTF
Sbjct  350   INGYRSLIFSGDHDMVVPFVGTQAWIRSLNYSLIDGWRPWMINDQ-IAGYTRTYANKMTF  408

Query  264   ATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             AT+KGSGH    +   E  IMF+RWI+GQ
Sbjct  409   ATVKGSGHTLE-YKPEESFIMFQRWINGQ  436



>ref|XP_010527656.1| PREDICTED: serine carboxypeptidase-like 2 [Tarenaya hassleriana]
Length=442

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/440 (44%), Positives = 277/440 (63%), Gaps = 24/440 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
              A   +    +PG    G LPFELETGY+GVG++EE+Q+FYYF+KS+  P+ DP + W  
Sbjct  22    FAVYSTVTSSLPGFH--GSLPFELETGYVGVGDSEEIQLFYYFIKSERKPSEDPVMVWLT  79

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS +  +  EIGP+  E+ +Y G  P L     +WTKVS+++F+D PA  GF+Y+ 
Sbjct  80    GGPGCSGISGLAFEIGPVKFELKEYNGTTPTLLPTSDSWTKVSSIIFLDQPAGTGFSYSR  139

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T++   +S++K  +  ++F+RKW   HPE+++NP Y+GGDS+SG  VP     I++GN+ 
Sbjct  140   TEQGRQASDLKSGQLVHQFIRKWMLIHPEFISNPLYIGGDSYSGKVVPPAVLFISEGNDQ  199

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHFSN  775
             G +P +NLKGY+LGNP +     ++  IP A+ M +I  ++Y+SL  +CKG Y     SN
Sbjct  200   GVEPRVNLKGYVLGNPLTDEEADNDAGIPYAHRMGIISDEIYESLVTSCKGKYFLVEPSN  259

Query  774   ELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLP-PGEFCWQMFWY  598
               CA+ + +FD+ T+ IN   I  D C                 P LP PG  C Q ++Y
Sbjct  260   IECARALERFDECTKDINGALITADKC----------------HPDLPYPGPEC-QTYFY  302

Query  597   LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIY  418
               S  W+N+ +V+  L +RKGTIG+W  CN  +I Y  D+  ALPYH NL+ RG R+L+Y
Sbjct  303   TLSYYWSNDESVRTTLGIRKGTIGKWDRCNREEIPYEEDIDSALPYHVNLSNRGYRSLVY  362

Query  417   SGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHI  238
             SGDHD+IV  ++T+AWI +L Y  VD WRPW  +   I G+ R+Y+NNMT+AT+KG GH 
Sbjct  363   SGDHDIIVSYVATQAWIKALGYPVVDEWRPWMDNRQ-IQGYARTYANNMTYATIKGGGHT  421

Query  237   APFFSAYECLIMFERWISGQ  178
             A  +      +MF+RWI G+
Sbjct  422   AE-YKRKPYYVMFKRWIDGE  440



>ref|NP_177471.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
 sp|Q9CAU1.1|SCP3_ARATH RecName: Full=Serine carboxypeptidase-like 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52138.1|AC010556_20 putative serine carboxypeptidase; 12385-14737 [Arabidopsis thaliana]
 gb|AEE35437.1| serine carboxypeptidase-like 3 [Arabidopsis thaliana]
Length=441

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/432 (45%), Positives = 276/432 (64%), Gaps = 27/432 (6%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             +  +PG  ++GPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPGCS+
Sbjct  33    IKSLPG--FEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPGCSS  90

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P  AGF+Y+ T+  N  
Sbjct  91    ISGLLFENGPLAMKLDVYNGTLPSLVSTTYSWTKASSMIFLDQPVGAGFSYSRTQLLNKP  150

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+  E+++ +EF++KW   H E+ +NPFYVGGDS+SG+ VP   + I+ GN     P IN
Sbjct  151   SDSGEAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGMVVPATVQEISKGNYECCNPPIN  210

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HFSNELCAQDM  754
             L+GY+LGNP +     +  RIP A+GM LI  +L++SL+K CKG+Y   H  N  C + +
Sbjct  211   LQGYVLGNPLTDFVYDYNSRIPFAHGMALISDELFESLKKTCKGDYRNVHPRNTECLKFI  270

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWAN  574
              +F++ T  I    I++ FC              ++ P       C+ ++ +L +  WAN
Sbjct  271   EEFNKCTNSICQRRIIDPFC-------------ETETPN------CY-IYRFLLAAYWAN  310

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
             +  V+ AL ++K TIG W  C+Y  I Y  D+  ++PYH N +  G R+LIYSGDHD  V
Sbjct  311   DETVRKALQIKKETIGEWVRCHY-GIPYNYDIKSSIPYHMNNSINGYRSLIYSGDHDFEV  369

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MTFAT++G GH    F   E
Sbjct  370   PFLGTQAWIRSLNYSVIDDWRPWMIKDQ-IAGYTRTYANKMTFATIRGGGHTIE-FKPEE  427

Query  213   CLIMFERWISGQ  178
               IMF+RWI GQ
Sbjct  428   ASIMFQRWIKGQ  439



>ref|XP_006297701.1| hypothetical protein CARUB_v10013730mg [Capsella rubella]
 gb|EOA30599.1| hypothetical protein CARUB_v10013730mg [Capsella rubella]
Length=438

 Score =   390 bits (1001),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/435 (45%), Positives = 277/435 (64%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  27    ASIVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPG  84

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++++   Y G +P L    ++WTK+S+++++D P   GF+Y+ T+  
Sbjct  85    CSSISGLLYENGPMTVKHEVYNGTLPSLVSATYSWTKISSIIYLDQPVGTGFSYSRTQLV  144

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N +S+  E ++ +EF+ KW   H E+L+NPFY GGDS+SGL +P + + I+ GN    KP
Sbjct  145   NKASDTGEVKRIHEFLHKWLGKHQEFLSNPFYAGGDSYSGLIIPALVQEISKGNYICCKP  204

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INLKGY+LGNP +       +RIP A+GM LI  +LY+S+++ CKG Y +    N  C 
Sbjct  205   PINLKGYVLGNPVTEYEIEQNHRIPYAHGMALISDELYESMKRICKGEYINVDPRNAECL  264

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ +    IN   I+   C +  T  D                 C++  ++L +  
Sbjct  265   KLVEEYQKCIGRINLPLIITPLCEK--TSPD-----------------CYEYRYFLTA-Y  304

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  VQ +L V+KG+IG W  C Y DI YT D+  ++PYH N +  G  +LIYSGDHD
Sbjct  305   WANDERVQKSLFVKKGSIGEWVRC-YLDIPYTRDIKSSVPYHMNNSIDGYPSLIYSGDHD  363

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             ++VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MT AT+KG GH A  + 
Sbjct  364   MVVPFLGTQAWIRSLNYSLIDDWRPWMIGDQ-IAGYTRTYANKMTLATIKGGGHTAE-YK  421

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  422   PEESYIMFQRWISGQ  436



>ref|XP_008452663.1| PREDICTED: serine carboxypeptidase-like 13 [Cucumis melo]
Length=464

 Score =   390 bits (1002),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 286/460 (62%), Gaps = 21/460 (5%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L  S    +  AA    V+ +PG  + G LPFELETGY+GVG+ EEVQ+FYYFVKS+ NP
Sbjct  11    LLVSVFQIIFAAASHWTVEFLPG--FPGRLPFELETGYVGVGDLEEVQLFYYFVKSEGNP  68

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
              TDP +FW  GGPGCSAL A+  E+GPI+ ++ +Y G +P++ LNP++WTK S++LF+DL
Sbjct  69    KTDPLLFWLTGGPGCSALTALAFEVGPINFKIEEYNGSLPQIILNPYSWTKKSSILFVDL  128

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             P   GF+Y TT ++    +  +   + +F +KW   HPE+L+NPFYVGGDS+S + +P+I
Sbjct  129   PVGTGFSYGTTPQSLKKGDFSQVHHSIQFFKKWLIRHPEFLSNPFYVGGDSYSSILIPVI  188

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I + NE    P INL+GYILGNP +       + IP A+ M LI  +L++SL  +CK
Sbjct  189   AQKILEENEHA--PYINLQGYILGNPVTIRTTYRNFAIPFAHRMTLISDELFESLVSSCK  246

Query  798   GNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCI--RVGTGSDGL--RRSLSQRPV  637
             G Y +   SN    +    + Q    +   +IL   C         D +  RRSL   P 
Sbjct  247   GEYVNIDPSNVDYLRHYNTYQQCISKVQKANILLPKCSFHSPKRQEDAIFERRSLYNTPK  306

Query  636   L-------PPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADM  478
             +        P   C   + +L S  W N+  V+ ALHVR+G++G W  C+     Y  D+
Sbjct  307   VLLDPEPSIPSIDC-PTYKFLLSSYWMNDDQVRKALHVREGSVGEWTRCS-DKQDYNYDI  364

Query  477   TDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAG  298
              +  PYH NL+++G R+LIYSGDHD++VP + T+AWI SLNYS V+ WRPW   +  +AG
Sbjct  365   ENVFPYHVNLSSKGYRSLIYSGDHDMVVPHLDTQAWIKSLNYSIVEDWRPWFIANQ-VAG  423

Query  297   FTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +TRSY+NNMTFAT+KG GH A  ++  EC ++F RWI+ +
Sbjct  424   YTRSYANNMTFATIKGGGHTAE-YTLKECSVVFSRWIARE  462



>ref|NP_179876.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
 sp|O81009.1|SCP12_ARATH RecName: Full=Serine carboxypeptidase-like 12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC32439.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07373.1| serine carboxypeptidase-like 12 [Arabidopsis thaliana]
Length=435

 Score =   389 bits (999),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/436 (45%), Positives = 278/436 (64%), Gaps = 27/436 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE E+VQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  22    GSIVKFLPG--FEGPLPFELETGYIGIGEEEDVQLFYYFIKSERNPKEDPLLLWLSGGPG  79

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++++   Y G +P L    ++WTK +N++F+D P  AGF+Y+     
Sbjct  80    CSSITGLLFENGPLALKSKVYNGSVPSLVSTTYSWTKTANIIFLDQPIGAGFSYSRIPLI  139

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E +  +EF++KW + HP++ +NPFY  GDS+SG+ VP + + I+ GN    KP
Sbjct  140   DTPSDTGEVKNIHEFLQKWLSKHPQFSSNPFYASGDSYSGMIVPALVQEISKGNYICCKP  199

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GYILGNP +       YRIP ++GM LI  +LY+S+ ++CKGNY +    N  C 
Sbjct  200   PINLQGYILGNPITYFEVDQNYRIPFSHGMALISDELYESIRRDCKGNYFNVDPRNTKCL  259

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  +N  +IL   C    T  D                 C+   +YL    
Sbjct  260   KLVEEYHKCTDELNEFNILSPDCDT--TSPD-----------------CFLYPYYLLG-Y  299

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTD-IGYTADMTDALPYHANLTTRGLRALIYSGDH  406
             W N+ +V+DALHV K +IG+W  C Y + I Y  D+ +++PYH N +  G R+LIYSGDH
Sbjct  300   WINDESVRDALHVNKSSIGKWERCTYQNRIPYNKDINNSIPYHMNNSISGYRSLIYSGDH  359

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             DL+VP ++T+AWI SLNYS +  WRPW   D  IAG+TR+YSN MTFAT+KGSGH A  +
Sbjct  360   DLVVPFLATQAWIKSLNYSIIHEWRPWMIKDQ-IAGYTRTYSNKMTFATVKGSGHTAE-Y  417

Query  225   SAYECLIMFERWISGQ  178
                E  IMF+RWISG 
Sbjct  418   KPNETFIMFQRWISGH  433



>ref|XP_006300201.1| hypothetical protein CARUB_v10016437mg [Capsella rubella]
 gb|EOA33099.1| hypothetical protein CARUB_v10016437mg [Capsella rubella]
Length=467

 Score =   390 bits (1001),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 198/448 (44%), Positives = 283/448 (63%), Gaps = 25/448 (6%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V ++PG  ++GPLPFELETGY+ +GE+++V++FYYFVKS+ NP  DP + W  GGPGCS+
Sbjct  25    VKYLPG--FEGPLPFELETGYVSIGESKDVELFYYFVKSERNPENDPLMIWLTGGPGCSS  82

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             +  ++   GPI+ +  +Y G +P L+L   +W KV+N+L+++ PA +G++YA T+ A  S
Sbjct  83    ICGLLFANGPIAFKGDEYNGTVPPLELTSFSWAKVANILYLESPAGSGYSYARTRHALES  142

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ K+  Q  +F+R WF DHPE+++NPFYVGGDS+SG  VP + + I+ GNE G  P   
Sbjct  143   SDTKQIYQIDQFLRSWFVDHPEFISNPFYVGGDSYSGKVVPGVVQQISLGNEKGLTPHKY  202

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
               GY+LGNP +  N    YRI  A+GM LI  +L++SLE++C+G +     SN  C+ ++
Sbjct  203   SGGYVLGNPLTDKNLESNYRISFAHGMGLISDELFESLERSCEGKFFKVDPSNARCSNNL  262

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGL----------RRSLSQ------RPVLPPGE  622
               +D     I   HIL   C       D L          RR L +        + PP  
Sbjct  263   QTYDHCMSEIYTEHILLRNCEVDYVLGDTLQTLPNIRADRRRELKEFSGNDSSSLPPPSC  322

Query  621   FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTT  442
             F ++   Y  S  WAN+  V+ AL V+K  +G+W  CN   I YT D+ +A PYH N + 
Sbjct  323   FTYK---YFLSAFWANDENVRKALGVKK-ELGKWNRCNIQYIPYTYDIYNAFPYHVNSSR  378

Query  441   RGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFA  262
             +G R+LIYSGDHD +VP  ST+AWI +LNYS V+ WRPW  H   +AG+TR+Y+NNMTFA
Sbjct  379   KGFRSLIYSGDHDSMVPFSSTQAWIRALNYSIVEDWRPWMMHSDQVAGYTRTYANNMTFA  438

Query  261   TLKGSGHIAPFFSAYECLIMFERWISGQ  178
             T+KG GH A  ++  +C +MF RWI G+
Sbjct  439   TVKGGGHTAE-YNPDQCSLMFRRWIDGE  465



>ref|XP_006399443.1| hypothetical protein EUTSA_v10015958mg [Eutrema salsugineum]
 gb|ESQ40896.1| hypothetical protein EUTSA_v10015958mg [Eutrema salsugineum]
Length=469

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 204/465 (44%), Positives = 295/465 (63%), Gaps = 27/465 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNP  1339
             L  SS+  +V A+    V ++PG  +DGPLPF+LETGY+ +GE+ +V++FY+FVKS+ NP
Sbjct  12    LSISSIYHLVDASL--HVKYLPG--FDGPLPFQLETGYVSMGESGDVELFYFFVKSERNP  67

Query  1338  TTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDL  1159
              TDP + W  GGPGCS++  ++   GP+  +  +Y G +P L+L   +WTKV+N+L+++ 
Sbjct  68    ETDPLMIWLTGGPGCSSICGLLLANGPLVFKGDEYNGTVPPLQLTSFSWTKVANILYLES  127

Query  1158  PARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPII  979
             PA +G+++A T +A  SS+ K++ Q  +F+R WF DHPE+++NPFYVGGDS+SG  VP +
Sbjct  128   PAGSGYSFARTPRAIESSDTKQTHQVDQFLRSWFVDHPEFISNPFYVGGDSYSGRVVPGV  187

Query  978   TKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCK  799
              + I+ GNE G  P IN++GYILGNP +  N    +R+  A+ M LI  +L++SLE++C 
Sbjct  188   VQQISLGNENGLTPHINIQGYILGNPVTYSNIESNHRVSFAHRMGLISDELFESLERSCG  247

Query  798   GNYDHFS--NELCAQDMGKFDQLTRGINPTHILEDFC-------IRVGTGSD---GLRRS  655
             G +      N  C+ ++  +DQ    I    IL   C        RV T  +   G RR 
Sbjct  248   GKFFDVDPGNIKCSNNLQTYDQCISEICVQQILLPKCKDDHVLPSRVPTLPNIRSGSRRE  307

Query  654   LSQ------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG  493
             L +        + PP  F ++   Y  S  WAN+  V+ AL V+KG  G+W  CN  +I 
Sbjct  308   LKEFSGNDSSSLPPPSCFTYK---YFLSAFWANDENVRRALGVKKG-FGKWSRCNTENIP  363

Query  492   YTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHD  313
             YT D+ +A+PYH N + +G R+LIYSGDHD++VP  STEAWI SLNYS VD WRPW    
Sbjct  364   YTYDINNAIPYHVNNSRKGFRSLIYSGDHDMMVPFSSTEAWIKSLNYSIVDDWRPWMMST  423

Query  312   GIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
               + G+TR+Y+N MTFAT+KG GH A +  A   L +F+RWI G+
Sbjct  424   NQVGGYTRTYANKMTFATIKGGGHSADYNPAQSSL-LFKRWIDGE  467



>ref|XP_009117321.1| PREDICTED: serine carboxypeptidase-like 10 isoform X1 [Brassica 
rapa]
Length=438

 Score =   389 bits (998),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 280/435 (64%), Gaps = 22/435 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  22    ASIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSEKNPKEDPLLIWLNGGPG  79

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  +  E GP+ ++   Y G +  L  + ++WT+V+N++++D P  AGF+Y+ T   
Sbjct  80    CSSLEGLFFENGPVGLKFEVYNGSLVSLVSSTYSWTQVANIIYLDQPVGAGFSYSRT-PL  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + +S+  E++  ++F++KW + HP++L+N FYV GDS+SG T+P + + I+ GN    KP
Sbjct  139   DKTSDTNEAKMIHQFLQKWLSKHPQFLSNSFYVSGDSYSGKTIPALVQEISKGNYICCKP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       YRIP ++GM+LI  +LY+SL++NCKGNY +    N  C 
Sbjct  199   PINLQGYVLGNPVTHPEIDENYRIPFSHGMSLISDELYESLKRNCKGNYRNVDPRNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C       D    S +  P       C+   +YL  + 
Sbjct  259   KLVEEYHKCTDKINTQHILLPDC-------DDKSNSSNTSPD------CYYYLYYL-IEC  304

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WANN  V++ALHV KGT G W  CN+T I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  305   WANNERVREALHVEKGTKGHWQRCNWT-IPYNQDIISSVPYHMNNSISGYRSLIYSGDHD  363

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +    T+AWI SLNYS +D WRPW   +  IAG+TR+YSN MT+AT+KG GH A  + 
Sbjct  364   ITMTFQGTQAWIKSLNYSIIDDWRPWMI-EAQIAGYTRTYSNKMTYATIKGGGHTAE-YK  421

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISG 
Sbjct  422   PNETFIMFQRWISGH  436



>ref|XP_006651780.1| PREDICTED: serine carboxypeptidase-like 18-like [Oryza brachyantha]
Length=453

 Score =   389 bits (998),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 272/443 (61%), Gaps = 7/443 (2%)
 Frame = -2

Query  1512  CSSMVSVVMAARGSKV-DHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPT  1336
             C   V   ++    KV  H+PG  +DGPLPF LETGY+ V E+  V++FY+FVKS+ NP 
Sbjct  12    CLIFVVPSLSGEAKKVVTHLPG--FDGPLPFYLETGYVSVEEDNGVELFYHFVKSERNPA  69

Query  1335  TDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLP  1156
             TDP I W  GGPGCS    ++ E+GP++  VV Y G +P+L  NP++WTK++N L++D P
Sbjct  70    TDPVILWLSGGPGCSGFSGLVYEVGPLNYVVVPYNGSLPQLVSNPYSWTKMANFLYLDSP  129

Query  1155  ARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIIT  976
               +GF+YA   K     +   S Q   F+ KWFNDHP+YL+NPFYVGG S++G   PII 
Sbjct  130   VGSGFSYARDPKGYDVGDYSSSSQVVTFLTKWFNDHPQYLSNPFYVGGSSYAGKVSPIIA  189

Query  975   KMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG  796
               I +  E    PLINLKGYI+GNP +  N    +R+P A+G+ +I    Y+   ++CKG
Sbjct  190   NYILEEIEERHHPLINLKGYIVGNPITGSNIEENFRVPYAHGVGIISDQQYEIAVESCKG  249

Query  795   NYDHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFC  616
             +Y   +N++CA+ M    +L   ++  HI+ED C+ +            +RP    G  C
Sbjct  250   DYVTSTNKICAEVMNVIQKLISEVSLGHIMEDKCVHISPKPINDEHIQLRRPPPRHGTNC  309

Query  615   WQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRG  436
             +   +YL S  WAN    +DAL +R+GT+  W  CN+ ++ Y +D+   + YH NLT++G
Sbjct  310   FTYKYYL-SYFWANYKGSRDALGIREGTVNEWVRCNF-NLPYVSDVPSNIDYHHNLTSKG  367

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              RAL+YSGDHDL+VP +ST +WI S NY  VD WR W   DG  AGFT  Y NN+TFATL
Sbjct  368   YRALVYSGDHDLLVPFLSTHSWIRSFNYPIVDDWRAWHL-DGQAAGFTIKY-NNLTFATL  425

Query  255   KGSGHIAPFFSAYECLIMFERWI  187
             KG+GH A  +       M +RWI
Sbjct  426   KGAGHTAVEYEPKRGFAMAQRWI  448



>emb|CDY11114.1| BnaC06g23660D [Brassica napus]
Length=439

 Score =   388 bits (997),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 195/436 (45%), Positives = 273/436 (63%), Gaps = 24/436 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  26    ADSASTVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSG  83

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++M++  Y G +P L    ++WTK+SN++F+D P   GF+Y+ T
Sbjct  84    GPGCSSISGLLFENGPLTMKLDAYNGSLPSLVSTTYSWTKLSNIIFLDQPVGTGFSYSRT  143

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                N  S+  E+ + +EF++KW   H E+ +NPFY  GDS+SG+ +P + + I+ GN   
Sbjct  144   SLHNKPSDSGEARRIHEFLQKWLGKHQEFTSNPFYAAGDSYSGMIIPALVQEISKGNYQC  203

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELC  766
               P INL+GY+LGNP +  N V+ YRIP A+GM LI  +LY+SL++ CKG Y +      
Sbjct  204   CNPPINLQGYMLGNPITEHNGVN-YRIPYAHGMALISDELYESLKRVCKGEYAYVD----  258

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
                       +R      +LE++       +D +   + Q P+         ++ YL S 
Sbjct  259   ----------SRNTECLKLLEEY----NKCTDRITLFIIQHPLCETETPNCYIYRYLLST  304

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              WAN+  V+ AL + + +IG W  CN  DI Y  D+  ++PYH N +  G R+LI+SGDH
Sbjct  305   YWANDKTVRKALQINEESIGEWIRCN-LDIPYNHDIVSSVPYHKNNSISGYRSLIFSGDH  363

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP + T+AWI SLNYS ++ WRPW   D  IAG+TR+Y+N MTFAT+K SGH  P +
Sbjct  364   DMAVPYLGTQAWIRSLNYSIINDWRPWMIDDQ-IAGYTRTYANKMTFATIKASGH-TPEY  421

Query  225   SAYECLIMFERWISGQ  178
                E  IMFERWISGQ
Sbjct  422   KPEESFIMFERWISGQ  437



>ref|XP_008452655.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Cucumis 
melo]
Length=464

 Score =   389 bits (999),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 197/450 (44%), Positives = 280/450 (62%), Gaps = 19/450 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V+H+PG  + GPLPF+LETGY+GVG+++E Q+F+YFVKS  NP TDP + W  G
Sbjct  18    AGSYSTVNHLPG--FPGPLPFQLETGYVGVGDSDEFQIFHYFVKSDQNPKTDPLLLWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSAL  ++ EIGPIS +  +    +P+L LNP++WTK S++LF+DLP   GF+Y T 
Sbjct  76    GPGCSALSGLVFEIGPISFKEEEAKESIPQLILNPYSWTKNSSILFVDLPVGTGFSYDTI  135

Query  1125  KKANVS-SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
               ++    +  + +   +F RKW  DHPE++TNPFYVGGDS+SG+ VP++ + I +GN  
Sbjct  136   TPSSFKPGDFSQIQHYLQFFRKWLVDHPEFITNPFYVGGDSYSGMIVPVLAQRIVEGNTI  195

Query  948   GTK-PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--S  778
               + P IN +GYILGNP +   +   + IP A+ M LI  +L++SLE +CKGNY +   S
Sbjct  196   HDEFPFINFQGYILGNPYTIRGSSKNFTIPFAHRMTLISDELFESLETSCKGNYVNIDPS  255

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD----GLRRSLSQRPVL------PP  628
             N  C +    +++    + P  I+   C+   +         RRSLS  P L        
Sbjct  256   NVECLRHYKIYEECISKVEPACIIYPKCVFKSSKQQYDVYNERRSLSSIPTLLLHQNSQL  315

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                    F Y  S  WAN   VQ AL++R+G+IG W  C    + Y  ++     YH  L
Sbjct  316   SSLRCPEFKYKLSTKWANTDQVQKALNIREGSIGEWIRCKDKKM-YNFEINSVFDYHMIL  374

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             +++G R+LIYSGDHD+++P + T+AWI +LNYS ++ WRPW   D  +AG+TR Y+NNMT
Sbjct  375   SSKGYRSLIYSGDHDMLIPHLDTQAWIKALNYSIIEDWRPWLISDQ-VAGYTRYYANNMT  433

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             FAT+KG GH A  ++  EC +MF RWI G+
Sbjct  434   FATIKGGGHTAE-YTKKECSVMFNRWILGE  462



>ref|XP_008337031.1| PREDICTED: serine carboxypeptidase-like 18 [Malus domestica]
Length=432

 Score =   388 bits (996),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/424 (45%), Positives = 272/424 (64%), Gaps = 19/424 (4%)
 Frame = -2

Query  1407  YIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTG  1228
             Y+GVGE EEVQ+FYYFVK++  P   P + W  GGPGCS+L A++ EIGP++  + +Y G
Sbjct  6     YVGVGEEEEVQLFYYFVKTERKPEEAPLMLWLTGGPGCSSLTALLYEIGPLNFNIEQYNG  65

Query  1227  GMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDH  1048
              +P L LNP+ WTKVS+++F+D P   GF+YA +  A+  S+ ++   A +F+RKW  DH
Sbjct  66    SLPTLTLNPYAWTKVSSIIFVDSPVGTGFSYARSSFASPPSDSEQVGHALQFLRKWLVDH  125

Query  1047  PEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYR  868
             PE+++NPF+VGGDS+SG+ VP++ ++I+DGN+ G +P INL+GYILGNP +   +    +
Sbjct  126   PEFMSNPFFVGGDSYSGIPVPVLAQLISDGNQEGVRPAINLQGYILGNPVTVPQDEGNSQ  185

Query  867   IPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDMGKFDQLTRGINPTHILEDFC  694
             I  A+GM LIP DL++SLE++C G Y      N  C +    +      IN  HILE  C
Sbjct  186   ITFAHGMGLIPDDLFESLERSCGGEYQTIDPRNAECLKHKQAYHTCISQINLAHILEWNC  245

Query  693   IRVGTGSD----GLRRSLSQR------PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHV  544
               V           RR LS +         PP     + + YL S+ W N+  V++ALH+
Sbjct  246   ELVSPKPPLHMLDKRRYLSNKDYNVFSESTPPPILDCRSYGYLLSEYWTNDQYVREALHI  305

Query  543   RK----GTIGRWCACNYTDIGYTADMTDALPYHANLTTRG-LRALIYSGDHDLIVPTMST  379
             RK    G+IGRW  C+Y DI Y  D+  ++ +HA  +  G  R+LIYSGDHD+ VP M+T
Sbjct  306   RKYAVQGSIGRWXRCSY-DIPYEYDIHTSIQFHAKFSAXGXYRSLIYSGDHDMXVPFMAT  364

Query  378   EAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMF  199
             +AWI SLNYS V+ WRPW    G +AG+TR+YSN MT+AT+KG+GH AP +   EC  M+
Sbjct  365   QAWIRSLNYSIVNDWRPWFV-KGQVAGYTRTYSNRMTYATVKGAGHTAPEYKPEECSTMY  423

Query  198   ERWI  187
              +W+
Sbjct  424   TKWL  427



>ref|NP_177473.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana]
 sp|Q9CAU3.1|SCP2_ARATH RecName: Full=Serine carboxypeptidase-like 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG52135.1|AC010556_17 putative serine carboxypeptidase; 5659-8034 [Arabidopsis thaliana]
 gb|AEE35439.1| serine carboxypeptidase-like 2 [Arabidopsis thaliana]
Length=441

 Score =   388 bits (996),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 274/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP I W  GGPG
Sbjct  30    ASIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPG  87

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P   GF+Y+ T++ 
Sbjct  88    CSSISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSMIFLDQPVGTGFSYSRTQQF  147

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW   H E+ +NPFYV GDS+SGL VP   + I+ GN     P
Sbjct  148   NKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYVAGDSYSGLVVPATVQEISKGNYECCNP  207

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HFSNELCA  763
              INL+GY+LGNP +        RIP A+GM LI  +LY+SL+K CKG Y   H  N  C 
Sbjct  208   PINLQGYVLGNPLTDYAIDSNSRIPFAHGMALISDELYESLKKTCKGEYTNVHPRNTQCL  267

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + +F++ T  I    IL+  C              ++ P       C+ ++ YL +  
Sbjct  268   KFIEEFNKCTNRILQQLILDPLC-------------ETETPD------CY-IYRYLLTTY  307

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++AL + K +IG W  C Y  I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  308   WANDATVREALQINKESIGEWVRC-YRTIPYDNDIKSSMPYHVNNSISGYRSLIYSGDHD  366

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L VP + T+AWI SLNYS +D WRPW   +  IAG+TR+Y+N MTFAT+KG GH    F 
Sbjct  367   LEVPYLGTQAWIRSLNYSIIDDWRPWMIKNQ-IAGYTRTYANKMTFATIKGGGHTIE-FK  424

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  425   PEEASIMFQRWINGQ  439



>ref|XP_009384628.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384629.1| PREDICTED: serine carboxypeptidase-like 18 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 198/438 (45%), Positives = 271/438 (62%), Gaps = 13/438 (3%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             + H+PG  ++GPLPF LETGY+ V E   VQ+FYYF+ S+  P  DP + W  GGPGCSA
Sbjct  36    ITHLPG--FEGPLPFHLETGYVDVDEANGVQLFYYFIMSERKPADDPLMVWITGGPGCSA  93

Query  1287  LFAIIQEIGPISMEVVKYTGGM-PKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANV  1111
                ++ EIGP+  +V  YT G+ P L  NP +WTKVS+++F+D P   GF+Y+ T++   
Sbjct  94    FSGLMFEIGPLQFDVAGYTDGLLPSLIYNPISWTKVSSIIFLDSPVGTGFSYSDTEQGLR  153

Query  1110  SSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLI  931
              ++ K +     F++KW+ DHP ++ NP Y+GGDS+SGL VP+I + I+DGNEAG     
Sbjct  154   ITDTKSAIHVCTFLKKWYVDHPSFIKNPLYIGGDSYSGLLVPVIAQYISDGNEAGDGLHF  213

Query  930   NLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQDMG  751
             NLKGY++GNP++         IP  +GM LI  +LY++ +++C   Y    N  CA  + 
Sbjct  214   NLKGYLVGNPSTDGEYDGNAIIPYVHGMGLISDELYEATKRSCGEQYQSPRNAECASCLQ  273

Query  750   KFDQLTRGINPTHILEDFCIRVGTGSDGL---RRSLSQRPVLPPGE-----FCWQMFWYL  595
               +Q   GIN  HILE  C       + L   RR L +  +  P          +   Y+
Sbjct  274   AVNQGLFGINNVHILEPLCFFASPKRNILTADRRKLLEEHLEQPLSKSDLPLQCRSSGYV  333

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
              S  WANN  V++AL VR+GT   W  CNY  I YT D++ +L YH +LT+RG RAL YS
Sbjct  334   LSYFWANNDTVREALGVREGTKQMWVRCNY-GINYTNDVSSSLKYHLSLTSRGYRALAYS  392

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD+ VP + T+AWI SLN+S VD WR W   DG +AGFTR+YSNN+TF T+KG GH A
Sbjct  393   GDHDMSVPFVGTQAWIRSLNFSIVDDWRSWFV-DGQVAGFTRTYSNNLTFVTIKGGGHTA  451

Query  234   PFFSAYECLIMFERWISG  181
             P +   ECL M +RW +G
Sbjct  452   PEYKPKECLAMVDRWFAG  469



>ref|NP_177472.1| serine carboxypeptidase-like 5 [Arabidopsis thaliana]
 gb|AAG52136.1|AC010556_18 putative serine carboxypeptidase; 8937-11310 [Arabidopsis thaliana]
 gb|AEE35438.1| serine carboxypeptidase-like 5 [Arabidopsis thaliana]
Length=438

 Score =   388 bits (996),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 279/433 (64%), Gaps = 25/433 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++G LPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  29    ASIVKFLPG--FEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPG  86

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P   GF+Y+ T++ 
Sbjct  87    CSSISGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSRTQQY  146

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW + H E+ +NPFYV GDS+SG+ VP   + I+ GN     P
Sbjct  147   NKPSDSGEAKRIHEFLQKWLSKHQEFSSNPFYVAGDSYSGMVVPATVQEISKGNYQCCSP  206

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQD  757
              INL+GY+LGNP +     + YRIP A+GM LI  +LY+SL++ CKG Y    +  C + 
Sbjct  207   PINLQGYVLGNPITEHAIDYNYRIPFAHGMALISDELYESLKRVCKGEYVDPRDTECLKL  266

Query  756   MGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWA  577
             + +F + T+G+    +++  C+             ++ P       C+ ++ YL +  W 
Sbjct  267   VEEFSKCTKGVCQEVVIKPLCV-------------TETPN------CY-IYRYLLTTYWV  306

Query  576   NNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLI  397
             N+V V+ AL + K +IG W  C Y  I YT D+  ++PYH N +  G R+LIYSGDHDL 
Sbjct  307   NDVNVRKALQINKESIGEWVRC-YFGIPYTHDIKSSVPYHMNNSINGYRSLIYSGDHDLN  365

Query  396   VPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAY  217
             VP ++T+AW+ SLNYS +D+WRPW   D  I G+T++Y+N MTFAT++ SGH A  +  Y
Sbjct  366   VPFLATQAWVRSLNYSIIDNWRPWMIKDQ-IGGYTKTYANKMTFATVRASGHTAE-YKPY  423

Query  216   ECLIMFERWISGQ  178
             E  IMF RWI+GQ
Sbjct  424   ETYIMFHRWINGQ  436



>sp|Q9CAU2.2|SCP5_ARATH RecName: Full=Serine carboxypeptidase-like 5; Flags: Precursor 
[Arabidopsis thaliana]
Length=438

 Score =   387 bits (995),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/433 (44%), Positives = 279/433 (64%), Gaps = 25/433 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++G LPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  29    ASIVKFLPG--FEGSLPFELETGYIGIGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPG  86

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P   GF+Y+ T++ 
Sbjct  87    CSSISGLLFENGPLAMKLDVYNGTLPSLVPTTYSWTKTSSMIFLDQPVGTGFSYSRTQQY  146

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW + H E+ +NPFYV GDS+SG+ VP   + I+ GN     P
Sbjct  147   NKPSDSGEAKRIHEFLQKWLSKHQEFSSNPFYVAGDSYSGMVVPATVQEISKGNYQCCSP  206

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQD  757
              INL+GY+LGNP +     + YRIP A+GM LI  +LY+SL++ CKG Y    +  C + 
Sbjct  207   PINLQGYVLGNPITEHAIDYNYRIPFAHGMALISDELYESLKRVCKGEYVDPRDTECLKL  266

Query  756   MGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWA  577
             + +F + T+G+    +++  C+             ++ P       C+ ++ YL +  W 
Sbjct  267   VEEFSKCTKGVCQEVVIKPLCV-------------TETPN------CY-IYRYLLTTYWV  306

Query  576   NNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLI  397
             N+V V+ AL + K +IG W  C Y  I YT D+  ++PYH N +  G R+LIYSGDHDL 
Sbjct  307   NDVNVRKALQINKESIGEWVRC-YFGIPYTHDIKSSVPYHMNNSINGYRSLIYSGDHDLN  365

Query  396   VPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAY  217
             VP ++T+AW+ SLNYS +D+WRPW   D  I G+T++Y+N MTFAT++G GH A  +  Y
Sbjct  366   VPFLATQAWVRSLNYSIIDNWRPWMIKDQ-IGGYTKTYANKMTFATVRGGGHTAE-YKPY  423

Query  216   ECLIMFERWISGQ  178
             E  IMF RWI+GQ
Sbjct  424   ETYIMFHRWINGQ  436



>ref|XP_003566614.1| PREDICTED: serine carboxypeptidase-like 13 isoform X1 [Brachypodium 
distachyon]
Length=498

 Score =   390 bits (1001),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 273/443 (62%), Gaps = 22/443 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V H+PG Q  GPLPF LETGY+ V E  +  +FYYF++S+ +P  DP + W  GGPGCS 
Sbjct  57    VTHLPGFQ--GPLPFYLETGYVEVDEQHDGSMFYYFIESERDPAEDPLVLWLTGGPGCSG  114

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             L A++ EIGP+S  +   +  +P L     +WTKVSN++FID P  AGF+Y     A  S
Sbjct  115   LSALLYEIGPLSFNMQSRSSTVPTLAYRADSWTKVSNIIFIDAPINAGFSYCREGDAYHS  174

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+ + + Q  EF+RKW ++H  +  NP Y+ GDS++GL VP++   IA+ +E    P  N
Sbjct  175   SDTQMASQILEFLRKWLDNHNSFKNNPLYIAGDSYAGLIVPVVASKIANEDEFSNMPFFN  234

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQDMGK  748
             LKGY++GNP +  N     +IP A+GM LI  +LY+S +++C G Y    N  C +++  
Sbjct  235   LKGYVVGNPVTDDNFETNAQIPFAHGMGLISDELYESAKRSCGGVYLDNKNFECQKNIQS  294

Query  747   FDQLTRGINPTHILE-DFCI---RVGTGSDGLRRSL-----------SQRPVLPPGEFCW  613
             FD+  + IN  HILE D+ +   R G     +RR L           S    +P      
Sbjct  295   FDECVKDINKFHILEADYPLDSTRSGELYARVRRELSVTEENAEVISSAVSTIPSRS---  351

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIG-YTADMTDALPYHANLTTRG  436
             + F YL S LWAN+ AV+ +L +R+G+I +W  C   D   YT D+  A+PYH  L TRG
Sbjct  352   RYFGYLLSPLWANSDAVRLSLGIREGSISKWKRCKRYDASWYTRDIESAVPYHLILITRG  411

Query  435   LRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATL  256
              RAL+YSGDHD++VP ++T+AWI  L++S VD WRPW    G +AG+TR YSNN+TFAT+
Sbjct  412   YRALVYSGDHDMVVPYLATQAWIRQLDFSIVDEWRPWYV-TGQVAGYTRMYSNNLTFATV  470

Query  255   KGSGHIAPFFSAYECLIMFERWI  187
             KG+GH AP F   EC  MF+RW+
Sbjct  471   KGAGHTAPEFRPKECFAMFQRWL  493



>ref|XP_006297708.1| hypothetical protein CARUB_v10013737mg [Capsella rubella]
 gb|EOA30606.1| hypothetical protein CARUB_v10013737mg [Capsella rubella]
Length=437

 Score =   387 bits (994),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/435 (45%), Positives = 273/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  26    ASTVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++++   Y G +P L    ++WTK+S++L++D P   GF+Y+ T   
Sbjct  84    CSSISGLLYENGPVTVKHEVYNGTLPSLVSTTYSWTKISSILYLDQPVGTGFSYSRTPFV  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF+ KW   H E+L+NPFYVGGDS+SG  +P + + I+ GN    KP
Sbjct  144   NKPSDSGEAKRIHEFLHKWLGRHQEFLSNPFYVGGDSYSGKIIPALVQEISKGNYLCCKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP++  +    YRIP A+GM LI  +LY+S+++ CKG Y +    N  C 
Sbjct  204   PINLQGYVLGNPSTESDTDKNYRIPYAHGMALISDELYESMKRICKGEYINVDPRNTKCL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++ T  IN   IL   C          R                     L +  
Sbjct  264   KLVEEYEKCTDRINKPLILTPDCEETSPDCYDYRG--------------------LLTTY  303

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +VQ ALHV KG+IG W  C++ D+ YT D+  ++PYH N +  G  +LI+SGDHD
Sbjct  304   WANDESVQRALHVNKGSIGEWVRCDW-DMPYTHDIKSSVPYHMNNSIDGYTSLIFSGDHD  362

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP + T+AWI SLNYS +D WRPW   D  I G+TRSY+N MTFAT+KG GH  P + 
Sbjct  363   MEVPFLGTQAWIRSLNYSIIDDWRPWMIGDQ-IGGYTRSYANKMTFATIKGGGH-TPEYK  420

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RW SGQ
Sbjct  421   PEETSIMFKRWFSGQ  435



>gb|EYU37561.1| hypothetical protein MIMGU_mgv1a005963mg [Erythranthe guttata]
Length=463

 Score =   388 bits (996),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 193/458 (42%), Positives = 281/458 (61%), Gaps = 18/458 (4%)
 Frame = -2

Query  1515  YCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPT  1336
             YC  ++ +  AA  S V+ +PG  Y GPLPF+LETGYIGVG+++EVQ+FYYFV+S+ +P 
Sbjct  6     YCLLLLLITAAASQSTVNTLPG--YPGPLPFKLETGYIGVGDDDEVQLFYYFVESERDPR  63

Query  1335  TDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLP  1156
              DP IFW  GGPGCS    ++ EIGP++ +VV + G  P   LNP++WTK+++++FID P
Sbjct  64    KDPLIFWLTGGPGCSGFSGLVYEIGPLAFDVVDFDGSFPSFTLNPYSWTKIASIIFIDSP  123

Query  1155  ARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIIT  976
                GF+Y  T ++  +S+ K +E  Y F+RKW + HP +L N  Y+ GDS+ G   P++ 
Sbjct  124   VGTGFSYTNTSESYATSDTKSTEDNYVFLRKWLSLHPRFLKNRLYIAGDSYGGKITPMVA  183

Query  975   KMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG  796
             + I++GNEAG +P + L+GYI+GN  +  N     +IP A+ M L+  + ++  + +C G
Sbjct  184   RAISEGNEAGLQPRMLLQGYIVGNSRTDANKDDNEKIPYAHRMGLVSDEYFELAKSSCLG  243

Query  795   NYDH--FSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGE  622
              Y +    N  C   +   ++ T+ IN  HILE  C  +    +  +R        P  +
Sbjct  244   EYVNPDPDNIECKYALRLVNECTKLINNAHILEPMCKFLSPNPNNSQRDPLFVEDDPVED  303

Query  621   FCW---------QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDA  469
             F +         + + Y  S +WANN +VQ+ALH+RKGTI  W  CN T + Y  D+   
Sbjct  304   FLFMSTQDDSLCRNYNYASSYVWANNESVQEALHIRKGTIPDWKRCN-TSLTYEYDVESV  362

Query  468   LPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTR  289
             L  H  L+ +G +AL YSGDHD+I+P MST  WI  LN +  D WRPW A+ G +AG+T 
Sbjct  363   LEDHRLLSEKGFQALAYSGDHDMIIPYMSTLKWIRELNLTVDDEWRPWTAN-GQVAGYTE  421

Query  288   SYSNN---MTFATLKGSGHIAPFFSAYECLIMFERWIS  184
              Y NN   +TFAT+KG+GH AP +   EC +MFERW+S
Sbjct  422   KYKNNQAYITFATVKGAGHTAPEYKPKECFVMFERWLS  459



>ref|XP_010939013.1| PREDICTED: serine carboxypeptidase-like 18 isoform X2 [Elaeis 
guineensis]
Length=456

 Score =   387 bits (995),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 185/444 (42%), Positives = 276/444 (62%), Gaps = 13/444 (3%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S + H+PG Q  GPLPF LETGY+ V E   V++FYYF++S+ NP+ DP + W  G
Sbjct  16    ALSASIITHLPGFQ--GPLPFYLETGYVSVDEENGVELFYYFIESERNPSEDPLLLWLTG  73

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   ++ EIGP+     +Y G +P L  +P++WT+V+N++F+D P   GF+++  
Sbjct  74    GPGCSAFSGLVFEIGPLKFVTAEYNGSLPNLVYHPYSWTRVANVIFLDSPVGTGFSFSRK  133

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
              +     ++  S Q Y+F+RKWF DH ++L+N  Y+ GDS+ G  VP++   I+   EA 
Sbjct  134   PEGYAVGDISSSMQVYKFLRKWFVDHAQFLSNSLYISGDSYGGKVVPVVADAISKDIEAD  193

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG-NYDHFSNEL  769
              +  +NLKGY++GNPA+ L      R+P A+G+ +I   LY+ ++KNC+G +Y++   E 
Sbjct  194   QQSRLNLKGYLIGNPATGLKVDKNARVPYAHGVGIISDVLYELIQKNCQGEDYENPVREQ  253

Query  768   CAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQ----RPVLPPGEFCWQ  610
             C   +  F +    I  +HILE  C       +   G RRS+ +     P   P   C +
Sbjct  254   CVTKLDAFHKFYSEIQTSHILEPKCAAASPKPEDMIGDRRSVKELELHSPPPHPALKC-R  312

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
              + Y  S  WAN+   + ALH++KGT+  W  CN +D+ Y  D+ + + YH +LT +G R
Sbjct  313   SYAYFLSYYWANSNITRKALHIKKGTVREWQRCN-SDLAYAKDIPNNINYHLSLTNKGYR  371

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             AL+YSGDHDL+VP + T+AWI SLN+S VD WR W    G +AG+T ++SNN+TFAT++G
Sbjct  372   ALVYSGDHDLVVPFVGTQAWIRSLNFSVVDEWRSWHV-GGQVAGYTTAFSNNLTFATVRG  430

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
             +GH AP +   ECL M +RWIS +
Sbjct  431   AGHTAPEYKPEECLAMLQRWISSR  454



>emb|CDY38096.1| BnaC02g06770D [Brassica napus]
Length=491

 Score =   389 bits (998),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 201/439 (46%), Positives = 284/439 (65%), Gaps = 16/439 (4%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++G LPFELETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  61    GSVVKFLPG--FEGHLPFELETGYIGVGEEEKVQLFYYFIKSEKNPKEDPLLIWLSGGPG  118

Query  1296  CSALFAIIQEIGPISMEVVK--YTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTK  1123
             CS+   +  E GP++  V +    G  P L    ++WTKV+N++F+D P   GF+YATT+
Sbjct  119   CSSATGLFFENGPVTFNVEEGYNEGSGPALLSTTYSWTKVANIIFLDQPGGTGFSYATTQ  178

Query  1122  KANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGT  943
               +  S+  E++Q +EF+RKW + H E+++N FYV GDS+SG  +P   + I+ GN+ G 
Sbjct  179   LLDTPSDSGEAKQIHEFIRKWLSKHTEFISNLFYVAGDSYSGKIIPATVQEISKGNDLGF  238

Query  942   KPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NEL  769
             KP +NL+GYILGNP +     H + IP A+GM LI  +LY+SL+++C+GNY++    N  
Sbjct  239   KPRVNLEGYILGNPVTDFEFDHNHGIPFAHGMALISDELYESLKRSCRGNYENIDPHNTE  298

Query  768   CAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP--GEFCWQMFWYL  595
             C +   K+ +    IN  HIL   C          RR +  R V  P   + C+ ++  L
Sbjct  299   CLKHHDKYLKCISSINVVHILMPRC----DPPLFPRRFILLRNVSAPLSADGCY-IYTDL  353

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
              + LWAN+ +V+ ALHV KG++ +W  C+ +   Y  D+  ++PYH N + +G R+LI+S
Sbjct  354   LASLWANDESVRKALHVVKGSVEKWVRCS-SGKPYDFDIKSSVPYHMNNSIKGYRSLIFS  412

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHDL+VP  ST+AWI SL YS +D WRPW  H+  IAG+TR+Y+NNMT+AT+K SGH  
Sbjct  413   GDHDLVVPFPSTQAWIRSLGYSIIDEWRPWMVHNQ-IAGYTRTYANNMTYATVKASGHTL  471

Query  234   PFFSAYECLIMFERWISGQ  178
               F   E  IMF+RWISGQ
Sbjct  472   E-FKPNESFIMFQRWISGQ  489



>emb|CDY50564.1| BnaA01g30780D [Brassica napus]
Length=439

 Score =   387 bits (993),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 195/439 (44%), Positives = 281/439 (64%), Gaps = 26/439 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V ++PG Q  GPLPFELETGYIGVGE EE Q+FYYF+KS+ NP  DP + W  G
Sbjct  22    ACSRSTVRYLPGFQ--GPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGC++L  ++ E GP+S  +    G +P L    ++WTKV+N++++D PA  GF+Y+  
Sbjct  80    GPGCTSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPAGTGFSYSRN  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A++ S+++ ++   EF+  W   HPEY +NPFYV G+S+SG+ VP I + I++ N   
Sbjct  140   PLADIPSDLRSAKLVNEFVHNWLAKHPEYYSNPFYVTGNSYSGIVVPAIVQEISNENGLC  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPL+NL+GY+LGNP +  +N   +RIP A+GM LI  + Y+ L ++C+GNY      N 
Sbjct  200   CKPLVNLQGYVLGNPVTDFDNNDNWRIPFAHGMALISDENYQLLRRSCRGNYIIVDPLNT  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-VLPPGEFCWQMFWYL  595
              C + + +F+    G++ T+IL            GL+   +  P V  P E        +
Sbjct  260   DCLKSVKEFENCVSGLDVTYIL------------GLKYVNASDPYVSNPSEHRMS----V  303

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
             +S+ WAN+ +V+ ALHV KG+IG W  C Y +I Y  D+  ++PYH N + +G R+LI+S
Sbjct  304   QSNCWANDESVRRALHVEKGSIGEWLRC-YREIPYKFDIRSSVPYHKNNSIQGYRSLIFS  362

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD+ VP ++T+ WI SLNYS +D WRPW  H+  +AG+TR+Y+NNMTFAT  G GH  
Sbjct  363   GDHDMYVPFLATQDWIRSLNYSIIDDWRPWMIHNQ-VAGYTRTYANNMTFAT--GGGHTM  419

Query  234   PFFSAYECLIMFERWISGQ  178
               +   EC +MFERWI+GQ
Sbjct  420   -VYKPEECSVMFERWINGQ  437



>ref|XP_003525944.2| PREDICTED: serine carboxypeptidase-like 19-like isoform X1 [Glycine 
max]
Length=438

 Score =   386 bits (992),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 194/447 (43%), Positives = 277/447 (62%), Gaps = 55/447 (12%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGE---NEEVQVFYYFVKSQTNPTT  1333
             ++S  +A   + V  +PG Q  GPLPF LETGY+ VGE    E  ++FYYF++S+ +P  
Sbjct  36    LISSKLAECHNIVRFLPGFQ--GPLPFLLETGYVEVGETEAEEHAELFYYFIESENDPKG  93

Query  1332  DPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPA  1153
             +P + W  GGPGCSA   ++ EIGP++ +  +Y G +P L L P +WTKVS+++F+DLPA
Sbjct  94    NPLLLWLTGGPGCSAFSGLVFEIGPLTFKNEEYNGSLPNLTLKPQSWTKVSSIIFVDLPA  153

Query  1152  RAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITK  973
               GF+Y  T++A   S+ K    A++F+RKW  DHPE+L+N  Y+ GDS+ G+ VP+I +
Sbjct  154   GTGFSYPKTERAVQQSSSKLVRHAHQFIRKWLIDHPEFLSNEVYIAGDSYCGIPVPVIVQ  213

Query  972   MIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGN  793
              I++GNE G +P I ++GY+LGNP ++ +    Y IP  +GM LI  +LY+SL+KNC+G 
Sbjct  214   EISNGNEGGMQPWIYIQGYLLGNPITT-STEKNYEIPFNHGMALISDELYESLQKNCRGE  272

Query  792   YDHFS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEF  619
             Y +    N LC +DM  +++       +H                               
Sbjct  273   YRNIDPRNALCLRDMQSYEE-------SHA------------------------------  295

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDI--GYTADMTDALPYHANLT  445
                   Y+    WAN+  V+ ALHVRKG+IG+W  CN  D+   + AD+  +  YH NL+
Sbjct  296   ------YVLCSYWANDDNVRKALHVRKGSIGKWTRCN-DDLKSKFNADIPSSFQYHVNLS  348

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R+LIYSGDHD++VP ++T+AWI SLNYS V  WR W  +DG +AG+TR+YSN MTF
Sbjct  349   RKGYRSLIYSGDHDMVVPFLATQAWIRSLNYSIVSDWRQW-YYDGQVAGYTRTYSNRMTF  407

Query  264   ATLKGSGHIAPFFSAYECLIMFERWIS  184
             AT+KG GH AP +   ECL MF RWIS
Sbjct  408   ATVKGGGHTAPEYKPEECLAMFSRWIS  434



>ref|XP_003633199.2| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Vitis 
vinifera]
Length=461

 Score =   387 bits (994),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 288/460 (63%), Gaps = 28/460 (6%)
 Frame = -2

Query  1515  YCSSMVSVVMAARG-----SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKS  1351
             + S M+ +++ + G     S +  +PG  + G LPF LETGY+GVGENEEVQ+FYYFVKS
Sbjct  10    FLSVMLLLLVFSSGIANGRSVIKTLPG--FSGELPFYLETGYVGVGENEEVQLFYYFVKS  67

Query  1350  QTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNML  1171
             Q NP  DP + W  GGPGCS L A   E GP++  + +Y GG+P L L  +TWTK  N++
Sbjct  68    QRNPVFDPLMLWLSGGPGCSTLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNII  127

Query  1170  FIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLT  991
             F+D P  +GF+Y+ T++  +  ++K + Q YEF++KW  DHPE+L N  YVGGDS+SG+ 
Sbjct  128   FVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYSGIP  187

Query  990   VPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
             VP++ + I  G+     P +NL+GY+LGNP +  +N    RIP A+ + LI  +LY+S +
Sbjct  188   VPMVVQEIYYGS-----PSLNLQGYVLGNPLTDTDNDVNSRIPFAHRLTLISDELYESAK  242

Query  810   KNCKGNY--DHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRR-SLSQRP  640
              +C G+Y   + SNE C  DM    +L   I    +LE  C   G  S   +   L+   
Sbjct  243   TSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNC---GISSRKPKEGELNHTH  299

Query  639   VLPP-GE----FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT  475
              L   GE    FC + + Y+ S++WANN  V++AL VR+GT G W  CN T++ +T D+T
Sbjct  300   FLTQLGEKSAYFCHE-YNYVFSEIWANNKDVREALRVREGTKGHWVRCNITNLAFTKDVT  358

Query  474   DALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGF  295
               + YH NLT  GLRALIYSGDHD+ +P + T+ WI SLN +  D WR W   DG +AG+
Sbjct  359   STVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCT-DGQVAGY  417

Query  294   TRSYSN---NMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             T +++N   ++TFAT+KG+GH+A  +   EC  M +RW +
Sbjct  418   TETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFA  457



>ref|XP_010429234.1| PREDICTED: serine carboxypeptidase-like 12 isoform X1 [Camelina 
sativa]
Length=433

 Score =   386 bits (991),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 194/438 (44%), Positives = 277/438 (63%), Gaps = 27/438 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP + W  G
Sbjct  19    AESSSIVKFLPG--FEGPLPFELETGYIGIGEKEEIQLFYYFIKSENNPDEDPLLLWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+   +  E GP++ +   Y G +P L    ++WTK++N++F+D P R GF+Y+ T
Sbjct  77    GPGCSSNTGLFLENGPLAFKSEVYNGSVPSLVSTTYSWTKMANIIFLDQPVRTGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                +  S+  E E+  EF+ KW N HP + +NPFY  GDS+SG+TVP + + I+ GN   
Sbjct  137   PLIDKPSDTGEVERIREFLLKWLNKHPTFSSNPFYAAGDSYSGMTVPALVQEISKGNYIC  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P INL+GY+LGNP + +    +YR+P ++GM LI  +LY+S+   CKGNY +   SN 
Sbjct  197   CEPPINLQGYVLGNPITHIEEEIKYRVPFSHGMGLISDELYESIRSACKGNYFNVDPSNT  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + ++ +    +   +IL   C    T SD                 C+   +YL 
Sbjct  257   KCLKLVEEYHKCIDKLYEYNILLPDCNM--TSSD-----------------CFLYPYYLL  297

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
              + WAN+ +V+DALH++KG+IG W  C+ ++  Y  D+  ++PYH + +  G R+LIYSG
Sbjct  298   -NFWANDESVRDALHIKKGSIGEWVICSRSN-AYNNDIKSSVPYHMHNSINGYRSLIYSG  355

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHDL+VP ++TEAWI SLNYS +  WRPW   D +IAG+TR+YSN MTFAT+KG GH   
Sbjct  356   DHDLVVPFLATEAWIKSLNYSIIHEWRPWMIKD-LIAGYTRTYSNKMTFATVKGGGHTVE  414

Query  231   FFSAYECLIMFERWISGQ  178
                  E  IMF+RWI+GQ
Sbjct  415   -NKPNESFIMFQRWINGQ  431



>ref|XP_010515304.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=442

 Score =   386 bits (992),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 274/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  +DG LPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  31    ASIVKSLPG--FDGLLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPG  88

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP++++   Y G +P L    ++WTKVS+++++D P   GF+Y+ T+  
Sbjct  89    CSSISGLLYENGPLTVKREVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLV  148

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF+ KW   H E+L+NPFYVGGDS+SG+ +P I + ++ GN    KP
Sbjct  149   NKPSDSGEAKRIHEFLYKWLGKHQEFLSNPFYVGGDSYSGMVIPAIVQEVSKGNYLCCKP  208

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP++       +RIP A+GM LI  +LY+S+++ CKG Y +    N  C 
Sbjct  209   PINLQGYVLGNPSTESEMDKNHRIPYAHGMALISDELYESMKRICKGEYINVDPRNTECL  268

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    IN   IL   C          R                     L +  
Sbjct  269   KLVEEYEKCIDRINQPLILTPNCEETSLDCYAYRS--------------------LLTTY  308

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V+ ALHV KG+IG W  CN+ +I YT D+  ++PYH N +  G  +LI+SGDHD
Sbjct  309   WANDENVRSALHVNKGSIGEWVRCNW-EIPYTHDIKSSVPYHMNNSIDGYPSLIFSGDHD  367

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             ++VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P + 
Sbjct  368   MMVPFLGTQAWIRSLNYSIIDDWRPWMIGDQ-IAGYTRTYANKMTFATIKGGGH-TPEYK  425

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  426   PEESYIMFQRWISGQ  440



>gb|KFK38432.1| hypothetical protein AALP_AA3G112600 [Arabis alpina]
Length=441

 Score =   386 bits (992),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/434 (44%), Positives = 281/434 (65%), Gaps = 27/434 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG  +DGPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPGC
Sbjct  31    SIVKFLPG--FDGPLPFELETGYIGIGEKEEVQLFYYFIKSERNPEQDPLLLWLSGGPGC  88

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S +  ++ E GP+++++  Y G +P L    ++WTKVS+++++D P   GF+Y+ T+  +
Sbjct  89    SCISGLLFENGPLTVKLDAYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLVD  148

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               S+  E+++ +EF++KW + H E+L+NPFY GGDS+SG+ VP + + I+ GN    KP 
Sbjct  149   KPSDSGEAKRIHEFLQKWLDKHQEFLSNPFYAGGDSYSGMVVPALVQEISKGNYLCCKPP  208

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQ  760
             INLKGY+LGNP + + + H+YRIP A+GM LI  +LY+S+++ CKG YD     N  C +
Sbjct  209   INLKGYVLGNPFTEVGSDHKYRIPYAHGMALISDELYESMKRICKGEYDVVDPHNTECLK  268

Query  759   DMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLW  580
              + ++ +    I    IL                 +S+  V  P   C++ + ++ +  W
Sbjct  269   LLEEYQKCVDRIFTGFIL-----------------ISECNVTSPD--CYK-YRFVLATYW  308

Query  579   ANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDL  400
             AN+ +V+ AL + K +IG W  C Y +I YT D+  ++PYH N +  G  +LI+SGDHD+
Sbjct  309   ANDESVRRALQINKDSIGEWIRC-YREIPYTQDIKSSVPYHMNNSIHGYPSLIFSGDHDM  367

Query  399   IVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSA  220
              VP + T+AWI SLNYS VD WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P +  
Sbjct  368   EVPFLGTQAWIRSLNYSIVDDWRPWMIGDQ-IAGYTRTYANKMTFATIKGGGH-TPEYKP  425

Query  219   YECLIMFERWISGQ  178
              +  IMF+RWI GQ
Sbjct  426   EDSSIMFQRWIDGQ  439



>ref|XP_007047573.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007047574.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91730.1| Serine carboxypeptidase-like 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOX91731.1| Serine carboxypeptidase-like 18, putative isoform 1 [Theobroma 
cacao]
Length=476

 Score =   387 bits (994),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 201/464 (43%), Positives = 283/464 (61%), Gaps = 24/464 (5%)
 Frame = -2

Query  1521  QLYCSSMVSVVMAARG----SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVK  1354
              L C  ++ V + +R     S +  +PG  +   LPF+LETGYIGVG+   V+ F+YF++
Sbjct  19    HLVCFYIIFVTICSRPALSFSTIRALPG--FSASLPFKLETGYIGVGD---VEFFFYFIE  73

Query  1353  SQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNM  1174
             S+ NP  DP   W  GGPGCSAL  +  EIGP+   +V+Y G +P   LNP++WTKV+++
Sbjct  74    SERNPAEDPLFLWLTGGPGCSALSGLFFEIGPLQFNMVEYNGSLPTFALNPYSWTKVASI  133

Query  1173  LFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGL  994
             +F+D P   GF+Y+ T +   + + + ++ AY F+RKW + H +++TNPFY+GGDS+SG+
Sbjct  134   IFLDAPVGTGFSYSRTLQGFKTGDKQYADDAYNFLRKWLDSHRKFITNPFYIGGDSYSGM  193

Query  993   TVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSL  814
              VPII + I+DG E    P INLKGY+LGNP +        +IP  + + LI  +LY+S 
Sbjct  194   IVPIIAQAISDGIEDKGVPSINLKGYLLGNPGTDSKFDDNSKIPFYHRVALISDELYESA  253

Query  813   EKNCKGNYDH--FSNELCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGSDGLRRSL-  652
             ++NCK  Y     SN  CA+D+    + T  IN  HILE  C    +     D  R+   
Sbjct  254   KRNCKEEYVEVDISNVDCAKDLQAISECTVHINEGHILEPDCPTEFKPLNSLDNNRKYFL  313

Query  651   --SQRPVLPPGEF----CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGY  490
                +  +    EF    C     YL   +WA +++VQ AL+VR+GT+  W  CN + + Y
Sbjct  314   ETHEEYLRVAAEFPQFGCRNYNGYL-CKVWATDISVQKALYVRQGTVTEWVRCN-SSLLY  371

Query  489   TADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDG  310
               D+  A+ YH  L T+G RALIYSGDHD +VP + TEAWI SLN+S VD WRPW   DG
Sbjct  372   DKDVESAVGYHRYLNTKGYRALIYSGDHDTVVPYVGTEAWIKSLNFSIVDDWRPWFV-DG  430

Query  309   IIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
              + G++R Y NN TFAT+KG GH AP +   ECL MF+RWIS +
Sbjct  431   QVGGYSREYGNNFTFATVKGGGHTAPEYKPKECLAMFKRWISQE  474



>ref|XP_003560245.1| PREDICTED: serine carboxypeptidase-like 18 [Brachypodium distachyon]
Length=481

 Score =   387 bits (995),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 196/444 (44%), Positives = 275/444 (62%), Gaps = 16/444 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA    V H+PG  +DGPLPF LETGY+GV E    ++FYYFV+S+ +P TDP + W  G
Sbjct  38    AAAQKVVTHLPG--FDGPLPFYLETGYVGVEEQTGTELFYYFVESERSPATDPVVLWLTG  95

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGG--MPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
             GP CS    +  E+GP+   +  Y GG  +PKL  NP +WTK+S++LF+D P  +GF+YA
Sbjct  96    GPRCSVFSGLAFEVGPVKFVLEPYIGGVGLPKLVHNPLSWTKMSSILFLDSPVGSGFSYA  155

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                K     +   S Q   F+ KWF DHP+YL+NPFY+GGDS++G+ +P+I + I++G E
Sbjct  156   RDPKGYDVGDYSSSLQVQRFLNKWFTDHPQYLSNPFYLGGDSYAGMVIPLIAQNISEGIE  215

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNE  772
                +PLINLKGY++GNP +     + ++I +A+G  +I   +Y++  KNCK +Y +  N+
Sbjct  216   KRQQPLINLKGYLVGNPKTDPKFDNNFKIQSAHGFGIISDQIYEAARKNCKEDYVNPENQ  275

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRV---GTGSDGLRRSLSQRPV---LPPGE---F  619
             +CA+ +   + L   I   HIL   C+         D  R+ L +  +    PPG     
Sbjct  276   MCAEVLHTINSLISEIADAHILYKKCVVAVPKPLEDDSGRKFLLEESIQLNQPPGRPTVD  335

Query  618   CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTR  439
             C+   +YL +  W NN   +DAL +++GTIG W  CN   + YT +M  ++PYH NLT R
Sbjct  336   CFTYGYYL-AYFWMNNNLTRDALGIKEGTIGEWIRCN-RGLPYTYEMPSSIPYHLNLTRR  393

Query  438   GLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFAT  259
             G RAL+YSGDHDL VP + T+AWI SLN+S VD WR W   DG  AGFT +Y+NN+TFAT
Sbjct  394   GYRALVYSGDHDLEVPLLGTQAWIRSLNFSIVDDWRAWHL-DGQAAGFTITYANNLTFAT  452

Query  258   LKGSGHIAPFFSAYECLIMFERWI  187
             +KG GH A  +   EC  M  RW+
Sbjct  453   VKGGGHTASEYQPEECFAMARRWL  476



>ref|XP_003604932.1| Serine carboxypeptidase [Medicago truncatula]
 gb|AES87129.1| 1-O-acylglucose:anthocyanin acyltransferase [Medicago truncatula]
Length=428

 Score =   385 bits (990),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 189/405 (47%), Positives = 273/405 (67%), Gaps = 17/405 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGE-NEEVQVFYYFVKSQTNPTTDPFIFWK  1312
             + A GSKV+H+PG Q  GPLPF+LETGY+G+GE N+++QVFYYF+KS+ NP  DP + W 
Sbjct  33    LEAYGSKVEHLPGFQ--GPLPFQLETGYVGLGESNDDMQVFYYFIKSENNPQKDPLMLWL  90

Query  1311  VGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYA  1132
              GGPGCS+   ++ +IGP   E+ +Y G +P L   P +WTK S+++F+DLP   GF+YA
Sbjct  91    TGGPGCSSFSGLVYQIGPFVFEIKEYNGSVPSLVSRPQSWTKRSSIIFVDLPLGTGFSYA  150

Query  1131  TTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNE  952
                 A+  S+ K    A++F+RKW  DHPE+L+N FY+GGDS+SG+ VP I + I++GNE
Sbjct  151   KNVTAH-RSDWKLVHHAHQFLRKWLIDHPEFLSNEFYIGGDSYSGIPVPAILQEISNGNE  209

Query  951   AGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--  778
              G  PLINL+GY+LGNP ++      Y+IP A+GM LI  +LY SL++NCKG Y +    
Sbjct  210   KGLLPLINLQGYLLGNPITTYKE-DNYQIPYAHGMGLISDELYASLQRNCKGEYINVDSR  268

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFC-----IRVGTGSDGLRRSLSQRPVLPPGEFCW  613
             NELC +D+  FD+   GIN  +IL+ +C     +   + ++ L++S S    +P  E   
Sbjct  269   NELCLRDLQSFDECLSGINTFNILDSYCEDDSHLWRRSLTEVLKKSSSSHLTVP--ELSC  326

Query  612   QMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGL  433
             Q++ +  +  WAN+  V+ ALH+R+G+IG+W  C  TD  +  ++  ++ +HANL+ +G 
Sbjct  327   QIYGFYLATKWANDENVRKALHIREGSIGKWERCYTTD--FEREIFSSVEFHANLSKKGY  384

Query  432   RALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAG  298
             R+LIYSGDHD +VP MST+AWI  LNYS VD WRPW   +G + G
Sbjct  385   RSLIYSGDHDAVVPFMSTQAWIRDLNYSIVDDWRPWFV-NGQVGG  428



>ref|XP_006407566.1| hypothetical protein EUTSA_v10020743mg [Eutrema salsugineum]
 gb|ESQ49019.1| hypothetical protein EUTSA_v10020743mg [Eutrema salsugineum]
Length=441

 Score =   386 bits (991),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 194/438 (44%), Positives = 278/438 (63%), Gaps = 24/438 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V ++PG  ++GPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  24    ADSASTVKYLPG--FEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPEEDPLLIWLSG  81

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  ++ E GP++++   Y G  P L    ++WTK ++++++D P   GF+Y+ T
Sbjct  82    GPGCSSLSGLLYENGPVTLKSEVYNGTRPSLVSTTYSWTKTTSIIYLDQPVGTGFSYSRT  141

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             + A   S+  E+++ +EF+ KW N H E+ +NPFYVGGDS+SG+ VP + + I+ GN   
Sbjct  142   QLAEKPSDSGEAKRIHEFLHKWLNKHQEFFSNPFYVGGDSYSGMVVPALVQEISQGNYLC  201

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +P INL+GY+LGNP + +   + +RIP A+GM LI  +LY+S+++ CKG Y     SN 
Sbjct  202   CEPPINLQGYVLGNPLTEVEIDYNHRIPYAHGMALISDELYESMKRICKGEYVTVDPSNT  261

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + ++ + T  IN   IL   C            S    P       C+  + Y+ 
Sbjct  262   ECLKLVEEYQKCTNRINNQLILTPLC----------EESEDTSPD------CY-TYRYVL  304

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             +  WAN+ +V+ AL + +G+I  W  C Y +I YT D+  +LPYH N + +G  +LI+SG
Sbjct  305   TTYWANDESVRRALQINEGSIREWVRC-YWEIPYTRDIKSSLPYHMNNSIKGYPSLIFSG  363

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHDL +P + T+AWI SLNYS  D WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P
Sbjct  364   DHDLTIPFLGTQAWIRSLNYSLTDDWRPWMIGDQ-IAGYTRTYANKMTFATVKGGGH-TP  421

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWI+GQ
Sbjct  422   EYKPEESYIMFQRWINGQ  439



>ref|XP_004975754.1| PREDICTED: serine carboxypeptidase-like 7-like [Setaria italica]
Length=470

 Score =   387 bits (993),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 195/437 (45%), Positives = 263/437 (60%), Gaps = 11/437 (3%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             G  V H+ G  +DGPLPF LETGY+ V E   VQ+FYYFV+S+ +   DP + W  GGPG
Sbjct  35    GHVVTHMRG--FDGPLPFYLETGYVEVDERHGVQLFYYFVRSEKDSDEDPLVLWLSGGPG  92

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS +  +  EIGP+  +   Y GG P L   P T TK SN++F+D P   GF+YATT++ 
Sbjct  93    CSGISGLAYEIGPLKFDAKGYRGGFPTLLYRPETSTKTSNIIFVDSPVGTGFSYATTEEG  152

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               +S+ K  EQ   F+RKW  DHP +L+NP Y+ GDS+SGL +P +T  I    E G KP
Sbjct  153   LKASDTKAVEQLVIFLRKWLQDHPRFLSNPLYIAGDSYSGLIIPGLTLEIDRSIELGEKP  212

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNELCAQD  757
             L NLKGYI GNP +      + +IP  +GM L+  +LY++   NC G Y   SN  C + 
Sbjct  213   LFNLKGYIAGNPVTDSQFDTDGQIPYLHGMGLVSDELYENARGNCGGKYSAPSNAACTEA  272

Query  756   MGKFDQLTRGINPTHILEDFC------IRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYL  595
             +      TR ++  HILE  C       +    +DG+ R + +      G  C +   Y+
Sbjct  273   IQAIKNCTRDLSGQHILEPACPDVVWSTKTVALADGISRVMLESAEFLSGFKCPEA-EYV  331

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
              SD+W N+  +Q++L VRKGTIG W   N+  + YT D+  A+ YH+ L T+G  ALIYS
Sbjct  332   LSDIWGNDATIQESLGVRKGTIGEWRRFNH-GLSYTEDIQSAVEYHSRLATKGYAALIYS  390

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD  +  + T+AWI  LN + VD WRPW   D  +AGFTR YS+N+TFAT+KG+GHIA
Sbjct  391   GDHDPSITHVGTQAWIRHLNLTIVDDWRPWYVGDQ-VAGFTRRYSSNLTFATVKGAGHIA  449

Query  234   PFFSAYECLIMFERWIS  184
             P +   EC  MF RW+S
Sbjct  450   PLYRPLECQTMFRRWMS  466



>ref|XP_010656845.1| PREDICTED: serine carboxypeptidase-like 13 [Vitis vinifera]
Length=480

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 197/453 (43%), Positives = 283/453 (62%), Gaps = 23/453 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A   S +  +PG  + G LPF LETGY+GVGENE VQ+FYYFVKSQ NP  DP + W  
Sbjct  29    VATARSIIKTLPG--FPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLT  86

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS L A   E GP+S  +  Y GG+P L+L  +TWT+  N++++D P   GF+Y+T
Sbjct  87    GGPGCSTLSAFFYESGPVSFNLT-YNGGLPTLELKEYTWTETLNIIYLDAPVGTGFSYST  145

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T++   + + K + Q YEF++KW   HPE+L N  Y+GGDS+SG+ VP+I + I   +E 
Sbjct  146   TQEGYTTDDYKSAAQIYEFLKKWLIQHPEFLKNNLYIGGDSYSGIPVPMIVQDIYYDSER  205

Query  948   GTKPLINL--KGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHF  781
             G  P +NL  +GY+LGNP +        R+P A+ + LI   LY+S + NC G+Y   + 
Sbjct  206   GGSPRLNLNLQGYVLGNPVTDAYIDKNSRVPFAHRLTLISDGLYESAKANCNGDYVNANA  265

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLRRSLSQRP---VLPPGE  622
             S+E C  D+ + ++L R IN   IL+  C             L+RSL++ P   +   GE
Sbjct  266   SSEQCESDVQEIEELLRDINIQQILDPDCTFSSPIPNEEKSNLQRSLAENPTDFLSQLGE  325

Query  621   ----FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHA  454
                 FC   + Y+ S+ WANN  V++ALHVR+GT G W  CN + + YT D+  ++ YH 
Sbjct  326   ETMYFC-HDYMYILSETWANNRDVREALHVREGTKGYWKRCNISGLAYTEDVISSVAYHR  384

Query  453   NLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNN  274
             NL+  GLRALIYSGDHD+ VP + T+ WI SLN +  D+WR W   +G +AG+T+ Y+N+
Sbjct  385   NLSKTGLRALIYSGDHDMSVPHIGTQQWIDSLNLTLADTWRAWYT-EGQVAGYTKRYTND  443

Query  273   ---MTFATLKGSGHIAPFFSAYECLIMFERWIS  184
                +T+AT+KG+GH+AP +   +C  M +RW +
Sbjct  444   DFALTYATVKGAGHVAPEYKPQQCYAMLKRWFA  476



>emb|CDX78700.1| BnaA03g06120D [Brassica napus]
Length=456

 Score =   386 bits (991),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 200/453 (44%), Positives = 293/453 (65%), Gaps = 33/453 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPF+LETGYIGVG+ E+VQ+FYYF+KS+ NP  DP + W  G
Sbjct  18    ANCGSIVKFLPG--FEGPLPFQLETGYIGVGDEEQVQLFYYFIKSEKNPKEDPLLIWLTG  75

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++ +V  Y GG P L    ++WTKV+N++F+D P  +GF+YATT
Sbjct  76    GPGCSSITGLLFENGPVTFKVEDYNGGTPTLLSTTYSWTKVANIIFLDQPVGSGFSYATT  135

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  +  S+  E+++ +EF+RKW ++H E+++NPFYV GDS+SG  +P + + I+ GN+ G
Sbjct  136   QFLDTPSDSGEAKRIHEFIRKWLSEHKEFISNPFYVSGDSYSGKIIPAMVQEISKGNDLG  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+G+++GNP +     H  RIP A+GM LI  +LY+SL+++CKGNYD+    N 
Sbjct  196   FKPQINLEGFVIGNPVTDTEFEHNQRIPFAHGMALISDELYESLKRSCKGNYDNIDPHNT  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-------VLPPGEFCW  613
              C   +  FD+    IN  +IL   C +  +    +    +  P       V  P  F  
Sbjct  256   EC---LKHFDE----INFANILIPRCDQALSPRRYILLPNTSAPSTDDDCYVSNPSSFYS  308

Query  612   QMFWY--------LRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYH  457
              M  +        L S LWAN+ +V++ALHV  G+I +W  C+ +   Y +D+  ++PYH
Sbjct  309   SMLCFCNHSEYTDLLSSLWANDESVREALHV--GSIDKWVRCS-SGKPYDSDIKSSVPYH  365

Query  456   ANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSN  277
              N + +G R+LI+SGDHDL+ P +ST+AWI SLNYS V+ WRPW  H+  +AG+T++Y+N
Sbjct  366   MNNSIKGYRSLIFSGDHDLMAPFISTQAWIRSLNYSIVEKWRPWMIHNQ-VAGYTQTYAN  424

Query  276   NMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
              MT+AT  G GH  P +   E  IMF+RWISGQ
Sbjct  425   KMTYAT--GGGH-TPEYKPKESFIMFQRWISGQ  454



>emb|CDY44586.1| BnaA04g10040D [Brassica napus]
Length=464

 Score =   386 bits (991),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/438 (44%), Positives = 268/438 (61%), Gaps = 22/438 (5%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +V    A   S V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP 
Sbjct  15    LVLRYFADSASVVKFLPG--FEGPLPFELETGYIGLGEEEELQMFYYFIKSENNPQEDPL  72

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             + W  GGPGCS+LF ++ E GP++++   Y G +P L    ++WTK++NM+F+D P  +G
Sbjct  73    LIWLTGGPGCSSLFGLVFENGPLALKFEVYNGSLPSLVSTTYSWTKMANMIFLDQPVGSG  132

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T   +  S+  E ++ +EF++KW + HP++  NPFYV GDS+SG+ VP + + I+
Sbjct  133   FSYSRTPLVDKVSDTGEVKRIHEFLQKWLSKHPQFYANPFYVAGDSYSGMIVPPVVQEIS  192

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
              GN    +PLINL+GYILGNP +     H   IP AYGM LI  +LY+S+++ CKG+Y  
Sbjct  193   KGNYICCRPLINLQGYILGNPVTDTKLEHNSLIPFAYGMALISEELYESMKRICKGSYGK  252

Query  783   FS--NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDG------------LRRSLSQ  646
                 N  C +    + + T  +N  HIL   C +                   LR   S 
Sbjct  253   VDSLNTDCLKLTEIYQKCTDRLNKYHILLPDCHKTSPDCHALSAFPRTKILVNLRTEQSN  312

Query  645   RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDAL  466
               +L       Q++ Y   + WANN  V  ALHV KG+IG W  CNY  I Y  D+  ++
Sbjct  313   SDLL-----LLQLYKYFLLEKWANNERVHKALHVNKGSIGEWRQCNYDGISYKYDIQSSV  367

Query  465   PYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRS  286
             PYH N +  G R+LI+SGDHD+ VP ++T+AWI SLNYS +D WRPW  +D  IAG+TR+
Sbjct  368   PYHKNNSINGFRSLIFSGDHDMTVPFLATQAWIKSLNYSIIDDWRPWMMNDQ-IAGYTRT  426

Query  285   YSNNMTFATLKGSGHIAP  232
             Y+N MTFAT+     I P
Sbjct  427   YANKMTFATVDTRQTINP  444



>ref|XP_010472296.1| PREDICTED: serine carboxypeptidase-like 11 isoform X1 [Camelina 
sativa]
Length=432

 Score =   385 bits (988),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 195/435 (45%), Positives = 276/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             GS V  +PG  ++GPLPFELETGYIG+GE EE+Q+FYYF+KS+ NP  DP + W  GGPG
Sbjct  21    GSIVKFLPG--FEGPLPFELETGYIGIGEKEEMQLFYYFIKSENNPKEDPLLLWLNGGPG  78

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+   +  E GP++ +   Y G +P L    ++WTK+ N++F+D P R GF+Y+ T   
Sbjct  79    CSSNTGLFFENGPLAFKSEVYNGSVPSLVSTTYSWTKMVNIIFLDQPVRTGFSYSRTPLI  138

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E ++  EF++KW N HP++ +NPFY  GDS+SG+ VP + + I+ GN    +P
Sbjct  139   DKPSDTGEVKRIREFLQKWLNKHPQFSSNPFYAAGDSYSGMIVPALVQEISRGNYICCEP  198

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNP +      +YR+P ++GM LI  ++Y+S+   CKGNY +   SN  C 
Sbjct  199   PINLQGYVLGNPITHFEEDEKYRVPFSHGMGLISDEVYESIRSACKGNYFNADPSNTKCL  258

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  +N  +IL   C    T SD                 C+   +YL S  
Sbjct  259   KLVEEYHKCTDKLNEFNILLPDCNM--TSSD-----------------CFLYPYYLLS-F  298

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V+DALH+ KG+IG W  CN ++  Y  D+  ++PYH N +  G R+LIY+GDHD
Sbjct  299   WANDESVRDALHIDKGSIGEWVRCNRSN-PYDKDIKSSVPYHMNNSISGYRSLIYNGDHD  357

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L+VP ++TEAWI SLNYS +  WRPW   D  IAG+TR+YSN MTFAT+KG GH      
Sbjct  358   LVVPFLATEAWIKSLNYSIIHEWRPWMIKDQ-IAGYTRTYSNKMTFATVKGGGHTVE-NK  415

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  416   PNESFIMFQRWINGQ  430



>ref|NP_973517.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
 gb|AEC07396.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
Length=437

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/444 (45%), Positives = 280/444 (63%), Gaps = 23/444 (5%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +VS      GS V  +PG  + GPLPFELETGYIG+GE E VQ FYYF+KS  NP  DP 
Sbjct  13    LVSSHHVRSGSIVKFLPG--FKGPLPFELETGYIGIGEEENVQFFYYFIKSDKNPQEDPL  70

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             I W  GGPGCS L  +  E GP++++   Y G +P L    ++WTK +N++F+D P  +G
Sbjct  71    IIWLNGGPGCSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSG  130

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T     +S+  E ++ +EF++KW   HP++L+NPFYV GDS+SG+ VP +   I+
Sbjct  131   FSYSKTPIER-TSDTSEVKKIHEFLQKWLIKHPQFLSNPFYVVGDSYSGMIVPALVHEIS  189

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
              GN     P INL+GY+LGNP + +     +RIP A+GM+LI  +LY+SL++ CKGNY  
Sbjct  190   KGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESLKRICKGNYFS  249

Query  783   F--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQ  610
                SN+ C + + ++ + T  IN  H L      +    D   + +S          C+ 
Sbjct  250   VDPSNKKCLKLVEEYHKCTDNINSHHTL------IANCDDSNTQHISPD--------CYY  295

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
               ++L  + WANN +V++ALHV KG+IG W   ++  I Y +D+  ++PYH N +  G R
Sbjct  296   YPYHL-VECWANNESVREALHVDKGSIGEWIR-DHRGIPYKSDIRSSIPYHMNNSINGYR  353

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LI+SGDHD+ +P  +T+AWI SLNYS +D WRPW    G IAG+TR+YSN MTFAT+K 
Sbjct  354   SLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMI-KGQIAGYTRTYSNKMTFATVKA  412

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
             SGH A +    E  IMF+RWISGQ
Sbjct  413   SGHTAEYLPE-ESSIMFQRWISGQ  435



>ref|NP_179884.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
 sp|O64811.1|SCP9_ARATH RecName: Full=Serine carboxypeptidase-like 9; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; Short=SST; 
AltName: Full=Sinapoylglucose--sinapoylglucose acyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17818.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07397.1| serine carboxypeptidase-like 9 [Arabidopsis thaliana]
Length=437

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/444 (45%), Positives = 280/444 (63%), Gaps = 23/444 (5%)
 Frame = -2

Query  1503  MVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPF  1324
             +VS      GS V  +PG  + GPLPFELETGYIG+GE E VQ FYYF+KS  NP  DP 
Sbjct  13    LVSSHHVRSGSIVKFLPG--FKGPLPFELETGYIGIGEEENVQFFYYFIKSDKNPQEDPL  70

Query  1323  IFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAG  1144
             I W  GGPGCS L  +  E GP++++   Y G +P L    ++WTK +N++F+D P  +G
Sbjct  71    IIWLNGGPGCSCLSGLFFENGPLALKNKVYNGSVPSLVSTTYSWTKTANIIFLDQPVGSG  130

Query  1143  FTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIA  964
             F+Y+ T     +S+  E ++ +EF++KW   HP++L+NPFYV GDS+SG+ VP +   I+
Sbjct  131   FSYSKTPIER-TSDTSEVKKIHEFLQKWLIKHPQFLSNPFYVVGDSYSGMIVPALVHEIS  189

Query  963   DGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDH  784
              GN     P INL+GY+LGNP + +     +RIP A+GM+LI  +LY+SL++ CKGNY  
Sbjct  190   KGNYICCNPPINLQGYVLGNPITHIEFEQNFRIPYAHGMSLISDELYESLKRICKGNYFS  249

Query  783   F--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQ  610
                SN+ C + + ++ + T  IN  H L      +    D   + +S          C+ 
Sbjct  250   VDPSNKKCLKLVEEYHKCTDNINSHHTL------IANCDDSNTQHISPD--------CYY  295

Query  609   MFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLR  430
               ++L  + WANN +V++ALHV KG+IG W   ++  I Y +D+  ++PYH N +  G R
Sbjct  296   YPYHL-VECWANNESVREALHVDKGSIGEWIR-DHRGIPYKSDIRSSIPYHMNNSINGYR  353

Query  429   ALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             +LI+SGDHD+ +P  +T+AWI SLNYS +D WRPW    G IAG+TR+YSN MTFAT+KG
Sbjct  354   SLIFSGDHDITMPFQATQAWIKSLNYSIIDDWRPWMI-KGQIAGYTRTYSNKMTFATVKG  412

Query  249   SGHIAPFFSAYECLIMFERWISGQ  178
              GH A +    E  IMF+RWISGQ
Sbjct  413   GGHTAEYLPE-ESSIMFQRWISGQ  435



>ref|XP_010486655.1| PREDICTED: serine carboxypeptidase-like 7 isoform X5 [Camelina 
sativa]
Length=446

 Score =   385 bits (988),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 279/438 (64%), Gaps = 27/438 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETG---YIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
              S V+ +PGL  DGPLPFELETG   YIGVGE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  29    ASVVEFLPGL--DGPLPFELETGVVTYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSG  86

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS++  ++ E GP++++   Y G +P L    ++WTKVS+++++D P   GF+Y+ T
Sbjct  87    GPGCSSISGLLYENGPLTVKFEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSKT  146

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             +  N  S+  E+++ +EF+ KW   H E+L NPFYV GDS+SG  +P + + I+ GN   
Sbjct  147   QLVNKPSDSGEAKRIHEFLHKWLGKHQEFLPNPFYVTGDSYSGNVIPALVQEISKGNYLC  206

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+GY+LGNP +       +RIP A+GM LI  +LY+S+++ CKG Y++    N 
Sbjct  207   CKPPINLQGYVLGNPLTESEIDSNHRIPYAHGMALISDELYESMKRICKGEYNNVDPRNT  266

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + +F++    IN +HI+   C               +    PP   C++ + YL 
Sbjct  267   ECLKLVEEFEKCIDRINESHIIAPDC--------------EENHETPPD--CYE-YRYLL  309

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             +  WAN  +V  ALHV KG+IG W  C++  I YT D+T ++PYH N +  G  +LI+SG
Sbjct  310   TTYWANYESVHRALHVNKGSIGEWVRCHW-GIPYTYDITSSVPYHMNNSIDGYPSLIFSG  368

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+ VP + T+AWI SLNYS  D WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P
Sbjct  369   DHDMRVPFLGTQAWIRSLNYSLTDDWRPWMIGDQ-IAGYTRTYANKMTFATIKGGGH-TP  426

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  IMF+RWISGQ
Sbjct  427   EYKPEESSIMFQRWISGQ  444



>ref|XP_010556472.1| PREDICTED: serine carboxypeptidase-like 18 isoform X1 [Tarenaya 
hassleriana]
Length=462

 Score =   385 bits (989),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 297/455 (65%), Gaps = 19/455 (4%)
 Frame = -2

Query  1503  MVSVVMAAR----GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPT  1336
             ++ +++AA+    G  V+ +PG  ++GPLPF+LETGY+GVGE E V +FYYF++S+ NP 
Sbjct  12    LIMILVAAQRVDSGVSVESLPG--FEGPLPFKLETGYVGVGEGEGVNLFYYFIESERNPE  69

Query  1335  TDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLP  1156
              DP + W  GGPGC++L  +  EIGP++ EV  Y GG+P L    ++WTKV++++F+D P
Sbjct  70    EDPLVIWLSGGPGCTSLSGLAFEIGPLAFEVDDYNGGVPSLVSTSYSWTKVASIIFLDQP  129

Query  1155  ARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIIT  976
                GF+YA T+ A+  S+ +++ Q YEF+RKW  DHP + +NPFYVGGDS+SG  VP I 
Sbjct  130   VGTGFSYARTRLADKPSDTRQAVQVYEFVRKWLIDHPRFTSNPFYVGGDSYSGRVVPAIV  189

Query  975   KMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG  796
             + I++GN+ G +P +NL+GY+LGNP +  +     +IP A+GM LI  +LY+SL+++C G
Sbjct  190   QEISNGNDKGFRPRVNLQGYVLGNPKTDGSFDSNSKIPYAHGMGLISDELYESLKRSCGG  249

Query  795   NYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQR----  643
             NY     SN  C   +  +D+    IN   IL   C       + SD  RR  S+     
Sbjct  250   NYWDVDPSNSECLNLLQDYDKCVSRINGAFILTPLCEFSSPRPSLSDITRRRYSRELLNT  309

Query  642   PVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALP  463
              +  P   C+  + YL S  WAN+  V+ ALHV KG+IG W  CN+  + Y  D+  ++P
Sbjct  310   SLSVPASDCY-TYRYLLSSYWANDEKVRRALHVVKGSIGNWVRCNW-GMPYDYDIRSSIP  367

Query  462   YHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY  283
             YH N + +G R+L++SGDHD++VP + T+AWI SLNYS VD WRPW  ++  +AG+TR+Y
Sbjct  368   YHLNNSLKGYRSLVFSGDHDMMVPFLGTQAWIRSLNYSIVDDWRPWIINNQ-VAGYTRTY  426

Query  282   SNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             +N MTFAT+KG GH    +   E  IMF+RWI+GQ
Sbjct  427   ANKMTFATIKGCGHTVE-YKPEEGSIMFQRWINGQ  460



>emb|CBI17847.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   387 bits (993),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 197/453 (43%), Positives = 283/453 (62%), Gaps = 23/453 (5%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A   S +  +PG  + G LPF LETGY+GVGENE VQ+FYYFVKSQ NP  DP + W  
Sbjct  79    VATARSIIKTLPG--FPGELPFYLETGYVGVGENESVQLFYYFVKSQRNPVLDPLVLWLT  136

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GGPGCS L A   E GP+S  +  Y GG+P L+L  +TWT+  N++++D P   GF+Y+T
Sbjct  137   GGPGCSTLSAFFYESGPVSFNLT-YNGGLPTLELKEYTWTETLNIIYLDAPVGTGFSYST  195

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T++   + + K + Q YEF++KW   HPE+L N  Y+GGDS+SG+ VP+I + I   +E 
Sbjct  196   TQEGYTTDDYKSAAQIYEFLKKWLIQHPEFLKNNLYIGGDSYSGIPVPMIVQDIYYDSER  255

Query  948   GTKPLINL--KGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNY--DHF  781
             G  P +NL  +GY+LGNP +        R+P A+ + LI   LY+S + NC G+Y   + 
Sbjct  256   GGSPRLNLNLQGYVLGNPVTDAYIDKNSRVPFAHRLTLISDGLYESAKANCNGDYVNANA  315

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFCIRVG----TGSDGLRRSLSQRP---VLPPGE  622
             S+E C  D+ + ++L R IN   IL+  C             L+RSL++ P   +   GE
Sbjct  316   SSEQCESDVQEIEELLRDINIQQILDPDCTFSSPIPNEEKSNLQRSLAENPTDFLSQLGE  375

Query  621   ----FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHA  454
                 FC   + Y+ S+ WANN  V++ALHVR+GT G W  CN + + YT D+  ++ YH 
Sbjct  376   ETMYFC-HDYMYILSETWANNRDVREALHVREGTKGYWKRCNISGLAYTEDVISSVAYHR  434

Query  453   NLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNN  274
             NL+  GLRALIYSGDHD+ VP + T+ WI SLN +  D+WR W   +G +AG+T+ Y+N+
Sbjct  435   NLSKTGLRALIYSGDHDMSVPHIGTQQWIDSLNLTLADTWRAWYT-EGQVAGYTKRYTND  493

Query  273   ---MTFATLKGSGHIAPFFSAYECLIMFERWIS  184
                +T+AT+KG+GH+AP +   +C  M +RW +
Sbjct  494   DFALTYATVKGAGHVAPEYKPQQCYAMLKRWFA  526



>ref|XP_009140442.1| PREDICTED: serine carboxypeptidase-like 13 isoform X2 [Brassica 
rapa]
Length=440

 Score =   384 bits (985),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/415 (46%), Positives = 267/415 (64%), Gaps = 25/415 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIGVG+ E++Q+FYYFVKS+ NP  DP + W  G
Sbjct  19    AESGSIVKFLPG--FEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+LFAI+ E GP++++   Y G +P L    ++WTK++N++F+D P  AGF+Y+ T
Sbjct  77    GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                N  S+  E +  +EF++KW + HPE+ +NPFYV GDS+SG  VP + + I+ GN   
Sbjct  137   PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYIC  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP IN++GYILGNP + + +    +IP A+GM LI  +LY+SL++ CKGNY++    N 
Sbjct  197   CKPPINIQGYILGNPITQIKSEDNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNT  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + +  +++ T  +N  HIL   C                  +  P  F   ++ Y  
Sbjct  257   ECLKHIEMYNKCTDKLNRYHILLPDC-----------------DMTSPDCF---LYNYFL  296

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
              D WANN  V+ AL V KG+IG W  CNY  I Y  D+   +PYH N +  G R+LIYSG
Sbjct  297   LDKWANNERVRRALQVTKGSIGEWKRCNYDVIPYNYDIQSTVPYHMNNSISGFRSLIYSG  356

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGS  247
             DHD++VP ++T+AWI SLNYS VD WRPW  +D  IAG+TR Y+N MT+AT+K S
Sbjct  357   DHDMVVPFIATQAWIRSLNYSIVDDWRPWMVNDQ-IAGYTRGYANKMTYATIKAS  410



>ref|XP_006403281.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
 gb|ESQ44734.1| hypothetical protein EUTSA_v10003211mg [Eutrema salsugineum]
Length=439

 Score =   384 bits (985),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/436 (44%), Positives = 281/436 (64%), Gaps = 25/436 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S + ++PG Q  GPLPF+LETGYIGVGE EE Q+FYYF+KS++NP  DP + W  GGPGC
Sbjct  23    STIRYLPGFQ--GPLPFKLETGYIGVGEAEEEQLFYYFIKSESNPEEDPLLIWLSGGPGC  80

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             S+L  ++ E GP++ +V  Y G    L    ++WTKV++++++D P   GF+Y+    A+
Sbjct  81    SSLSGLLFENGPLAFKVESYDGDTLSLVSTTYSWTKVASIIYLDQPVGTGFSYSRNPLAD  140

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
               S+ + +++ +EF+RKW   HPE+ +NPFYV G+S+SG+ +P I + I++GN    KP 
Sbjct  141   KPSDTRAAKRVHEFLRKWLAKHPEFFSNPFYVAGNSYSGIVIPAIVQEISNGNGLCCKPQ  200

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFSNEL---CA  763
             INL+GY+LGNP ++ +N    RIP A+GM LIP +L++SL ++C+GNY    + L   C 
Sbjct  201   INLQGYVLGNPLTNFDNNDNSRIPFAHGMALIPDELFESLRRSCRGNYYVKMDPLNTGCL  260

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-VLPPGEFCWQMFWYLRSD  586
             + + +F++   G++ T+IL            G +   +  P V  P E    +     S+
Sbjct  261   KLVQEFEKCVSGLDLTYIL------------GPKYVNASDPYVSNPSEHRMSVL----SN  304

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              WAN   V+ AL V KG+IG W  C Y +I Y  D+  ++PYH N + +G R+LI+SGDH
Sbjct  305   RWANEERVRRALGVEKGSIGEWLRC-YREIPYNIDIRSSVPYHKNNSIQGYRSLIFSGDH  363

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP + T+ WI SLNYS +D WRPW  H+  +AG+TR+Y+N MTFAT+KG GH    +
Sbjct  364   DMFVPFLETQDWIRSLNYSIIDDWRPWMIHNQ-VAGYTRTYANKMTFATVKGGGHTM-VY  421

Query  225   SAYECLIMFERWISGQ  178
                EC +MF+RWIS Q
Sbjct  422   KPEECSVMFKRWISDQ  437



>ref|XP_009139928.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Brassica 
rapa]
Length=436

 Score =   383 bits (984),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 280/436 (64%), Gaps = 28/436 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVG--ENEEVQVFYYFVKSQTNPTTDPFIFWKVGGP  1300
             S V ++PG  ++GPLPFELETGY+GVG  E E+VQ+FYYF+KS+ NP  DP + W  GGP
Sbjct  23    SIVKYLPG--FEGPLPFELETGYVGVGVGEEEQVQLFYYFIKSERNPEKDPLLLWLSGGP  80

Query  1299  GCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK  1120
             GCS++  ++ E GP++++   Y G +P L    ++WTK+S+++++D P   GF+Y+ T  
Sbjct  81    GCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYSRTHL  140

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S+  E +  +EF++KW N H E+L+NPFY GGDS+SG+ +P + + I+ GN    K
Sbjct  141   ASKPSDSGEVKLVHEFLQKWLNKHQEFLSNPFYAGGDSYSGMVLPALVQEISKGNYLCCK  200

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELC  766
             P INL+GY+LGNP + +   H +RIP  +GM LI  +LY+S+++ CKG Y+    SN+ C
Sbjct  201   PPINLQGYVLGNPVTDIEFDHNHRIPFTHGMALISDELYESMKRICKGEYETVDPSNKEC  260

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
              + + ++ + T  IN + +    C                     P   C+  + Y+ + 
Sbjct  261   LKLVEEYHKCTDRINYSLVTTPLCED------------------DPSPDCYD-YRYVLTT  301

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              WAN+ +V+ ALH+ K + G+W  C++ D+ YT D+  ++PYH N +  G  +LI+SGDH
Sbjct  302   YWANDESVRRALHINKESKGKWVRCDW-DMAYTNDIKSSVPYHMNNSINGYPSLIFSGDH  360

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP++ T+AWI SLNYS  D WRPW   D  IAG+TR+Y+NNMTF T+KG GH  P +
Sbjct  361   DMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQ-IAGYTRTYANNMTFVTIKGGGH-TPEY  418

Query  225   SAYECLIMFERWISGQ  178
                E  IMF+RWISGQ
Sbjct  419   KPEESYIMFQRWISGQ  434



>ref|XP_009139927.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=441

 Score =   383 bits (984),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 280/436 (64%), Gaps = 28/436 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVG--ENEEVQVFYYFVKSQTNPTTDPFIFWKVGGP  1300
             S V ++PG  ++GPLPFELETGY+GVG  E E+VQ+FYYF+KS+ NP  DP + W  GGP
Sbjct  28    SIVKYLPG--FEGPLPFELETGYVGVGVGEEEQVQLFYYFIKSERNPEKDPLLLWLSGGP  85

Query  1299  GCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK  1120
             GCS++  ++ E GP++++   Y G +P L    ++WTK+S+++++D P   GF+Y+ T  
Sbjct  86    GCSSISGLLYENGPVTVKFEVYNGTLPSLIATTYSWTKISSIIYLDQPVGTGFSYSRTHL  145

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S+  E +  +EF++KW N H E+L+NPFY GGDS+SG+ +P + + I+ GN    K
Sbjct  146   ASKPSDSGEVKLVHEFLQKWLNKHQEFLSNPFYAGGDSYSGMVLPALVQEISKGNYLCCK  205

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELC  766
             P INL+GY+LGNP + +   H +RIP  +GM LI  +LY+S+++ CKG Y+    SN+ C
Sbjct  206   PPINLQGYVLGNPVTDIEFDHNHRIPFTHGMALISDELYESMKRICKGEYETVDPSNKEC  265

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
              + + ++ + T  IN + +    C                     P   C+  + Y+ + 
Sbjct  266   LKLVEEYHKCTDRINYSLVTTPLCED------------------DPSPDCYD-YRYVLTT  306

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              WAN+ +V+ ALH+ K + G+W  C++ D+ YT D+  ++PYH N +  G  +LI+SGDH
Sbjct  307   YWANDESVRRALHINKESKGKWVRCDW-DMAYTNDIKSSVPYHMNNSINGYPSLIFSGDH  365

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP++ T+AWI SLNYS  D WRPW   D  IAG+TR+Y+NNMTF T+KG GH  P +
Sbjct  366   DMYVPSLGTQAWIRSLNYSVTDDWRPWMIGDQ-IAGYTRTYANNMTFVTIKGGGH-TPEY  423

Query  225   SAYECLIMFERWISGQ  178
                E  IMF+RWISGQ
Sbjct  424   KPEESYIMFQRWISGQ  439



>gb|KFK39468.1| hypothetical protein AALP_AA3G248300 [Arabis alpina]
Length=444

 Score =   383 bits (984),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 192/439 (44%), Positives = 273/439 (62%), Gaps = 27/439 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  G
Sbjct  28    ADSASIVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTG  85

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GP CS++  ++ E GP+++++  Y G +P L    ++WTK S++LF+D P   GF+Y+ T
Sbjct  86    GPACSSISGLLFENGPLTIKLDVYNGTLPSLVSTSYSWTKTSSILFLDQPVGTGFSYSKT  145

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
             K  N  S++ E ++  EF  KW   H E+ +NPFYV GDS++G+ VP + + I+ GN   
Sbjct  146   KIFNTPSDLGEVKRINEFFHKWLGKHQEFSSNPFYVAGDSYAGMIVPAVVQEISKGNYQC  205

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
               P INL+GY+LGNP + +    +YRIP A+GM LI  +LY+SL++ CKG Y +    N 
Sbjct  206   CNPPINLQGYVLGNPITEVETDFDYRIPYAHGMALISDELYESLKRACKGKYQNVDPRNT  265

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + +  + +   GIN   I   FC                   +P    C+ ++ Y  
Sbjct  266   KCLKLVEDYHKCIDGINMYTISSPFC----------------ETAIPR---CY-IYRYFL  305

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACN-YTDIGYTADMTDALPYHANLTTRGLRALIYS  415
             S+ WAN+  V++AL + + +IG W  CN    + Y  D+   +PYH N +  G R+LI+S
Sbjct  306   SEYWANDKTVRNALRIDEDSIGEWLRCNPDVKMAYANDIISNVPYHLNNSINGYRSLIFS  365

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GD D+ VP ++T+AWI SLNYS +D WRPW  +D  IAG+TR+Y+N MTFAT+KG GH  
Sbjct  366   GDQDMQVPYLATQAWIKSLNYSIIDDWRPWMINDQ-IAGYTRTYANKMTFATIKGGGH-T  423

Query  234   PFFSAYECLIMFERWISGQ  178
             P ++  E  IMF+RWI+GQ
Sbjct  424   PEYTPEESFIMFQRWINGQ  442



>ref|XP_011006023.1| PREDICTED: serine carboxypeptidase-like 3 isoform X1 [Populus 
euphratica]
Length=487

 Score =   384 bits (987),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 198/424 (47%), Positives = 270/424 (64%), Gaps = 19/424 (4%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V  +PGL+  GPLPF LETGY+GV E E+VQ+FYYF+KSQ NP  DP + W  G
Sbjct  19    AAARSIVKFLPGLK--GPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNPKDDPLLLWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   ++ EIGPIS EV +Y G +P L LNP++WT+VS+++F+DLPA  GF+YA T
Sbjct  77    GPGCSAFCGLVFEIGPISFEVKEYNGSLPTLVLNPYSWTQVSSIIFLDLPAGTGFSYART  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A   S+ K+   A +F+RKW  DH E+L NP Y+ GDS+SG  VP I + I++GN  G
Sbjct  137   PLALQRSDFKQVSHAEQFLRKWLMDHQEFLANPIYIAGDSYSGKIVPAIVQNISNGNNDG  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNE  772
              +PL+N+KGYILGNP +        RIP A+GM LI  +LY+SL+K+C G Y     SN 
Sbjct  197   IEPLLNVKGYILGNPITDPTFDFNSRIPFAHGMGLISDELYESLKKSCAGEYQTIKPSNA  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQ--------RPVLPPG  625
              C +++  FD+    I   HILE  C         + G RR L +        +P LP  
Sbjct  257   ECLKNVEAFDKCISDIEDAHILERKCPSDAPRLIETLGKRRYLRENPRELLHFKPDLP--  314

Query  624   EFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
                 + + ++ +  WAN+  V+ ALHVR+G+I  W  CNY  + YT ++  ++ YH +L 
Sbjct  315   TIGCRAYGHVLAAYWANDDNVRKALHVREGSIEEWKRCNYK-LPYTYEIKSSIKYHIDLG  373

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              +G R LIYSGDHD+  P + T+AWI  LNYS VD W+PW  + G +AG+TR+YS+ + F
Sbjct  374   IKGYRRLIYSGDHDMEAPFLGTQAWIRYLNYSVVDDWQPW-HYQGQVAGYTRTYSSQLAF  432

Query  264   ATLK  253
             AT+K
Sbjct  433   ATVK  436



>emb|CBI17848.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   387 bits (994),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 288/460 (63%), Gaps = 28/460 (6%)
 Frame = -2

Query  1515  YCSSMVSVVMAARG-----SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKS  1351
             + S M+ +++ + G     S +  +PG  + G LPF LETGY+GVGENEEVQ+FYYFVKS
Sbjct  112   FLSVMLLLLVFSSGIANGRSVIKTLPG--FSGELPFYLETGYVGVGENEEVQLFYYFVKS  169

Query  1350  QTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNML  1171
             Q NP  DP + W  GGPGCS L A   E GP++  + +Y GG+P L L  +TWTK  N++
Sbjct  170   QRNPVFDPLMLWLSGGPGCSTLTAFFYENGPLTFNIQEYEGGLPNLYLKENTWTKTLNII  229

Query  1170  FIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLT  991
             F+D P  +GF+Y+ T++  +  ++K + Q YEF++KW  DHPE+L N  YVGGDS+SG+ 
Sbjct  230   FVDAPVGSGFSYSKTQEGYIMEDLKYAAQTYEFLKKWLVDHPEFLKNELYVGGDSYSGIP  289

Query  990   VPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
             VP++ + I  G+     P +NL+GY+LGNP +  +N    RIP A+ + LI  +LY+S +
Sbjct  290   VPMVVQEIYYGS-----PSLNLQGYVLGNPLTDTDNDVNSRIPFAHRLTLISDELYESAK  344

Query  810   KNCKGNY--DHFSNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRR-SLSQRP  640
              +C G+Y   + SNE C  DM    +L   I    +LE  C   G  S   +   L+   
Sbjct  345   TSCNGDYVTVNASNEQCVADMEAISKLIDQIYIMQVLEPNC---GISSRKPKEGELNHTH  401

Query  639   VLPP-GE----FCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMT  475
              L   GE    FC + + Y+ S++WANN  V++AL VR+GT G W  CN T++ +T D+T
Sbjct  402   FLTQLGEKSAYFCHE-YNYVFSEIWANNKDVREALRVREGTKGHWVRCNITNLAFTKDVT  460

Query  474   DALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGF  295
               + YH NLT  GLRALIYSGDHD+ +P + T+ WI SLN +  D WR W   DG +AG+
Sbjct  461   STVAYHQNLTNTGLRALIYSGDHDMSIPHIGTQEWINSLNLTLEDPWRTWCT-DGQVAGY  519

Query  294   TRSYSN---NMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
             T +++N   ++TFAT+KG+GH+A  +   EC  M +RW +
Sbjct  520   TETFTNDDFDLTFATVKGAGHVAIEYKPKECYAMIDRWFA  559


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 4/59 (7%)
 Frame = -2

Query  1449  LQYDGPLPFELETG----YIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSAL  1285
             L +   L F LETG    Y+GVG+NEEVQ+ Y F + + NP+ +P +FW  GGP CS  
Sbjct  21    LGFPEELSFYLETGFVCRYVGVGKNEEVQLLYLFFRLERNPSVNPLMFWLTGGPSCSTF  79



>ref|XP_002459781.1| hypothetical protein SORBIDRAFT_02g010510 [Sorghum bicolor]
 gb|EER96302.1| hypothetical protein SORBIDRAFT_02g010510 [Sorghum bicolor]
Length=483

 Score =   384 bits (987),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 196/449 (44%), Positives = 276/449 (61%), Gaps = 23/449 (5%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTD--PFIFWKVGG  1303
             G  V  +PG  +DG LPF LETGY+ V E+  V++FYYFV+S++   +   PF+FW  GG
Sbjct  34    GRVVTSLPG--FDGDLPFHLETGYVEVDEDAGVELFYYFVRSESESESGDAPFLFWLTGG  91

Query  1302  PGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTK  1123
               CS    +  EIGPI   V  Y G +P+L+ N ++W+KVS++LF+D P  AGF+++   
Sbjct  92    DRCSVFSGLAYEIGPIRFVVEPYNGTLPRLRYNQNSWSKVSHILFVDSPVGAGFSFSRDP  151

Query  1122  KANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGT  943
             K     ++  ++Q  +F+ KWF+DHPEYL NPFY+GGDS++G  VP I +MI++G EAG 
Sbjct  152   KGYDVGDISSTQQLRDFLIKWFDDHPEYLANPFYIGGDSYAGKIVPFIGQMISEGIEAGR  211

Query  942   KPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKG-NYDHFSNELC  766
             +P  NLKGY++GN A+  +     R+P A+G+ +I   LY+++  +C+G +Y + +N LC
Sbjct  212   RPFPNLKGYLVGNAATGESIDTTSRVPYAHGVGIISAQLYETILGHCQGEDYTNPANTLC  271

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVG---------TGSDGLR-------RSLSQRPVL  634
             AQ +  F+ L   +   HIL D C+             GSD  R       R +   P  
Sbjct  272   AQALYTFNNLIDEVQHAHILLDRCVYASPAPNVVSRMDGSDNRRILRAEMGRGMLNHPPA  331

Query  633   PPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHA  454
              P   C    +YL S  WAN+   ++AL ++KGT+  W  C+  D+ YT D+  ++ YH 
Sbjct  332   RPPFGCLTYRYYL-SYFWANDKRTREALGIKKGTVDEWVRCHDGDLPYTKDLKSSIKYHR  390

Query  453   NLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNN  274
             NLT+RG RAL+YSGDHDL+VP + T+AW+ SLN+  VD WR W    G  AGFT SYSNN
Sbjct  391   NLTSRGYRALVYSGDHDLLVPHLGTQAWVRSLNFPIVDDWRAWHL-GGQAAGFTISYSNN  449

Query  273   MTFATLKGSGHIAPFFSAYECLIMFERWI  187
             MTFAT+KG GH AP +    C  MF RWI
Sbjct  450   MTFATIKGGGHTAPEYEPERCFAMFTRWI  478



>ref|XP_006294237.1| hypothetical protein CARUB_v10023234mg [Capsella rubella]
 gb|EOA27135.1| hypothetical protein CARUB_v10023234mg [Capsella rubella]
Length=439

 Score =   383 bits (983),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 280/432 (65%), Gaps = 23/432 (5%)
 Frame = -2

Query  1467  VDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSA  1288
             V  +PG  ++GPLPFELETGYIG+GE EE Q+FYYF+KS+ NP  DP + W  GGPGCS+
Sbjct  27    VKFLPG--FEGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPEEDPLLLWLNGGPGCSS  84

Query  1287  LFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVS  1108
             + A++ EIGP++++   Y G +P L    ++WTKV+N++F+D P   GF+Y+ T     +
Sbjct  85    ITALLLEIGPVALKSEAYNGSVPSLVTTTYSWTKVANIIFLDQPIGVGFSYSKTPLGE-T  143

Query  1107  SNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLIN  928
             S+  E +  +EF++KW N HP+Y +NPFY  GDS++G+ +P +   I+ GN     P IN
Sbjct  144   SDTNEVKMIHEFLQKWLNKHPQYYSNPFYATGDSYAGMIIPAVVDEISKGNYICCNPPIN  203

Query  927   LKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQDM  754
             L+GY+LGNP + +     YRIP A+GM+LI  +LY+SL++ CKGNY +   SN  C + +
Sbjct  204   LQGYVLGNPITDVEMELNYRIPFAHGMSLISDELYESLKRFCKGNYFYVDPSNTKCLELV  263

Query  753   GKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDLWAN  574
              +F++ T  IN   IL   C    T              + P   C+   ++L  + WAN
Sbjct  264   EEFNKCTENINIHQILIPNCDHTKTEE------------ISPD--CYYYRYHLL-ERWAN  308

Query  573   NVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIV  394
               +V++ALH+RKGT G W   N++ I Y  ++  ++PYH N +  G R+LI+SGDHD+++
Sbjct  309   KDSVRNALHIRKGTKGEWERYNHS-IPYDRNIKSSIPYHMNNSINGYRSLIFSGDHDMVL  367

Query  393   PTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYE  214
             P+ +T+AWI SLNYS    W+PW  +D  IAG+TR+Y+N MTFAT+KG GH  P +   E
Sbjct  368   PSFATQAWIKSLNYSITHDWKPWMINDQ-IAGYTRTYANKMTFATIKGCGH-TPEYLPEE  425

Query  213   CLIMFERWISGQ  178
               I+F+RWI+GQ
Sbjct  426   TSILFKRWINGQ  437



>gb|KEH33547.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=454

 Score =   383 bits (984),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 203/455 (45%), Positives = 280/455 (62%), Gaps = 22/455 (5%)
 Frame = -2

Query  1512  CSSMVSV------VMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKS  1351
             CS +V V      +M   GS V ++PG  +DG LPF+LETGYIGVGE  +VQ+FYYFV+S
Sbjct  6     CSCIVLVTLMLLPLMVYSGSIVKNLPG--FDGELPFKLETGYIGVGEGAKVQMFYYFVES  63

Query  1350  QTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNML  1171
             Q NP  DP + W VGGPGCSAL A   E GP++ME   Y+G +PKLKLNP+ WT + NM+
Sbjct  64    QRNPFVDPILLWFVGGPGCSALSAFFFENGPLTMED-DYSGILPKLKLNPYGWTHMLNMM  122

Query  1170  FIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLT  991
             +ID+P   GF+Y+ T++   SS+    +  Y F++KW  DHP++ +NPFY+GG S+SG T
Sbjct  123   YIDIPVGTGFSYSETQEGYYSSDTLWVDHTYSFLQKWILDHPKFSSNPFYIGGGSYSGFT  182

Query  990   VPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLE  811
                + + + DGN A  KP IN+KGY+L +PA  L      ++  AY MNLIP +LY+SLE
Sbjct  183   TGPLVQKVYDGNIARHKPHINIKGYVLASPAVDLYQHVNDQVLYAYHMNLIPKELYESLE  242

Query  810   KNCKGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPV  637
             +NCKG+Y +   +N  C  D   + +L R IN   ILE  CI     +  +R     +PV
Sbjct  243   ENCKGDYVNIDPNNTKCVSDYEAYSELVRYINEQQILEPLCITTPALNQIIR-----QPV  297

Query  636   LPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYH  457
                 EF  + +++L  D+WAN+  V+ AL VR+GT G +  CN T + YT  +TD + Y+
Sbjct  298   QDDQEFSCRSYYHLLVDIWANDENVRKALRVREGTKGEFLRCNKT-LAYTQTLTDVVEYY  356

Query  456   ANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSY--  283
              NLT   + ALIY  D D+ +P + T+ WI S N ST D WR W   +G +AGFT  Y  
Sbjct  357   RNLTNANILALIYGSDLDMSIPQLGTQVWIKSFNMSTHDKWRAWFV-EGQVAGFTEIYKM  415

Query  282   --SNNMTFATLKGSGHIAPFFSAYECLIMFERWIS  184
                + +T+  LKG+GH+A  F   E   M +RW S
Sbjct  416   KEDHYLTYVALKGAGHVAQTFKPKEVYNMIKRWFS  450



>emb|CDP01265.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   385 bits (988),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 194/410 (47%), Positives = 273/410 (67%), Gaps = 18/410 (4%)
 Frame = -2

Query  1488  MAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKV  1309
             +A+ GS V  +PG  ++GPLPFELETGYIGV E+E+VQ+FYYFVKS+++P TDP + W  
Sbjct  39    LASAGSPVKFLPG--FEGPLPFELETGYIGVDESEDVQLFYYFVKSESSPETDPLVLWLS  96

Query  1308  GGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYAT  1129
             GG  C++   +  EIGPI  E V Y G +PKL LNP++WTKV++++F+DLP  +GF+YA 
Sbjct  97    GGNCCTSFSGLAYEIGPIKFEQVLYHGTLPKLLLNPYSWTKVASIIFVDLPVASGFSYAR  156

Query  1128  TKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEA  949
             T KA+ S+ ++   QAYEF+RKW  DHPE++++P Y+GGDS +G++VPI+T++I+DGN  
Sbjct  157   TAKASQSTVLQACNQAYEFLRKWLVDHPEFISSPVYIGGDSKAGISVPIVTQLISDGNAV  216

Query  948   GTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SN  775
             G +P I+LKGYILGNP ++  +   Y I   +GM LI  +LY+SL+ +CKG Y +   SN
Sbjct  217   GIEPHIDLKGYILGNPVTTPGD-GNYAIQFTHGMGLISDELYESLKLSCKGEYQNIDPSN  275

Query  774   ELCAQDMGKFDQLTRGINPT--HILEDFCIRVGTGSDGL---RRSLSQRPVLPPGEFCWQ  610
              LC Q+M  ++Q +   + +  HILE +C       + L   RRS  Q       E   Q
Sbjct  276   ALCLQNMEAYNQASNHFSASFAHILEPYCPYASPKPNNLFTGRRSTIQVFCEKTRELKIQ  335

Query  609   MFWYLRSD------LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                   +D       WAN+ +VQ+ALHVRKG+IG W  CN     +  ++ ++LPYHANL
Sbjct  336   ELAAPFTDGYRLVYHWANDESVQEALHVRKGSIGEWIRCN-CRYPFIRNIGNSLPYHANL  394

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAG  298
             + RG R+LIYSGDHD++VP   T+AW+ SLNY  +D WR W    G +AG
Sbjct  395   SIRGYRSLIYSGDHDMVVPHFGTQAWVKSLNYPIIDDWRQWILQ-GQVAG  443



>gb|KCW68631.1| hypothetical protein EUGRSUZ_F02236 [Eucalyptus grandis]
Length=461

 Score =   383 bits (984),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/425 (45%), Positives = 270/425 (64%), Gaps = 15/425 (4%)
 Frame = -2

Query  1494  VVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFW  1315
             V ++  GS++  +PG  ++GPLPF LETGY+ VGE+EE+Q+FYYF +S+ N   D    W
Sbjct  32    VQLSCCGSRLAFLPG--FEGPLPFHLETGYVAVGESEEIQLFYYFAESERNSKEDALFLW  89

Query  1314  KVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTY  1135
               GGPGCSAL  +I EIGP++  +  Y   +P+  LNP++WTK S+++F+D P   GF+Y
Sbjct  90    LTGGPGCSALSGLIYEIGPLNFNIKAYDRSLPEFVLNPYSWTKASSIIFVDSPVGTGFSY  149

Query  1134  ATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGN  955
             A    A  + + ++ +  ++F+R+W   HPE+++NP Y+GGDS+SGLT+PI+ + I DGN
Sbjct  150   AENPLAYETGDFRQVQHLHQFLRRWLISHPEFISNPVYIGGDSYSGLTLPILVQEIMDGN  209

Query  954   EAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HF  781
             + G  P IN++GY+LGNP +         +  A+GM LI  +LY+SL++ CKG+Y     
Sbjct  210   DEGKSPAINIQGYVLGNPLTDPAFDQNAPVLFAHGMGLISDELYESLKRTCKGHYQFSES  269

Query  780   SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSD---GLRRSLSQRPVL--PPGEF-  619
             S+  C  D+  F Q T G+    ILE  C           G RRSL +   L   P +  
Sbjct  270   SDADCMNDLMAFHQCTSGLQTAQILEPLCGYASMKPGEMFGDRRSLLENFFLVREPTDLD  329

Query  618   --CWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLT  445
               C + + Y  S  W N+  V++ALH+RKG+IG W  CN  ++ YT D++  L YHA L+
Sbjct  330   LGC-RTYGYRLSYSWTNDDNVREALHIRKGSIGDWQRCN-NELNYTNDISSTLQYHAKLS  387

Query  444   TRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTF  265
              RG R+LIYSGDHD+IVP M T+AWI SLNYS +D WR W    G +AG+TR+YSN MTF
Sbjct  388   ARGCRSLIYSGDHDMIVPFMGTQAWIRSLNYSIIDDWRSWMVR-GQVAGYTRTYSNGMTF  446

Query  264   ATLKG  250
             AT+K 
Sbjct  447   ATVKA  451



>ref|NP_198467.2| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
 sp|Q8RWJ6.1|SCP1_ARATH RecName: Full=Serine carboxypeptidase-like 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM13043.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AAM91325.1| serine carboxypeptidase [Arabidopsis thaliana]
 gb|AED94054.1| serine carboxypeptidase-like 1 [Arabidopsis thaliana]
Length=441

 Score =   382 bits (982),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 196/435 (45%), Positives = 272/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++G LPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP I W  GGPG
Sbjct  30    ASIVKSLPG--FEGQLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLILWLTGGPG  87

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CSA+  ++ E GP++M++  Y G +P L    ++WTK S+++F+D P   GF+Y+ T++ 
Sbjct  88    CSAISGLLFENGPLTMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTQQF  147

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW   H  + +NPFYV GDS+SGL VP   + I+ GN     P
Sbjct  148   NKPSDSGEAKRIHEFLQKWLGKHQVFSSNPFYVAGDSYSGLVVPATVQEISKGNYECCNP  207

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYD--HFSNELCA  763
              INL+GY+LGNP +        RIP A+GM LI  +LY+SL+K CKG Y   H  N  C 
Sbjct  208   PINLQGYVLGNPLTDYTTGSNSRIPFAHGMALISDELYESLKKTCKGEYTNVHPRNTQCL  267

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + +F++ T  I    IL+  C              ++ P       C+ ++ YL +  
Sbjct  268   KFVEEFNKCTNRIFQQLILDPLC-------------ETETPD------CY-IYRYLLTTY  307

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++AL + K +IG W  C Y+ I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  308   WANDATVREALQINKESIGEWVRCYYS-IPYNNDIKSSMPYHVNNSISGYRSLIYSGDHD  366

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
               VP + T+AWI SLNYS +D WRPW   +  IAG+TR+Y+N MTFAT+KG GH A    
Sbjct  367   FEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQ-IAGYTRTYANKMTFATIKGGGHTAE-SK  424

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  425   PEEASIMFQRWINGQ  439



>ref|XP_006376415.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|ERP54212.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=428

 Score =   382 bits (981),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 198/435 (46%), Positives = 264/435 (61%), Gaps = 32/435 (7%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             AA  S V ++PG  + GPLPF LETGY+GV E E+VQ+FYYF+KSQ N   DP + W  G
Sbjct  19    AAAHSTVKYLPG--FKGPLPFHLETGYVGVDEAEDVQLFYYFIKSQRNSKDDPLLLWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCSA   +  EIGPI+ E  +Y G +P L        +VS+++F+DLP   GF+YA T
Sbjct  77    GPGCSAFSGLAFEIGPINFEEKEYNGSLPTLMAALLINFQVSSIIFLDLPVSTGFSYART  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A   S+ K+  QA +F+RKW  DH E L+NP Y+ GDS+SG+ VP + + I++GN  G
Sbjct  137   PLALQRSDFKQVSQAEQFLRKWLMDHQELLSNPVYISGDSYSGIIVPAVVQKISNGNNDG  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
             TKPLINLKGY LGNP +        RIP ++GM LI  +LY+SL+K+C G Y      N 
Sbjct  197   TKPLINLKGYTLGNPFTDPTFDLNSRIPFSHGMGLISDELYESLKKSCGGEYQSIDPKNS  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C +++   D+    I  +HILE             R+             C   + +L 
Sbjct  257   ECLENLEARDKCISEIEESHILE-------------RK-------------CPSTYGHLL  290

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             +  WAN+  V+ ALHVR+G+IG W  CNY    YT ++  ++  H +L   G R LIYSG
Sbjct  291   ATYWANDDNVRKALHVREGSIGEWQRCNYKS-PYTHEIKSSVKNHIDLGIEGYRRLIYSG  349

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+ VP + T+AWI SLNYS VD W PW    G +AG+TR+YS+ +TFAT+KG GH AP
Sbjct  350   DHDMEVPFLGTQAWIRSLNYSIVDDWHPW-HFQGQVAGYTRTYSSQLTFATVKGGGHTAP  408

Query  231   FFSAYECLIMFERWI  187
              +   EC  MF+RWI
Sbjct  409   GYRPAECFAMFKRWI  423



>ref|XP_006399444.1| hypothetical protein EUTSA_v10016050mg [Eutrema salsugineum]
 gb|ESQ40897.1| hypothetical protein EUTSA_v10016050mg [Eutrema salsugineum]
Length=470

 Score =   383 bits (984),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 197/467 (42%), Positives = 295/467 (63%), Gaps = 27/467 (6%)
 Frame = -2

Query  1518  LYCSSMVSVVMAARGS-KVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN  1342
             L+ SS++S+      S  V ++PG  +DGPLPF+LETGY+ VGE+E+V++FYYFVKS+ N
Sbjct  9     LFLSSILSIHHLVDASLHVKYLPG--FDGPLPFQLETGYVSVGESEDVELFYYFVKSERN  66

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P TDP + W  GGPGCS++   +   GP+  +  +Y G +P L+L   +WTKV+N+L+++
Sbjct  67    PKTDPLMIWLTGGPGCSSICGFLFANGPLVFKGDEYNGTVPPLELASFSWTKVANILYLE  126

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
              PA +G+++A   +A+ SS+ K++ Q  +F+R WF DHPE+ +NP YVGGDS+SG+ VP 
Sbjct  127   SPAGSGYSFARNLRASESSDTKQTHQIDQFLRSWFVDHPEFTSNPVYVGGDSYSGIIVPG  186

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             + + I+ GNE G  PLIN++GY+LGNP +  +    +++  A+ M LI  +L++SL +NC
Sbjct  187   LAQQISFGNEKGLTPLINIQGYVLGNPVTYPSIESYHQVSFAHRMGLISDELFESLVRNC  246

Query  801   KGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFC-------IRVGTGS---DGLRR  658
              G       SN  C+ D+  + Q    I    IL   C        ++ T     +G RR
Sbjct  247   GGKVFDVDPSNAKCSDDLQSYGQCISKIYVAQILLPNCKVDHVFQSKIPTLPNIINGRRR  306

Query  657   SLSQ-------RPVLPPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTD  499
              L +         + PP  F ++   Y  S  WAN+  V+ AL V+K   G+W  CN  +
Sbjct  307   ELKEFSGNEYSSSLPPPSCFTYK---YFLSGFWANDENVRRALGVKK-EFGKWSRCNTEN  362

Query  498   IGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAA  319
             I YT D+ +A+PYH N + +G R+L+YSGDHD+++P  STEAWI +LNYS VD WRPW  
Sbjct  363   IPYTYDIHNAIPYHVNNSLKGFRSLLYSGDHDMVIPFSSTEAWIRTLNYSIVDDWRPWMM  422

Query  318   HDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
                 +AG+TR+Y+N MTFAT+KG GH A  ++  +  ++F+RWI G+
Sbjct  423   STNQVAGYTRTYANKMTFATIKGGGHSAE-YNPEQSSLLFKRWIDGE  468



>ref|XP_010509542.1| PREDICTED: serine carboxypeptidase-like 9 isoform X1 [Camelina 
sativa]
Length=443

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/441 (43%), Positives = 282/441 (64%), Gaps = 23/441 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS +  +PG  +DGPLPFELETGYIG+GE EE Q+FYYF+KS+ NP  DP + W  G
Sbjct  19    AYSGSIIKFLPG--FDGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L A++ EIGP++++   Y G +P +    ++WTKV+N++F+D P  AGF+Y+ T
Sbjct  77    GPGCSSLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                + +S+  E +  +EF++KW + HP++++NPFY  GDS++G+ VP++   I+ GN   
Sbjct  137   -SLDKTSDTNEVKMIHEFLQKWLSKHPQFISNPFYATGDSYAGMIVPVLVDEISKGNYIC  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
               P INL+GY+LGNP +      +YRIP  +GM+LI  +LY+SL++ CKGNY +    N 
Sbjct  196   CNPPINLQGYVLGNPITHDQVELDYRIPFVHGMSLISDELYQSLKRFCKGNYYNVDPRNT  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFC---IRVGTGSDGLRRSLSQRPVLPPGEFCWQMFW  601
              C + + ++ + T  IN  HIL   C   I      D  +R               Q + 
Sbjct  256   KCLKVVQEYHKCTDKINIHHILFPNCDDTITQNIAPDCFKR------------LIMQYYK  303

Query  600   YLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALI  421
             Y   + WAN  +V+ AL ++KG+   W   N+T I Y  ++  ++PYH N +  G R+LI
Sbjct  304   YYLFERWANKESVRKALQIKKGSKVEWVRYNHT-IPYDRNIISSVPYHMNNSINGYRSLI  362

Query  420   YSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGH  241
             +SGDHD+++P+++T+AWI SLNYS    W+PW  +D  IAG+TR+Y+N MTF+T+KG GH
Sbjct  363   FSGDHDMVLPSIATQAWIKSLNYSITHDWKPWMINDQ-IAGYTRTYANKMTFSTIKGCGH  421

Query  240   IAPFFSAYECLIMFERWISGQ  178
               P +   E  I+F+RWI+GQ
Sbjct  422   -TPEYLPEESSILFKRWINGQ  441



>ref|XP_010556477.1| PREDICTED: serine carboxypeptidase-like 18 [Tarenaya hassleriana]
Length=430

 Score =   382 bits (980),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 194/451 (43%), Positives = 271/451 (60%), Gaps = 47/451 (10%)
 Frame = -2

Query  1497  SVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIF  1318
             +++ A   S +  +PG  ++GPLPFELETGY+GVGE ++ Q+FYYFVKSQTNP  DP + 
Sbjct  14    TILFAVSRSSIKFLPG--FEGPLPFELETGYVGVGEFDDAQLFYYFVKSQTNPKEDPLMI  71

Query  1317  WKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFT  1138
             W  GGP CS+  A+  EIGP++  V +Y G +P L    ++WTK ++++F+D P  +GF+
Sbjct  72    WLTGGPVCSSASALFYEIGPLTFRVEEYNGSLPTLVSTSYSWTKAASIIFVDSPVGSGFS  131

Query  1137  YATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADG  958
             YA    ++ + +  +  Q  +F+RKW  DHPE+L+NPFYVGGDS+SG+ VP +   I  G
Sbjct  132   YARKPSSSRAGDTIQVHQVDQFLRKWLMDHPEFLSNPFYVGGDSYSGIIVPALVHHIHIG  191

Query  957   NEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS  778
             NE G  P INL+GY+LGNPA+  N+    RIP A+GM LI  +LYKS+            
Sbjct  192   NENGVTPPINLQGYVLGNPATDENSDTNSRIPFAHGMGLISDELYKSVS-----------  240

Query  777   NELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSL-----------SQRPVLP  631
                             G+N  HIL   C     GSD  R+ +           +  P L 
Sbjct  241   ----------------GLNTLHILLPDC-----GSDSTRQHIIKFSGGRILGETLNPTLS  279

Query  630   PGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHAN  451
                F   ++ +L S  WAN+  V+ ALHVRK +IG W  CN   + Y+ D+  +  YHA 
Sbjct  280   LPWFGCYLYKFLLSSFWANDENVRRALHVRKASIGLWSRCNTDKVPYSKDIPSSFQYHAI  339

Query  450   LTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNM  271
              + +G R+LIYSGDHD +VP + T+AWI +LNYS ++ WRPW   D  IAG+TR+Y+N M
Sbjct  340   NSAKGFRSLIYSGDHDYVVPFLGTQAWIRALNYSIINDWRPWLI-DNQIAGYTRTYANKM  398

Query  270   TFATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             TFAT+KG  H A  +   E  ++FERWI G+
Sbjct  399   TFATIKGGAHTAD-YKPKESSVLFERWIRGE  428



>emb|CDY08603.1| BnaA05g28390D [Brassica napus]
Length=443

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 282/436 (65%), Gaps = 25/436 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + ++PG  ++GPLPFELETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  28    ASIIKYLPG--FEGPLPFELETGYIGVGEEEQVQLFYYFIKSEGNPEEDPILLWLSGGPG  85

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK-  1120
             CS++  ++ E GP+++++  Y G +P L    ++WTK+S+++++D P   GF+Y+ T+K 
Sbjct  86    CSSISGLLYENGPMTVKLEVYNGTVPSLVSTTYSWTKISSIIYLDQPVGTGFSYSKTQKL  145

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S++ E+++ +EF+ KW N H E+L+NPFYVGGDS++G+ VP + + I+ GN    K
Sbjct  146   ASKPSDLGEAKRIHEFLHKWLNKHQEFLSNPFYVGGDSYAGMVVPALVQEISKGNYVCCK  205

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELC  766
             P INL+GY+LGNP++ +   + +RIP A+GM LI  +LY+S+E+ CKG Y++   SN  C
Sbjct  206   PPINLQGYVLGNPSTEVAFDYNHRIPYAHGMALISDELYESMERICKGEYENVNPSNTEC  265

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
              + + ++ +    IN   IL   C       D L    + R              Y+ + 
Sbjct  266   LKLVEEYHKCVDRINFALILTPLC---EESEDTLPDCYTYR--------------YVLTA  308

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              W N+ +V+ AL + K +  +W  CN+  + YT D+  ++PYH N +  G R+LIY+GDH
Sbjct  309   YWTNDESVRKALQIHKKSKEKWVRCNW-GMPYTHDIKSSVPYHMNNSINGYRSLIYNGDH  367

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MTFAT+K  GH    +
Sbjct  368   DMFVPFLGTQAWIRSLNYSIIDDWRPWMIADQ-IAGYTRTYANKMTFATIKARGHTIE-Y  425

Query  225   SAYECLIMFERWISGQ  178
                E  IMF+RWI+GQ
Sbjct  426   KPEESYIMFQRWINGQ  441



>ref|XP_010464720.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=443

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/435 (44%), Positives = 275/435 (63%), Gaps = 24/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V+ +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  29    ASIVESLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPG  86

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP+++++  Y G +P L    ++WTKVS+++++D P   GF+Y+ T+  
Sbjct  87    CSSISGLLYENGPLTVKLEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLV  146

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E+++ +EF+ KW   H E+L+NPFYV GDS+SG  +P + + I+ G     KP
Sbjct  147   DKPSDSGEAKRIHEFLHKWLGKHQEFLSNPFYVTGDSYSGKVIPALVQEISKGKYLCCKP  206

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       +RIP A+GM LI  +LY+S+++ CKG Y +    N  C 
Sbjct  207   PINLQGYVLGNPLTESEIDINHRIPYAHGMALISDELYESMKRICKGEYINVDPRNTECL  266

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    I   HI+  +C               +    PP  + ++   Y+ +  
Sbjct  267   KLVEEYEKCINRIFEAHIITPYC--------------EENQETPPDSYTYR---YVLTTY  309

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN  +V  ALHV KG+IG W  C+     YT D+  ++PYH N +  G  +LI+SGDHD
Sbjct  310   WANYESVHRALHVNKGSIGEWVRCSKKK-PYTYDIKSSIPYHMNNSIDGYPSLIFSGDHD  368

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L VP ++T+AWI SLNYS +D WRPW   D  I G+TR+Y+N MTFAT+KG GH  P + 
Sbjct  369   LTVPFLATQAWIRSLNYSLIDDWRPWMIGDQ-IGGYTRTYANKMTFATIKGGGH-TPEYK  426

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  427   PEESSIMFQRWISGQ  441



>ref|XP_010486652.1| PREDICTED: serine carboxypeptidase-like 7 isoform X2 [Camelina 
sativa]
Length=440

 Score =   382 bits (980),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/435 (44%), Positives = 274/435 (63%), Gaps = 24/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V+ +PG  +DG LPFELETGYIGVGE EEVQ+FYYF+KS+  P  DP + W  GGPG
Sbjct  26    ASIVEFLPG--FDGRLPFELETGYIGVGEEEEVQLFYYFIKSERIPEEDPILLWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  +  E GP+++++  Y G +P L   P++WTKVS+++++D P   GF+Y+ T++ 
Sbjct  84    CSSISGLFYENGPVTVKLEVYNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQRV  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF+ KW   H E+ +NPFYVGGDS+SG  +P + + I+ GN    KP
Sbjct  144   NKPSDSGEAKRIHEFLHKWLGKHQEFSSNPFYVGGDSYSGKIIPALVQEISKGNYLCCKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       YRIP A+GM LI  +LY+S+++ CKG+Y +    N  C 
Sbjct  204   PINLQGYVLGNPYTESEFERNYRIPYAHGMALISDELYESMKRICKGDYINMDPRNRECL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    INP  I    C      S                  C++ + Y+ +  
Sbjct  264   KLVEEYEKCIARINPLLITTPVCEECEETSPD----------------CYE-YRYMLTTK  306

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN  +V  ALHV KG+IG W  C++  I YT D+  ++PYH N +  G  +LI++GDHD
Sbjct  307   WANYESVHRALHVNKGSIGEWVRCHW-GIPYTRDIKSSIPYHMNNSIDGYPSLIFNGDHD  365

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP + T+AWI SLNYS +D WRPW   D   AG+TR+Y+N MTFAT+KG GH  P + 
Sbjct  366   MAVPFLGTQAWIRSLNYSLIDDWRPWMIGDQ-TAGYTRTYANKMTFATVKGGGH-TPEYK  423

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI GQ
Sbjct  424   PEETYIMFQRWIRGQ  438



>emb|CDY52618.1| BnaCnng22970D [Brassica napus]
Length=439

 Score =   381 bits (979),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/439 (44%), Positives = 278/439 (63%), Gaps = 26/439 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A   S V ++PG Q  GPLPFELETGYIGVGE EE Q+FYYF+KS+ NP  DP + W  G
Sbjct  22    ACSRSTVRYLPGFQ--GPLPFELETGYIGVGEAEEDQLFYYFIKSERNPEEDPLLIWLSG  79

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L  ++ E GP+S  +    G +P L    ++WTKV+N++++D P   GF+Y+  
Sbjct  80    GPGCSSLSGLLFENGPLSFNIESDNGDIPSLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  139

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A++ S+++ ++   EF+  W   HPEY +NPFYV G+S+SG+ VP I + I+  N   
Sbjct  140   PLADIPSDIRSAKLVNEFVHNWLAKHPEYYSNPFYVTGNSYSGIVVPAIVQEISKENGLC  199

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KPL+NL+GY+LGNP +  +N   +RIP A+GM LI  + Y+ L ++C+GN       N 
Sbjct  200   CKPLVNLQGYVLGNPVTDFDNNDNWRIPFAHGMALISDENYQLLRRSCRGNCIIVDPLNT  259

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRP-VLPPGEFCWQMFWYL  595
              C + + +F+    G++ T+IL            GL+   +  P V  P E        +
Sbjct  260   DCLKSVQEFENCVSGLDVTYIL------------GLKYVNASDPYVSNPSEHRMS----V  303

Query  594   RSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYS  415
             +S+ WAN+ +V+ ALHV KG+IG W  C Y +I Y  D+  ++PYH N + +G R+LI+S
Sbjct  304   QSNCWANDESVRRALHVEKGSIGEWLRC-YREIPYKFDIRSSVPYHKNNSIQGYRSLIFS  362

Query  414   GDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIA  235
             GDHD+ VP ++T+ WI SLNYS +D WRPW  H+  +AG+TR+Y+NNMTFAT  G GH  
Sbjct  363   GDHDMYVPFLATQDWIRSLNYSIIDDWRPWMIHNQ-VAGYTRTYANNMTFAT--GGGHTM  419

Query  234   PFFSAYECLIMFERWISGQ  178
               +   EC +MFERWI+GQ
Sbjct  420   -VYKPEECSVMFERWINGQ  437



>ref|XP_006472317.1| PREDICTED: serine carboxypeptidase-like 18-like isoform X3 [Citrus 
sinensis]
Length=463

 Score =   382 bits (982),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/413 (46%), Positives = 266/413 (64%), Gaps = 25/413 (6%)
 Frame = -2

Query  1473  SKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGC  1294
             S V  +PG Q  GPL FELETGY+GVGE+E+ Q+FYYFVKS+ NP  DP + W  GGPGC
Sbjct  25    STVKFLPGFQ--GPLSFELETGYVGVGESEDAQLFYYFVKSEKNPKEDPLLLWLTGGPGC  82

Query  1293  SALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKAN  1114
             SA  A++ EIGPI+  +++Y G +P L LNP++WTK +++LF+D P   GF+Y  T  A+
Sbjct  83    SAFSALVYEIGPINFNILEYNGSLPTLHLNPYSWTKEASILFVDSPVGTGFSYVRTPLAS  142

Query  1113  VSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPL  934
              + + K+  Q  +F+RKW  DHPE+L+N FYVGGDS+SG+TVP + + I++ NE G KPL
Sbjct  143   QTGDFKQVHQVDQFLRKWLMDHPEFLSNTFYVGGDSYSGITVPPLAQQISNENEEGIKPL  202

Query  933   INLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCAQ  760
             INL+GYILGNP +        +IP A+GM LI  +LY+SL+  C G+Y +   SN  C  
Sbjct  203   INLQGYILGNPKTDKIVDKNSQIPFAHGMGLISNELYESLKITCGGDYANIDPSNVDCLN  262

Query  759   DMGKFDQLTRGINPTHILEDFCIRVG---TGSDGLRRSLSQRPVLPPGEFCWQMFWYLRS  589
             D   F +L  G++  HILE  C         S+G RRSL+                  +S
Sbjct  263   DNQAFSELISGLDQNHILEPHCPFFSPKPRDSNGKRRSLNDNE---------------KS  307

Query  588   DLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGD  409
               + +      ++  R G+ G+W  CNY D+ YT ++  +  +H +L+T+G R+LIYSGD
Sbjct  308   QEFLDPEPALPSIGCR-GSKGKWQRCNY-DLPYTQEIGSSFSFHVSLSTKGYRSLIYSGD  365

Query  408   HDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKG  250
             HD++VP + TEAWI SLNYS +D WRPW  H   +AG+TR+YSN MT+AT+K 
Sbjct  366   HDMVVPFLGTEAWIKSLNYSIIDDWRPWILHSQ-VAGYTRTYSNRMTYATVKA  417



>emb|CDX89533.1| BnaC04g35520D [Brassica napus]
Length=472

 Score =   382 bits (982),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 192/429 (45%), Positives = 275/429 (64%), Gaps = 21/429 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS V  +PG  ++GPLPFELETGYIGVG+ E++Q+FYYFVKS+ NP  DP + W  G
Sbjct  19    AESGSIVKFLPG--FEGPLPFELETGYIGVGDKEDLQMFYYFVKSENNPQEDPLLIWLTG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+LFAI+ E GP++++   Y G +P L    ++WTK++N++F+D P  AGF+Y+ T
Sbjct  77    GPGCSSLFAILFENGPLALKFELYNGTLPSLVTTTYSWTKMANIVFLDQPVGAGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                N  S+  E +  +EF++KW + HPE+ +NPFYV GDS+SG  VP + + I+ GN   
Sbjct  137   PLLNKVSDTGEVKVIHEFLQKWLSKHPEFYSNPFYVTGDSYSGKIVPPLVQEISRGNYIC  196

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              +P IN++GYILGNP + + + +  +IP A+GM LI  +LY+SL++ CKGNY++    N 
Sbjct  197   CEPPINIQGYILGNPITQITSENNSKIPYAHGMALISDELYESLKRICKGNYENVGSRNT  256

Query  771   LCAQDMGKFDQLTRGINPTHILEDFC--------------IRVGTGSDGLRRSLSQRPVL  634
              C + +  +++ T  +N  HIL   C                + T    + R++ +   +
Sbjct  257   ECLKHIEIYNKCTDKLNTYHILLPDCDMTSPDCFVSHTSFTLLVTAVKMIGRNIYREMTM  316

Query  633   PPGEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHA  454
                    Q++ Y   + WANN  V+ AL V KG+IG W  CNY  I Y  D+   +PYH 
Sbjct  317   I--YVALQLYNYFLLNKWANNERVRRALQVTKGSIGEWRRCNYDVIPYNYDIQSTVPYHM  374

Query  453   NLTTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNN  274
             N +  G R+LIYSGDHD++VP ++T+AWI SLNYS VD WRPW  +D  IAG+TRSY+N 
Sbjct  375   NNSISGFRSLIYSGDHDMLVPFIATQAWIRSLNYSIVDDWRPWMVNDQ-IAGYTRSYANK  433

Query  273   MTFATLKGS  247
             MT+AT+K S
Sbjct  434   MTYATIKAS  442



>ref|NP_850034.1| sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 sp|Q8RUW5.2|SCP8_ARATH RecName: Full=Serine carboxypeptidase-like 8; AltName: Full=Protein 
SINAPOYLGLUCOSE ACCUMULATOR 1; AltName: Full=Sinapoylglucose--malate 
O-sinapoyltransferase; Short=SMT; AltName: Full=Sinapoylglucose--sinapoylglucose 
O-sinapoyltransferase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF78760.1|AF275313_1 sinapoylglucose:malate sinapoyltransferase [Arabidopsis thaliana]
 gb|AAK59557.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAK93737.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AEC07390.1| serine carboxypeptidase-like 8 [Arabidopsis thaliana]
Length=433

 Score =   381 bits (979),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 278/435 (64%), Gaps = 25/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIG+GE+E VQ FYYF+KS+ NP  DP + W  GGPG
Sbjct  20    ASIVKFLPG--FEGPLPFELETGYIGIGEDENVQFFYYFIKSENNPKEDPLLIWLNGGPG  77

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS L  II E GP+ ++   + G  P L    ++WTK++N++F+D P  +GF+Y+ T   
Sbjct  78    CSCLGGIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKMANIIFLDQPVGSGFSYSKT-PI  136

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + + ++ E ++ +EF++KW + HP+Y +NP YV GDS+SG+ VP + + I+ GN    +P
Sbjct  137   DKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEP  196

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNP + ++    +RIP AYGM LI  ++Y+ +++ C GNY +   SN  C 
Sbjct  197   PINLQGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCL  256

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             +   ++ + T  IN  HIL   C      S                  C+   ++L  + 
Sbjct  257   KLTEEYHKCTAKINIHHILTPDCDVTNVTSPD----------------CYYYPYHL-IEC  299

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V++ALH+ KG+ G+W  CN T I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  300   WANDESVREALHIEKGSKGKWARCNRT-IPYNHDIVSSIPYHMNNSISGYRSLIYSGDHD  358

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP ++T+AWI SLNYS + +WRPW  ++  IAG+TR+YSN MTFAT+KG GH A  + 
Sbjct  359   IAVPFLATQAWIRSLNYSPIHNWRPWMINNQ-IAGYTRAYSNKMTFATIKGGGHTAE-YR  416

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  417   PNETFIMFQRWISGQ  431



>ref|XP_010509543.1| PREDICTED: serine carboxypeptidase-like 9 isoform X2 [Camelina 
sativa]
Length=437

 Score =   381 bits (979),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 188/438 (43%), Positives = 287/438 (66%), Gaps = 23/438 (5%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS +  +PG  +DGPLPFELETGYIG+GE EE Q+FYYF+KS+ NP  DP + W  G
Sbjct  19    AYSGSIIKFLPG--FDGPLPFELETGYIGIGEEEEAQLFYYFIKSENNPKEDPLLLWLNG  76

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+L A++ EIGP++++   Y G +P +    ++WTKV+N++F+D P  AGF+Y+ T
Sbjct  77    GPGCSSLTALLSEIGPVALKSEVYNGSVPSMFSTTYSWTKVANIIFLDQPVGAGFSYSRT  136

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
                + +S+  E +  +EF++KW + HP++++NPFY  GDS++G+ VP++   I+ GN   
Sbjct  137   -SLDKTSDTNEVKMIHEFLQKWLSKHPQFISNPFYATGDSYAGMIVPVLVDEISKGNYIC  195

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
               P INL+GY+LGNP +      +YRIP  +GM+LI  +LY+SL++ CKGNY +    N 
Sbjct  196   CNPPINLQGYVLGNPITHDQVELDYRIPFVHGMSLISDELYQSLKRFCKGNYYNVDPRNT  255

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + + ++ + T  IN  HIL   C       D + ++++      P  F ++ + + R
Sbjct  256   KCLKVVQEYHKCTDKINIHHILFPNC------DDTITQNIA------PDCFYYKYYLFER  303

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
                WAN  +V+ AL ++KG+   W   N+T I Y  ++  ++PYH N +  G R+LI+SG
Sbjct  304   ---WANKESVRKALQIKKGSKVEWVRYNHT-IPYDRNIISSVPYHMNNSINGYRSLIFSG  359

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+++P+++T+AWI SLNYS    W+PW  +D  IAG+TR+Y+N MTF+T+KG GH  P
Sbjct  360   DHDMVLPSIATQAWIKSLNYSITHDWKPWMINDQ-IAGYTRTYANKMTFSTIKGCGH-TP  417

Query  231   FFSAYECLIMFERWISGQ  178
              +   E  I+F+RWI+GQ
Sbjct  418   EYLPEESSILFKRWINGQ  435



>gb|AAC17816.2| putative serine carboxypeptidase I [Arabidopsis thaliana]
 gb|AAM15006.1| putative serine carboxypeptidase I [Arabidopsis thaliana]
Length=433

 Score =   380 bits (977),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 278/435 (64%), Gaps = 25/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIG+GE+E VQ FYYF+KS+ NP  DP + W  GGPG
Sbjct  20    ASIVKFLPG--FEGPLPFELETGYIGIGEDENVQFFYYFIKSENNPKEDPLLIWLNGGPG  77

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS L  II E GP+ ++   + G  P L    ++WTK++N++F+D P  +GF+Y+ T   
Sbjct  78    CSCLGGIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKMANIIFLDQPVGSGFSYSKT-PI  136

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             + + ++ E ++ +EF++KW + HP+Y +NP YV GDS+SG+ VP + + I+ GN    +P
Sbjct  137   DKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYVVGDSYSGMIVPALVQEISQGNYICCEP  196

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELCA  763
              INL+GY+LGNP + ++    +RIP AYGM LI  ++Y+ +++ C GNY +   SN  C 
Sbjct  197   PINLQGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRICNGNYYNVDPSNTQCL  256

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             +   ++ + T  IN  HIL   C      S                  C+   ++L  + 
Sbjct  257   KLTEEYHKCTAKINIHHILTPDCDVTNVTSPD----------------CYYYPYHL-IEC  299

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ +V++ALH+ KG+ G+W  CN T I Y  D+  ++PYH N +  G R+LIYSGDHD
Sbjct  300   WANDESVREALHIEKGSKGKWARCNRT-IPYNHDIVSSIPYHMNNSISGYRSLIYSGDHD  358

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP ++T+AWI SLNYS + +WRPW  ++  IAG+TR+YSN MTFAT+K SGH A  + 
Sbjct  359   IAVPFLATQAWIRSLNYSPIHNWRPWMINNQ-IAGYTRAYSNKMTFATIKASGHTAE-YR  416

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  417   PNETFIMFQRWISGQ  431



>ref|XP_002878650.1| hypothetical protein ARALYDRAFT_481168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54909.1| hypothetical protein ARALYDRAFT_481168 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   380 bits (977),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 194/450 (43%), Positives = 283/450 (63%), Gaps = 36/450 (8%)
 Frame = -2

Query  1521  QLYCSSMVSVVMAARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTN  1342
              +YC+S+V             +PG  ++GPLPFELETGYIG+GE+E VQ FYYF+KS+ N
Sbjct  18    HVYCASIVKF-----------LPG--FEGPLPFELETGYIGIGEDENVQFFYYFIKSENN  64

Query  1341  PTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFID  1162
             P  DP + W  GGPGCS L  I+ E GP+ ++   Y G  P L    ++WTK++N++F+D
Sbjct  65    PKEDPLLIWLNGGPGCSCLGGILFENGPVGLKFEVYNGSAPSLFSTTYSWTKMANIIFLD  124

Query  1161  LPARAGFTYATTKKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPI  982
              P  +GF+Y+ T   + + ++ E ++ +EF++KW   HP+Y  NPFYV GDS+SG+ VP 
Sbjct  125   QPVGSGFSYSKT-PIDKTGDISEVKRTHEFLQKWLRRHPQYFINPFYVVGDSYSGMIVPA  183

Query  981   ITKMIADGNEAGTKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNC  802
             + + I+ GN    +P INL+GY+LGNP + ++    +RI  AYGM LI  ++Y+ ++++C
Sbjct  184   LVQEISQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRILYAYGMGLISDEIYEPMKRSC  243

Query  801   KGNYDHF--SNELCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPP  628
              GNY +   SN  C +   ++ + T  IN  HIL   C      S               
Sbjct  244   NGNYYNVDPSNTKCLKLTEEYHKCTDKINIHHILTPDCDVTNVTSPD-------------  290

Query  627   GEFCWQMFWYLRSDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANL  448
                C+   ++L  + WAN+ +V++AL ++KG+ G+W  CN T I Y  D+  ++PYH N 
Sbjct  291   ---CYYYPYHL-IECWANDESVREALQIKKGSKGKWARCNRT-IPYNHDIESSIPYHMNN  345

Query  447   TTRGLRALIYSGDHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMT  268
             + RG R+LIYSGDHD+ VP ++T+AWI SLNYS + +WRPW  ++  IAG+TR+YSN MT
Sbjct  346   SIRGYRSLIYSGDHDIAVPFLATQAWIRSLNYSPIHNWRPWMINNQ-IAGYTRAYSNKMT  404

Query  267   FATLKGSGHIAPFFSAYECLIMFERWISGQ  178
             FAT+KG GH A  +   E  IMF+RWISGQ
Sbjct  405   FATIKGGGHTAE-YRPNETFIMFQRWISGQ  433



>ref|XP_009146838.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Brassica 
rapa]
Length=443

 Score =   381 bits (978),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 187/436 (43%), Positives = 282/436 (65%), Gaps = 25/436 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S + ++PG  ++GPLPFELETGYIGVGE E+VQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  28    ASIIKYLPG--FEGPLPFELETGYIGVGEEEQVQLFYYFIKSEGNPEEDPILLWLSGGPG  85

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKK-  1120
             CS++  ++ E GP+++++  Y G +P L    ++W K+S+++++D P   GF+Y+ T+K 
Sbjct  86    CSSISGLLYENGPMTVKLEVYNGTVPSLVSTTYSWAKISSIIYLDQPVGTGFSYSKTQKL  145

Query  1119  ANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTK  940
             A+  S++ E+++ +EF+ KW N H ++L+NPFYVGGDS++G+ VP + + I+ GN    K
Sbjct  146   ASKPSDLGEAKRIHEFLHKWLNKHQDFLSNPFYVGGDSYAGMVVPALVQEISKGNYVCCK  205

Query  939   PLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHF--SNELC  766
             P INL+GY+LGNP++ +   + +RIP A+GM LI  +LY+S+E+ CKG Y++   SN  C
Sbjct  206   PPINLQGYVLGNPSTEVAFDYNHRIPYAHGMALISDELYESMERICKGEYENVNPSNTEC  265

Query  765   AQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSD  586
              + + ++ +    IN   IL   C       D L    + R              Y+ + 
Sbjct  266   LKLVEEYHKCVDRINFALILTPLC---EESEDTLPDCYTYR--------------YVLTA  308

Query  585   LWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDH  406
              W N+ +V+ AL + K +  +W  CN+  + YT D+  ++PYH N +  G R+LIY+GDH
Sbjct  309   YWTNDESVRKALQIHKKSKEKWVRCNW-GMPYTHDIKSSVPYHMNNSINGYRSLIYNGDH  367

Query  405   DLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFF  226
             D+ VP + T+AWI SLNYS +D WRPW   D  IAG+TR+Y+N MTFAT+KG GH    +
Sbjct  368   DMFVPFLGTQAWIRSLNYSIIDDWRPWMIADQ-IAGYTRTYANKMTFATIKGGGHTIE-Y  425

Query  225   SAYECLIMFERWISGQ  178
                E  IMF+RWI+GQ
Sbjct  426   KPEESYIMFQRWINGQ  441



>gb|KHN47358.1| ABC transporter B family member 9 [Glycine soja]
Length=1648

 Score =   407 bits (1046),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 197/423 (47%), Positives = 276/423 (65%), Gaps = 14/423 (3%)
 Frame = -2

Query  1419  LETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPGCSALFAIIQEIGPISMEVV  1240
             L T Y+GVGE+E+VQ FYYF++S+ NP  DP + W  GGPGCSAL  ++ EIGP++ +  
Sbjct  1229  LHTKYVGVGESEDVQAFYYFIESENNPKKDPLMLWLTGGPGCSALSGLVFEIGPLTFKYE  1288

Query  1239  KYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKANVSSNMKESEQAYEFMRKW  1060
             +Y G +P L L PH+WTKVS+++F+DLP   GFTYATT+ A   S+     Q ++F+RKW
Sbjct  1289  EYNGSLPNLVLRPHSWTKVSSIIFVDLPVSTGFTYATTEFAAQRSDWILVHQVHQFLRKW  1348

Query  1059  FNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKPLINLKGYILGNPASSLNNV  880
               DHP + +N  Y+GGDS+SG+ +P+I + I+ GNE G +P INL+GY+LGN A++    
Sbjct  1349  LIDHPNFSSNEVYIGGDSYSGIPIPVIVQEISRGNEKGLQPWINLQGYLLGNAATTRRE-  1407

Query  879   HEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCAQDMGKFDQLTRGINPTHIL  706
               Y+IP A+GM LI  +LY SL+KNCK  Y +    N LC++D+  F+++T G+N  HIL
Sbjct  1408  KNYQIPFAHGMGLISDELYGSLQKNCKEEYINVDTRNVLCSRDIESFNEVTSGLNSAHIL  1467

Query  705   EDFCIRVGTGSDGLRRSLSQRPV-------LPPGEFCWQMFWYLRSDLWANNVAVQDALH  547
             +  C  + T +   R  L + P        L       + + Y     WAN+  V+ ALH
Sbjct  1468  DPSCEWLDTETSWRRSLLKKYPRKNFLNTHLKLAPLNCRSYVYFLCGYWANDDNVRTALH  1527

Query  546   VRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHDLIVPTMSTEAWI  367
             +RKG+IG+W  C + DI    D++ +  YH NL+ +G R+LIYSGDHD+ +P ++T+AWI
Sbjct  1528  IRKGSIGKWHRCTF-DIPNKKDISSSYEYHVNLSRKGYRSLIYSGDHDMTIPFLATQAWI  1586

Query  366   TSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFSAYECLIMFERWI  187
              SLNYS VD WR W   +G +AG+TR+YSN MTFAT  G GH AP +   EC  MF RWI
Sbjct  1587  RSLNYSIVDEWRQWHT-NGQVAGYTRTYSNRMTFAT--GGGHTAPEYKPDECFAMFSRWI  1643

Query  186   SGQ  178
             S +
Sbjct  1644  SNR  1646



>ref|NP_177470.4| serine carboxypeptidase-like 6 [Arabidopsis thaliana]
 sp|Q9CAU0.2|SCP6_ARATH RecName: Full=Serine carboxypeptidase-like 6; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE35436.1| serine carboxypeptidase-like 6 [Arabidopsis thaliana]
Length=452

 Score =   381 bits (978),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 271/435 (62%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  30    ASVVKSLPG--FEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPG  87

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CSA+  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P   GF+Y+ T+  
Sbjct  88    CSAISGLLYENGPLTMKLDVYNGTLPSLVSTTYSWTKNSSMIFLDQPVGTGFSYSRTELF  147

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW   H E+ +NPFYVGGDS+SG+TVP   + I+ GN    KP
Sbjct  148   NKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGITVPATVQEISKGNYQCCKP  207

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +        +IP A+GM LI  +LY+SL++ CKG Y+H    N  C 
Sbjct  208   PINLQGYMLGNPITDSKIDGNSQIPYAHGMALISDELYESLKRICKGEYEHVDPYNTECL  267

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + +F++ T  +  +HIL   C          R SLS                      
Sbjct  268   KLLEEFNECTSKLYRSHILYPLCEMTNPDCYIYRYSLSH--------------------Y  307

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             W N+  V+ AL + K +I  W  C+++   YT D+  ++PYH N +  G R+LI+SGDHD
Sbjct  308   WVNDETVRKALQINKESIREWKRCDWSK-PYTKDIISSVPYHMNNSINGYRSLIFSGDHD  366

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
               VP + T+ WI SLNY+ VD WRPW  ++  +AG+TR+Y+N MTFAT+KG GH A  + 
Sbjct  367   FEVPLIGTQVWIKSLNYAIVDKWRPWMINNQ-VAGYTRTYANKMTFATVKGGGHTAE-YK  424

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  425   PDETFIMFQRWINGQ  439



>ref|XP_010464717.1| PREDICTED: serine carboxypeptidase-like 7 isoform X1 [Camelina 
sativa]
Length=440

 Score =   380 bits (977),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 194/435 (45%), Positives = 274/435 (63%), Gaps = 24/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V+ +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP   P + W  GGPG
Sbjct  26    ASIVEFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEVPLLLWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  +  E GP+++++    G +P L   P++WTKVS+++++D P   GF+Y+ T+  
Sbjct  84    CSSISGLFYENGPVTVKLEVNNGTIPSLVSTPYSWTKVSSIIYLDQPVGTGFSYSRTQLV  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF+ KW   H E+ +N FYVGGDS+SG  VP + + I+ GN    KP
Sbjct  144   NKPSDSGEAKRIHEFLHKWLGKHQEFSSNSFYVGGDSYSGKVVPALVQEISKGNYLCCKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GYILGNP +       YRIP A+GM +I  +LY+S++  CKG+Y +    N  C 
Sbjct  204   PINLQGYILGNPYTESEFEKNYRIPYAHGMAMISDELYESMKIICKGDYINVDPRNRECL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    INP  I    C            S    P       C++ + Y+ +  
Sbjct  264   KLVEEYEKCIARINPLLITTPVC----------EESQETSPN------CYE-YRYMLTTY  306

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN  +V  ALHV KG+IG W  C++  I YT D+  ++PYH N +  G  +LI+SGDHD
Sbjct  307   WANYQSVHRALHVNKGSIGEWVRCHW-GIPYTHDIKSSIPYHMNNSIDGYPSLIFSGDHD  365

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             ++VP + T+AWI SLNYS +D WRPW   D   AG+TR+Y+N MTFAT+KG GH  P + 
Sbjct  366   MVVPFLGTQAWIRSLNYSLIDDWRPWMIGDQ-TAGYTRTYANKMTFATIKGGGH-TPEYK  423

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  424   PEETSIMFQRWISGQ  438



>ref|XP_010484310.1| PREDICTED: serine carboxypeptidase-like 7 [Camelina sativa]
Length=440

 Score =   380 bits (976),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/435 (44%), Positives = 275/435 (63%), Gaps = 24/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  +DGPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  26    ASIVKFLPG--FDGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLSGGPG  83

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP+++++  Y G +P L    ++WTKVS+++++D P   GF+Y+ T+  
Sbjct  84    CSSISGLLYENGPLTVKLEVYNGTLPSLVSTTYSWTKVSSIIYLDQPVGTGFSYSRTQLV  143

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             +  S+  E+++ +EF+ KW   H E+L+NPFYV GDS+SG  +P + + I+ GN    KP
Sbjct  144   DKPSDSGEAKRIHEFLHKWLGKHQEFLSNPFYVTGDSYSGKVIPALVQEISKGNYFCCKP  203

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       +RIP A+GM LI  +LY+S+++ CKG Y +    N  C 
Sbjct  204   PINLQGYVLGNPLTESEIDWNHRIPYAHGMALISDELYESMKRICKGEYINVDPRNTECL  263

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    I  +HI+   C               +    PP  + ++   YL +  
Sbjct  264   KLVKEYEKCIDRIFESHIISPDC--------------DENQETPPDCYTYR---YLLTTY  306

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN  +V  ALHV KG+IG W  C+     YT D+  ++PYH N +  G  +LI+SGDHD
Sbjct  307   WANYESVHRALHVNKGSIGEWVRCSQKK-PYTYDIKSSVPYHMNNSIDGYPSLIFSGDHD  365

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             L+VP + T+AWI SLNYS  D WRPW   D  IAG+TR+Y+N MTFAT+KG GH  P + 
Sbjct  366   LMVPFLGTQAWIRSLNYSLTDDWRPWMIGDQ-IAGYTRTYANKMTFATIKGGGH-TPEYR  423

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWISGQ
Sbjct  424   PEETSIMFQRWISGQ  438



>gb|AAG52139.1|AC010556_21 putative serine carboxypeptidase; 15190-18301 [Arabidopsis thaliana]
Length=441

 Score =   380 bits (976),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 192/435 (44%), Positives = 271/435 (62%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIGVGE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  30    ASVVKSLPG--FEGPLPFELETGYIGVGEEEEVQLFYYFIKSERNPKEDPLLLWLTGGPG  87

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CSA+  ++ E GP++M++  Y G +P L    ++WTK S+M+F+D P   GF+Y+ T+  
Sbjct  88    CSAISGLLYENGPLTMKLDVYNGTLPSLVSTTYSWTKNSSMIFLDQPVGTGFSYSRTELF  147

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW   H E+ +NPFYVGGDS+SG+TVP   + I+ GN    KP
Sbjct  148   NKPSDTGEAKRIHEFLQKWLGKHQEFSSNPFYVGGDSYSGITVPATVQEISKGNYQCCKP  207

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +        +IP A+GM LI  +LY+SL++ CKG Y+H    N  C 
Sbjct  208   PINLQGYMLGNPITDSKIDGNSQIPYAHGMALISDELYESLKRICKGEYEHVDPYNTECL  267

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + +F++ T  +  +HIL   C          R SLS                      
Sbjct  268   KLLEEFNECTSKLYRSHILYPLCEMTNPDCYIYRYSLSH--------------------Y  307

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             W N+  V+ AL + K +I  W  C+++   YT D+  ++PYH N +  G R+LI+SGDHD
Sbjct  308   WVNDETVRKALQINKESIREWKRCDWSK-PYTKDIISSVPYHMNNSINGYRSLIFSGDHD  366

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
               VP + T+ WI SLNY+ VD WRPW  ++  +AG+TR+Y+N MTFAT+KG GH A  + 
Sbjct  367   FEVPLIGTQVWIKSLNYAIVDKWRPWMINNQ-VAGYTRTYANKMTFATVKGGGHTAE-YK  424

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  425   PDETFIMFQRWINGQ  439



>ref|XP_010428244.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428245.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428246.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
 ref|XP_010428247.1| PREDICTED: serine carboxypeptidase-like 2 isoform X1 [Camelina 
sativa]
Length=442

 Score =   380 bits (976),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 189/435 (43%), Positives = 276/435 (63%), Gaps = 27/435 (6%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
              S V  +PG  ++GPLPFELETGYIG+GE EEVQ+FYYF+KS+ NP  DP + W  GGPG
Sbjct  31    ASIVKFLPG--FEGPLPFELETGYIGIGEEEEVQLFYYFIKSERNPEEDPLLLWLSGGPG  88

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS++  ++ E GP+ M++  Y G +P L    ++WTK S+++F+D P   GF+Y+ T ++
Sbjct  89    CSSISGLLYENGPLKMKLDVYNGTLPSLVSTTYSWTKTSSIIFLDQPVGTGFSYSRTTQS  148

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
             N  S+  E+++ +EF++KW   H E+ +NPFYV GDS+SG+ VP   + I+ GN     P
Sbjct  149   NKPSDSGEAKRIHEFLQKWLGKHQEFSSNPFYVTGDSYSGMVVPATVQEISKGNYQCCNP  208

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +       +RIP A+GM LI  +LY+SL++ CKG+Y H    N  C 
Sbjct  209   PINLQGYVLGNPLTDFATDTNHRIPFAHGMALISDELYESLKRVCKGDYGHVDPRNTECL  268

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++++    +  + IL   C              ++ P       C+ ++ Y  +  
Sbjct  269   KLIEEYNKCISRLYRSFILFPLC-------------ETETPN------CY-IYRYFLTTH  308

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+ AV++AL + K +IG W  C Y  + YT D+  ++PYH N +  G R+LI+SGDHD
Sbjct  309   WANDAAVREALQINKESIGEWVRC-YFGMPYTNDIKSSIPYHMNNSISGYRSLIFSGDHD  367

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + VP ++T+AWI SLNYS +D WRPW   D  I G+TR+Y+N MTFAT+KG GH A  + 
Sbjct  368   MEVPFLATQAWIRSLNYSVIDEWRPWMIKDQ-IGGYTRTYANKMTFATVKGGGHTAE-YK  425

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  426   PDETFIMFQRWINGQ  440



>ref|XP_010429240.1| PREDICTED: serine carboxypeptidase-like 10 isoform X2 [Camelina 
sativa]
Length=422

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/435 (45%), Positives = 281/435 (65%), Gaps = 36/435 (8%)
 Frame = -2

Query  1476  GSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVGGPG  1297
             G+ V  +PG  ++GPLPFELETGYIG+GE E++QVFYYF+KS+ NP  DP + W  GGPG
Sbjct  20    GTIVKFLPG--FEGPLPFELETGYIGIGEEEDMQVFYYFIKSEKNPKEDPLLLWLDGGPG  77

Query  1296  CSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATTKKA  1117
             CS+L  ++ E GP++++   Y G  P L    ++WTK++N++++D P  AGF+Y+ T   
Sbjct  78    CSSLGGLLFENGPLALKSEVYNGITPSLVSTTYSWTKMANIIYLDQPVGAGFSYSRTPIG  137

Query  1116  NVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAGTKP  937
               S  + E ++ ++F++KW + HP++++N FYV GDS+S             GN    KP
Sbjct  138   KTSDTI-EVKRIHDFLQKWLSKHPQFISNSFYVTGDSYS-------------GNYICCKP  183

Query  936   LINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NELCA  763
              INL+GY+LGNP +   +   YRIP AYGM+LI  +LY+S+++ CKGNY++    +  C 
Sbjct  184   PINLQGYVLGNPITYAEHEKNYRIPFAYGMSLISDELYESMKRTCKGNYENVDPRDTKCL  243

Query  762   QDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLRSDL  583
             + + ++ + T  IN  HIL   C + G G            + PP   C+   ++L  + 
Sbjct  244   KLVEEYHKCTDKINTQHILLPDCDKKGKG------------ITPPD--CYYYLYFL-IEC  288

Query  582   WANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSGDHD  403
             WAN+  V++ALHV KGT G+W  CN+T I Y  D+  ++PYHAN + RG R+LIYSGDHD
Sbjct  289   WANDERVREALHVSKGTKGQWDRCNWT-IPYDNDIISSVPYHANNSFRGYRSLIYSGDHD  347

Query  402   LIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAPFFS  223
             + +P  +T+AWI SLNYS VD WRPW  +   IAG+TR+YSN MTFAT+KG GH A +  
Sbjct  348   ITMPFQATQAWIKSLNYSIVDDWRPWMINHQ-IAGYTRTYSNKMTFATVKGGGHTAEYLP  406

Query  222   AYECLIMFERWISGQ  178
               E  IMF+RWI+GQ
Sbjct  407   N-ETSIMFQRWITGQ  420



>ref|XP_006299183.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
 gb|EOA32081.1| hypothetical protein CARUB_v10015328mg [Capsella rubella]
Length=435

 Score =   380 bits (975),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 188/438 (43%), Positives = 277/438 (63%), Gaps = 27/438 (6%)
 Frame = -2

Query  1485  AARGSKVDHIPGLQYDGPLPFELETGYIGVGENEEVQVFYYFVKSQTNPTTDPFIFWKVG  1306
             A  GS +  +PG  ++GPLPFELETGYIGVGE EE Q+FYYFVKS++NP  DP + W  G
Sbjct  21    AYSGSIIRSLPG--FEGPLPFELETGYIGVGEAEEDQMFYYFVKSESNPIEDPLLVWLTG  78

Query  1305  GPGCSALFAIIQEIGPISMEVVKYTGGMPKLKLNPHTWTKVSNMLFIDLPARAGFTYATT  1126
             GPGCS+   ++ E GP++ +V  Y G +P L    ++WTKV+N++++D P   GF+Y+  
Sbjct  79    GPGCSSFSGLVYENGPLAFKVETYNGSVPTLVSTTYSWTKVANIIYLDQPVGTGFSYSRN  138

Query  1125  KKANVSSNMKESEQAYEFMRKWFNDHPEYLTNPFYVGGDSFSGLTVPIITKMIADGNEAG  946
               A++ S+   +++  EF+R W   HPEY +NPFYV G+S+SG  +P I + I++GN   
Sbjct  139   PLADIPSDTGSAKRVNEFLRNWLAKHPEYFSNPFYVAGNSYSGKVIPAIVQEISNGNYIC  198

Query  945   TKPLINLKGYILGNPASSLNNVHEYRIPAAYGMNLIPTDLYKSLEKNCKGNYDHFS--NE  772
              KP INL+GY++GNP +  ++  + RIP A+GM LI  +L++SL+++C GNY+     N 
Sbjct  199   CKPQINLQGYVIGNPVTYYDHDKDSRIPFAHGMGLISDELFESLKRSCGGNYNTVDPLNT  258

Query  771   LCAQDMGKFDQLTRGINPTHILEDFCIRVGTGSDGLRRSLSQRPVLPPGEFCWQMFWYLR  592
              C + +  + +   GI    ++   C    T  D                 C+  + YL 
Sbjct  259   ECLKLVEDYHKCVSGIYEELVIAPKCET--TSPD-----------------CY-TYRYLL  298

Query  591   SDLWANNVAVQDALHVRKGTIGRWCACNYTDIGYTADMTDALPYHANLTTRGLRALIYSG  412
             S+ WANN +V+ AL V KG+ G+W  C+Y  +    D+  ++PYH N + +G R+L+ SG
Sbjct  299   SNYWANNKSVRRALKVVKGSKGKWERCDYA-VHCKKDIISSIPYHMNNSIKGYRSLVISG  357

Query  411   DHDLIVPTMSTEAWITSLNYSTVDSWRPWAAHDGIIAGFTRSYSNNMTFATLKGSGHIAP  232
             DHD+ +P + T+AWI+SLNYS +D WRPW   D  +AG+T++Y+N MTFAT+KG GH   
Sbjct  358   DHDMTIPFVGTQAWISSLNYSVIDKWRPWMVLDQ-VAGYTKTYANKMTFATVKGGGHTLE  416

Query  231   FFSAYECLIMFERWISGQ  178
              +   EC IMF+RWISGQ
Sbjct  417   -YKPEECSIMFKRWISGQ  433



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4732378313600