BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81368_g1_i1 len=1220 path=[1198:0-1219]

Length=1220
                                                                      Score     E

gb|AHL24653.1|  Fra e 11.01 allergen                                    421   6e-142   
ref|XP_009626579.1|  PREDICTED: pectinesterase 1-like                   418   1e-140   
ref|XP_009789874.1|  PREDICTED: pectinesterase 1-like                   416   7e-140   
ref|XP_004239982.1|  PREDICTED: pectinesterase 1-like                   415   2e-139   
emb|CDP13860.1|  unnamed protein product                                414   3e-139   
ref|XP_006365351.1|  PREDICTED: pectinesterase 2-like                   411   8e-138   
ref|XP_006365350.1|  PREDICTED: pectinesterase 2-like                   404   3e-135   
ref|XP_004513231.1|  PREDICTED: pectinesterase 1-like                   399   5e-133   
sp|D8VPP5.1|AL11A_OLEEU  RecName: Full=Pectinesterase 1; AltName:...    396   3e-132   
sp|B2VPR8.1|AL11B_OLEEU  RecName: Full=Pectinesterase 2; AltName:...    396   5e-132   Olea europaea
ref|XP_011076543.1|  PREDICTED: pectinesterase 1-like                   395   1e-131   
ref|XP_004239981.2|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    390   5e-130   
ref|XP_011076542.1|  PREDICTED: pectinesterase 1-like                   390   1e-129   
ref|XP_010038407.1|  PREDICTED: putative pectinesterase 63              382   2e-126   
ref|XP_007218171.1|  hypothetical protein PRUPE_ppa007533mg             381   2e-126   
ref|XP_009362793.1|  PREDICTED: putative pectinesterase 63              379   1e-125   
gb|AAX11262.1|  pectin methylesterase allergenic protein                377   5e-125   Kali turgidum [common saltwort]
gb|KEH30561.1|  pectinesterase-like protein                             377   8e-125   
ref|XP_009136508.1|  PREDICTED: putative pectinesterase 63 isofor...    377   2e-124   
ref|XP_008234142.1|  PREDICTED: putative pectinesterase 63              376   3e-124   
ref|XP_007222175.1|  hypothetical protein PRUPE_ppa007766mg             375   4e-124   
ref|XP_011014352.1|  PREDICTED: pectinesterase PPME1-like               375   8e-124   
ref|XP_008338559.1|  PREDICTED: putative pectinesterase 63              375   1e-123   
ref|XP_004516439.1|  PREDICTED: pectinesterase PPME1-like               374   1e-123   
ref|XP_007038213.1|  Pectinesterase, putative isoform 1                 374   2e-123   
gb|ACO34813.1|  Sal k 1 pollen allergen                                 373   2e-123   Kali turgidum [common saltwort]
ref|XP_011076539.1|  PREDICTED: pectinesterase 1-like                   382   2e-123   
gb|KHN29928.1|  Pectinesterase PPME1-like protein                       374   2e-123   
ref|XP_007215602.1|  hypothetical protein PRUPE_ppa007761mg             373   2e-123   
ref|XP_008219199.1|  PREDICTED: pectinesterase PPME1-like               374   3e-123   
ref|XP_008234143.1|  PREDICTED: putative pectinesterase 63              373   4e-123   
ref|XP_004287800.1|  PREDICTED: probable pectinesterase 48-like         373   6e-123   
ref|XP_002318197.1|  hypothetical protein POPTR_0012s12720g             372   9e-123   Populus trichocarpa [western balsam poplar]
ref|XP_002318199.2|  hypothetical protein POPTR_0012s11460g             372   1e-122   Populus trichocarpa [western balsam poplar]
ref|XP_009363888.1|  PREDICTED: putative pectinesterase 63              372   1e-122   
ref|XP_003518804.1|  PREDICTED: pectinesterase PPME1                    371   2e-122   
ref|XP_009122341.1|  PREDICTED: pectinesterase PPME1                    371   3e-122   
gb|KEH17536.1|  pectinesterase-like protein                             371   3e-122   
emb|CDX70037.1|  BnaA10g23860D                                          370   4e-122   
ref|XP_010423212.1|  PREDICTED: pectinesterase PPME1-like               370   4e-122   
ref|XP_002511045.1|  Pectinesterase-1 precursor, putative               370   4e-122   Ricinus communis
ref|XP_006394480.1|  hypothetical protein EUTSA_v10004453mg             370   5e-122   
emb|CDP19851.1|  unnamed protein product                                367   1e-121   
ref|XP_010452707.1|  PREDICTED: pectinesterase PPME1                    369   2e-121   
emb|CDX98975.1|  BnaC09g48600D                                          369   2e-121   
gb|KDP22496.1|  hypothetical protein JCGZ_26327                         378   2e-121   
gb|AAX11261.1|  pectin methylesterase allergenic protein                367   2e-121   Kali turgidum [common saltwort]
gb|AAT99258.1|  pectin-methyltransferase precursor                      368   3e-121   
ref|XP_008244214.1|  PREDICTED: putative pectinesterase 63              368   4e-121   
ref|XP_010087095.1|  Pectinesterase PPME1                               368   5e-121   
ref|XP_010491358.1|  PREDICTED: pectinesterase PPME1-like               367   5e-121   
gb|KHG24685.1|  Pectinesterase PPME1 -like protein                      367   8e-121   
ref|NP_177152.2|  pectinesterase PPME1                                  367   8e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010457627.1|  PREDICTED: putative pectinesterase 63              367   9e-121   
ref|XP_009363892.1|  PREDICTED: probable pectinesterase 48              366   1e-120   
gb|ADH82125.1|  pectinesterase                                          366   2e-120   
emb|CDY23044.1|  BnaC07g31430D                                          369   2e-120   
gb|KEH38558.1|  pectinesterase-like protein                             366   2e-120   
dbj|BAB09012.1|  pectin methylesterase-like protein                     366   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871269.1|  ATPPME1                                            365   3e-120   
emb|CDY14046.1|  BnaC02g01630D                                          365   4e-120   
ref|XP_009125688.1|  PREDICTED: pectinesterase PPME1-like               365   4e-120   
ref|XP_006289810.1|  hypothetical protein CARUB_v10003415mg             363   3e-119   
ref|XP_010666416.1|  PREDICTED: pectinesterase 2-like                   363   3e-119   
ref|XP_010667524.1|  PREDICTED: pectinesterase 2-like                   363   4e-119   
ref|XP_006572809.1|  PREDICTED: uncharacterized protein LOC100306...    362   1e-118   
ref|XP_003516497.1|  PREDICTED: pectinesterase PPME1                    361   2e-118   
ref|XP_003517889.1|  PREDICTED: pectinesterase PPME1-like               361   2e-118   
ref|XP_006381893.1|  hypothetical protein POPTR_0006s20010g             361   2e-118   
ref|XP_003517875.1|  PREDICTED: pectinesterase PPME1                    361   2e-118   
ref|XP_010666417.1|  PREDICTED: putative pectinesterase 63              360   3e-118   
ref|XP_011033438.1|  PREDICTED: pectinesterase PPME1-like               361   4e-118   
ref|XP_002309337.2|  hypothetical protein POPTR_0006s20000g             360   5e-118   Populus trichocarpa [western balsam poplar]
ref|XP_011040323.1|  PREDICTED: pectinesterase PPME1-like               359   9e-118   
ref|XP_010546425.1|  PREDICTED: pectinesterase PPME1-like               359   9e-118   
gb|KFK25126.1|  hypothetical protein AALP_AA8G069500                    359   1e-117   
ref|XP_002511044.1|  Pectinesterase-3 precursor, putative               359   2e-117   Ricinus communis
ref|XP_003634032.1|  PREDICTED: putative pectinesterase 63              358   2e-117   
ref|XP_008234141.1|  PREDICTED: putative pectinesterase 63              358   2e-117   
ref|NP_568181.1|  putative pectinesterase 48                            358   3e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321778.1|  hypothetical protein POPTR_0015s12220g             357   6e-117   Populus trichocarpa [western balsam poplar]
gb|KDP39968.1|  hypothetical protein JCGZ_03499                         356   1e-116   
gb|KFK27921.1|  hypothetical protein AALP_AA8G447400                    356   2e-116   
ref|XP_002511043.1|  Pectinesterase-1 precursor, putative               356   2e-116   Ricinus communis
gb|AAG52566.1|AC010675_14  putative pectin methylesterase; 8433-9798    355   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207766.1|  hypothetical protein PRUPE_ppa026550mg             355   6e-116   
ref|XP_007206641.1|  hypothetical protein PRUPE_ppa021246mg             355   7e-116   
ref|XP_002530224.1|  Pectinesterase U1 precursor, putative              354   1e-115   Ricinus communis
ref|XP_010546117.1|  PREDICTED: pectinesterase PPME1-like isoform X2    353   1e-115   
ref|XP_010523318.1|  PREDICTED: pectinesterase PPME1-like               354   1e-115   
ref|XP_010666418.1|  PREDICTED: pectinesterase 1-like                   353   1e-115   
ref|XP_010546116.1|  PREDICTED: pectinesterase PPME1-like isoform X1    353   2e-115   
gb|AAM65347.1|  pectin methyl-esterase-like protein                     352   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007207707.1|  hypothetical protein PRUPE_ppa025119mg             353   3e-115   
ref|XP_002277202.1|  PREDICTED: putative pectinesterase 63              352   6e-115   Vitis vinifera
ref|XP_006399225.1|  hypothetical protein EUTSA_v10013901mg             352   1e-114   
ref|XP_002277388.2|  PREDICTED: putative pectinesterase 63              352   1e-114   Vitis vinifera
ref|XP_010523329.1|  PREDICTED: pectinesterase PPME1-like               351   1e-114   
emb|CAB87930.1|  pectin methyl-esterase-like protein                    350   3e-114   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20154.1|  hypothetical protein MIMGU_mgv1a008641mg                349   1e-113   
ref|XP_010109161.1|  Pectinesterase PPME1                               348   2e-113   
ref|XP_009136509.1|  PREDICTED: putative pectinesterase 63 isofor...    347   2e-113   
emb|CAN78808.1|  hypothetical protein VITISV_030725                     348   4e-113   Vitis vinifera
ref|XP_007216116.1|  hypothetical protein PRUPE_ppa018812mg             348   4e-113   
ref|XP_008229317.1|  PREDICTED: putative pectinesterase 63              345   5e-112   
ref|XP_007153340.1|  hypothetical protein PHAVU_003G027000g             343   4e-111   
ref|XP_002511042.1|  Pectinesterase-1 precursor, putative               342   5e-111   Ricinus communis
ref|XP_008449624.1|  PREDICTED: pectinesterase PPME1-like               342   5e-111   
ref|XP_006485036.1|  PREDICTED: pectinesterase PPME1-like               340   2e-110   
gb|KDO57708.1|  hypothetical protein CISIN_1g039631mg                   340   2e-110   
ref|XP_006437032.1|  hypothetical protein CICLE_v10031872mg             340   3e-110   
ref|XP_006280767.1|  hypothetical protein CARUB_v10026738mg             338   6e-110   
ref|XP_009362807.1|  PREDICTED: putative pectinesterase 63              338   2e-109   
ref|XP_002866448.1|  pectinesterase family protein                      337   2e-109   
ref|XP_006399226.1|  hypothetical protein EUTSA_v10013913mg             337   4e-109   
ref|NP_200976.1|  putative pectinesterase 63                            336   4e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25128.1|  hypothetical protein AALP_AA8G069700                    335   3e-108   
ref|XP_010491360.1|  PREDICTED: probable pectinesterase 49              335   4e-108   
ref|XP_007204487.1|  hypothetical protein PRUPE_ppa019696mg             334   7e-108   
ref|XP_010662219.1|  PREDICTED: putative pectinesterase 63              334   8e-108   
emb|CAN66682.1|  hypothetical protein VITISV_005088                     334   9e-108   Vitis vinifera
ref|XP_010252431.1|  PREDICTED: putative pectinesterase 63              334   9e-108   
ref|NP_196359.1|  putative pectinesterase 49                            333   9e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010452709.1|  PREDICTED: probable pectinesterase 49              333   2e-107   
ref|XP_007204920.1|  hypothetical protein PRUPE_ppa026195mg             332   2e-107   
ref|XP_009122340.1|  PREDICTED: probable pectinesterase 49              333   2e-107   
ref|XP_010423211.1|  PREDICTED: probable pectinesterase 49              333   2e-107   
ref|XP_009130989.1|  PREDICTED: probable pectinesterase 50              332   4e-107   
emb|CBI38549.3|  unnamed protein product                                333   4e-107   
ref|XP_002871270.1|  pectinesterase family protein                      332   4e-107   
ref|NP_196360.1|  putative pectinesterase 50                            332   5e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871271.1|  pectinesterase family protein                      332   5e-107   
ref|XP_004156059.1|  PREDICTED: pectinesterase PPME1-like               332   6e-107   
gb|KFK25127.1|  hypothetical protein AALP_AA8G069600                    330   3e-106   
emb|CDX81050.1|  BnaC03g03040D                                          329   6e-106   
ref|XP_010491359.1|  PREDICTED: probable pectinesterase 50              328   9e-106   
ref|XP_010423208.1|  PREDICTED: probable pectinesterase 50 isofor...    328   1e-105   
ref|XP_006289803.1|  hypothetical protein CARUB_v10003407mg             327   3e-105   
gb|KHN28380.1|  Putative pectinesterase 48                              325   3e-105   
ref|XP_010452708.1|  PREDICTED: probable pectinesterase 50              327   3e-105   
ref|XP_008449623.1|  PREDICTED: putative pectinesterase 63              327   6e-105   
ref|XP_006286828.1|  hypothetical protein CARUB_v10003776mg             326   8e-105   
gb|KHG22980.1|  Pectinesterase PPME1 -like protein                      325   1e-104   
ref|XP_008228727.1|  PREDICTED: pectinesterase PPME1-like               324   3e-104   
ref|XP_009125689.1|  PREDICTED: probable pectinesterase 50              325   3e-104   
emb|CDY14045.1|  BnaC02g01620D                                          324   4e-104   
ref|XP_007038214.1|  Pectinesterase isoform 2                           322   9e-104   
gb|KDP39969.1|  hypothetical protein JCGZ_03500                         323   3e-103   
emb|CDP21978.1|  unnamed protein product                                318   6e-103   
ref|XP_008376964.1|  PREDICTED: probable pectinesterase 48              319   9e-103   
ref|XP_010109162.1|  putative pectinesterase 50                         320   1e-102   
gb|KGN48072.1|  hypothetical protein Csa_6G428290                       320   1e-102   
ref|XP_004289004.1|  PREDICTED: pectinesterase PPME1-like               321   1e-102   
ref|XP_004140272.1|  PREDICTED: pectinesterase PPME1-like               319   5e-102   
ref|XP_004140273.1|  PREDICTED: pectinesterase PPME1-like               318   7e-102   
gb|KDP39971.1|  hypothetical protein JCGZ_03502                         323   2e-101   
gb|KGN48071.1|  hypothetical protein Csa_6G428040                       317   2e-101   
ref|XP_007204919.1|  hypothetical protein PRUPE_ppa020130mg             317   3e-101   
ref|XP_002277518.1|  PREDICTED: putative pectinesterase 63 isofor...    318   3e-101   Vitis vinifera
emb|CBI27759.3|  unnamed protein product                                318   4e-101   
ref|XP_008391732.1|  PREDICTED: putative pectinesterase 63              316   6e-101   
ref|XP_008242288.1|  PREDICTED: putative pectinesterase 63              316   8e-101   
ref|XP_009343360.1|  PREDICTED: putative pectinesterase 63              316   9e-101   
ref|XP_010483849.1|  PREDICTED: putative pectinesterase 63              313   2e-100   
ref|XP_006572810.1|  PREDICTED: uncharacterized protein LOC100306...    313   2e-100   
ref|XP_009348900.1|  PREDICTED: putative pectinesterase 63 isofor...    312   2e-99    
ref|XP_010656088.1|  PREDICTED: putative pectinesterase 63 isofor...    312   3e-99    
gb|EPS69429.1|  hypothetical protein M569_05334                         310   3e-99    
ref|XP_006474682.1|  PREDICTED: putative pectinesterase 63-like         312   4e-99    
gb|KHN47850.1|  Putative pectinesterase 63                              308   8e-99    
emb|CDY02121.1|  BnaA03g40460D                                          308   8e-99    
gb|KHN15646.1|  Putative pectinesterase 63                              308   1e-98    
ref|XP_007202075.1|  hypothetical protein PRUPE_ppa005976mg             312   1e-98    
gb|KDO73799.1|  hypothetical protein CISIN_1g047018mg                   310   2e-98    
ref|XP_011039979.1|  PREDICTED: putative pectinesterase 63              310   2e-98    
ref|XP_006381567.1|  hypothetical protein POPTR_0006s13930g             310   2e-98    
ref|XP_006452876.1|  hypothetical protein CICLE_v10010655mg             310   3e-98    
ref|XP_004169214.1|  PREDICTED: probable pectinesterase 48-like         308   1e-97    
ref|XP_004140274.1|  PREDICTED: probable pectinesterase 48-like         308   1e-97    
ref|XP_011016271.1|  PREDICTED: putative pectinesterase 63              308   2e-97    
ref|XP_008344163.1|  PREDICTED: putative pectinesterase 63              306   2e-97    
ref|XP_009402033.1|  PREDICTED: putative pectinesterase 63              301   1e-94    
ref|XP_004144054.1|  PREDICTED: probable pectinesterase 50-like         300   2e-94    
ref|XP_008450966.1|  PREDICTED: putative pectinesterase 63              300   3e-94    
ref|XP_002516214.1|  Pectinesterase-3 precursor, putative               293   7e-92    Ricinus communis
gb|KDP33954.1|  hypothetical protein JCGZ_07525                         292   2e-91    
ref|XP_010259713.1|  PREDICTED: pectinesterase PPME1-like               291   2e-91    
ref|XP_004140271.1|  PREDICTED: pectinesterase PPME1-like               287   1e-89    
ref|XP_010243601.1|  PREDICTED: pectinesterase PPME1-like               286   2e-89    
ref|XP_007154546.1|  hypothetical protein PHAVU_003G127700g             284   1e-88    
ref|XP_007219703.1|  hypothetical protein PRUPE_ppa024066mg             283   1e-88    
ref|XP_009123158.1|  PREDICTED: probable pectinesterase 49              280   1e-87    
ref|XP_010259712.1|  PREDICTED: pectinesterase PPME1-like               278   1e-86    
ref|XP_004174112.1|  PREDICTED: pectinesterase PPME1-like               273   4e-85    
ref|XP_003541318.1|  PREDICTED: putative pectinesterase 63-like         274   9e-85    
ref|XP_003609956.1|  Pectinesterase                                     269   6e-83    
gb|KHN07870.1|  Putative pectinesterase 63                              268   8e-83    
ref|XP_009348902.1|  PREDICTED: putative pectinesterase 63 isofor...    266   8e-82    
ref|XP_007038215.1|  Pectin lyase-like superfamily protein, putat...    264   9e-82    
ref|XP_006843862.1|  hypothetical protein AMTR_s00007p00264370          263   2e-80    
ref|XP_004174171.1|  PREDICTED: probable pectinesterase 49-like         256   9e-79    
ref|XP_007038216.1|  Pectin lyase-like superfamily protein, putat...    256   1e-78    
ref|NP_001234964.1|  uncharacterized protein LOC100306177 precursor     252   1e-77    
ref|XP_010262227.1|  PREDICTED: putative pectinesterase 63              253   2e-76    
ref|XP_007219211.1|  hypothetical protein PRUPE_ppa017319mg             249   4e-76    
ref|XP_004495886.1|  PREDICTED: probable pectinesterase 53-like         250   4e-75    
ref|XP_010679463.1|  PREDICTED: probable pectinesterase 53              249   2e-74    
ref|XP_007145123.1|  hypothetical protein PHAVU_007G212000g             246   2e-73    
gb|KHG12918.1|  putative pectinesterase 53 -like protein                243   1e-72    
ref|XP_010094410.1|  putative pectinesterase 53                         243   2e-72    
gb|KDP28296.1|  hypothetical protein JCGZ_14067                         243   2e-72    
ref|XP_001769271.1|  predicted protein                                  241   6e-72    
ref|XP_011040796.1|  PREDICTED: probable pectinesterase 53              241   1e-71    
ref|XP_010276487.1|  PREDICTED: probable pectinesterase 53 isofor...    241   2e-71    
ref|XP_006349162.1|  PREDICTED: probable pectinesterase 53-like         240   2e-71    
ref|XP_006853729.1|  hypothetical protein AMTR_s00056p00166920          239   5e-71    
ref|XP_010276488.1|  PREDICTED: probable pectinesterase 53 isofor...    239   1e-70    
ref|XP_002320279.2|  hypothetical protein POPTR_0014s11240g             238   2e-70    Populus trichocarpa [western balsam poplar]
ref|XP_008801747.1|  PREDICTED: probable pectinesterase 53              238   3e-70    
ref|XP_002965129.1|  hypothetical protein SELMODRAFT_167160             236   8e-70    
ref|XP_010914653.1|  PREDICTED: probable pectinesterase 53              236   9e-70    
ref|XP_002962215.1|  hypothetical protein SELMODRAFT_165098             235   9e-70    
ref|XP_003632380.2|  PREDICTED: probable pectinesterase 53              236   9e-70    
ref|XP_009787978.1|  PREDICTED: probable pectinesterase 53 isofor...    236   1e-69    
ref|XP_004229371.1|  PREDICTED: probable pectinesterase 53              236   1e-69    
ref|XP_010267113.1|  PREDICTED: probable pectinesterase 53              235   2e-69    
ref|XP_007051206.1|  Pectinesterase                                     235   2e-69    
ref|XP_003579301.1|  PREDICTED: putative pectinesterase 63              236   2e-69    
emb|CBI27989.3|  unnamed protein product                                233   3e-69    
gb|KEH25488.1|  pectinesterase                                          233   6e-69    
ref|XP_002531506.1|  Pectinesterase-2 precursor, putative               233   8e-69    Ricinus communis
ref|XP_010093131.1|  putative pectinesterase 8                          234   1e-68    
ref|XP_010316821.1|  PREDICTED: probable pectinesterase 53              233   1e-68    
ref|NP_001067039.1|  Os12g0563700                                       234   2e-68    Oryza sativa Japonica Group [Japonica rice]
emb|CAN63186.1|  hypothetical protein VITISV_037092                     233   2e-68    Vitis vinifera
ref|XP_009599854.1|  PREDICTED: probable pectinesterase 53              233   2e-68    
emb|CDY31785.1|  BnaC01g27410D                                          229   2e-68    
ref|XP_009406173.1|  PREDICTED: probable pectinesterase 53 isofor...    233   2e-68    
ref|XP_006387630.1|  hypothetical protein POPTR_0746s00200g             230   2e-68    
ref|XP_010656255.1|  PREDICTED: probable pectinesterase 53              233   2e-68    
ref|XP_009414379.1|  PREDICTED: probable pectinesterase 53 isofor...    233   3e-68    
ref|XP_008244291.1|  PREDICTED: putative pectinesterase 63              228   3e-68    
ref|NP_001044216.1|  Os01g0743200                                       232   4e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011025911.1|  PREDICTED: probable pectinesterase 53              231   7e-68    
ref|XP_010249481.1|  PREDICTED: probable pectinesterase 53              231   1e-67    
ref|XP_011093645.1|  PREDICTED: probable pectinesterase 53 isofor...    231   1e-67    
ref|XP_009802490.1|  PREDICTED: probable pectinesterase 53              230   1e-67    
gb|EEC69509.1|  hypothetical protein OsI_38743                          231   2e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_003567104.1|  PREDICTED: probable pectinesterase 53 isofor...    231   2e-67    
ref|XP_008673062.1|  PREDICTED: pectinesterase isoform X1               231   2e-67    
ref|XP_004969916.1|  PREDICTED: probable pectinesterase 53-like         231   2e-67    
emb|CDY68784.1|  BnaCnng60500D                                          227   2e-67    
ref|XP_006492456.1|  PREDICTED: probable pectinesterase 53-like         230   2e-67    
ref|XP_008242479.1|  PREDICTED: probable pectinesterase 53              230   2e-67    
ref|XP_003530551.1|  PREDICTED: probable pectinesterase 53-like i...    229   2e-67    
ref|XP_001756557.1|  predicted protein                                  227   3e-67    
ref|XP_007204399.1|  hypothetical protein PRUPE_ppa007112mg             229   3e-67    
ref|XP_002310842.1|  hypothetical protein POPTR_0007s13780g             228   3e-67    Populus trichocarpa [western balsam poplar]
ref|XP_006380792.1|  hypothetical protein POPTR_0007s13780g             228   3e-67    
ref|XP_009414378.1|  PREDICTED: probable pectinesterase 53 isofor...    229   5e-67    
ref|XP_003524409.1|  PREDICTED: probable pectinesterase 53-like         229   5e-67    
ref|XP_009591684.1|  PREDICTED: probable pectinesterase 53              229   6e-67    
gb|ACU13228.1|  unknown                                                 223   7e-67    Glycine max [soybeans]
ref|XP_008387348.1|  PREDICTED: probable pectinesterase 53              228   8e-67    
gb|KDP46694.1|  hypothetical protein JCGZ_06482                         228   1e-66    
ref|XP_006646312.1|  PREDICTED: probable pectinesterase 53-like         228   1e-66    
ref|XP_010915080.1|  PREDICTED: probable pectinesterase 53 isofor...    228   1e-66    
ref|XP_006400534.1|  hypothetical protein EUTSA_v10013810mg             228   1e-66    
ref|XP_006340937.1|  PREDICTED: probable pectinesterase 53-like         227   2e-66    
ref|XP_008657240.1|  PREDICTED: probable pectinesterase 53              228   2e-66    
ref|XP_010271483.1|  PREDICTED: probable pectinesterase 53              228   2e-66    
ref|XP_004964049.1|  PREDICTED: probable pectinesterase 53-like         228   2e-66    
gb|EYU24077.1|  hypothetical protein MIMGU_mgv1a008262mg                227   3e-66    
gb|EYU46841.1|  hypothetical protein MIMGU_mgv1a019910mg                226   4e-66    
ref|XP_004287482.1|  PREDICTED: probable pectinesterase 53-like         226   4e-66    
ref|XP_009120862.1|  PREDICTED: probable pectinesterase 53              226   5e-66    
ref|XP_004503496.1|  PREDICTED: probable pectinesterase 53-like         226   6e-66    
ref|XP_003591360.1|  Pectinesterase                                     225   6e-66    
ref|XP_010535938.1|  PREDICTED: probable pectinesterase 53              226   6e-66    
ref|XP_004251642.1|  PREDICTED: probable pectinesterase 53              226   6e-66    
ref|XP_006371972.1|  hypothetical protein POPTR_0018s06820g             227   8e-66    
ref|XP_011093643.1|  PREDICTED: probable pectinesterase 53 isofor...    226   8e-66    
ref|XP_002974192.1|  hypothetical protein SELMODRAFT_101090             224   9e-66    
ref|XP_002975044.1|  hypothetical protein SELMODRAFT_102829             224   1e-65    
ref|XP_011100946.1|  PREDICTED: probable pectinesterase 53              225   1e-65    
gb|ACU18534.1|  unknown                                                 220   1e-65    
ref|XP_003631899.2|  PREDICTED: probable pectinesterase 53              225   1e-65    
ref|XP_011009863.1|  PREDICTED: probable pectinesterase 53              225   1e-65    
ref|XP_002871903.1|  pectinesterase family protein                      225   2e-65    
emb|CDP03246.1|  unnamed protein product                                224   2e-65    
gb|AFK35509.1|  unknown                                                 225   2e-65    
gb|KHG28421.1|  putative pectinesterase 53 -like protein                225   2e-65    
ref|XP_006848989.1|  hypothetical protein AMTR_s00028p00077900          224   2e-65    
ref|XP_007046753.1|  Pectin lyase-like superfamily protein isoform 1    224   2e-65    
ref|XP_011079515.1|  PREDICTED: probable pectinesterase 53              224   2e-65    
ref|XP_001769817.1|  predicted protein                                  224   2e-65    
gb|KEH27219.1|  pectinesterase                                          224   2e-65    
ref|XP_006353578.1|  PREDICTED: probable pectinesterase 53-like         224   3e-65    
ref|XP_008338574.1|  PREDICTED: pectinesterase PPME1-like               219   5e-65    
ref|XP_010915072.1|  PREDICTED: probable pectinesterase 53 isofor...    224   5e-65    
ref|XP_006287923.1|  hypothetical protein CARUB_v10001159mg             224   5e-65    
ref|XP_008461405.1|  PREDICTED: probable pectinesterase 53              224   6e-65    
gb|KGN66185.1|  hypothetical protein Csa_1G575010                       224   6e-65    
ref|XP_004158420.1|  PREDICTED: probable pectinesterase 53-like         224   6e-65    
ref|NP_197474.1|  probable pectinesterase 53                            224   6e-65    
emb|CDY48409.1|  BnaAnng09780D                                          221   6e-65    
gb|EYU30697.1|  hypothetical protein MIMGU_mgv1a024695mg                223   7e-65    
ref|XP_003529058.2|  PREDICTED: probable pectinesterase 53-like         223   7e-65    
ref|XP_003630703.1|  Pectinesterase                                     223   7e-65    
gb|KDP33787.1|  hypothetical protein JCGZ_07358                         223   8e-65    
ref|XP_010493050.1|  PREDICTED: probable pectinesterase 53              223   8e-65    
ref|XP_004135808.1|  PREDICTED: probable pectinesterase 53-like         224   8e-65    
ref|XP_010420786.1|  PREDICTED: probable pectinesterase 53 isofor...    223   8e-65    
ref|XP_008649911.1|  PREDICTED: probable pectinesterase 53              224   8e-65    
ref|XP_008804057.1|  PREDICTED: probable pectinesterase 53              223   8e-65    
ref|XP_007152966.1|  hypothetical protein PHAVU_004G175200g             223   9e-65    
ref|XP_001777108.1|  predicted protein                                  220   9e-65    
ref|XP_008450789.1|  PREDICTED: probable pectinesterase 53              223   1e-64    
gb|KHN40374.1|  Putative pectinesterase 53                              221   1e-64    
emb|CDP01931.1|  unnamed protein product                                222   1e-64    
ref|NP_001167796.1|  pectinesterase precursor                           223   2e-64    
ref|XP_010049610.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    222   2e-64    
ref|XP_006444558.1|  hypothetical protein CICLE_v10024027mg             222   2e-64    
ref|XP_010454257.1|  PREDICTED: probable pectinesterase 53              222   2e-64    
ref|XP_010688346.1|  PREDICTED: probable pectinesterase 53              223   3e-64    
ref|XP_009402793.1|  PREDICTED: probable pectinesterase 53              222   3e-64    
ref|XP_008352338.1|  PREDICTED: probable pectinesterase 53              221   3e-64    
ref|XP_003516527.2|  PREDICTED: probable pectinesterase 53-like         221   4e-64    
ref|XP_002968924.1|  hypothetical protein SELMODRAFT_65663              218   4e-64    
ref|XP_004136146.1|  PREDICTED: probable pectinesterase 53-like         221   5e-64    
ref|XP_011078244.1|  PREDICTED: probable pectinesterase 53              221   5e-64    
emb|CDY42290.1|  BnaC02g08960D                                          221   7e-64    
gb|KHN14256.1|  Putative pectinesterase 53                              221   7e-64    
ref|XP_006451320.1|  hypothetical protein CICLE_v10010616mg             220   7e-64    
gb|KFK42874.1|  hypothetical protein AALP_AA1G050100                    220   7e-64    
emb|CDY33185.1|  BnaC04g08540D                                          219   7e-64    
ref|XP_009352561.1|  PREDICTED: probable pectinesterase 53              221   9e-64    
gb|EMT04970.1|  Putative pectinesterase 53                              221   9e-64    
ref|XP_002458469.1|  hypothetical protein SORBIDRAFT_03g034250          221   9e-64    
gb|KCW58194.1|  hypothetical protein EUGRSUZ_H00909                     221   1e-63    
ref|XP_007160279.1|  hypothetical protein PHAVU_002G308000g             220   1e-63    
ref|XP_006475590.1|  PREDICTED: probable pectinesterase 53-like i...    219   1e-63    
ref|XP_009126386.1|  PREDICTED: probable pectinesterase 53              220   1e-63    
ref|XP_010324275.1|  PREDICTED: pectinesterase QRT1                     219   1e-63    
ref|XP_004961453.1|  PREDICTED: probable pectinesterase 53-like i...    221   1e-63    
ref|XP_008337605.1|  PREDICTED: probable pectinesterase 53              220   1e-63    
gb|AFK39158.1|  unknown                                                 220   1e-63    
ref|XP_011076540.1|  PREDICTED: pectinesterase 2-like                   214   1e-63    
ref|XP_007013011.1|  Pectin lyase-like superfamily protein isoform 1    220   2e-63    
ref|XP_002976448.1|  hypothetical protein SELMODRAFT_104861             219   2e-63    
gb|KHG26932.1|  putative pectinesterase 53 -like protein                220   2e-63    
ref|XP_010069754.1|  PREDICTED: probable pectinesterase 53 isofor...    221   2e-63    
ref|XP_002961718.1|  hypothetical protein SELMODRAFT_76693              218   2e-63    
ref|XP_003566023.2|  PREDICTED: probable pectinesterase 53              218   2e-63    
ref|XP_010679844.1|  PREDICTED: probable pectinesterase 53              220   2e-63    
gb|EPS63895.1|  pectinesterase                                          217   2e-63    
ref|XP_008656475.1|  PREDICTED: probable pectinesterase 53 isofor...    220   2e-63    
ref|XP_006475589.1|  PREDICTED: probable pectinesterase 53-like i...    219   3e-63    
gb|KHG03314.1|  putative pectinesterase 8 -like protein                 218   3e-63    
ref|XP_008451885.1|  PREDICTED: probable pectinesterase 8               219   3e-63    
ref|XP_009406172.1|  PREDICTED: probable pectinesterase 53 isofor...    219   3e-63    
gb|KDP42780.1|  hypothetical protein JCGZ_00479                         219   4e-63    
ref|XP_002964788.1|  hypothetical protein SELMODRAFT_83442              217   4e-63    
ref|XP_002514210.1|  Pectinesterase PPE8B precursor, putative           219   4e-63    
ref|XP_002979836.1|  hypothetical protein SELMODRAFT_55472              216   6e-63    
ref|XP_008660472.1|  PREDICTED: putative pectinesterase 63              219   6e-63    
ref|XP_002440102.1|  hypothetical protein SORBIDRAFT_09g026060          219   6e-63    
ref|XP_010522833.1|  PREDICTED: probable pectinesterase 53              218   7e-63    
ref|XP_007013013.1|  Pectin lyase-like superfamily protein isoform 3    218   7e-63    
ref|XP_009397881.1|  PREDICTED: probable pectinesterase 68              217   9e-63    
ref|XP_009144121.1|  PREDICTED: probable pectinesterase 15              216   9e-63    
dbj|BAK03607.1|  predicted protein                                      219   1e-62    
ref|XP_006346251.1|  PREDICTED: pectinesterase QRT1-like                217   1e-62    
ref|XP_006418040.1|  hypothetical protein EUTSA_v10009800mg             218   1e-62    
ref|XP_002443368.1|  hypothetical protein SORBIDRAFT_08g018360          219   2e-62    
gb|EEC79546.1|  hypothetical protein OsI_20666                          218   2e-62    
ref|NP_001056077.1|  Os05g0521600                                       218   2e-62    
ref|XP_010686768.1|  PREDICTED: probable pectinesterase 8               218   2e-62    
emb|CDY44939.1|  BnaA02g04440D                                          219   2e-62    
ref|XP_009764658.1|  PREDICTED: pectinesterase QRT1                     216   2e-62    
ref|XP_006425546.1|  hypothetical protein CICLE_v10027321mg             216   2e-62    
ref|XP_006653657.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    216   3e-62    
ref|XP_010110876.1|  putative pectinesterase 53                         216   3e-62    
ref|XP_009411137.1|  PREDICTED: pectinesterase QRT1                     215   3e-62    
gb|ABG46325.1|  putative pectin methylesterase                          215   5e-62    
ref|XP_010240218.1|  PREDICTED: probable pectinesterase 68              215   5e-62    
ref|XP_009602719.1|  PREDICTED: pectinesterase QRT1                     215   5e-62    
ref|XP_009803587.1|  PREDICTED: putative pectinesterase 11              215   6e-62    
ref|XP_011095807.1|  PREDICTED: pectinesterase QRT1-like                215   6e-62    
ref|XP_008367992.1|  PREDICTED: putative pectinesterase 63              214   6e-62    
gb|KHG28220.1|  putative pectinesterase 53 -like protein                215   6e-62    
ref|XP_010113388.1|  putative pectinesterase 53                         215   6e-62    
ref|XP_001769270.1|  predicted protein                                  216   7e-62    
ref|XP_010315307.1|  PREDICTED: putative pectinesterase 11              214   9e-62    
ref|XP_004513038.1|  PREDICTED: probable pectinesterase 53-like         215   9e-62    
ref|XP_008656474.1|  PREDICTED: probable pectinesterase 53 isofor...    215   1e-61    
ref|XP_009399936.1|  PREDICTED: probable pectinesterase 68              214   1e-61    
ref|XP_010069753.1|  PREDICTED: probable pectinesterase 53 isofor...    216   1e-61    
ref|XP_010516895.1|  PREDICTED: probable pectinesterase 15              215   2e-61    
emb|CAD41229.2|  OSJNBa0010H02.16                                       213   2e-61    
ref|XP_009119166.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    214   3e-61    
gb|EYU27258.1|  hypothetical protein MIMGU_mgv1a025960mg                211   3e-61    
ref|XP_009621417.1|  PREDICTED: putative pectinesterase 11              213   3e-61    
ref|XP_009349568.1|  PREDICTED: probable pectinesterase 8               214   3e-61    
ref|XP_007215489.1|  hypothetical protein PRUPE_ppa006779mg             214   4e-61    
gb|AFW82525.1|  hypothetical protein ZEAMMB73_386621                    214   4e-61    
gb|KHN26987.1|  Putative pectinesterase 53                              213   5e-61    
ref|XP_010505218.1|  PREDICTED: probable pectinesterase 15              214   5e-61    
ref|XP_001774315.1|  predicted protein                                  210   6e-61    
ref|XP_010260644.1|  PREDICTED: probable pectinesterase 8               213   7e-61    
emb|CDX78291.1|  BnaA03g02030D                                          210   8e-61    
ref|XP_002448293.1|  hypothetical protein SORBIDRAFT_06g024730          212   8e-61    
ref|XP_006429777.1|  hypothetical protein CICLE_v10011953mg             212   1e-60    
ref|XP_006294321.1|  hypothetical protein CARUB_v10023328mg             213   2e-60    
ref|XP_011074601.1|  PREDICTED: putative pectinesterase 11              211   2e-60    
ref|XP_011097804.1|  PREDICTED: pectinesterase QRT1                     211   2e-60    
ref|XP_001764301.1|  predicted protein                                  209   2e-60    
ref|NP_172023.1|  putative pectinesterase 8                             212   2e-60    
ref|XP_008378333.1|  PREDICTED: probable pectinesterase 8               212   2e-60    
ref|XP_006481444.1|  PREDICTED: probable pectinesterase 8-like          211   3e-60    
gb|ABR18283.1|  unknown                                                 210   3e-60    
ref|XP_001778325.1|  predicted protein                                  211   4e-60    
gb|EPS61453.1|  hypothetical protein M569_13345                         208   4e-60    
ref|XP_002863340.1|  pectinesterase family protein                      210   4e-60    
ref|XP_008229648.1|  PREDICTED: probable pectinesterase 8               211   4e-60    
ref|XP_008653334.1|  PREDICTED: pectinesterase QRT1 isoform X1          210   5e-60    
ref|XP_010919565.1|  PREDICTED: probable pectinesterase 68              209   5e-60    
ref|XP_007226857.1|  hypothetical protein PRUPE_ppa017141mg             209   5e-60    
ref|XP_001752210.1|  predicted protein                                  211   5e-60    
ref|XP_010543016.1|  PREDICTED: probable pectinesterase 8               211   5e-60    
ref|XP_004147773.1|  PREDICTED: probable pectinesterase 8-like          211   5e-60    
ref|XP_010088935.1|  Putative pectinesterase 11                         209   6e-60    
ref|XP_004168775.1|  PREDICTED: probable pectinesterase 8-like          211   6e-60    
ref|XP_002879623.1|  pectinesterase family protein                      211   7e-60    
gb|EMT14071.1|  Putative pectinesterase 68                              209   7e-60    
ref|XP_006838145.1|  hypothetical protein AMTR_s00106p00092510          209   7e-60    
ref|XP_008786957.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    209   7e-60    
ref|XP_009336347.1|  PREDICTED: probable pectinesterase 67              209   8e-60    
ref|XP_008390573.1|  PREDICTED: probable pectinesterase 67              209   9e-60    
ref|NP_199561.1|  pectin methylesterase 5                               209   9e-60    
ref|XP_008669043.1|  PREDICTED: probable pectinesterase 68              209   1e-59    
ref|XP_006346252.1|  PREDICTED: pectinesterase QRT1-like                208   1e-59    
ref|XP_006654665.1|  PREDICTED: probable pectinesterase 53-like         210   1e-59    
ref|XP_004244060.1|  PREDICTED: pectinesterase QRT1-like                209   1e-59    
ref|XP_001762576.1|  predicted protein                                  207   1e-59    
ref|XP_010064980.1|  PREDICTED: pectinesterase QRT1                     209   1e-59    
ref|XP_004976450.1|  PREDICTED: probable pectinesterase 68-like         208   2e-59    
ref|XP_009372133.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    208   2e-59    
ref|XP_004169876.1|  PREDICTED: probable pectinesterase 53-like         209   2e-59    
ref|XP_008465244.1|  PREDICTED: probable pectinesterase 53              209   2e-59    
ref|XP_009787979.1|  PREDICTED: probable pectinesterase 53 isofor...    209   2e-59    
ref|XP_004972590.1|  PREDICTED: probable pectinesterase 8-like          209   2e-59    
ref|XP_004172449.1|  PREDICTED: probable pectinesterase 53-like         207   3e-59    
ref|NP_181209.1|  putative pectinesterase 15                            209   3e-59    
ref|XP_010936491.1|  PREDICTED: pectinesterase QRT1-like                208   3e-59    
ref|XP_009612401.1|  PREDICTED: probable pectinesterase 8               208   3e-59    
ref|XP_002892282.1|  predicted protein                                  209   4e-59    
ref|XP_010509442.1|  PREDICTED: probable pectinesterase 15              209   4e-59    
ref|XP_004961452.1|  PREDICTED: probable pectinesterase 53-like i...    209   4e-59    
ref|XP_004305897.1|  PREDICTED: probable pectinesterase 8-like          209   5e-59    
emb|CDP08865.1|  unnamed protein product                                208   5e-59    
ref|XP_009118594.1|  PREDICTED: probable pectinesterase 8               209   5e-59    
ref|XP_002962216.1|  hypothetical protein SELMODRAFT_76951              207   5e-59    
ref|XP_011070218.1|  PREDICTED: probable pectinesterase 68              206   5e-59    
ref|XP_004146488.1|  PREDICTED: probable pectinesterase 53-like         208   6e-59    
emb|CBI31927.3|  unnamed protein product                                207   6e-59    
ref|XP_002521065.1|  Pectinesterase-1 precursor, putative               208   6e-59    
gb|EMT30081.1|  Putative pectinesterase 53                              209   6e-59    
ref|XP_001764345.1|  predicted protein                                  206   7e-59    
ref|XP_002267842.1|  PREDICTED: probable pectinesterase 8               208   8e-59    
ref|XP_001758990.1|  predicted protein                                  205   9e-59    
ref|XP_008340594.1|  PREDICTED: probable pectinesterase 67              206   9e-59    
ref|XP_006280682.1|  hypothetical protein CARUB_v10026646mg             206   1e-58    
ref|XP_002266321.3|  PREDICTED: probable pectinesterase 68              207   1e-58    
ref|XP_009602721.1|  PREDICTED: pectinesterase QRT1-like                206   1e-58    
ref|XP_010936490.1|  PREDICTED: pectinesterase QRT1-like                207   1e-58    
gb|KFK31368.1|  hypothetical protein AALP_AA6G103300                    206   2e-58    
emb|CDY06568.1|  BnaC02g12920D                                          207   2e-58    
emb|CDX77772.1|  BnaC07g20260D                                          205   2e-58    
ref|XP_002445213.1|  hypothetical protein SORBIDRAFT_07g006050          207   2e-58    
gb|ABD64977.1|  pectinesterase family protein                           206   2e-58    
ref|XP_002323171.2|  hypothetical protein POPTR_0016s01920g             206   2e-58    
ref|XP_010484902.1|  PREDICTED: probable pectinesterase 8               207   2e-58    
ref|XP_009407032.1|  PREDICTED: putative pectinesterase 11              206   2e-58    
ref|XP_001766064.1|  predicted protein                                  204   2e-58    
ref|XP_008223370.1|  PREDICTED: probable pectinesterase 67              205   2e-58    
ref|XP_009405469.1|  PREDICTED: probable pectinesterase 8               207   3e-58    
ref|XP_010025544.1|  PREDICTED: probable pectinesterase 8               206   3e-58    
ref|XP_006365130.1|  PREDICTED: putative pectinesterase 11-like         204   3e-58    
ref|XP_002965130.1|  hypothetical protein SELMODRAFT_83276              205   4e-58    
gb|AAO22722.1|  putative pectinesterase family protein                  206   4e-58    
ref|XP_009803530.1|  PREDICTED: probable pectinesterase 8 isoform X1    205   5e-58    
ref|XP_010457617.1|  PREDICTED: probable pectinesterase 8               206   5e-58    
emb|CDY59753.1|  BnaC08g49280D                                          204   5e-58    
ref|XP_009772188.1|  PREDICTED: probable pectinesterase 8               205   5e-58    
ref|XP_010475224.1|  PREDICTED: probable pectinesterase 8               206   6e-58    
gb|EMT24197.1|  Pectinesterase QRT1                                     204   6e-58    
gb|AAB71446.1|  Similar to Prunus pectinesterase (gb|X95991)            205   7e-58    
ref|XP_003611307.1|  Pectinesterase                                     204   7e-58    
ref|XP_009610336.1|  PREDICTED: probable pectinesterase 8 isoform X1    204   8e-58    



>gb|AHL24653.1| Fra e 11.01 allergen [Fraxinus excelsior]
Length=368

 Score =   421 bits (1083),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 205/366 (56%), Positives = 268/366 (73%), Gaps = 6/366 (2%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHY-LC-PGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELA  181
             K+V+ + + TV++   LC P VFSDD +PIPA+  ++NSWF   ++P S RK  L+P L 
Sbjct  4     KIVSSIALETVIVSIILCMPIVFSDDRVPIPADSAQINSWFDGIVRPLSARKATLDPALV  63

Query  182   KAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFIS  361
              AE++PK I++  +G GDFKTI +AI ++P GNT+RVI+S+ PGNY E++KI   KPFI+
Sbjct  64    TAESEPKVIKLKSDGSGDFKTINDAIKTIPDGNTKRVILSLAPGNYKEKVKIGMYKPFIT  123

Query  362   LHGDD-KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
              +G+D  + P ++   TA +  TV SAT+IVE DYF A  + I+NSAPRPDGKR+GAQA 
Sbjct  124   FYGEDPNNMPVLVFGGTAKEYDTVESATLIVESDYFNAVNLKIVNSAPRPDGKREGAQAA  183

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             AL   GD ++FYNV+L+G+QDT CDD+G+HF+KD YIEGTVDFIFG+GK+LY++TELHVI
Sbjct  184   ALRIGGDKSSFYNVKLYGYQDTLCDDRGKHFYKDCYIEGTVDFIFGSGKSLYLNTELHVI  243

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIK  898
              GD +A++TAQA+ T  EDTGYSF HCKVTG G  A LGR WM  ++VVFAY E+SDAI 
Sbjct  244   PGDQLAMITAQARKTDSEDTGYSFVHCKVTGTGGVAYLGRSWMPAAKVVFAYTEMSDAIN  303

Query  899   PEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             P+GW  V  K  +  T  F EY N GPGA +  R  FV K+   + K F+S  +IEASKW
Sbjct  304   PKGWSIV--KPEHESTVRFAEYDNKGPGANVDKRAKFVNKLTKADAKPFVSLSYIEASKW  361

Query  1079  LLPPAK  1096
             LLPPAK
Sbjct  362   LLPPAK  367



>ref|XP_009626579.1| PREDICTED: pectinesterase 1-like [Nicotiana tomentosiformis]
Length=367

 Score =   418 bits (1075),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 263/360 (73%), Gaps = 4/360 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
             + +++T++L    P VFSDDS+PIPA+K ++NSWF +N++P   RK+ L+P L  AEA  
Sbjct  11    EAIVITIVL--FIPRVFSDDSVPIPADKSQINSWFETNVKPLDARKDTLDPALVAAEANK  68

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               I+V  +G G+FKT+ +AI+S+P GN +RVIISIG GNYTE++KI R KPFI+L+GD K
Sbjct  69    TTIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIERYKPFITLYGDPK  128

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P+II   TA   GTV SATV+VE +YF A  IN +NSAPRPDGKR+ AQA AL   GD
Sbjct  129   NVPNIIFNGTAKDYGTVDSATVVVESEYFTAVNINFVNSAPRPDGKRELAQAAALRTGGD  188

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+ YN +++GFQDTFCDD G+HFFKD YIEGTVDFIFGNGK+LY++TE+HVI GD MA+
Sbjct  189   KASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGDPMAM  248

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A+     D+GYSF HC +TG G  A LGR W  F++VV++Y ++SD + PEGW   
Sbjct  249   ITAHARGAGNVDSGYSFVHCMITGTGNTAFLGRAWKPFAKVVYSYTDMSDVVHPEGWSD-  307

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
              GK+ Y  + ++GEY   G GA +  R  +V+K+ D E K FI+ G+IE SKWLLPP  +
Sbjct  308   NGKSDYDRSVFYGEYNCKGAGATMERRVGYVRKLTDAEAKPFITLGYIEGSKWLLPPVAL  367



>ref|XP_009789874.1| PREDICTED: pectinesterase 1-like [Nicotiana sylvestris]
Length=367

 Score =   416 bits (1069),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 262/360 (73%), Gaps = 4/360 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
             + +++T+LL    P VFSDDS+PIPA+K ++ SWF +N++P   RK+ L+P L  AEA  
Sbjct  11    EAIVITILL--FIPRVFSDDSVPIPADKSQIKSWFETNVKPLDARKDTLDPALVAAEANK  68

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               I+V  +G G+FKT+ +AI+S+P GN +RVIISIG GNYTE++KI R KPFI+L+GD K
Sbjct  69    TIIKVRADGSGEFKTLTDAINSIPQGNKRRVIISIGGGNYTEKVKIDRYKPFITLYGDPK  128

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P+II   TA   GTV SATV+VE +YF A  IN +NSAPRPDGKR+ AQA AL   GD
Sbjct  129   NVPNIIFNGTAKDYGTVDSATVVVESEYFSAVNINFVNSAPRPDGKRELAQAAALRTGGD  188

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+ YN +++GFQDTFCDD G+HFFKD YIEGTVDFIFGNGK+LY++TE+HVI GD MA+
Sbjct  189   KASLYNCKMYGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTEMHVIPGDPMAM  248

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A+     D+GYSF HC +TG G+ ALLGR W  F++VV++Y ++SD + PEGW   
Sbjct  249   ITAHARGAGNVDSGYSFVHCMITGTGKTALLGRAWKPFAKVVYSYTDMSDVVHPEGWSD-  307

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
              GK+ Y  + ++GEY   G GA +  R  + KK+ D E K  I+ G+IE SKWLLPP  +
Sbjct  308   NGKSDYDRSVFYGEYNCKGAGATMDGRVGYAKKLTDAEAKPLITLGYIEGSKWLLPPVTL  367



>ref|XP_004239982.1| PREDICTED: pectinesterase 1-like [Solanum lycopersicum]
Length=368

 Score =   415 bits (1066),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 203/363 (56%), Positives = 256/363 (71%), Gaps = 3/363 (1%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAE  190
              V + +++T LL  +   VFSDD +PIPA+K ++NSWF +N++P   RK+ L+P L  AE
Sbjct  8     FVVETIIITFLLLNIIE-VFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAE  66

Query  191   AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG  370
             A    I+V   G GDFKTI EA+ S+P GN +RVII IG GNYTE++KI R KPF++L+G
Sbjct  67    ANKTIIKVRTYGSGDFKTITEAVKSIPEGNKKRVIIWIGSGNYTEKIKIERTKPFVTLYG  126

Query  371   DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
             D K+ P+II   TA +  TV SATVIVE +YF A  IN +N+APRPDGK   AQA AL  
Sbjct  127   DPKNVPNIIFHGTAQEYTTVDSATVIVESEYFSAVNINFVNTAPRPDGKSDKAQAAALRT  186

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
              GD A+ YN ++ GFQDTFCDD G+HFFKD YIEGTVDFIFGNGK+LY++TE HVI GD 
Sbjct  187   GGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGDP  246

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             MA+VTAQA+     D+G+SF HC +TG G  A LGR W  +S+VVF+Y +++D I PEGW
Sbjct  247   MAMVTAQARAVENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEGW  306

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 GK  +G T Y+GEYK  G GA L  R  F KK+ D+E K FIS  +IE SKWLLPP
Sbjct  307   SDF-GKKEFGSTVYYGEYKCKGAGATLDKRVPFTKKLTDEEAKPFISLAYIEGSKWLLPP  365

Query  1091  AKV  1099
               +
Sbjct  366   VTL  368



>emb|CDP13860.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   414 bits (1065),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 264/363 (73%), Gaps = 5/363 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
             +N+ ++ + LL    P V SD+++P PA+K ++NSWF  N+QP ++RK+ L+P L  AEA
Sbjct  6     LNKAILFSTLL--FIPLVLSDNTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEA  63

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
              P+ I++  +G G+FKTI +AI+S+P  NT RVIIS+GPGNYTE++KI R KPFI++ GD
Sbjct  64    NPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGD  123

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
                 P+++   TAA+ GTV SAT+IVE DYF A+ + + NSAPRP+G  KGAQA+A+   
Sbjct  124   PNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIG  183

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             GD A+FYN +  GFQDT CDDKG+H FKD YIEGTVDFIFGNGK++Y++ ELHVI GD  
Sbjct  184   GDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDRQ  243

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
             A +TAQA+HT  EDTGYSF HCKVTG G  A LGR WM + +VVFAY ++SDA+ P GW 
Sbjct  244   AWITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVIPAGWS  303

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKL-TARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                       T  FGE+ +TGPG+   ++R  F KK+ + EVK F++ GFIEASKWLLPP
Sbjct  304   N-NFHPETEKTVLFGEFSSTGPGSDTSSSRAAFTKKLTEAEVKPFLTLGFIEASKWLLPP  362

Query  1091  AKV  1099
              +V
Sbjct  363   TQV  365



>ref|XP_006365351.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=368

 Score =   411 bits (1056),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 200/363 (55%), Positives = 254/363 (70%), Gaps = 3/363 (1%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAE  190
              V + +++T L   +  GVFSDD +PIPA+K ++NSWF +N++P   RK+ L+P L  AE
Sbjct  8     FVVETIIITFLFFNII-GVFSDDLVPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAE  66

Query  191   AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG  370
             A    I+V  +G GDFKTI EA+ S+P GN +RVII IG GNYTE++KI R KPF++ +G
Sbjct  67    ANKTIIKVRTDGSGDFKTITEAVKSIPEGNKRRVIIWIGGGNYTEKIKIERTKPFVTFYG  126

Query  371   DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
             D K+ P+II   TA +  TV SATVIVE +YF A  IN +N+APRPDGK   AQA AL  
Sbjct  127   DSKNVPNIIFHGTAKEYTTVDSATVIVESEYFNAVNINFVNTAPRPDGKSDKAQAAALRT  186

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
              GD A+ YN ++ GFQDTFCDD G+HFFKD YIEGTVDFIFGNGK+LY++TE HVI GD 
Sbjct  187   GGDKASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSLYLNTETHVIPGDP  246

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             MA+VTA A+     D+G+SF HC +TG G  A LGR W  +S+VVF+Y +++D I PEGW
Sbjct  247   MAMVTAHARAAENFDSGFSFVHCMITGTGNTAYLGRAWKQYSKVVFSYTDMTDVIHPEGW  306

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 GK  +  T Y+GEYK  G GA L  R  F KK+ D+E K FIS  +IE SKWLLPP
Sbjct  307   SNF-GKKEFDSTVYYGEYKCKGAGATLDKRVPFTKKLSDEEAKPFISLAYIEGSKWLLPP  365

Query  1091  AKV  1099
               +
Sbjct  366   VTL  368



>ref|XP_006365350.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=367

 Score =   404 bits (1038),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 251/360 (70%), Gaps = 4/360 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
             + +++T+LL    P VFSDD+IPIPA+K ++NSWF +N++P   RK+ L+P L  AEA  
Sbjct  11    ETIVLTILL--FIPRVFSDDTIPIPADKSQLNSWFEANVKPLDARKDTLDPALVAAEANK  68

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               I+V  +G GDFKT+ EA+ S+P GN +RVII IG GNYTE++KI R KPF++L+GD K
Sbjct  69    TIIKVRTDGSGDFKTLTEAVKSIPEGNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPK  128

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P+II   TA Q   V SATVIVE +YF A  IN +N+APRPDGK + AQA AL   GD
Sbjct  129   NVPNIIFHGTAKQYTIVESATVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTGGD  188

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+ YN ++ GFQDTFCDD G+HFFKD YIEGTVDFIFGNGK++Y++TE HVI GD MA+
Sbjct  189   KASLYNCKMFGFQDTFCDDSGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAM  248

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             VTA A+     D+GYSF HC +TG G  A LGR W  F +VVF Y +++D + PEGW   
Sbjct  249   VTAHARDAENVDSGYSFVHCTITGTGNTAYLGRAWKPFGKVVFLYSDMTDVVHPEGWSD-  307

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
              GK     + ++GEY   G GA L  R  F KK+ D E K FIS  +IE SKWLLPP  +
Sbjct  308   NGKPENDKSVFYGEYNCKGAGAALEKRVGFTKKLSDAEAKPFISLAYIEGSKWLLPPVTL  367



>ref|XP_004513231.1| PREDICTED: pectinesterase 1-like [Cicer arietinum]
Length=370

 Score =   399 bits (1024),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 191/363 (53%), Positives = 254/363 (70%), Gaps = 4/363 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPG-VFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAK  184
             K V   + V +++ +L    V SDD++PIP++K ++N+WF++N++P S RKN L+P L  
Sbjct  4     KTVRSYIHVALVISFLTANIVLSDDNVPIPSDKAQLNTWFNNNVKPLSQRKNTLDPALVT  63

Query  185   AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             AE   K ++V K+G GDFKTI +AI S+P GNT+RVI+ IG GN+ E++ I R KPF++L
Sbjct  64    AEEGAKVVKVMKDGSGDFKTITDAIKSIPEGNTKRVIVYIGGGNFNEKITIGRTKPFVTL  123

Query  365   HGD-DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVA  541
             +G    + P++    TA Q GTV SAT+IVEGDYF+A+ I I N+APRPDGKR+GAQAVA
Sbjct  124   YGALGGNMPNLTYGGTAQQYGTVDSATLIVEGDYFVAANIMISNTAPRPDGKRQGAQAVA  183

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
             L  SGD A+FYN +L GFQDT CDD+ RH FK+  I+GTVDFIFG+GK+LY++TEL V+ 
Sbjct  184   LRISGDKASFYNCKLLGFQDTVCDDRNRHLFKNCLIQGTVDFIFGSGKSLYLNTELRVLG  243

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
                M V+ AQA+ +  ED GYSF HC +TG G G  LGR WM+ S+ VFAY  ++  +  
Sbjct  244   DTGMTVIVAQARKSDSEDNGYSFVHCDITGTGNGTFLGRAWMSHSKAVFAYTHMTSVVNQ  303

Query  902   EGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
             EGW      + Y  T YFGEY+NTGPGA L  R    K++ D EVK +I+   IE SKWL
Sbjct  304   EGWSD-NRHSQYASTVYFGEYRNTGPGADLKGRSKITKQLSDAEVKPYITLAMIEGSKWL  362

Query  1082  LPP  1090
             LPP
Sbjct  363   LPP  365



>sp|D8VPP5.1|AL11A_OLEEU RecName: Full=Pectinesterase 1; AltName: Full=Pollen allergen 
Ole e 11.0101; Short=Ole e 11-1; AltName: Allergen=Ole e 11.0101; 
Flags: Precursor [Olea europaea]
 gb|ACZ57582.1| Ole e 11.0101 allergen precursor [Olea europaea]
Length=364

 Score =   396 bits (1018),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/364 (54%), Positives = 259/364 (71%), Gaps = 8/364 (2%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             + V++ +LL+   P V SDD  PIP+N  ++NSWF   IQP + RK  ++P L  AE + 
Sbjct  7     EAVLLGILLY--IPIVLSDDRAPIPSNSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQT  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-  376
             K I++  +G GDFK+I EAI S+P  NT+RVI+S+ PGNY+E++KI   K +I+ +G+D 
Sbjct  65    KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSLAPGNYSEKVKIGMYKHYITFYGEDP  124

Query  377   KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
              + P ++   TAA+ GTV SAT+IVE +YF A  + I+NSAPRPDGKR GAQA AL  SG
Sbjct  125   NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  557   DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
             D A+FYNV+++GFQDT CDDKG+HF+KD YIEGTVDFIFG+GK+++++TELH + GD  A
Sbjct  185   DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  737   VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             ++TAQA+ T  EDTGY F +C+VT  G GA LGR WM  ++VVFAY E+ DAI PEGW  
Sbjct  245   IITAQARKTDSEDTGYYFVNCRVT--GGGAFLGRSWMPAAKVVFAYTEMVDAIHPEGWIL  302

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
             V  K  +  T  F EY N GPGA +  R  FVK++ D E K+ IS G IEASKWLLPP  
Sbjct  303   V--KPEHESTVRFSEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV  360

Query  1097  V*AP  1108
             V  P
Sbjct  361   VGLP  364



>sp|B2VPR8.1|AL11B_OLEEU RecName: Full=Pectinesterase 2; AltName: Full=Pollen allergen 
Ole e 11.0102; Short=Ole e 11-2; AltName: Allergen=Ole e 11.0102; 
Flags: Precursor [Olea europaea]
 gb|AAY88919.1| Ole e 11.0102 allergen precursor [Olea europaea]
Length=364

 Score =   396 bits (1017),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 199/364 (55%), Positives = 258/364 (71%), Gaps = 8/364 (2%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             + V++ +LL+   P V SDD  PIPAN  ++NSWF   IQP + RK  ++P L  AE + 
Sbjct  7     EAVLLGILLY--IPIVLSDDRAPIPANSAQLNSWFDGIIQPVAVRKATMDPALVTAEGQA  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-  376
             K I++  +G GDFK+I EAI S+P  NT+RVI+S  PGNY+E++KI   K +I+ +G+D 
Sbjct  65    KVIKLKSDGSGDFKSINEAIKSIPDDNTKRVILSFSPGNYSEKVKIGMYKHYITFYGEDP  124

Query  377   KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
              + P ++   TAA+ GTV SAT+IVE +YF A  + I+NSAPRPDGKR GAQA AL  SG
Sbjct  125   NNMPILVFGGTAAEYGTVDSATLIVESNYFSAVNLKIVNSAPRPDGKRVGAQAAALRISG  184

Query  557   DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
             D A+FYNV+++GFQDT CDDKG+HF+KD YIEGTVDFIFG+GK+++++TELH + GD  A
Sbjct  185   DKASFYNVKIYGFQDTLCDDKGKHFYKDCYIEGTVDFIFGSGKSIFLNTELHAVPGDQPA  244

Query  737   VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             ++TAQA+ T  EDTGY F +C+VT  G GA LGR WM  ++VVFAY E+ DAI PEGW  
Sbjct  245   IITAQARKTESEDTGYYFVNCRVT--GGGAFLGRSWMPAAKVVFAYTEMGDAIHPEGWIL  302

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
             V  K  +  T  F EY N GPGA +  R  FVK++ D E K+ IS G IEASKWLLPP  
Sbjct  303   V--KPEHESTVRFPEYNNKGPGANMEKRAKFVKRLSDAEAKQSISLGSIEASKWLLPPRV  360

Query  1097  V*AP  1108
             V  P
Sbjct  361   VGLP  364



>ref|XP_011076543.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   395 bits (1015),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/358 (52%), Positives = 252/358 (70%), Gaps = 4/358 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             ++V +T LL  + P   S +  PIPANK ++NSWF  N+ P ++R+ +L+P + +AE   
Sbjct  12    EVVFLTALL--VLPIALSTNDEPIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               +RV  +G GDFKT+ +AI SVP GN  RVIISIGPGNYTE++KI R   FI+L+GD  
Sbjct  70    TVVRVRTDGSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPN  129

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P ++   TAAQ GT+ SAT+ VE DYF A  + I+NSAPRPDGKR GAQAVA+  +G+
Sbjct  130   NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+FYN R++GFQDT CDD+G+H FKD Y+EGTVDFIFG+G++LY+++E+HVI GD ++ 
Sbjct  190   YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             + A ++    E  GY F HC+VTG    A L R W  + RV+FAY ++SDA+ P+GW   
Sbjct  250   IAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSN-  308

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPA  1093
              G+ H   T YFGEY N GPG+ L+ R  + K++ D EVK FIS  +IE SKWLLPPA
Sbjct  309   NGQNHTDSTVYFGEYHNEGPGSDLSKRAAYGKQLSDAEVKSFISIAYIEGSKWLLPPA  366



>ref|XP_004239981.2| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 1-like, partial 
[Solanum lycopersicum]
Length=358

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 192/360 (53%), Positives = 249/360 (69%), Gaps = 4/360 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
             + + + +LL    P VFSDD +PIPA+K ++NS F +N++P   RK+ L+P L  AEA  
Sbjct  2     ETIFLIILL--FIPRVFSDDLVPIPADKSQLNSGFEANVKPLDARKDTLDPALVAAEANK  59

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               I+V  +G GDFKT+ EA+ S+P  N +RVII IG GNYTE++KI R KPF++L+GD K
Sbjct  60    TIIKVRTDGSGDFKTLTEAVKSIPEDNKRRVIIWIGGGNYTEKVKIERNKPFVTLYGDPK  119

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P+II   TA Q   V S TVIVE +YF A  IN +N+APRPDGK + AQA AL  +GD
Sbjct  120   NVPNIIFSGTAKQYTIVESGTVIVESEYFSAVNINFVNTAPRPDGKMELAQAAALRTAGD  179

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+ YN ++ GFQDTFCDDKG+HFFKD YIEGTVDFIFGNGK++Y++TE HVI GD MA+
Sbjct  180   KASLYNCKMFGFQDTFCDDKGKHFFKDCYIEGTVDFIFGNGKSIYLNTEAHVIPGDPMAM  239

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             VTA A+     D+GYSF HC +TG G  A LGR W  FS+VVF+Y +++D + PEGW   
Sbjct  240   VTAHARDGENVDSGYSFVHCTITGTGNTAYLGRAWKPFSKVVFSYTDMTDVVHPEGWSD-  298

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
              GK     + ++GEY   G GA    R  + KK+ D+E K FIS  +IE SKWLLPP  +
Sbjct  299   NGKPENDKSVFYGEYNCKGAGAASGKRVPYTKKLSDEEAKPFISLAYIEGSKWLLPPVTL  358



>ref|XP_011076542.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=370

 Score =   390 bits (1001),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 185/358 (52%), Positives = 250/358 (70%), Gaps = 4/358 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             ++V +T LL  + P   S +  PIPANK ++NSWF  N+ P ++R+ +L+P + +AE   
Sbjct  12    EVVFLTALL--VLPIALSTNDEPIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNV  69

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
               +RV  +  GDFKT+ +AI SVP GN  RVIISIGPGNY E++KI R   FI+L+GD  
Sbjct  70    TVVRVRTDRSGDFKTVTDAIKSVPQGNKHRVIISIGPGNYIEKVKIDRYTHFITLYGDPN  129

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P ++   TAAQ GT+ SAT+ VE DYF A  + I+NSAPRPDGKR GAQAVA+  +G+
Sbjct  130   NMPVMLFDGTAAQFGTLESATLTVESDYFSAVNLKIVNSAPRPDGKRVGAQAVAMKIAGE  189

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              A+FYN R++GFQDT CDD+G+H FKD Y+EGTVDFIFG+G++LY+++E+HVI GD ++ 
Sbjct  190   YASFYNCRMYGFQDTLCDDRGKHLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSF  249

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             + A ++    E  GY F HC+VTG    A L R W  + RV+FAY ++SDA+ P+GW   
Sbjct  250   IAAHSRSKHNEANGYVFVHCRVTGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSN-  308

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPA  1093
              G+ H   T YFGEY N GPG+ L+ R  + K++ D EVK FIS  +IE SKWLLPPA
Sbjct  309   NGQNHTDSTVYFGEYHNEGPGSDLSKRAAYGKQLSDAEVKSFISIAYIEGSKWLLPPA  366



>ref|XP_010038407.1| PREDICTED: putative pectinesterase 63 [Eucalyptus grandis]
 gb|KCW46225.1| hypothetical protein EUGRSUZ_K00113 [Eucalyptus grandis]
Length=372

 Score =   382 bits (980),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/361 (52%), Positives = 240/361 (66%), Gaps = 7/361 (2%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA-KPK  202
             + +  LL  L     SDD IPIPA+K +VN+WF  N+Q    RK  L+P L  AEA  PK
Sbjct  15    IAILSLLIALAQIAVSDDKIPIPADKSQVNAWFQQNVQAFEARKGTLDPNLEAAEAIPPK  74

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              IRV ++G GDFKT+ EAI+S+P GN+QRVI+SI  G Y E++ I R KPF++L+G   D
Sbjct  75    VIRVSQDGSGDFKTVTEAINSIPAGNSQRVIVSIAGGVYKEKITIERTKPFVTLYGSPND  134

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TA Q GTV SA++IVE DYF+ + + I NSAPRPDGK  G QAVAL  SGD 
Sbjct  135   MPKLTYSGTAQQYGTVDSASIIVESDYFVGANLIIENSAPRPDGKAAGGQAVALRTSGDK  194

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R+ GFQDT CDD+G HFFKD YIEGTVDFIFG+G ++Y++TEL V+    ++V+
Sbjct  195   AAFYNCRMLGFQDTLCDDRGFHFFKDCYIEGTVDFIFGSGTSIYLNTELRVLGDSGLSVI  254

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV-  919
             TAQA+ +  EDTGYS  HC +TG G G  LGR WM   RV+F+Y ++S  I P GW    
Sbjct  255   TAQARQSNTEDTGYSLVHCSITGTGNGTFLGRAWMPSPRVIFSYTDMSSVINPLGWSDNF  314

Query  920   -PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              P +     T  F EYK +G G+    R  F K++ D +V+ FIS  +I  SKWLLPP +
Sbjct  315   HPERQR---TVTFAEYKCSGEGSTPAGRAKFAKQLSDADVQTFISLSYIVGSKWLLPPPR  371

Query  1097  V  1099
             V
Sbjct  372   V  372



>ref|XP_007218171.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
 gb|EMJ19370.1| hypothetical protein PRUPE_ppa007533mg [Prunus persica]
Length=364

 Score =   381 bits (979),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 249/359 (69%), Gaps = 3/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             VN  + +T++L +      +DD  P+PA++ +VN+WF++N++P + R+  L+P LAKAEA
Sbjct  3     VNAALTMTLIL-FTATIAMADDHTPVPADQSQVNTWFNNNVKPYTARRGTLDPTLAKAEA  61

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
               K I+V KNG G FKTI +A++S+P GNT+RVI+ IG G Y E++ I R KPF++ +G 
Sbjct  62    SQKVIKVMKNGSGQFKTITDAVNSIPAGNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGS  121

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++    T+ + GTV SATVI E DYF+A+ + I NS+PRPDGKR GAQAVAL  S
Sbjct  122   PTNMPTLTFAGTSQKYGTVNSATVIAESDYFVAANVIIKNSSPRPDGKRVGAQAVALRVS  181

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ +A YN +L GFQDT CDD+G H FKD +IEGTVDFI+G+GK+LY++TELHV+  + +
Sbjct  182   GNKSALYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGL  241

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HCK+TG G G  LGR W     VV+AY  ++  I P GW 
Sbjct  242   TVITAQARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAGWS  301

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                       T ++GEYK +GPG+    R  + K + D+++K F+S G+I+ SKWLLPP
Sbjct  302   D-NNHPERDSTVFYGEYKCSGPGSSAVGREKYTKHLTDEQIKPFLSLGYIQGSKWLLPP  359



>ref|XP_009362793.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 251/359 (70%), Gaps = 4/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEA  193
             V+  +++T+LL        +DD+ P+PA   +VN+WF++N++P + R K L+P +  AEA
Sbjct  3     VHAALIMTILLSATI--AMADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAVVTAEA  60

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
               K I+V ++GKG+FKT+ +AI+S+P GNT+RVI+ IG G Y E++ I R KPF++L+G 
Sbjct  61    GQKVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGTGEYKEKITIPRNKPFVTLYGS  120

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P +    TA + GTV SAT+I E DYF+A+ +NI NS+PRPDGKR GAQAVAL  S
Sbjct  121   PTNMPILTFDGTAQKYGTVNSATIIAESDYFVAANLNIKNSSPRPDGKRVGAQAVALRVS  180

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ AA YN +L GFQDT CDD+G H FKD YIEGTVDFI+G+GK+LY++TELHV+  + +
Sbjct  181   GNKAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDNGI  240

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HCK+TG G G  LGR W A  +VV+AY  ++  + P GW 
Sbjct  241   TVITAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNMTKVVNPAGWS  300

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                  +    T  +GEYK  GPG+    + N  K++ D++ K+FIS G+I+ SKWLLPP
Sbjct  301   N-DNHSERDKTVSYGEYKCMGPGSSKNNKRNLSKELTDEQAKRFISLGYIQGSKWLLPP  358



>gb|AAX11262.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   377 bits (968),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 188/339 (55%), Positives = 238/339 (70%), Gaps = 3/339 (1%)
 Frame = +2

Query  89    PIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGKGDFKTIKEAIDS  265
             PIP N  E+ SWF   ++P S +K L P + +AE+   + I V ++G G FKTI +A+  
Sbjct  2     PIPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG-DDKDRPSIIGCSTAAQDGTVMSAT  442
             V  GNT+RVII+IGPG Y E++KI R  P+I+L+G D K+RP+I    TAA+ GTV SAT
Sbjct  62    VKVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  443   VIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKG  622
             +IVE DYF+ + + + NSAPRPDGKRKGA+A AL  SGD AAFYN +  GFQDT CDDKG
Sbjct  122   LIVESDYFVGANLIVSNSAPRPDGKRKGARASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  623   RHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCK  802
              H FKD YIEGTVDFIFG  ++LY++TELHV+ GD MA++TA A+   +   GYSF HCK
Sbjct  182   NHLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  803   VTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             VTG G  ALLGR W   +RVVF+YC +SDA+KPEGW     K     T +FGEYKNTGPG
Sbjct  242   VTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPG  300

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             A    R  + K++ + + K F S  +IEA+KWLLPP KV
Sbjct  301   AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLLPPPKV  339



>gb|KEH30561.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   377 bits (969),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 245/367 (67%), Gaps = 2/367 (1%)
 Frame = +2

Query  2     VRKKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPEL  178
             V K     + +  ++L +   GV SDD+IPIPA K +++SWF+SN+ P   RK+ L+P L
Sbjct  2     VSKTRTYAINIAIIVLLFTVKGVLSDDTIPIPAEKTQLDSWFNSNVGPLEQRKSALDPAL  61

Query  179   AKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFI  358
               AEA  K I+V ++G GDFKTI +AI+S+PTGNT+RVI+SIG GNY E++KI R KPF+
Sbjct  62    VTAEAGAKVIKVMQDGSGDFKTITDAINSIPTGNTKRVIVSIGGGNYNEKIKIERTKPFV  121

Query  359   SLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
             +L+G   + P++    TA Q GTV SAT+IVE DYF+A+ + I NSAPRPDGK  GAQAV
Sbjct  122   TLYGTPANMPNLTYGGTAKQYGTVDSATLIVESDYFVAANMLISNSAPRPDGKSAGAQAV  181

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             AL  SGD AAFYN +  GFQDT CDD+  HFFKD  I+GTVDFIFG+G +LY  +EL  +
Sbjct  182   ALRISGDKAAFYNCKFLGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYFKSELRAL  241

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIK  898
                   V+ AQA+ +  +   YSF HC VTG G    L R WM + +++FAY  +S+ + 
Sbjct  242   GDAGPTVIVAQARKSVSDADLYSFVHCDVTGTGSTTFLARAWMTYPKIIFAYSTMSNVVD  301

Query  899   PEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             P+GW        +  T+YFGEY+NTGP +    R    K++   EVK FI+ G I+ SKW
Sbjct  302   PKGWDNT-MHPEFDKTSYFGEYQNTGPKSDPKGRATVGKQLSAAEVKPFITLGMIQGSKW  360

Query  1079  LLPPAKV  1099
             LLPP KV
Sbjct  361   LLPPPKV  367



>ref|XP_009136508.1| PREDICTED: putative pectinesterase 63 isoform X1 [Brassica rapa]
Length=364

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 180/357 (50%), Positives = 248/357 (69%), Gaps = 3/357 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
              L++  +L+    P V+ +D+ PIP NK+ +  WF++N+   ++RK+ L+P L  AEA P
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVPSLASRKDTLDPALLTAEATP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V +NG+GDFKT+ EAI+SVP GN +RVII +G G Y E++ I R KPFI+L+GD  
Sbjct  67    RVIKVRQNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPN  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P +    TAA+ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+
Sbjct  127   AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRV  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GWH  
Sbjct  246   ITAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-  304

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               +T    T ++GEYK +GPG++   R  + + + + E   FIS G+I+ S WLLPP
Sbjct  305   NTQTERDKTVFYGEYKCSGPGSRKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPP  361



>ref|XP_008234142.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 245/356 (69%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L M  +LL        +DD  P+PA + +VN+WF++N++P + +K  L+P LA AEA   
Sbjct  14    LTMTLILLTATI--AMADDDTPVPAEQTQVNTWFNNNVKPYTEQKGTLDPALATAEAGQT  71

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G FKTI +AI+S+P GNT+RVI+ IG G Y E++ I R KPF++ +G   +
Sbjct  72    IIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSPTN  131

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA + GTV SATVI E DYFMA+ +   NS+PRPDGK  GAQAVAL  SG+ 
Sbjct  132   MPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSGNK  191

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A YN +L GFQDT CDDKG HFFKD +IEGTVDFI+G+GK+LY++TELHV+  + + V+
Sbjct  192   SALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTELHVVGDNGLTVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  +DTGYSF HCK+TG G G  LGR W     VVFAY  +S+ I P GW    
Sbjct  252   TAQARDSASDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPVGWSN-D  310

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +     T ++GEYK++GPG+ +  R  + K + D++VK F++ G+I+ SKWLLPP
Sbjct  311   NRPERDSTVFYGEYKSSGPGSSVAGRVKYTKHLTDEQVKPFLNLGYIQGSKWLLPP  366



>ref|XP_007222175.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 ref|XP_007224100.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
 gb|EMJ23374.1| hypothetical protein PRUPE_ppa007766mg [Prunus persica]
 gb|EMJ25299.1| hypothetical protein PRUPE_ppa015611mg [Prunus persica]
Length=356

 Score =   375 bits (964),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 244/356 (69%), Gaps = 8/356 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L+++T  +        +DD  PIPAN+ +VN+WF++N++P + R+  L+P LA AEA   
Sbjct  3     LILLTATI------AMADDDTPIPANQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQT  56

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G FKTI +AI+S+P  NT+RVI+ IG G Y E++ I R KPF++  G   +
Sbjct  57    VIKVMKDGSGQFKTITDAINSIPADNTKRVIVYIGEGKYEEKITIPRNKPFVTFFGSPTN  116

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA + GTV SATVIVE DYFMA+ + I NS+PRPDGK  GAQAVAL  SG+ 
Sbjct  117   MPTLTFAGTAQKYGTVNSATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNK  176

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A YN +L GFQDTFCDDKG HF KD +IEGTVDFI+G+GK+LY++ ELHV+  + + V+
Sbjct  177   SALYNCKLIGFQDTFCDDKGNHFLKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVI  236

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  +DTGYSF HCK+TG G G  LGR W     VVFAY  +S+ I P GW    
Sbjct  237   TAQARDSSSDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSD-D  295

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                    T ++GEYK +GPG+    R  + K++ D+++K F+S G+I+ SKWLLPP
Sbjct  296   NHPERDNTVFYGEYKCSGPGSSAAGRVKYTKQLTDEQIKPFLSLGYIQGSKWLLPP  351



>ref|XP_011014352.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=364

 Score =   375 bits (962),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 191/360 (53%), Positives = 245/360 (68%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  M  +LL  +   V SDD  PIPA+   +N+WF  N++P + RK  ++P L  AEAKP
Sbjct  8     QCAMTAILL--VSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEAKP  65

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V ++G G+FKT+K+AI+S+PTGNT+RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  66    RTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERGKPFVTFLGSPS  125

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             ++P++    TA + GTV SAT+  E DYF+A+ I I NSAPRP+G+ KG QAVAL  SGD
Sbjct  126   NKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIIKNSAPRPNGELKGEQAVALRISGD  185

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN RL GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TELHVI  +N   
Sbjct  186   KSAFYNCRLLGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGEENGNF  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A+++  EDTG+SF HCKV G G +GA LGR W A  RVVF+Y  +SD + PEGW  
Sbjct  246   ITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSDVVNPEGWSN  305

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P +     T  FGEYK  G GA    R    K++   +   FIS GFIE SKW+L P
Sbjct  306   NFHPERDQ---TALFGEYKCEGEGANPAGRAKASKQLTPDQAAPFISLGFIEGSKWVLHP  362



>ref|XP_008338559.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=370

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 179/360 (50%), Positives = 250/360 (69%), Gaps = 4/360 (1%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAE  190
             +V+  +++T+LL        +DD+ P+PA   +VN+WF++N++P + R K L+P +  AE
Sbjct  9     VVHAALIMTILLSATI--AMADDNTPVPAALSQVNTWFNNNVKPYTQRQKTLDPAVVTAE  66

Query  191   AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG  370
             A  K I+V ++GKG+FKT+ +AI+S+P GNT+RVI+ IG G Y E++ I R KPF++L+G
Sbjct  67    AGQKVIKVMQDGKGNFKTVTDAINSIPAGNTKRVIVYIGSGEYKEKITIPRNKPFVTLYG  126

Query  371   DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
                + P +    TA + GTV SATVI E DYF+A+ + I NS+PRPDGKR GAQAVAL  
Sbjct  127   SPTNMPILTFDGTAQKYGTVNSATVIAESDYFVAANLIIKNSSPRPDGKRVGAQAVALRV  186

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
             SG+ AA YN +L GFQDT CDD+G H FKD YIEGTVDFI+G+GK+LY++ ELHV+  + 
Sbjct  187   SGNKAALYNCKLFGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNXELHVLGDNG  246

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             + V+TAQA+ +  EDTGYSF HCK+TG G G  LGR W A  +VV+AY  ++  + P GW
Sbjct  247   ITVITAQARDSDSEDTGYSFVHCKITGTGIGTYLGRAWRARPQVVYAYTNMTKVVNPAGW  306

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                   +    T  +GEYK  GPG+    + N  K++ D++ K+FIS G+I+ SKWLLPP
Sbjct  307   SN-DNHSERDKTVSYGEYKCMGPGSSKNNKRNLSKELTDEQAKRFISLGYIQGSKWLLPP  365



>ref|XP_004516439.1| PREDICTED: pectinesterase PPME1-like [Cicer arietinum]
Length=367

 Score =   374 bits (961),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 239/344 (69%), Gaps = 2/344 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKT  244
             V SDD+  +PA + EV+SWF+SNI P   RK+ L+P L  AEA    ++V ++G GDFK+
Sbjct  24    VLSDDNAAVPAERAEVDSWFNSNIGPLEQRKSTLDPALVTAEANATIVKVNQDGSGDFKS  83

Query  245   IKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG  424
             I +AI+S+P+GNTQRVI++IG GNY E++KI + KPFI+  G   + P++    TA + G
Sbjct  84    ITDAINSIPSGNTQRVILNIGGGNYQEKIKIEKTKPFITFIGTPSNMPNLTYGGTAQEYG  143

Query  425   TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDT  604
             TV SAT+IVE DYF+AS I I NSAPRPDGK+ GAQAVA+  +GD AAFYN +  GFQDT
Sbjct  144   TVDSATLIVESDYFVASNIMISNSAPRPDGKKSGAQAVAMRITGDKAAFYNCKFLGFQDT  203

Query  605   FCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGY  784
              CDDK  HFFKD  I+GTVDFIFGNG++LY+  EL V+    M V+ AQA+ +  E + Y
Sbjct  204   ICDDKNIHFFKDCLIQGTVDFIFGNGRSLYLKNELRVLGNAEMTVIVAQARKSESEKSLY  263

Query  785   SFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEY  964
             +F HC VTG G G  LGR WMA+S+V+FAY  +S  + P GW        Y  T+YFGEY
Sbjct  264   TFVHCDVTGTGTGTYLGRAWMAYSKVIFAYSTLSSVLNPLGWSN-NRHPEYDKTSYFGEY  322

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              NTGPGA    R    +++ D EVK F++ G IEASKWLLPP K
Sbjct  323   MNTGPGADTKGRAPITRQLTDAEVKPFLTLGSIEASKWLLPPPK  366



>ref|XP_007038213.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
 gb|EOY22714.1| Pectinesterase, putative isoform 1 [Theobroma cacao]
Length=368

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 246/359 (69%), Gaps = 8/359 (2%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEAKPKHI  208
             + T+L+  L P V S +S PIP +K ++ +WF++NI+P S R   ++P LAKAE     I
Sbjct  15    ICTILV--LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAAHII  72

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
             +V K+G GDF TI +AI SVP+GNT+RVIISIG G+Y E+++I R KPFI+ +GD ++ P
Sbjct  73    KVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPRNMP  132

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
             ++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPDG   GAQAV+L  SGD AA
Sbjct  133   NLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGDKAA  192

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FYN ++ GFQDT CDD+G HFFKD YI GTVDFIFG+GK+LY++T L+V     + V+TA
Sbjct  193   FYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTVITA  252

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--P  922
             QA+ +  E+TGYSF HC VTG   GA LGR W    RVVFAY  +S  I P GW     P
Sbjct  253   QARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTNMSSVIHPLGWSDNLHP  312

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
              +     T +FGEYK  G GA  + R  + K++ D E K F+  GFI+ +KWLLPP +V
Sbjct  313   ERAK---TVFFGEYKCKGKGASFSGREKYAKRLTDGEAKPFLVLGFIDGAKWLLPPPRV  368



>gb|ACO34813.1| Sal k 1 pollen allergen [Salsola kali]
Length=339

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 236/338 (70%), Gaps = 3/338 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGKGDFKTIKEAIDSV  268
             IP N  E+ SWF   ++P S +K L P + +AE+   + I V ++G G FKTI +A+  V
Sbjct  3     IPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKHV  62

Query  269   PTGNTQRVIISIGPGNYTERLKIVREKPFISLHG-DDKDRPSIIGCSTAAQDGTVMSATV  445
               GNT+RVII+IGPG Y E++KI R  P+I+L+G D K+RP+I    TAA+ GTV SAT+
Sbjct  63    KVGNTKRVIITIGPGEYREKVKIERLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSATL  122

Query  446   IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGR  625
             IVE DYF+ + + + NSAPRPDGKRKGAQA AL  SGD AAFYN +  GFQDT CDDKG 
Sbjct  123   IVESDYFVGANLIVSNSAPRPDGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKGN  182

Query  626   HFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKV  805
             H FKD YIEGTVDFIFG  ++LY++TELHV+ GD MA++TA A+   +   GYSF HCKV
Sbjct  183   HLFKDCYIEGTVDFIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCKV  242

Query  806   TGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGA  985
             TG G  ALLGR W   +RVVF+YC +SDA+KPEGW     K     T +FGEYKNTGPGA
Sbjct  243   TGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPGA  301

Query  986   KLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                 R  + K++ + + K F S  +IEA+KWL PP KV
Sbjct  302   AADKRVPYTKQLTEADAKTFTSLEYIEAAKWLPPPPKV  339



>ref|XP_011076539.1| PREDICTED: pectinesterase 1-like [Sesamum indicum]
Length=623

 Score =   382 bits (982),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 239/336 (71%), Gaps = 2/336 (1%)
 Frame = +2

Query  89    PIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDS  265
             PIPANK ++NSWF  N+ P ++R+ +L+P + +AE     +RV  +G GDFKT+ +AI S
Sbjct  285   PIPANKAQLNSWFDRNVGPLASREGSLDPAVVEAEKNVTVVRVRTDGSGDFKTVTDAIKS  344

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATV  445
             VP GN  RVIISIGPGNYTE++KI R   FI+L+GD  + P ++   TAAQ GT+ SAT+
Sbjct  345   VPQGNKHRVIISIGPGNYTEKVKIDRYTHFITLYGDPNNMPVMLFDGTAAQFGTLESATL  404

Query  446   IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGR  625
              VE DYF A  + I+NSAP+PDGKR GAQAVA+  +G+ A+FYN R++GFQDT CDD+G+
Sbjct  405   TVESDYFSAVNLKIVNSAPKPDGKRVGAQAVAIKIAGEYASFYNCRMYGFQDTLCDDRGK  464

Query  626   HFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKV  805
             H FKD Y+EGTVDFIFG+G++LY+++E+HVI GD ++ + A ++    E  GY F HC+V
Sbjct  465   HLFKDCYVEGTVDFIFGSGQSLYLNSEIHVIPGDPVSFIAAHSRSKHNEANGYVFVHCRV  524

Query  806   TGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGA  985
             TG    A L R W  + RV+FAY ++SDA+ P+GW    G+ H   T YFGEY N GPG+
Sbjct  525   TGTNGTAYLARSWFPYGRVIFAYSQLSDAVNPQGWSN-NGQNHTDSTVYFGEYHNEGPGS  583

Query  986   KLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPA  1093
              L+ R  + K   D EVK FIS  +IE SKWLLPPA
Sbjct  584   DLSKRAAYGKVSSDAEVKSFISIAYIEGSKWLLPPA  619



>gb|KHN29928.1| Pectinesterase PPME1-like protein [Glycine soja]
Length=369

 Score =   374 bits (960),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/362 (51%), Positives = 245/362 (68%), Gaps = 3/362 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAK  184
             K +   + VT+++ +L   V FSDD++PIPANK ++ +WF +N+ P   RK+ ++P L  
Sbjct  4     KTICTTIQVTLIVAFLTTQVVFSDDTVPIPANKAQLGTWFSTNVGPLDQRKSTMDPALVA  63

Query  185   AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             AE   K ++V ++G G+FKTI +AI+S+P+GNT+RVI+ IG GNY E++KI + KPFI+L
Sbjct  64    AEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITL  123

Query  365   HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
             +G  +  P++    TA + GTV SAT+IVE DYF+A+ I I NSAPRPDGK +G QAVAL
Sbjct  124   YGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVAL  183

Query  545   TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
               SGD AAFYN +  GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LY+ TEL  +  
Sbjct  184   RISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGD  243

Query  725   DNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPE  904
               + V+ AQA+ +  ED  YSF HC VTG G G  LGR WM   RVVFAY  +S  +K E
Sbjct  244   TGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVVKKE  303

Query  905   GWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             GW       H      FGEY+NTGPGA    R     ++ + +VK +I+ G IE SKWLL
Sbjct  304   GWSNNNHPEH-DKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSKWLL  362

Query  1085  PP  1090
             PP
Sbjct  363   PP  364



>ref|XP_007215602.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
 gb|EMJ16801.1| hypothetical protein PRUPE_ppa007761mg [Prunus persica]
Length=356

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/356 (50%), Positives = 244/356 (69%), Gaps = 8/356 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L+++T  +        +DD  P+PA++ +VN+WF++N++P + R+  L+P LA AEA   
Sbjct  3     LILLTATI------AMADDDTPVPADQSQVNTWFNNNVKPYTERQGTLDPALATAEAGQT  56

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G FKTI +AI+S+P  NT+RVI+ IG G Y E++ I R KPF++ +G   +
Sbjct  57    VIKVMKDGSGQFKTITDAINSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFYGSPTN  116

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA + GTV SATVIVE DYFMA+ + I NS+PRPDGK  GAQAVAL  SG+ 
Sbjct  117   MPTLTFTGTAQKYGTVNSATVIVESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNK  176

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A YN +L GFQDT CDDKG HFFKD +IEGTVDFI+G+GK+LY++ ELHV+  + + V+
Sbjct  177   SALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVI  236

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  +DTGYSFAHC +TG G G  LGR W     VVFAY  +S  I P GW    
Sbjct  237   TAQARDSASDDTGYSFAHCNITGTGNGTYLGRAWRISPMVVFAYTSMSKVINPAGWSN-D  295

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                    T ++GEYK +GPG+ +  R  ++K M D+++K F+S  +I+ SKWLLPP
Sbjct  296   NHPERDNTVFYGEYKCSGPGSSVAGRVKYIKHMTDEQIKPFLSLDYIQGSKWLLPP  351



>ref|XP_008219199.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=374

 Score =   374 bits (959),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 242/356 (68%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L M  +LL        +DD  P+PA++ +VN+WF++N++P + R+  L+P LA AEA   
Sbjct  17    LTMTLILLTATI--AMADDDTPVPADQPQVNTWFNNNVKPYTERQGTLDPALATAEAGQT  74

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G FKTI +AI+S+P  NT+RVI+ IG G Y E++ I R KPF++  G   +
Sbjct  75    VIKVMKDGSGQFKTITDAINSIPADNTKRVIVYIGEGEYEEKITIPRNKPFVTFFGSPTN  134

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA + GTV SATVI E DYFMA+ + I NS+PRPDGK  GAQAVAL  SG+ 
Sbjct  135   MPTLTFAGTAQKYGTVNSATVIAESDYFMAANVIIKNSSPRPDGKAVGAQAVALRVSGNK  194

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A YN +L GFQDT CDDKG HFFKD +IEGTVDFI+G+GK+LY++ ELHV+  + + V+
Sbjct  195   SALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNNELHVVGDNGLTVI  254

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  +DTGYSF HCK+TG G G  LGR W     VVFAY  +S+ I P GW    
Sbjct  255   TAQARDSASDDTGYSFVHCKITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSN-D  313

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +     T ++GEYK +GPG+    R  + K + D+++K F+S G+I+ SKWLLPP
Sbjct  314   NRPERDNTVFYGEYKCSGPGSSAAGRVKYTKHLTDEQIKPFLSLGYIQGSKWLLPP  369



>ref|XP_008234143.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   373 bits (958),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 244/356 (69%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L M  +LL        +DD  P+PA++ +VN+WF++N++P + ++  L+P LA AEA   
Sbjct  14    LTMTLILLTATI--AMADDDTPVPADQSQVNTWFNNNVKPYTEQQGTLDPALATAEAGQT  71

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G FKTI +AI+S+P GNT+RVI+ IG G Y E++ I R KPF++ +G   +
Sbjct  72    VIKVMKDGSGQFKTITDAINSIPAGNTKRVIVYIGGGEYEEKITIPRNKPFVTFYGSPTN  131

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA + GTV SATVI E DYFMA+ +   NS+PRPDGK  GAQAVAL  SG+ 
Sbjct  132   MPTLTFGGTAQKYGTVNSATVIAESDYFMAANVIFKNSSPRPDGKAVGAQAVALRVSGNK  191

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A YN +L GFQDT CDDKG HFFKD +IEGTVDFI+G+GK+LY++T LHV+  + + V+
Sbjct  192   SALYNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIWGSGKSLYLNTRLHVVGDNGLTVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  +DTGYSF HC +TG G G  LGR W     VVFAY  +S+ I P GW    
Sbjct  252   TAQARDSASDDTGYSFVHCSITGTGNGTYLGRAWRISPMVVFAYTSMSEVINPAGWSN-D  310

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +     T ++GEYK++GPG+ +  R  + K + D++VK F++ G+I+ SKWLLPP
Sbjct  311   NRPERDSTVFYGEYKSSGPGSSVAGRVKYTKHLTDEQVKPFLNLGYIQGSKWLLPP  366



>ref|XP_004287800.1| PREDICTED: probable pectinesterase 48-like [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   373 bits (957),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 184/364 (51%), Positives = 249/364 (68%), Gaps = 7/364 (2%)
 Frame = +2

Query  5     RKKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELA  181
             R  +   L+M+T +L  L   V   D   IP++K  V+ WF  N++P + RK+ L+P+L 
Sbjct  7     RMSIHAALMMITTVL--LAATVSMADDPVIPSDKSAVDKWFQDNVKPLADRKSSLDPDLV  64

Query  182   KAE-AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFI  358
             KAE   PK ++V  NG GDFK I EAIDS+P  NT+RVII +G G Y E++ I + KPF+
Sbjct  65    KAEDGDPKIVKVMANG-GDFKKISEAIDSIPASNTKRVIIYVGGGVYNEKITIPKNKPFV  123

Query  359   SLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
             +L GD K+ P++     +A+ GT+ SAT+ VE DYF+   +NIINS+PRPDGK++GAQA+
Sbjct  124   TLMGDSKNMPNLTFNGDSAKYGTLYSATLSVESDYFVGVNLNIINSSPRPDGKKEGAQAL  183

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             AL  SG+ AA YN ++ GFQDT CDD+G HF KDSY+EGTVDFIFG+GK+LY++T ++V+
Sbjct  184   ALKLSGNKAALYNCQMFGFQDTLCDDQGNHFIKDSYVEGTVDFIFGSGKSLYLNTHINVL  243

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIK  898
                 M V+TA A+   +ED GYSF HC +TG G G  LGR W A  +V FAY E+ + +K
Sbjct  244   GDSGMTVITANAREG-DEDKGYSFVHCSITGTGSGTFLGRAWRAAPKVTFAYTEMGEVVK  302

Query  899   PEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             PEGW        Y  +  FGEYKNTGPG+ ++ R +F K++ D + K FIS GFI+ SKW
Sbjct  303   PEGWTD-NNHPEYDKSVSFGEYKNTGPGSSMSKRVSFTKELSDADAKPFISLGFIDGSKW  361

Query  1079  LLPP  1090
             LLPP
Sbjct  362   LLPP  365



>ref|XP_002318197.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
 gb|EEE96417.1| hypothetical protein POPTR_0012s12720g [Populus trichocarpa]
Length=364

 Score =   372 bits (955),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 243/360 (68%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +  +LL  +   V SDD  PIPA+   +N+WF  N++P + RK  ++P L  AEAKP
Sbjct  8     QCALTAILL--VSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEAKP  65

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V ++G G+FKT+K+AI+S+PTGNT+RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  66    RTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVTFLGSPS  125

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             ++P++    TA + GTV SAT+  E DYF+A+ I   NSAPRP+G+ KG QAVAL  SGD
Sbjct  126   NKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVALRISGD  185

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN RL GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TELHVI  +N   
Sbjct  186   KSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDENGNF  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A+++  EDTG+SF HCKV G G +GA LGR W A  RVVF+Y  +S  + PEGW  
Sbjct  246   ITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVVNPEGWSN  305

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P +     T  FGEYK  G GA    R    K++   +   FIS GFIE SKWLL P
Sbjct  306   NFHPERDQ---TALFGEYKCEGEGANPAGRAKATKQLTPDQAAPFISLGFIEGSKWLLHP  362



>ref|XP_002318199.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
 gb|EEE96419.2| hypothetical protein POPTR_0012s11460g [Populus trichocarpa]
Length=364

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 189/360 (53%), Positives = 243/360 (68%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +  +LL  +   V SDD  PIPA+   +N+WF  N++P + RK  ++P L  AEAKP
Sbjct  8     QCAITAILL--VSTTVSSDDKSPIPADPSSLNTWFQDNVKPLADRKGTIDPALEAAEAKP  65

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V ++G G+FKT+K+AI+S+PTGNT+RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  66    RTIKVRQDGSGEFKTLKDAINSIPTGNTERVIVDIGPGEYIEKLKIERSKPFVTFLGSPS  125

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             ++P++    TA + GTV SAT+  E DYF+A+ I   NSAPRP+G+ KG QAVAL  SGD
Sbjct  126   NKPTLSFDGTAKEYGTVYSATLEAEADYFVAANIIFKNSAPRPNGELKGEQAVALRISGD  185

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN RL GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TELHVI  +N   
Sbjct  186   KSAFYNCRLIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDENGNF  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A+++  EDTG+SF HCKV G G +GA LGR W A  RVVF+Y  +S  + PEGW  
Sbjct  246   ITAHARNSEAEDTGFSFVHCKVDGTGAKGAYLGRAWQARPRVVFSYTTMSSVVNPEGWSN  305

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P +     T  FGEYK  G GA    R    K++   +   FIS GFIE SKWLL P
Sbjct  306   NFHPERDQ---TALFGEYKCEGEGANPAGRAKATKQLTPDQAAPFISLGFIEGSKWLLHP  362



>ref|XP_009363888.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=363

 Score =   372 bits (954),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 178/359 (50%), Positives = 249/359 (69%), Gaps = 4/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
             V+  +++T+LL        +DD+ PIP++  ++N+WF++N++P + R++ L+P +  AEA
Sbjct  3     VHAALIMTILLTATV--ATADDNAPIPSDHSQINTWFNNNVKPYTERQSTLDPAIVTAEA  60

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 I+V ++GKGDFKTI +AI+S+P GNT+RVI+ IG G Y E++ I R KPF++L+G 
Sbjct  61    GQTVIKVMQDGKGDFKTITDAINSIPAGNTKRVIVHIGGGEYNEKITIPRNKPFVTLYGS  120

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++    TA + GTV SATVI E DYF+A  + I NS+PRPDGKR GAQAVAL  S
Sbjct  121   PTNMPNLTFDGTAQKYGTVNSATVIAESDYFIAINLLIKNSSPRPDGKRVGAQAVALRVS  180

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ +A YN +L GFQDT CDD+G H FKD YIEGTVDFI+G+GK+LY++TELHV+    +
Sbjct  181   GNNSALYNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGI  240

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HC VTG+G G  LGR W    +VV+AY  +++ + P GW 
Sbjct  241   TVITAQARDSASEDTGYSFVHCNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWS  300

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                       T  +GEYK  GPG+    + N  K++ D++VK FIS G+I+ SKWLLPP
Sbjct  301   N-DNHPERDNTVSYGEYKCMGPGSSTYNKRNLSKELTDEQVKPFISLGYIQGSKWLLPP  358



>ref|XP_003518804.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 245/362 (68%), Gaps = 3/362 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAK  184
             K +   + VT+++ +L   V FSDD++PIPA+K ++ +WF +N+ P   RK+ ++P L  
Sbjct  4     KTICTTIQVTLIVAFLTTQVVFSDDTVPIPAHKAQLGTWFSTNVGPLDQRKSTMDPALVA  63

Query  185   AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             AE   K ++V ++G G+FKTI +AI+S+P+GNT+RVI+ IG GNY E++KI + KPFI+L
Sbjct  64    AEEGAKVVKVMQDGSGEFKTITDAINSIPSGNTKRVIVYIGAGNYNEKIKIEKTKPFITL  123

Query  365   HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
             +G  +  P++    TA + GTV SAT+IVE DYF+A+ I I NSAPRPDGK +G QAVAL
Sbjct  124   YGVPEKMPNLTFGGTALKYGTVDSATLIVESDYFVAANIIISNSAPRPDGKIQGGQAVAL  183

Query  545   TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
               SGD AAFYN +  GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LY+ TEL  +  
Sbjct  184   RISGDKAAFYNCKFFGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYLSTELRTLGD  243

Query  725   DNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPE  904
               + V+ AQA+ +  ED  YSF HC VTG G G  LGR WM   RVVFAY  +S  +K E
Sbjct  244   TGITVIVAQARKSPTEDNAYSFVHCDVTGTGNGTFLGRAWMPHPRVVFAYSTMSAVVKKE  303

Query  905   GWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             GW       H      FGEY+NTGPGA    R     ++ + +VK +I+ G IE SKWLL
Sbjct  304   GWSNNNHPEH-DKNVRFGEYQNTGPGADPKGRAAITTQLNEMQVKPYITLGMIEGSKWLL  362

Query  1085  PP  1090
             PP
Sbjct  363   PP  364



>ref|XP_009122341.1| PREDICTED: pectinesterase PPME1 [Brassica rapa]
 gb|AGX13882.1| pectin methylesterase [Brassica rapa subsp. chinensis]
Length=365

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 242/360 (67%), Gaps = 3/360 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +++ ++ P V +DD+ PIP  K +V  WF +N+ P   RK L+P L  AEA+P
Sbjct  5     NVSILLALVVVFVTPTVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +AI SVP  NT+RVII I PG Y E++ I R KPFI+L GD K
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
             MAAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G +LY+ T+LHV+ GD + V
Sbjct  184   MAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + +E +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                 H   T ++GEYK  G G++   R  F +K+      +F++ G+IE SKWLLPP  V
Sbjct  303   KIAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPPPAV  361



>gb|KEH17536.1| pectinesterase-like protein [Medicago truncatula]
 gb|KEH17537.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 177/366 (48%), Positives = 247/366 (67%), Gaps = 5/366 (1%)
 Frame = +2

Query  5     RKKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELA  181
             R  M+N  ++V + +  +     SDD+IP+PAN+ +V+SWF++N+ P   RK+ L+P L 
Sbjct  6     RTYMINVAIIVALFMVNVA---LSDDTIPVPANRAQVDSWFNTNVGPLEQRKSTLDPALV  62

Query  182   KAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFIS  361
              AEA  K I+V ++G GDFKTI +AI+S+PTGNT RVI++IG G+Y E++KI R KPF++
Sbjct  63    TAEAGAKVIKVMQDGSGDFKTITDAINSIPTGNTVRVIVNIGGGSYNEKIKIDRTKPFVT  122

Query  362   LHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVA  541
             L+G   + P++    TA Q GTV SAT+I E DYF+A+ I + NSAPRPDGK  G QAVA
Sbjct  123   LYGAPGNMPNLTYGGTAKQYGTVDSATLIAESDYFVAANILVSNSAPRPDGKTAGGQAVA  182

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
             L  SGD AAFYN +  GFQDT CDD+  H FKD  I+GTVDFIFG+G +LY+ +EL  ++
Sbjct  183   LRISGDKAAFYNCKFFGFQDTICDDRHNHIFKDCVIQGTVDFIFGSGTSLYLKSELRALD  242

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
                  V+ AQA+ T  +   YSF HC +TG G    L R WM + ++++AY  +++ + P
Sbjct  243   DTGPTVIVAQARKTASDADLYSFVHCDITGTGSSTFLARAWMTYPKIIYAYSTMTNVVNP  302

Query  902   EGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
             +GW        +  T+YFGEY+NTGP +    R +  K++ + EVK FI+ G I+ASKWL
Sbjct  303   KGWDNA-MHPEFDKTSYFGEYQNTGPKSDPKGRASVAKQLTEAEVKPFITLGMIQASKWL  361

Query  1082  LPPAKV  1099
             LPP KV
Sbjct  362   LPPPKV  367



>emb|CDX70037.1| BnaA10g23860D [Brassica napus]
Length=365

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 242/360 (67%), Gaps = 3/360 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +++ ++ P V +DD+ PIP  K +V  WF +N+ P   RK L+P L  AEA+P
Sbjct  5     NVSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +AI SVP  NT+RVII I PG Y E++ I R KPFI+L GD K
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAANTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKMKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
             MAAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G +LY+ T+LHV+ GD + V
Sbjct  184   MAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + +E +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSADEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                 H   T ++GEYK  G G++   R  F +K+      +F++ G+IE SKWLLPP  V
Sbjct  303   KIAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPPPAV  361



>ref|XP_010423212.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 242/357 (68%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF +N+ P + RK L+P L  AEA P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPEAKPQVEQWFKANVGPLAQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+F T+  AI SVP GNT+RVII I PG+Y E++ I R +PFI+L G   
Sbjct  65    RIINVNPKG-GEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P II   TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVIIFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + EE +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F++++   E  +F+S G+I+ SKWLLPP
Sbjct  303   KTPAH-DKTVFYGEYKCSGPGSISAKRVPFIQEIDPTEANRFLSLGYIQGSKWLLPP  358



>ref|XP_002511045.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51647.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=366

 Score =   370 bits (951),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 242/367 (66%), Gaps = 11/367 (3%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPG-------VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLN  169
             M  Q+  +  + HY+          V SDD+ PIPA +D++NSWF +N++P S+RK  L+
Sbjct  1     MAKQITYIGAI-HYVIAATLLAATTVISDDATPIPAAEDQINSWFQANVKPFSSRKGTLD  59

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P L  AE  PK I+V  +G GDFK++ +A+ S+P+GN  RVI+ IG G YTE++ I R K
Sbjct  60    PALEAAETAPKRIKVRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGAGVYTEKVIIDRIK  119

Query  350   PFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGA  529
             PF++L G     P++    TA + GTV SAT+ VE DYF+A+ I I N+APRPDG R GA
Sbjct  120   PFVTLLGSSNPMPTLQFDGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDG-RAGA  178

Query  530   QAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTEL  709
             QAVAL  +GD  AFYN R+ GFQDT CDDKGRHFFKD YIEGTVDFIFG+GK+LY+ T L
Sbjct  179   QAVALRVAGDKTAFYNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTNL  238

Query  710   HVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISD  889
             +VI+   M V+TAQA+HT  ED+G+SF H  + G    A LGR WM    VVF+Y ++S+
Sbjct  239   NVIKEKFMTVITAQAKHTSSEDSGFSFVHSNIAGDATDAYLGRAWMEMPEVVFSYSKMSN  298

Query  890   AIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
              + P GW             +F EYK +GPGA  + R  F K++ D E K FIS G+I+ 
Sbjct  299   VVIPAGWSNY-NHPEREKNIFFAEYKCSGPGANPSGRAKFSKQLSDSEAKSFISLGYIQG  357

Query  1070  SKWLLPP  1090
              KWLLPP
Sbjct  358   CKWLLPP  364



>ref|XP_006394480.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
 gb|ESQ31766.1| hypothetical protein EUTSA_v10004453mg [Eutrema salsugineum]
Length=364

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 182/356 (51%), Positives = 244/356 (69%), Gaps = 4/356 (1%)
 Frame = +2

Query  29    VMVTVLLHYL-CPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             ++VT+LL  +  P V  +D+ PIP NK  +  WF++N+   ++RK  L+P L  AEA P+
Sbjct  8     LIVTILLVVITSPIVSGNDASPIPQNKRRIEQWFNTNVPSLASRKGTLDPALLTAEASPR  67

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V +NG+G FKT+ EAI SVP GNT+RVII +GPG Y E++ I R KPFI+L+G    
Sbjct  68    VIKVKQNGRGHFKTLTEAIKSVPAGNTRRVIIKLGPGVYKEKITIDRNKPFITLYGHPNA  127

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TAAQ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+ 
Sbjct  128   MPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGNK  187

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  188   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLRTQLNVV-GDGLRVI  246

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA A  +  E +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW    
Sbjct  247   TAHAGKSAAEKSGYSFVHCKVTGTGTGVYLGRAWMSHPKVVYAYTDMSSVVNPSGWQD-N  305

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             G+T    T ++GEYK +GPG+    R  + + + + E   FIS G+I+ S WLLPP
Sbjct  306   GQTERDKTVFYGEYKCSGPGSNKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPP  361



>emb|CDP19851.1| unnamed protein product [Coffea canephora]
Length=309

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/299 (58%), Positives = 226/299 (76%), Gaps = 3/299 (1%)
 Frame = +2

Query  17   VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
            +N+ ++ + LL    P V SDD++P PA+K ++NSWF  N+QP ++RK+ L+P L  AEA
Sbjct  3    LNKAILFSTLL--FIPLVLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEA  60

Query  194  KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
             P+ I++  +G G+FKTI +AI+S+P  NT RVIIS+GPGNYTE++KI R KPFI++ GD
Sbjct  61   NPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGD  120

Query  374  DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
                P+++   TAA+ GTV SAT+IVE DYF A+ + + NSAPRP+G  KGAQA+A+   
Sbjct  121  PNHMPTLVFGGTAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIG  180

Query  554  GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
            GD A+FYN +  GFQDT CDDKG+H FKD YIEGTVDFIFGNGK++Y++ ELHVI GD  
Sbjct  181  GDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDRQ  240

Query  734  AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
            A +TAQA+HT  EDTGYSF HCKVTG G  A LGR WM + +VVFAY ++SDA+ P+GW
Sbjct  241  AWITAQARHTDAEDTGYSFVHCKVTGTGRTAYLGRTWMPYGKVVFAYTDMSDAVIPDGW  299



>ref|XP_010452707.1| PREDICTED: pectinesterase PPME1 [Camelina sativa]
Length=361

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 241/357 (68%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF +N+ P + RK L+P L  AEA P
Sbjct  5     NVSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLAQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+F T+  AI SVP GNT+RVII I PG+Y E++ I R +PFI+L G   
Sbjct  65    RIINVNPKG-GEFTTLTAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + EE +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F++++   E  +F+S G+I+ SKWLLPP
Sbjct  303   KTPAH-DKTVFYGEYKCSGPGSLSAKRVPFIQEIDPTEANRFLSLGYIQGSKWLLPP  358



>emb|CDX98975.1| BnaC09g48600D [Brassica napus]
Length=365

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/360 (50%), Positives = 242/360 (67%), Gaps = 3/360 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +++ ++ P V +DD+ PIP  K +V  WF +N+ P   RK L+P L  AEA+P
Sbjct  5     NVSILLALVVVFVTPMVLADDATPIPEAKVQVEQWFEANVAPLPARKGLDPALVAAEAEP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +AI SVP  NT+RVII I PG Y E++ I R KPFI+L GD K
Sbjct  65    RTITVDPKG-GEFKTLMDAIKSVPAENTKRVIIKIAPGEYREKVTIDRNKPFITLMGDPK  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIIVKNTAPAPDGKAKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G +LY+ T+LHV+ GD + V
Sbjct  184   KAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSLYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  ++EE +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSKEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                 H   T ++GEYK  G G++   R  F +K+      +F++ G+IE SKWLLPP  V
Sbjct  303   KIAAH-DKTVFYGEYKCQGEGSQTEKRVPFTQKIDPTVANRFLTLGYIEGSKWLLPPPAV  361



>gb|KDP22496.1| hypothetical protein JCGZ_26327 [Jatropha curcas]
Length=651

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 239/342 (70%), Gaps = 3/342 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKT  244
             V S+D+ PIP +K +V SWF ++++P ++RK  LN  L  AEAKPK I+V ++G G+FKT
Sbjct  311   VCSNDATPIPPDKSQVQSWFAAHVKPLASRKGTLNSTLEAAEAKPKTIKVRQDGSGNFKT  370

Query  245   IKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG  424
             I +A++SVP  N QRVII IGPG YTE++ I REKPFI+  G  K      G  TAA+ G
Sbjct  371   ITDAVNSVPAKNAQRVIIDIGPGVYTEKVTIPREKPFITFRGPPKMATLQFG-GTAAKYG  429

Query  425   TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDT  604
             TV SAT+ VE ++F+A+ + I N+AP+PDGKRKGAQAVAL     M AFYNVRL GFQDT
Sbjct  430   TVYSATLQVESEFFVAANLIIKNTAPQPDGKRKGAQAVALRTGASMQAFYNVRLLGFQDT  489

Query  605   FCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGY  784
              CDDKG HFFKD YIEGTVDFIFG+GK++Y++T+L+V+E  +  ++TAQA+    ED GY
Sbjct  490   LCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLYVLEEKDAQIITAQAREKEGEDIGY  549

Query  785   SFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEY  964
             SF HC + GVG  A LGR WMA  RVVFAY  +S  + PEGW             YFGE+
Sbjct  550   SFVHCDIKGVGNRAFLGRAWMAMPRVVFAYSSMSSVVHPEGWSN-NNHPEREKNLYFGEF  608

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             KNTGPG+    R  F K++  +E K F++ GFI+ S WLLPP
Sbjct  609   KNTGPGSNPKGRAKFSKQLSFEEAKPFLTLGFIKGSSWLLPP  650



>gb|AAX11261.1| pectin methylesterase allergenic protein [Salsola kali]
Length=339

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 234/339 (69%), Gaps = 3/339 (1%)
 Frame = +2

Query  89    PIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGKGDFKTIKEAIDS  265
             PIP N  E+ SWF   ++P S +K L P + +AE+   + I V ++G G FKTI +A+  
Sbjct  2     PIPPNPAELESWFQGAVKPVSEQKGLEPSVVQAESGGVETIEVRQDGSGKFKTISDAVKH  61

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG-DDKDRPSIIGCSTAAQDGTVMSAT  442
             V  GNT+RVII+IGPG Y E++KI    P+I+L+G D K+RP+I    TAA+ GTV SAT
Sbjct  62    VKVGNTKRVIITIGPGEYREKVKIEGLHPYITLYGIDPKNRPTITFAGTAAEFGTVDSAT  121

Query  443   VIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKG  622
             +IVE DYF+ + + + NSAPRP GKRKGAQA AL  SGD AAFYN +  GFQDT CDDKG
Sbjct  122   LIVESDYFVGANLIVSNSAPRPAGKRKGAQASALRISGDRAAFYNCKFTGFQDTVCDDKG  181

Query  623   RHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCK  802
              H FKD YIEGTVD IFG  ++LY++TELHV+ GD MA++TA A+   +   GYSF HCK
Sbjct  182   NHLFKDCYIEGTVDLIFGEARSLYLNTELHVVPGDPMAMITAHARKNADGVGGYSFVHCK  241

Query  803   VTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             VTG G  ALLGR W   +RVVF+YC +SDA+KPEGW     K     T +FGEYKNTGPG
Sbjct  242   VTGTGGTALLGRAWFEAARVVFSYCNLSDAVKPEGWSD-NNKPAAQKTIFFGEYKNTGPG  300

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             A    R  + K++ + + K F S  +IEA+KWL PP KV
Sbjct  301   AAADKRVPYTKQLTEADAKTFTSLEYIEAAKWLPPPPKV  339



>gb|AAT99258.1| pectin-methyltransferase precursor [Salsola kali]
Length=362

 Score =   368 bits (945),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/366 (52%), Positives = 246/366 (67%), Gaps = 7/366 (2%)
 Frame = +2

Query  8     KKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKA  187
             ++ V+ L++  VL++      F+  +  IP N  E+ SWF   ++P S +K L P + + 
Sbjct  2     EEHVSMLLVGFVLINI----AFTSIAQLIPPNPAELESWFQGAVKPVSEQKGLEPSVVQT  57

Query  188   EAKP-KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             E+   + I V ++G G FKTI +A+  V  GNT+RVII+IGPG Y E++KI R  P+I+L
Sbjct  58    ESGGVETIEVRQDGSGKFKTISDAVKHVKVGNTKRVIITIGPGEYREKVKIERLHPYITL  117

Query  365   HG-DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVA  541
             +G D K+RP+I    TAA+ GTV SATVIVE DY + + + + NSAPRPDGKRKGAQA A
Sbjct  118   YGIDPKNRPTITFAGTAAEFGTVDSATVIVESDYSVGAHLIVTNSAPRPDGKRKGAQAGA  177

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
             L  SGD AAFYN +  GFQDT CDDKG HFF D Y EGTVDFIFG  ++LY++TELHV+ 
Sbjct  178   LRISGDRAAFYNCKFTGFQDTVCDDKGNHFFTDCYTEGTVDFIFGEARSLYLNTELHVVP  237

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
             GD MA++TA A+   +   GYSF HCKVTG G  ALLGR W   +RVVF+YC +SDA KP
Sbjct  238   GDPMAMITAHARKNADGVGGYSFVHCKVTGTGGTALLGRAWFDAARVVFSYCNLSDAAKP  297

Query  902   EGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
             EGW     K     T  FGEYKNTGPGA    R  + K++ + + K F S  +IEA+KWL
Sbjct  298   EGWSD-NNKPEAQKTILFGEYKNTGPGAAPDKRAPYTKQLTEADAKTFTSLEYIEAAKWL  356

Query  1082  LPPAKV  1099
             LPP KV
Sbjct  357   LPPPKV  362



>ref|XP_008244214.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=371

 Score =   368 bits (945),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 246/356 (69%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +  +LL+ +   V +DD  P+PA++ +VN+WF++N+ P   R+  L+P L  AE    
Sbjct  14    LTVTLILLNAII--VVADDDAPVPADQSQVNTWFNNNVNPNKERQGKLDPALVTAELGQT  71

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              ++V K+G G+FKTI +A++S+P  NT+RVI+ IG G Y E++ I R  PF++ +G   +
Sbjct  72    IVKVMKDGSGEFKTITDAVNSIPAENTKRVIVYIGGGEYNEKITIPRNIPFVTFYGSPTN  131

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++I    A + GTV SATVI E DYF+A+ + I NS+P+PDGKR G QA+AL  SG+ 
Sbjct  132   MPTLIFGGNAQKYGTVDSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNK  191

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             +A +N R+ GFQDT CDDKG HFFKD +IEGTVDFIFG+GK+LY++TELHV+  + M V+
Sbjct  192   SALFNCRVIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEMTVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  EDTGYSF HC +TG G G  LGR W    RVVFAY  +S+ I P GW+   
Sbjct  252   TAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTSMSEVITPAGWNN-K  310

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +     T ++GE+K +GPG+ +  R  + K++ +++VK F++ G+I+ SKWLLPP
Sbjct  311   NRPERDSTVFYGEHKCSGPGSSMVGRVKYTKQLNEEQVKPFLNLGYIQGSKWLLPP  366



>ref|XP_010087095.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXB26150.1| Pectinesterase PPME1 [Morus notabilis]
Length=368

 Score =   368 bits (944),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/365 (51%), Positives = 250/365 (68%), Gaps = 8/365 (2%)
 Frame = +2

Query  8     KKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKA  187
             +K+   LV++ V L      V +DD++ IP  K ++NSWF+ N++P S  K L+P L  A
Sbjct  3     QKLTCALVLLVVALIATNNIVNADDNVQIPYQKGQLNSWFNGNVRPLSASKGLDPALVAA  62

Query  188   EAKP-KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             E  P K ++V K+G GDFKT++EAI+SVP+GN++RVII +G G Y E++ I R KPFI+L
Sbjct  63    ETGPAKVVKVAKDGSGDFKTVQEAINSVPSGNSKRVIIYVGGGEYHEKVTIDRSKPFITL  122

Query  365   HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
             +G   + P+I    TAAQ GTV SAT+IV  DYF+   + I NSAPRPDG RKGAQAVAL
Sbjct  123   YGSPTNMPTISYAGTAAQYGTVDSATLIVGSDYFVGVNLIIKNSAPRPDGIRKGAQAVAL  182

Query  545   TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
               SG+ A FY  +L GFQDT CDD+G H FKD YIEGTVDFIFG+G +LY++TELHVI  
Sbjct  183   RASGNKATFYKCKLLGFQDTLCDDRGFHLFKDCYIEGTVDFIFGSGTSLYLNTELHVISD  242

Query  725   DNM-AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
               M +V+TAQA+ +  + TG+SF HC +TG  + A+LGR WM  ++V+FAY  +   I P
Sbjct  243   PTMESVITAQARQS-ADGTGFSFVHCTITGNAKDAVLGRAWMPNAKVIFAYTNLGGVISP  301

Query  902   EGWHGV--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASK  1075
             +GW     P + +   T +FGEY+NTG  A    R +FVK + D + K +++ GFI+ SK
Sbjct  302   QGWSDNMHPERDN---TVFFGEYQNTGASANDDGRVDFVKTLNDAQAKPYLTLGFIQGSK  358

Query  1076  WLLPP  1090
             WLLPP
Sbjct  359   WLLPP  363



>ref|XP_010491358.1| PREDICTED: pectinesterase PPME1-like [Camelina sativa]
Length=361

 Score =   367 bits (943),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 240/357 (67%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF +N+ P   RK L+P L  AEA P
Sbjct  5     NVSILLGLLVVFVSPMVFADDVTPIPEAKPQVEQWFKANVGPLPQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+F TI  AI SVP GNT+RVII I PG+Y E++ I R +PFI+L G   
Sbjct  65    RIINVNPKG-GEFTTITAAIKSVPAGNTKRVIIKIAPGDYKEKVTIERNQPFITLMGQPT  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   YAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + EE +GYSF HCKVTGVGEG  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   ITAHAGKSAEEKSGYSFVHCKVTGVGEGIYLGRAWMSHPKVVYAYTEMTSVVNPAGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F++++   E  +F+S G+I+ SKWLLPP
Sbjct  303   KVPAH-DKTVFYGEYKCSGPGSLSAKRVPFIQEIDLTEANRFLSLGYIQGSKWLLPP  358



>gb|KHG24685.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=369

 Score =   367 bits (943),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 186/360 (52%), Positives = 251/360 (70%), Gaps = 11/360 (3%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKH  205
             + V++LL    P + S    PIPA+K ++N+WF+  I+    R N L+PEL +AE KP+ 
Sbjct  16    ICVSILL--FAPIIVSQ---PIPADKSQINAWFNGIIKSVKERGNTLDPELVEAETKPRI  70

Query  206   IRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDR  385
             I+V + G G+F TI +AI+SVP+GNT+RVI+SIGPG+Y E+++I R KPFI+L GD K  
Sbjct  71    IKVMQGGGGEFDTITKAIESVPSGNTKRVIVSIGPGSYKEKIRIERNKPFITLLGDPKKM  130

Query  386   PSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMA  565
             P++    TA Q GTV SAT+I E  YF+ + +NI+N+APRPDGK  GAQAVAL  SGD +
Sbjct  131   PNLTFDGTAKQFGTVDSATLITECSYFVGANLNILNTAPRPDGKMVGAQAVALRVSGDRS  190

Query  566   AFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGD-NMAVV  742
             AFYN ++ GFQDT CDD+G HFFKD +I GTVDFIFG+GK+LY++TE+ V EGD  + V+
Sbjct  191   AFYNCKIIGFQDTLCDDRGNHFFKDCHIRGTVDFIFGSGKSLYLNTEIFV-EGDPGLTVI  249

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW-HGV  919
             TAQA+ +  EDTGYSF H  ++G  + A LGR W +  RVV+AY E+ + I P GW H V
Sbjct  250   TAQARESSSEDTGYSFVHGSISGTAKNAFLGRAWKSSPRVVYAYTEMGNVINPVGWSHNV  309

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
               +     T Y+GEYK TG GA    R  FVK++ D E + F+   ++EA+KWLLPP  +
Sbjct  310   --QPERAKTVYYGEYKCTGQGANPKTREPFVKQLPDAEAQPFLVLDYVEATKWLLPPPTI  367



>ref|NP_177152.2| pectinesterase PPME1 [Arabidopsis thaliana]
 sp|Q84WM7.1|PPME1_ARATH RecName: Full=Pectinesterase PPME1; Short=AtPPME1; Short=PE PPME1; 
AltName: Full=Pectin methylesterase 9; Short=AtPME9; AltName: 
Full=Pectin methylesterase PPME1; AltName: Full=Protein 
POLLEN SPECIFIC PME 1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22801.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE35001.1| pectinesterase PPME1 [Arabidopsis thaliana]
Length=361

 Score =   367 bits (942),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 177/357 (50%), Positives = 240/357 (67%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF++N+ P + RK L+P L  AEA P
Sbjct  5     NVSILLGLLMVFVTPMVFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +AI SVP GNT+RVII + PG Y E++ I R KPFI+L G   
Sbjct  65    RIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPN  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             + A A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   IAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F + + D+E  +F+S G+I+ SKWLLPP
Sbjct  303   KTPAH-DKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPP  358



>ref|XP_010457627.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=365

 Score =   367 bits (942),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 182/360 (51%), Positives = 244/360 (68%), Gaps = 3/360 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
              L++ ++L+    P VF++D+ PIP NK  +  WF++N+   ++RK+ L+P L  AEAKP
Sbjct  7     SLIVTSLLVVITSPVVFANDAAPIPQNKGGIEQWFNTNVPSLASRKSTLDPALLAAEAKP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V +NG+G FKTI EAI SV  GNT RVII +GPG Y E++ I R KPFI+L+G   
Sbjct  67    RIIKVEQNGRGQFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPN  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P +    TA + GTV SAT+IV  DYFMA  I + NSAP PDGK KGAQA+++  SG+
Sbjct  127   AMPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKMKGAQALSMRISGN  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V
Sbjct  187   KAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRV  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  T +E TGY+F HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW   
Sbjct  246   ITAHAGKTAQEKTGYTFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVDPSGWQA-  304

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                     T ++GEYK TGPG+    R  F + + D + K FIS G+I+ S WLLPP K+
Sbjct  305   NRDIGRDKTVFYGEYKCTGPGSLKAKRVKFTQYIDDIKAKYFISLGYIQGSSWLLPPPKL  364



>ref|XP_009363892.1| PREDICTED: probable pectinesterase 48 [Pyrus x bretschneideri]
Length=355

 Score =   366 bits (940),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 175/353 (50%), Positives = 244/353 (69%), Gaps = 4/353 (1%)
 Frame = +2

Query  35    VTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIR  211
             +T+LL        +DD+ PIP++  ++N+WF++N++P + R++ L+P +A AEA    I+
Sbjct  1     MTILL--TATAATADDNTPIPSDHSQINTWFNNNVKPYTERQSTLDPAVATAEAGQTVIK  58

Query  212   VCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPS  391
             V ++GKGDFKT+ +AI+S+P GNT+RVI+ IG G Y E++ I + KPF++L+G      +
Sbjct  59    VMQDGKGDFKTVTDAINSIPAGNTKRVIVHIGRGEYNEKITIPQNKPFVTLYGSPTKMSN  118

Query  392   IIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAF  571
             +    TA + GTV SATVI E DYF+A+ + I NS+PRPDGKR GAQAVAL  SG+ +A 
Sbjct  119   LTFAGTAQKYGTVNSATVIAEFDYFIATNLLIKNSSPRPDGKRVGAQAVALRVSGNNSAL  178

Query  572   YNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQ  751
             YN +L GFQDT CDD+G H FKD YIEGTVDFI+G+GK+LY++TELHV+    + V+TAQ
Sbjct  179   YNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGITVITAQ  238

Query  752   AQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKT  931
             A+ +  EDTGYSF HC VTG+G G  LGR W    +VV+AY  +++ + P GW       
Sbjct  239   ARDSASEDTGYSFVHCNVTGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGWSN-DNHP  297

Query  932   HYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 T  +GEYK   PG+    + N  K++ DQ+VK FIS G+I+ SKWLLPP
Sbjct  298   ERDNTVSYGEYKCMDPGSSTYNKRNLSKELTDQQVKPFISLGYIQGSKWLLPP  350



>gb|ADH82125.1| pectinesterase [Brassica rapa subsp. pekinensis]
Length=363

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 240/354 (68%), Gaps = 3/354 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHI  208
             +++ +++ ++ P V +DD+ PIP  K +   WF +N+ P  +RK L+P L  AEA P+ I
Sbjct  8     MLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPSRKGLDPALVAAEASPRTI  67

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V   G G+FKT+ +A+ S+P  NT+RVII +GPG Y E++ I ++KPFI+L GD K  P
Sbjct  68    NVNPKG-GEFKTLTDALKSIPEKNTKRVIIKMGPGEYKEKVTIDKKKPFITLMGDPKAMP  126

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
              +    TAAQ GTV SA++I+  DYF+A  I + NSAP+PDGKRKGAQA+A+  SG+ AA
Sbjct  127   VLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNNAA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FYN + HGFQDT CDD G HFFKD YIEGT DFIFG+G ++Y+DT+LH + GD + V++A
Sbjct  187   FYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVISA  245

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
              A  + EE +GYSF HCKVTG G G  LGR W +  +VV+AY E+S  + P GW      
Sbjct  246   HAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANKVA  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              H   T ++GEY+ TGPG+    R  F + + + E  +F+S G+I+ S WLLPP
Sbjct  306   AH-DKTVFYGEYRCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIKGSSWLLPP  358



>emb|CDY23044.1| BnaC07g31430D [Brassica napus]
Length=451

 Score =   369 bits (948),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 245/357 (69%), Gaps = 6/357 (2%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKP  199
              L++  +L+    P V+ +D+ PIP NK+ +  WF++N+   ++RK+ L+P L  AEA P
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNTNVPSLASRKDKLDPALLTAEATP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
                RV +NG+GDF T+ EAI+SVP GN +RVII +G G Y E++ I R KPFI+L+G+  
Sbjct  67    ---RVRQNGRGDFNTLTEAINSVPVGNNERVIIKLGHGEYKEKVTIDRNKPFITLYGNPN  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P +    TAA+ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+
Sbjct  124   AMPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V
Sbjct  184   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GWH  
Sbjct  243   ITAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-  301

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               +T    T ++GEYK +GPG++   R  + + + + E   FIS G+I+ S WLLPP
Sbjct  302   NTQTERDKTVFYGEYKCSGPGSRKKKRVKYTQDIDNIEANSFISLGYIQGSSWLLPP  358



>gb|KEH38558.1| pectinesterase-like protein [Medicago truncatula]
Length=367

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 247/367 (67%), Gaps = 7/367 (2%)
 Frame = +2

Query  5     RKKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELA  181
             R   +N  ++V +    +   V SDD  PIPAN+ ++++WF++N+ P + RK  L+P L 
Sbjct  6     RTSTINVAIIVALFTANV---VLSDDLTPIPANRAQLDAWFNTNVGPLAQRKATLDPSLV  62

Query  182   KAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFIS  361
              AEA PK I V ++GKGDFKTI +AI+S+PTGN +RVI+ IG GNY E++KI R KPF++
Sbjct  63    AAEAAPKVITVMQDGKGDFKTITDAINSIPTGNNKRVIVKIGGGNYNEKIKIERTKPFVT  122

Query  362   LHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVA  541
             L+      P+I    TAA+ GTV SAT+IVE DYF+A+ I + NSAPRPDG++ G QAVA
Sbjct  123   LYAAPGTMPNITFGGTAAKYGTVDSATLIVESDYFVAANIMLSNSAPRPDGRKAGEQAVA  182

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
             L  SGD AAFYN ++ GFQDT CDD+  HFFKD  I+GTVDFIFG+G +LY+  EL  + 
Sbjct  183   LRISGDRAAFYNCKILGFQDTICDDRHNHFFKDCLIQGTVDFIFGSGTSLYLKNELRALG  242

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
                  V+ AQA+ +  +   YSF HC +TG G    L R WM + ++++AY  +++ + P
Sbjct  243   DAGPTVIVAQARKSASDADLYSFVHCDITGTGTTTFLARAWMTYPKIIYAYSTMTNVVHP  302

Query  902   EGW-HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             +GW +G+     +  T+YFGEY+NTGP +    R +  K++ + EVK FI+ G I+ SKW
Sbjct  303   KGWDNGM--HPEFDKTSYFGEYQNTGPKSDPKGRVSITKQLSEAEVKPFITLGMIQGSKW  360

Query  1079  LLPPAKV  1099
             LLPP KV
Sbjct  361   LLPPPKV  367



>dbj|BAB09012.1| pectin methylesterase-like protein [Arabidopsis thaliana]
Length=364

 Score =   366 bits (939),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/360 (51%), Positives = 243/360 (68%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNL-NPELAKAEAKP  199
              L++  +L+    P VF +D+ PIP NK  +  WF++N+   ++RK+  +P L  AEAKP
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVPSLASRKSTSDPALLTAEAKP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V +NG+G FKTI EAI+SV  GNT+RVII IGPG Y E++ I R KPFI+L+G   
Sbjct  67    RIIKVKQNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFITLYGHPN  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P +    TAAQ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+
Sbjct  127   AMPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQALSMRISGN  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V
Sbjct  187   KAAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRV  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A  +  E +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW   
Sbjct  246   ITAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVVNPSGWQ--  303

Query  920   PGKTHYGG---TTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               +    G   T ++GEYK TG G+    R  + + + D E K FIS G+I+ S WLLPP
Sbjct  304   --ENREAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDIEAKYFISLGYIQGSSWLLPP  361



>ref|XP_002871269.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47528.1| ATPPME1 [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   365 bits (938),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/357 (50%), Positives = 239/357 (67%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF +N+ P + RK L+P L  AEA P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPEAKPQVAQWFKANVAPLAQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +AI SVP GNT+RVII + PG Y E++ I R KPFI+L G   
Sbjct  65    RIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPG  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   FAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             + A A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   IAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F + + D+E  +F+S G+I+ SKWLLPP
Sbjct  303   KTPAH-DKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPP  358



>emb|CDY14046.1| BnaC02g01630D [Brassica napus]
Length=363

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 240/354 (68%), Gaps = 3/354 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHI  208
             +++ +++ ++ P V +DD+ PIP  K +V  WF +N+ P  +RK L+P L  AEA P+ I
Sbjct  8     MLLAMVMVFVTPMVLADDNTPIPEAKPQVEQWFKTNVAPLPSRKGLDPALVAAEASPRTI  67

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V   G G+FKT+ +A+ SVP  NT+RVII + PG Y E++ + ++KPFI+L GD K  P
Sbjct  68    NVNPKG-GEFKTLTDALKSVPEKNTKRVIIKMAPGEYKEKVTLDKKKPFITLMGDPKAMP  126

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
              +    TAAQ GTV SA++I+  DYF+A  I + NSAP+PDGKRKGAQA+A+  SG+ AA
Sbjct  127   VLTFDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNNAA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FYN + HGFQDT CDD G HFFKD YIEGT DFIFG+G ++Y++T+LH + GD + V++A
Sbjct  187   FYNCKFHGFQDTVCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLETQLHAV-GDGIKVISA  245

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
              A  + EE +GYSF HCKVTG G G  LGR W +  +VV+AY E+S  + P GW      
Sbjct  246   HAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWQANKVA  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              H   T ++GEYK TGPG+    R  F + + + E  +F+S G+I+ S WLLPP
Sbjct  306   AH-DKTVFYGEYKCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIQGSSWLLPP  358



>ref|XP_009125688.1| PREDICTED: pectinesterase PPME1-like [Brassica rapa]
 gb|AGX13881.1| pectin methylesterase [Brassica rapa subsp. chinensis]
 emb|CDY55179.1| BnaAnng13700D [Brassica napus]
Length=363

 Score =   365 bits (938),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 239/354 (68%), Gaps = 3/354 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHI  208
             +++ +++ ++ P V +DD+ PIP  K +   WF +N+ P  +RK L+P L  AEA P+ I
Sbjct  8     MLLAMVMVFVTPMVLADDNTPIPEAKPQAEQWFKTNVAPLPSRKGLDPALVAAEASPRTI  67

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V   G G+FKT+ +A+ S+P  NT+RVII + PG Y E++ I ++KPFI+L GD K  P
Sbjct  68    NVNPKG-GEFKTLTDALKSIPEKNTKRVIIKMAPGEYKEKVTIDKKKPFITLMGDPKAMP  126

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
              +    TAAQ GTV SA++I+  DYF+A  I + NSAP+PDGKRKGAQA+A+  SG+ AA
Sbjct  127   VLTYDGTAAQYGTVNSASLIILSDYFIAVNIIVKNSAPKPDGKRKGAQALAMRISGNNAA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FYN + HGFQDT CDD G HFFKD YIEGT DFIFG+G ++Y+DT+LH + GD + V++A
Sbjct  187   FYNCKFHGFQDTLCDDAGNHFFKDCYIEGTFDFIFGSGTSMYLDTQLHAV-GDGIKVISA  245

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
              A  + EE +GYSF HCKVTG G G  LGR W +  +VV+AY E+S  + P GW      
Sbjct  246   HAGKSAEEKSGYSFVHCKVTGDGGGIYLGRSWKSHPKVVYAYTEMSSLVNPTGWKANKVA  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              H   T ++GEYK TGPG+    R  F + + + E  +F+S G+I+ S WLLPP
Sbjct  306   AH-DKTVFYGEYKCTGPGSHTAKRVPFTQDIDENEANRFLSLGYIKGSSWLLPP  358



>ref|XP_006289810.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
 gb|EOA22708.1| hypothetical protein CARUB_v10003415mg [Capsella rubella]
Length=361

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 175/357 (49%), Positives = 238/357 (67%), Gaps = 3/357 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD  PIP  K +V  WF +N+ P + RK L+P L  AEA P
Sbjct  5     NVSILLGLLVVFVSPVVFADDVTPIPETKPQVEQWFKTNVAPLAQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V   G G+FKT+ +A+ SVP GNT+RVII + PG Y E++ I + KPFI+L G   
Sbjct  65    RTITVNPKG-GEFKTLTDALKSVPAGNTKRVIIKMAPGEYREKVTIDKNKPFITLMGQPN  123

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+
Sbjct  124   AMPVISFDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGN  183

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
             MAAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V
Sbjct  184   MAAFYNCKFYGFQDTVCDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRV  242

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             + A A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW   
Sbjct  243   IAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQEN  302

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 H   T ++GEYK +GPG+    R  F + +   E  +F+S G+I+ SKWLLPP
Sbjct  303   KTPAH-DKTVFYGEYKCSGPGSHKAKRVPFTQDIDATEANRFLSLGYIQGSKWLLPP  358



>ref|XP_010666416.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 238/339 (70%), Gaps = 4/339 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAE-AKPKHIRVCKNGKGDFKTIKEAIDS  265
             IP ++ EV++WF S I+P S  K  L P + +AE    + + V ++G G FKTI +A+  
Sbjct  27    IPESEAEVDTWFQSVIKPISELKGTLEPSILEAENGGVETLDVRQDGSGKFKTISDAVKH  86

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRPSIIGCSTAAQDGTVMSAT  442
             V  GNT+RVII+IGPG Y E++++ R + +I+ +G D K+RP+I    TAA+ G V SAT
Sbjct  87    VKVGNTKRVIITIGPGEYREKIQLERMQSYITFYGTDPKNRPTITFAGTAAEFGAVDSAT  146

Query  443   VIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKG  622
             +IVE DYF+A+ + I NSAPRPDGK+KGAQA A+  SGD AAFYN +  GFQ+T CDD+G
Sbjct  147   LIVESDYFVAANLIISNSAPRPDGKKKGAQAAAIRISGDRAAFYNCKFTGFQNTICDDQG  206

Query  623   RHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCK  802
              HFFKD Y+EGT DFIFG  K+LY++TELHVI GD  A++ A A+   +++ GYSF HCK
Sbjct  207   NHFFKDCYVEGTADFIFGEAKSLYLNTELHVIPGDGEAIIAAHARKDLDDEGGYSFVHCK  266

Query  803   VTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             VTG G  A+LG  W   +RVV++YC I D I+PEGW     +  Y  TTYFGEYKNTGPG
Sbjct  267   VTGTGGNAILGTAWFQAARVVYSYCAIGDVIRPEGWSD-NKQPEYQKTTYFGEYKNTGPG  325

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             A +  R  + KK+ D EVK FIS  FI+A+KWL+P  K+
Sbjct  326   ADIKKRVPYFKKLTDIEVKPFISLEFIDAAKWLIPLPKI  364



>ref|XP_010667524.1| PREDICTED: pectinesterase 2-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   363 bits (931),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 187/339 (55%), Positives = 234/339 (69%), Gaps = 4/339 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAE-AKPKHIRVCKNGKGDFKTIKEAIDS  265
             IPAN  EV  WF S ++P S  K  L P +  AE    + + V ++GKG FKTI +A+  
Sbjct  27    IPANAAEVERWFQSVVKPISAAKGTLEPSVIAAEDGGVETLDVRQDGKGKFKTISDAVKH  86

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRPSIIGCSTAAQDGTVMSAT  442
             V  GN +RVII IGPG Y E++KI R + +I+ +G D K+RP+I    TAAQ GTV SAT
Sbjct  87    VKVGNKKRVIIKIGPGEYREKIKIERFQSYITFYGTDPKNRPTITFAGTAAQYGTVDSAT  146

Query  443   VIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKG  622
             +IVE DYF+A+ I I NSAPRPDGK+KGAQA A+  SGD +AFYN +  GFQDT CDDKG
Sbjct  147   LIVESDYFVAANIIISNSAPRPDGKKKGAQAAAIRISGDRSAFYNCKFVGFQDTVCDDKG  206

Query  623   RHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCK  802
             +HFFKD YIEGTVDFIFG  ++LY++TELHVI GD  A++ A A+  ++ + GYSF HCK
Sbjct  207   KHFFKDCYIEGTVDFIFGEARSLYLNTELHVIPGDREAMIVAHARKNQDGEGGYSFVHCK  266

Query  803   VTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             VTG G  A+LGR W   +R VFAY  ISD IKPEGW     +     T +FGEY NTGPG
Sbjct  267   VTGTGGHAVLGRAWFDAARSVFAYSTISDVIKPEGWSDNRNQ-KCQKTVFFGEYANTGPG  325

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             A L  R  + KK+   E K+FIS  +I+A+KWLLPP +V
Sbjct  326   ADLKRRVPYSKKLTAAEAKQFISLEYIDAAKWLLPPPRV  364



>ref|XP_006572809.1| PREDICTED: uncharacterized protein LOC100306177 isoform X1 [Glycine 
max]
Length=369

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 244/356 (69%), Gaps = 3/356 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
             + VT+++ +L   V  SDD++PIPANK ++  W+++N+ P   RK+ ++P L  AE   K
Sbjct  10    IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAK  69

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              ++V ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  + 
Sbjct  70    VVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD 
Sbjct  130   MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV TEL  +  + + V+
Sbjct  190   AAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVI  249

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +SD +   GW    
Sbjct  250   VAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSNNN  309

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                H   T  FGEY+N+GPGA    R    K++ ++EVK +I+   IE SKWLLPP
Sbjct  310   HPEH-DKTVRFGEYQNSGPGADPKGRATITKQLSEREVKPYITLAMIEGSKWLLPP  364



>ref|XP_003516497.1| PREDICTED: pectinesterase PPME1 [Glycine max]
Length=369

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 243/356 (68%), Gaps = 3/356 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
             + VT+++ +L   V  SDD++PIPANK ++  W+++N+ P   RK+ ++P L  AE   K
Sbjct  10    IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTMDPALVTAEEGAK  69

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              ++V ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  + 
Sbjct  70    VVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD 
Sbjct  130   MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV TEL  +  + + V+
Sbjct  190   AAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVI  249

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +SD +   GW    
Sbjct  250   VAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSNNN  309

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                H   T  FGEY+N+GPGA    R    K++ + EVK +I+   IE SKWLLPP
Sbjct  310   HPEH-DKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSKWLLPP  364



>ref|XP_003517889.1| PREDICTED: pectinesterase PPME1-like [Glycine max]
Length=369

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 245/362 (68%), Gaps = 3/362 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAK  184
             K +   + VT+++ +L   V FSDD++PIPANK+++ +WF +N+ P   RK+ ++P L  
Sbjct  4     KTICTTIQVTLIVAFLTTQVVFSDDNVPIPANKEQLGTWFSTNVGPLDQRKSTIDPALVA  63

Query  185   AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             AE   K ++V ++G G+FKTI +AI+SVP GNT+RVI+ IG GNY E++KI R KPF++L
Sbjct  64    AEEGAKVVKVMQDGSGEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTL  123

Query  365   HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
             +G  +  P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL
Sbjct  124   YGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVAL  183

Query  545   TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
               SGD AAFYN ++ GFQDT CDD+ +HFFKD  I+GT+D+IFG+GK+LY+ TEL  +  
Sbjct  184   RISGDKAAFYNCKMFGFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGD  243

Query  725   DNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPE  904
             + + V+ AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +S  +   
Sbjct  244   NGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIVNKL  303

Query  905   GWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             GW       H   T  FGEY+NTGPGA    R    K++ + EVK +I+   IE SKWLL
Sbjct  304   GWSNNNHPEH-DKTVRFGEYQNTGPGADPKGRAPITKQLSETEVKPYITLAMIEGSKWLL  362

Query  1085  PP  1090
             PP
Sbjct  363   PP  364



>ref|XP_006381893.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
 gb|ERP59690.1| hypothetical protein POPTR_0006s20010g [Populus trichocarpa]
Length=365

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 238/360 (66%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +  +LL  +   V SDD  PIPA+   +N WF  N++P + RK  ++P L  AEAKP
Sbjct  9     QCAITAILL--VSTTVSSDDKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALMAAEAKP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V K+G G+FKT+K+AI+S+PTGN +RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  67    RTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPS  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P++    TA + GTV SAT+  E DYF+A+ I I NSAPRP G+ KG QAVAL  SGD
Sbjct  127   NMPTLSFDGTARKYGTVYSATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGD  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN R  GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TELHVI  +    
Sbjct  187   KSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNF  246

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A++   E+TG+SF HCKV G G + A LGR W    RVVF+Y  +S  + PEGW  
Sbjct  247   ITAHARNNEAENTGFSFVHCKVDGTGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN  306

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P + H   T  FGEYK  G GA   AR    K++   +V  FIS GFIE SKWLL P
Sbjct  307   NFHPERDH---TALFGEYKCKGEGANPAARAKASKQLTPGQVAPFISLGFIEGSKWLLHP  363



>ref|XP_003517875.1| PREDICTED: pectinesterase PPME1 [Glycine max]
 gb|KHN04070.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN32883.1| Pectinesterase PPME1 [Glycine soja]
 gb|KHN44801.1| Pectinesterase PPME1 [Glycine soja]
Length=369

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 243/356 (68%), Gaps = 3/356 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
             + VT+++ +L   V  SDD++PIPANK ++  W+++N+ P   RK+ ++P L  AE   K
Sbjct  10    IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAK  69

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              ++V ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  + 
Sbjct  70    VVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD 
Sbjct  130   MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV TEL  +  + + V+
Sbjct  190   AAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVI  249

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +SD +   GW    
Sbjct  250   VAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSNNN  309

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                H   T  FGEY+N+GPGA    R    K++ + EVK +I+   IE SKWLLPP
Sbjct  310   HPEH-DKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSKWLLPP  364



>ref|XP_010666417.1| PREDICTED: putative pectinesterase 63 [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 184/344 (53%), Positives = 238/344 (69%), Gaps = 4/344 (1%)
 Frame = +2

Query  77    DDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAE-AKPKHIRVCKNGKGDFKTIK  250
             D    IP N  EV +WF++ ++P S  K  L P + +AE    + I V ++G G FKTI 
Sbjct  20    DAQTLIPENPAEVETWFNNVVKPISQVKGALEPSVIEAENGGVETIDVRQDGSGKFKTIA  79

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRPSIIGCSTAAQDGT  427
             +A+  V  GN +RVII+IGPG Y E++KI R + +I+ +G D K+RP+I    TAAQ GT
Sbjct  80    DAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFYGTDPKNRPTITFAGTAAQYGT  139

Query  428   VMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTF  607
             V SAT+IVE DYF+A+ + I NSAPRPDGK KG QA A+  SGD +AFYN +  GFQDT 
Sbjct  140   VDSATLIVESDYFVAANLIISNSAPRPDGKTKGGQAAAIRISGDRSAFYNCKFTGFQDTV  199

Query  608   CDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYS  787
             CDDKG HFFKD YIEGTVDFIFG  +++Y++TELHVI GD  A++TA A+  ++   GYS
Sbjct  200   CDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPGDLEAMITAHARGNQDGVGGYS  259

Query  788   FAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYK  967
             F HCKVTG G  A+LGR W A +RVV+++C+IS+ I+PEGW     K  Y  T YFGEYK
Sbjct  260   FVHCKVTGTGSYAVLGRAWFAAARVVYSFCDISNVIRPEGWSD-NKKAAYQTTVYFGEYK  318

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             N G GA +  R  + K + D E K+FIS  +I+A+KWLLPP KV
Sbjct  319   NKGTGADIKKRVPYFKNLTDLEAKQFISMEYIDAAKWLLPPPKV  362



>ref|XP_011033438.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=377

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 237/360 (66%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +  +LL  +   V SDD  PIPA+   +N WF  N++P + RK  ++P L  AEAKP
Sbjct  21    QCAITAILL--VSATVSSDDKSPIPADPSSLNKWFQDNVRPLADRKGTIDPALLAAEAKP  78

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V K+G G+FKT+K+AI+S+PTGN +RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  79    RTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPG  138

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P++    TA Q GTV SAT+  E DYF+A+ I I NSAPRP G+ KG QAVAL  SGD
Sbjct  139   NMPTLSFDGTARQYGTVYSATLEAEADYFVAANIIIKNSAPRPQGQLKGEQAVALRISGD  198

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN R  GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TEL VI  +    
Sbjct  199   KSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELRVIGDEKGNF  258

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A++   EDTG+SF HCKV G G + A LGR W    RVVF+Y  +S  + PEGW  
Sbjct  259   ITAHARNNEAEDTGFSFVHCKVDGTGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN  318

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P + H   T  FGEYK  G GA   AR    K++   +V  FI+ GFIE SKWLL P
Sbjct  319   NFHPERDH---TALFGEYKCNGEGANPAARAQASKQLAPGQVAPFITLGFIEGSKWLLHP  375



>ref|XP_002309337.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
 gb|EEE92860.2| hypothetical protein POPTR_0006s20000g [Populus trichocarpa]
Length=365

 Score =   360 bits (924),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 188/360 (52%), Positives = 238/360 (66%), Gaps = 9/360 (3%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +  +LL  +   V SDD  PIPA+   +N WF  N++P + RK  ++P L  AEAKP
Sbjct  9     QCAITAILL--VSTTVSSDDKSPIPADPSSLNKWFQDNVRPLANRKGTIDPALKAAEAKP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V K+G G+FKT+K+AI+S+PTGN +RVI+ IGPG Y E+LKI R KPF++  G   
Sbjct  67    RTIKVRKDGSGEFKTLKDAINSIPTGNKERVIVHIGPGEYIEKLKIERGKPFVTFLGSPS  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             + P++    TA + GTV SAT+  E DYF+A+ I I NSAPRP G+ KG QAVAL  SGD
Sbjct  127   NMPTLSFDGTARKYGTVYSATLEAEADYFVAANIIIKNSAPRPKGQLKGEQAVALRISGD  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              +AFYN R  GFQDT CDDKGRH FKD YIEGTVD+IFG+GK+LY+ TELHVI  +    
Sbjct  187   KSAFYNCRFIGFQDTLCDDKGRHLFKDCYIEGTVDYIFGSGKSLYLGTELHVIGDEKGNF  246

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             +TA A++   E+TG+SF HCKV G G + A LGR W    RVVF+Y  +S  + PEGW  
Sbjct  247   ITAHARNNEAENTGFSFVHCKVDGNGTKRAYLGRAWQQRPRVVFSYTTMSSVVNPEGWSN  306

Query  917   V--PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                P + H   T  FGEYK  G GA   AR    K++   +V  FIS GFIE SKWLL P
Sbjct  307   NFHPERDH---TALFGEYKCKGEGANPAARAKASKQLTPGQVAPFISLGFIEGSKWLLHP  363



>ref|XP_011040323.1| PREDICTED: pectinesterase PPME1-like [Populus euphratica]
Length=362

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 241/361 (67%), Gaps = 9/361 (2%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             V  +V + +LL  + P   S D+ PIP     +NSWF +N++P + R   L+P L  AEA
Sbjct  6     VTGMVAIVILL-LVSPAAGSRDTGPIPGEPSSLNSWFQANVKPYTQRNGTLDPALETAEA  64

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
             KPK I V K+G GDFKT+  A+ S+ +GNTQRVI+ IG G Y E+++I + KPF++  G 
Sbjct  65    KPKTIMVRKDGSGDFKTLTSAVRSISSGNTQRVIVDIGSGVYNEKIQIDKGKPFVTFKGS  124

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
              +  P++    TA   GTV SAT+ V+ DYF+AS I I NS+PRP GK K  QAVAL   
Sbjct  125   ARSVPTLTFAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLK-EQAVALRIG  183

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             GD AAFYN RL GFQDT CDDKGRHFFKD YIEGTVDFIFG+GK+LY+ T ++V+    +
Sbjct  184   GDKAAFYNCRLVGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLADQGL  243

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW-  910
             AV+TAQA++ +E+DTG+SF HCKV G+G+GA LGR W    RVVFA+  +S  + P GW 
Sbjct  244   AVITAQARN-KEDDTGFSFVHCKVNGIGKGAFLGRAWTERPRVVFAFTAMSSVVDPGGWS  302

Query  911   -HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
              +  P +        FGEYK  GPG+  + R  F K++  Q+V  F+S  +IE SKWLLP
Sbjct  303   DNQHPERDR---IVSFGEYKCKGPGSNPSGRVKFSKQLTPQQVNPFLSLAYIEGSKWLLP  359

Query  1088  P  1090
             P
Sbjct  360   P  360



>ref|XP_010546425.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   359 bits (922),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 175/344 (51%), Positives = 230/344 (67%), Gaps = 3/344 (1%)
 Frame = +2

Query  62    PGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDF  238
             P V + DS PIP ++ EV  WF +N+ P + R   L+P L  AEA P+ I V KNG GDF
Sbjct  18    PAVLAGDSTPIPEDRAEVEEWFKANVAPLAHRNATLDPALVAAEAAPRVITVSKNGDGDF  77

Query  239   KTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQ  418
             KT+K AI S+P GN +RVII +GPG Y E++ I R KPFI+L+G     P +    TAA+
Sbjct  78    KTLKAAIKSIPKGNQERVIIKMGPGEYREKVTIDRNKPFITLYGRPDAMPVLTYHGTAAK  137

Query  419   DGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQ  598
              GTV SA++IV  DYFMA  I + NSAP PDGK KGAQA+A+  SG+ AAFYN   HGFQ
Sbjct  138   YGTVDSASLIVLSDYFMAVNIILKNSAPMPDGKMKGAQALAMRISGNKAAFYNCEFHGFQ  197

Query  599   DTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDT  778
             DT CDD G HFFKD YIEGT DFIFG+G ++Y++T+L+V+ G+ M V+TAQA  T  + +
Sbjct  198   DTLCDDIGYHFFKDCYIEGTFDFIFGSGTSIYLNTQLNVV-GNGMRVITAQAGKTIADPS  256

Query  779   GYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFG  958
             GYSF HC+VTG G    LGR WM+  +VV+AY E++ A+ P GW  +  +     + Y+G
Sbjct  257   GYSFVHCRVTGTGSEIYLGRAWMSHPKVVYAYTEMTSALNPTGWQ-LNSEPDRDSSVYYG  315

Query  959   EYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             EYK  GPG+    R    + +   E  +F++ G+I+ SKWLLPP
Sbjct  316   EYKCYGPGSNTEERVASTRSLDSNEAARFLTLGYIQGSKWLLPP  359



>gb|KFK25126.1| hypothetical protein AALP_AA8G069500 [Arabis alpina]
Length=362

 Score =   359 bits (922),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 241/358 (67%), Gaps = 4/358 (1%)
 Frame = +2

Query  20    NQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP  199
             N  +++ +L+ ++ P VF+DD+ PIPA+K  V  WF +++ P   RK L+P L  AEA P
Sbjct  5     NVPILLALLVVFVTPMVFADDNAPIPASKPGVEQWFKTHVAPLPQRKGLDPALVAAEAAP  64

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-  376
             K I V   G G+FKT+ +AI SVP GNT+RVII + PG Y E++ I R KPFI+L G   
Sbjct  65    KTITVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLLGQPG  123

Query  377   KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
              + P I    TAA+ GTV SA++I+  DYFMA  I + NSAP PDGK KGAQA+++  SG
Sbjct  124   ANMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIIVKNSAPAPDGKTKGAQALSMRISG  183

Query  557   DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
             + AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + 
Sbjct  184   NYAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIR  242

Query  737   VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             V+TA A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW  
Sbjct  243   VITAHAGKSAEEKSGYSFVHCKVTGTGSGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQE  302

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                  +   T ++GEYK +G G++   R  F +++   E  +F++ G+I+ SKWLLPP
Sbjct  303   NKQPAN-DKTVFYGEYKCSGAGSQTAKRVPFTQEIDANEANRFLTLGYIQGSKWLLPP  359



>ref|XP_002511044.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF51646.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=366

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 248/369 (67%), Gaps = 15/369 (4%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPG-------VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLN  169
             M  Q+  + ++ HY+          V SDD+ PIPA +++VNSWF +N++  S+RK  L+
Sbjct  1     MAKQITYIAII-HYVIAAILLAATTVISDDATPIPAAENQVNSWFQANVKHFSSRKGTLD  59

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P L  AEA PK I+V  +G GDFK++ +A+ S+P+GN  RVI+ IG G YTE++ I R K
Sbjct  60    PALLAAEAAPKRIKVRLDGSGDFKSVTDALKSIPSGNEHRVIVDIGCGVYTEKVTIDRIK  119

Query  350   PFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGA  529
             PF++L G  K  P++    TA + GTV SAT+ VE DYF+A+ I I N+APRPDG R GA
Sbjct  120   PFVTLLGSSKHMPTLQFAGTAKKYGTVYSATLTVEADYFVAANIIIKNTAPRPDG-RAGA  178

Query  530   QAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTEL  709
             QAVAL  +GD AAFYN R+ GFQDT CDDKGRHFFKD YIEGTVDFIFG+GK+LY+ T L
Sbjct  179   QAVALRVAGDKAAFYNCRILGFQDTVCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLKTHL  238

Query  710   HVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISD  889
             +VI+   M V+TAQA+HT  ED+G+SF H  +TG    A LGR WM    VVF+Y ++S 
Sbjct  239   NVIKEKFMTVITAQAKHTSSEDSGFSFVHSSITGDATDAYLGRAWMEMPEVVFSYSKMSK  298

Query  890   AIKPEGW--HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFI  1063
              + P GW  +  P +        F EYK +GPGA  + R  F K++ D   K+FIS G+I
Sbjct  299   VVIPAGWSNYNHPEREK---NILFAEYKCSGPGANPSGRVKFSKQLSDSAAKRFISLGYI  355

Query  1064  EASKWLLPP  1090
             + SKWLLPP
Sbjct  356   QGSKWLLPP  364



>ref|XP_003634032.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38547.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 238/361 (66%), Gaps = 7/361 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCP----GVFSD-DSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKA  187
             + ++++    L P     V +D D+  IP++K ++  WF ++IQ    R+  L+P L +A
Sbjct  3     MTVISIAFFLLVPLSSSAVLADNDNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEA  62

Query  188   EAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLH  367
             E   K I+V K+G G+F T+  A++SVP GNTQRVII IG G Y E++KI R KPFI+ +
Sbjct  63    EDSVKIIKVSKSGGGNFNTVMAAVNSVPAGNTQRVIIWIGGGVYEEKIKIDRNKPFITFY  122

Query  368   GDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALT  547
             G  +D P +    TAA+ GTV SAT+IVE DYFMA  I +INS+PRPDGKRKGAQAVAL 
Sbjct  123   GSPEDMPKLSFDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALR  182

Query  548   QSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGD  727
              SGD AAFYN RL GFQDT CDD+GRHFF + Y+EGTVD+IFG+GK+LY+ TELH     
Sbjct  183   VSGDKAAFYNCRLIGFQDTLCDDRGRHFFHECYVEGTVDYIFGSGKSLYLSTELHTKGDG  242

Query  728   NMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEG  907
               +V+TAQA++   ED GYSF HC ++G G    LGR WM+  RVVF+Y  +S  + P G
Sbjct  243   GFSVITAQARNLEWEDNGYSFVHCTLSGTGGNTFLGRAWMSRPRVVFSYTFMSSVVSPLG  302

Query  908   WHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
             W     +       ++GEYK  GP A  + RP F K++ D     FI+  +I+AS WLLP
Sbjct  303   WSD-NDQPERDSLVFYGEYKCMGPAADTSKRPKFSKELDDNGATPFITLNYIDASTWLLP  361

Query  1088  P  1090
             P
Sbjct  362   P  362



>ref|XP_008234141.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=367

 Score =   358 bits (920),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/359 (48%), Positives = 241/359 (67%), Gaps = 7/359 (2%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             VN  + +T++L +      +DD  P+ A++ +VN+WF++N++P + R+  L+P LA AEA
Sbjct  10    VNAALTMTLIL-FTATITMADDHTPVLADQSQVNTWFNNNVKPYTARRGTLDPALATAEA  68

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
               K I+V K+G G FKTI +A       NT+RVI+ IG G Y E++ I R KPF++ +G 
Sbjct  69    GQKVIKVMKDGSGQFKTITDAXXX----NTKRVIVYIGGGEYNEKITIPRNKPFVTFYGS  124

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++    T+ + GTV SATVI E DYF+AS + I NS+PRPDGKR GAQAVAL  S
Sbjct  125   PANMPTLTFAGTSQKYGTVNSATVIAESDYFVASNVIIKNSSPRPDGKRVGAQAVALRVS  184

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ +A YN +L GFQDT CDD+G H FKD +IEGTVDFI+G+GK+LY++TELHV+  + +
Sbjct  185   GNKSALYNCKLIGFQDTLCDDRGNHLFKDCFIEGTVDFIWGSGKSLYLNTELHVLGDNGL  244

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HCK+TG G G  LGR W     VV+AY  ++  I P GW 
Sbjct  245   TVITAQARDSASEDTGYSFVHCKITGTGSGTYLGRAWRTNPMVVYAYTSMTKVINPAGWS  304

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                       T ++GEYK +GPG+    R  + K + D+++K F+S G+I+ SKWLLPP
Sbjct  305   D-DNHPERDSTVFYGEYKCSGPGSSAAGRVKYTKHLTDEQIKPFLSLGYIQGSKWLLPP  362



>ref|NP_568181.1| putative pectinesterase 48 [Arabidopsis thaliana]
 sp|Q9LY19.2|PME48_ARATH RecName: Full=Probable pectinesterase 48; Short=PE 48; AltName: 
Full=Pectin methylesterase 48; Short=AtPME48; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED91154.1| putative pectinesterase 48 [Arabidopsis thaliana]
Length=361

 Score =   358 bits (918),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 239/360 (66%), Gaps = 3/360 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAE  190
             +  N  +++ +L+ ++ P VF+DD  PIP  K +V  WF++++ P + RK L+P L  AE
Sbjct  2     RYTNVSILLGMLVIFVSPMVFADDLTPIPEGKPQVVQWFNTHVGPLAQRKGLDPALVAAE  61

Query  191   AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG  370
             A P+ I V   G G+FKT+ +AI SVP GNT+RVII +  G Y E++ I R KPFI+L G
Sbjct  62    AAPRIINVNPKG-GEFKTLTDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMG  120

Query  371   DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
                  P I    TAA+ GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  
Sbjct  121   QPNAMPVITYDGTAAKYGTVDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRI  180

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
             SG+ AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD 
Sbjct  181   SGNFAAFYNCKFYGFQDTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDG  239

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             + V+ A A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW
Sbjct  240   IRVIAAHAGKSAEEKSGYSFVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGW  299

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                    H   T ++GEYK +GPG+    R  F + + D+E   F+S G+I+ SKWLLPP
Sbjct  300   QENKTPAH-DKTVFYGEYKCSGPGSHKAKRVPFTQDIDDKEANCFLSLGYIQGSKWLLPP  358



>ref|XP_002321778.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
 gb|EEF05905.1| hypothetical protein POPTR_0015s12220g [Populus trichocarpa]
Length=362

 Score =   357 bits (917),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 237/353 (67%), Gaps = 8/353 (2%)
 Frame = +2

Query  41    VLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVC  217
             V+L  +     S D+ PIP     +NSWFH+N++  + R   L+P L  AEAKPK IRV 
Sbjct  13    VILLLVSTTAGSKDTSPIPGEPSSLNSWFHANVKSYTQRNGTLDPALETAEAKPKTIRVR  72

Query  218   KNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSII  397
             K+G GDFKT+  A+ S+ +GNTQRVI+ IG G Y E+++I +EKPF++  G     P++ 
Sbjct  73    KDGSGDFKTLTGAVRSISSGNTQRVIVDIGSGVYNEKIQIEKEKPFVTFKGSASSMPTLT  132

Query  398   GCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYN  577
                TA   GTV SAT+ V+ DYF+AS I I NS+PRP GK K  QAVAL   GD AAFYN
Sbjct  133   FAGTARVYGTVYSATLQVDSDYFVASNIIIKNSSPRPSGKLK-EQAVALRIGGDKAAFYN  191

Query  578   VRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQ  757
              RL GFQDT CDDKGRHFFKD YIEGTVDFIFG+GK+LY+ T ++V+    +AV+TAQA+
Sbjct  192   CRLIGFQDTLCDDKGRHFFKDCYIEGTVDFIFGSGKSLYLGTAINVLADQGLAVITAQAR  251

Query  758   HTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW--HGVPGKT  931
             + +E+DTG+SF HCKV G+G+ A LGR W    RVVFA+  +S  + P GW  +  P + 
Sbjct  252   N-KEDDTGFSFVHCKVNGIGKWAFLGRAWTERPRVVFAFTTMSSVVNPGGWSDNQHPERD  310

Query  932   HYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                    FGEYK  GPG+  + R  F +++  Q+VK F+S  +IE SKWLLPP
Sbjct  311   R---IVSFGEYKCKGPGSNPSGRVKFSRQLTPQQVKPFLSLAYIEGSKWLLPP  360



>gb|KDP39968.1| hypothetical protein JCGZ_03499 [Jatropha curcas]
Length=358

 Score =   356 bits (913),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 184/369 (50%), Positives = 241/369 (65%), Gaps = 18/369 (5%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVF------SDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNP  172
             M+  L ++  + + +   VF      SDD++PIP  + EVN+WF +N++P + RK  L+ 
Sbjct  1     MIKHLNLLAFVEYAIIAIVFTAITVSSDDAVPIPEAEAEVNAWFEANVKPLADRKGTLDG  60

Query  173   ELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
              L  AEA PK I+V  +G G+FKTI +A+ S+P  NTQRVI+ IGPG YTE++ + +EK 
Sbjct  61    NLEAAEATPKTIKVSADGSGEFKTITDAVKSIPAKNTQRVIVDIGPGTYTEKITVEKEKG  120

Query  353   FISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQ  532
             F+S  G   ++  I    TA + GTV SAT+ VE D+F        N+AP PDG R GAQ
Sbjct  121   FVSFIGV-PEKTIIEFAGTAHEYGTVYSATLQVESDFF--------NTAPPPDGVRPGAQ  171

Query  533   AVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELH  712
             AVA    G+MA+FYN R  GFQDT CDDKG HFFKD YIEGTVDFIFG+GK++Y++T+L 
Sbjct  172   AVAFRIGGNMASFYNCRFIGFQDTICDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTQLE  231

Query  713   VIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDA  892
             VI+  +M V+ AQA+   EE TG+SF HC +TG  +GA LGR WM   + +FAY  ISD 
Sbjct  232   VIQDKDMTVIVAQARGNAEE-TGFSFVHCSITGKAKGAFLGRAWMPAPKAIFAYSTISDV  290

Query  893   IKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEAS  1072
             I PEGW             +FGEYKNTGPGA +  R  F K++ + EVK FIS  +IE S
Sbjct  291   ICPEGWSN-NQHPEREPEIFFGEYKNTGPGAAIEGRVKFAKQLTEAEVKPFISLSYIEGS  349

Query  1073  KWLLPPAKV  1099
             KWLLPP K+
Sbjct  350   KWLLPPPKL  358



>gb|KFK27921.1| hypothetical protein AALP_AA8G447400 [Arabis alpina]
Length=364

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/357 (50%), Positives = 236/357 (66%), Gaps = 3/357 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
              L+++ +L+    P VF +D+ PIP NK  +  WF +N+   ++RK  L+  L  AE  P
Sbjct  7     SLIVIALLVVVTSPVVFGNDASPIPENKFGIEQWFKTNVPSLASRKGTLDQALLIAETAP  66

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I+V KNG+G FKTI EAI SV  GNT+RVII IGPG Y E++ I R KPFI+L+G   
Sbjct  67    RVIKVKKNGRGHFKTITEAIKSVREGNTRRVIIKIGPGVYKEKITIDRNKPFITLYGHPN  126

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
               P +    TA Q GTV SAT+IV  DYFMA  I + NSAP PDGK KGAQA+++  SG+
Sbjct  127   AMPVLTYDGTALQYGTVDSATLIVMSDYFMAVNIIVKNSAPMPDGKMKGAQALSMRISGN  186

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+LHV+ GD + V
Sbjct  187   KAAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLHVV-GDGIRV  245

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA A     E++GY+F HC VTG G G  LGR WM++ +VV+AY ++S  + P GW   
Sbjct  246   ITAHAGKATVENSGYTFVHCTVTGTGTGIYLGRAWMSYPKVVYAYTDMSSVVNPSGWQE-  304

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               +T    T ++GEYK TG G+    R  F + + D E K F S G+I+ S W+LPP
Sbjct  305   NRETGQDKTVFYGEYKCTGTGSHKEKRVKFTQDIDDTEAKFFTSLGYIKGSSWVLPP  361



>ref|XP_002511043.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51645.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/342 (52%), Positives = 230/342 (67%), Gaps = 4/342 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKT  244
             V SDD+ PIP     +  WF +N++P + RK  L+P L  AEA PK I+V  +G G+FKT
Sbjct  25    VSSDDTTPIPEAASGIAGWFSANVKPLADRKGTLDPALEAAEANPKTIKVRLDGSGEFKT  84

Query  245   IKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG  424
             I +A+ S+P+GNTQRVI+ IGPG Y E++ I R+KPF++  G   +  +I    TA + G
Sbjct  85    IADAVKSIPSGNTQRVIVDIGPGTYNEKITIERDKPFVTFLGP-SNMATIAFGGTAHEYG  143

Query  425   TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDT  604
             TV SAT+ VE +YF+A+ + I N+APRPDGK  GAQA+A+   G  AAFY V++ GFQDT
Sbjct  144   TVYSATLQVESEYFIAANLIIQNTAPRPDGKTPGAQALAVRTGGSKAAFYKVKMLGFQDT  203

Query  605   FCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGY  784
              CDDKG HFFKD YIEGTVDFIFG+GK++Y++TE++V+      V+TAQA+    EDTG+
Sbjct  204   LCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTVITAQARQ-GSEDTGF  262

Query  785   SFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEY  964
             SF HC V G G GA LGR WM   RVVFAY  ++  + PEGW              FGEY
Sbjct  263   SFVHCSVGGTGTGAHLGRAWMEAPRVVFAYTAMTGVVNPEGWSS-NNHPEREAKVVFGEY  321

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             KNTGPGA    R  + K++ D E+  F+S GFIE SKWLLPP
Sbjct  322   KNTGPGAAPDGRVKYSKQLTDAEIAPFLSLGFIEGSKWLLPP  363



>gb|AAG52566.1|AC010675_14 putative pectin methylesterase; 8433-9798 [Arabidopsis thaliana]
Length=338

 Score =   355 bits (911),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/341 (51%), Positives = 230/341 (67%), Gaps = 7/341 (2%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTI  247
             VF+DD  PIP  K +V  WF++N+ P + RK L+P L  AEA P+ I    NG G+FKT+
Sbjct  2     VFADDVTPIPEGKPQVAQWFNANVGPLAQRKGLDPALVAAEAAPRII----NG-GEFKTL  56

Query  248   KEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGT  427
              +AI SVP GNT+RVII + PG Y E++ I R KPFI+L G     P I    TAA+ GT
Sbjct  57    TDAIKSVPAGNTKRVIIKMAPGEYKEKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  116

Query  428   VMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTF  607
             V SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+ AAFYN + +GFQDT 
Sbjct  117   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  176

Query  608   CDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYS  787
             CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V+ A A  + EE +GYS
Sbjct  177   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYS  235

Query  788   FAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYK  967
             F HCKVTG G G  LGR WM+  +VV+AY E++  + P GW       H   T ++GEYK
Sbjct  236   FVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKTPAH-DKTVFYGEYK  294

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +GPG+    R  F + + D+E  +F+S G+I+ SKWLLPP
Sbjct  295   CSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPP  335



>ref|XP_007207766.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
 gb|EMJ08965.1| hypothetical protein PRUPE_ppa026550mg [Prunus persica]
Length=371

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 243/359 (68%), Gaps = 3/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             V+  ++VT++L      V +DD+ P+PA+  +VN+WF++N++    R+  L+P L  AE 
Sbjct  10    VHAALIVTLILLTAAIAVANDDT-PVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEV  68

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 ++V K+G G+FKTI +A++S+P  NT+RVI+ IG G Y E++ I R KPF++ +G 
Sbjct  69    GQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGS  128

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++   S A + GT+ SATVI E DYF+A  + I NS+P+P     G QA+AL  S
Sbjct  129   PTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVS  188

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G  +A +N RL GFQDT CDDKG HFFKD +IEGTVDFIFG+GK+LY++TELHV+  + M
Sbjct  189   GTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEM  248

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HC +TG G G  LGR W    RVVFAY  +S+ I P GW+
Sbjct  249   TVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGMSEVITPAGWN  308

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 +     T ++GEYK +GPG+ +  R  + K++ ++++K F++ G+I+ SKWLLPP
Sbjct  309   N-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYIQGSKWLLPP  366



>ref|XP_007206641.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 ref|XP_007206849.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
 gb|EMJ07840.1| hypothetical protein PRUPE_ppa021246mg [Prunus persica]
 gb|EMJ08048.1| hypothetical protein PRUPE_ppa027083mg [Prunus persica]
Length=371

 Score =   355 bits (910),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/359 (47%), Positives = 243/359 (68%), Gaps = 3/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             V+  ++VT++L      V +DD+ P+PA+  +VN+WF++N++    R+  L+P L  AE 
Sbjct  10    VHAALIVTLILLTATIAVANDDT-PVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEV  68

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 ++V K+G G+FKTI +A++S+P  NT+RVI+ IG G Y E++ I R KPF++ +G 
Sbjct  69    GQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGS  128

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++   S A + GT+ SATVI E DYF+A  + I NS+P+P     G QA+AL  S
Sbjct  129   PTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVS  188

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G  +A +N RL GFQDT CDDKG HFFKD +IEGTVDFIFG+GK+LY++TELHV+  + M
Sbjct  189   GTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEM  248

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HC +TG G G  LGR W    RVVFAY  +S+ I P GW+
Sbjct  249   TVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFAYTGMSEVITPAGWN  308

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 +     T ++GEYK +GPG+ +  R  + K++ ++++K F++ G+I+ SKWLLPP
Sbjct  309   N-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYIQGSKWLLPP  366



>ref|XP_002530224.1| Pectinesterase U1 precursor, putative [Ricinus communis]
 gb|EEF32171.1| Pectinesterase U1 precursor, putative [Ricinus communis]
Length=368

 Score =   354 bits (909),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/358 (50%), Positives = 237/358 (66%), Gaps = 7/358 (2%)
 Frame = +2

Query  35    VTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIR  211
             + ++L  L     SDD+  IP ++  +NSWF +N++P ++RK  LNP L  AEA PK I+
Sbjct  15    IILVLAVLISTATSDDTEQIPESQSALNSWFEANVKPYASRKGTLNPALEAAEANPKTIK  74

Query  212   VCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPS  391
             V  +G GDFKT+ +A+ S+P  NTQRVI+ IGPG YTE++ +  +KPF++L+G     P+
Sbjct  75    VRTDGSGDFKTVTDALKSIPVKNTQRVIVDIGPGVYTEKITVDIQKPFVTLYGSPNAMPT  134

Query  392   IIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAF  571
             +    TA + GT  SAT+IV  DYF+A+ I I N+APRP+GK +G QAVAL   G  AA 
Sbjct  135   LAFGGTAKEYGTDDSATLIVMSDYFVAANIIIKNTAPRPNGKPQG-QAVALRLWGSKAAI  193

Query  572   YNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQ  751
             YN R+ GFQDT CDD G HFFKD YIEGT+DFIFG GK++Y+++ +HV++   + V+TAQ
Sbjct  194   YNCRILGFQDTLCDDHGMHFFKDCYIEGTIDFIFGLGKSIYLNSIIHVVDDKLLTVITAQ  253

Query  752   AQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--PG  925
             A    +EDTG+ F HC +TG G GA LGR WM   RVVFAY  +   I P GW     P 
Sbjct  254   AGSDPKEDTGFVFVHCSITGDGTGAFLGRAWMPMPRVVFAYTRMGKVIHPGGWFNNFHPE  313

Query  926   KTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             +     T  F EYK+TGPG K   R  + K++ D E KK+IS G+IE S WLLPP K+
Sbjct  314   RER---TVSFAEYKSTGPGYKPNERVKYSKQLTDTEAKKYISLGYIEGSTWLLPPPKL  368



>ref|XP_010546117.1| PREDICTED: pectinesterase PPME1-like isoform X2 [Tarenaya hassleriana]
Length=348

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 233/342 (68%), Gaps = 4/342 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKT  244
             V + D+ PIP  + +V+ WF +N++  S RK  L+P L  AEAKP  I V K G G F+T
Sbjct  7     VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGG-GQFRT  65

Query  245   IKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG  424
             + EA+ S+P GN++RVII +GPG Y E++ I R KPFI+L G+ K  P I    TAA+ G
Sbjct  66    LTEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYG  125

Query  425   TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDT  604
             TV SAT+IV  DYFMA  + + N+AP PDGK KGAQA+A+  SG+ AAFYN + +G+QDT
Sbjct  126   TVDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDT  185

Query  605   FCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGY  784
              CDD G HFFKD YIEGT DFIFG+G +LY+ T+LHV+ GD + V+TAQA  +  + +GY
Sbjct  186   VCDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGY  244

Query  785   SFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEY  964
             SF HC+VTG GEG  LGR WM   +VV+AY E++  + P GWH  P  +    T ++GEY
Sbjct  245   SFVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGWHHNPDISR-DKTVFYGEY  303

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             K  GPG+    R  + + +   E ++F++ G+I+ SKWLLPP
Sbjct  304   KCYGPGSLKHKRVPYTQDLDATEARRFLTLGYIQGSKWLLPP  345



>ref|XP_010523318.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=364

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 171/356 (48%), Positives = 232/356 (65%), Gaps = 3/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             LV + ++L    P V ++D  PIP NK +VN WF++ +QP S RK  L+P LA AE+ P+
Sbjct  8     LVALLMVLASPPPAVLANDVTPIPENKGQVNPWFNAQVQPFSRRKATLDPALAAAESSPR  67

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              IRV KNG GDF T+  AI+S+P+GN +RVII +GPG Y E++ I R KPF++L+G    
Sbjct  68    VIRVNKNGGGDFNTLTAAINSIPSGNARRVIIKLGPGEYREKVTIGRTKPFVTLYGQPNA  127

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +     A Q GT  SAT+IV  DYF A  I + N+AP+PD +R   QA+A+  SG+ 
Sbjct  128   MPVLTFNGKATQYGTFNSATLIVLSDYFTAVNIIVKNTAPKPDPRRDDGQALAMRISGNK  187

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +GFQDT CDD G HFFKD Y+EGT DFIFGNG +LY+ T +H + G+ + V+
Sbjct  188   AAFYNCKFYGFQDTLCDDTGNHFFKDCYVEGTFDFIFGNGTSLYIGTLIHAV-GNGIRVI  246

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             +AQ   + ++ +GYSF HCKVTG GEG  LGR W    +V++AY E++  + P GW    
Sbjct  247   SAQGAQSAKDPSGYSFVHCKVTGEGEGIYLGRAWRTHPKVIYAYTEMTSVVNPAGWQNNT  306

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              K     T ++GEYK  GPG+    R  F + +  QE   F+S G+I+ SKWLLPP
Sbjct  307   EKARQ-KTVFYGEYKCFGPGSHQEKRVPFTQDIDAQEAAHFLSLGYIQGSKWLLPP  361



>ref|XP_010666418.1| PREDICTED: pectinesterase 1-like [Beta vulgaris subsp. vulgaris]
Length=362

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 242/357 (68%), Gaps = 5/357 (1%)
 Frame = +2

Query  41    VLLHYLCPGVFSDDS-IPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAE-AKPKHIR  211
             ++L  L   +F+ D+   IP N  EV +WF + ++P S  K  L P +  AE    + I 
Sbjct  7     IILASLFLVIFTIDAQTLIPENAAEVETWFSNVVKPISQAKGALEPSVIDAENGGVETID  66

Query  212   VCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRP  388
             V ++G G FKTI +A+  V  GN +RVII+IGPG Y E++KI R + +I+ +G D K+RP
Sbjct  67    VRQDGSGKFKTISDAVKHVKVGNKKRVIITIGPGEYREKVKIERLQSYITFYGTDPKNRP  126

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
             +I    TAAQ GTV SAT+IVE DYF+A+ + I NSAPRP+GK KG QA A+  SGD +A
Sbjct  127   TITFGGTAAQYGTVDSATLIVESDYFVAANLIISNSAPRPNGKTKGGQAAAIRISGDRSA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FYN +  GFQDT CDDKG HFFKD YIEGTVDFIFG  +++Y++TELHVI GD  A++TA
Sbjct  187   FYNCKFTGFQDTVCDDKGNHFFKDCYIEGTVDFIFGEARSIYLNTELHVIPGDLEAMITA  246

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
              A+  ++   GYSF HCKVTG G  A+LGR W   +RVV+++C+IS+ I+PEGW     K
Sbjct  247   HARGNQDGVGGYSFVHCKVTGTGGIAVLGRAWFPAARVVYSFCDISNVIRPEGWSD-NKK  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
               Y  T YFGEYKN G GA +  R  + K + D E K FIS  +I+A+KWLLPP KV
Sbjct  306   AAYQTTVYFGEYKNKGTGADIKKRVPYFKNLTDIEAKLFISMEYIDAAKWLLPPPKV  362



>ref|XP_010546116.1| PREDICTED: pectinesterase PPME1-like isoform X1 [Tarenaya hassleriana]
Length=363

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 233/342 (68%), Gaps = 4/342 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKT  244
             V + D+ PIP  + +V+ WF +N++  S RK  L+P L  AEAKP  I V K G G F+T
Sbjct  22    VLASDATPIPEARGQVDQWFATNVKALSQRKGTLDPALEAAEAKPLVITVNKGG-GQFRT  80

Query  245   IKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG  424
             + EA+ S+P GN++RVII +GPG Y E++ I R KPFI+L G+ K  P I    TAA+ G
Sbjct  81    LTEALRSIPAGNSRRVIIRMGPGEYREKVTIDRNKPFITLLGNPKSMPVITFDGTAAKYG  140

Query  425   TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDT  604
             TV SAT+IV  DYFMA  + + N+AP PDGK KGAQA+A+  SG+ AAFYN + +G+QDT
Sbjct  141   TVDSATLIVLSDYFMAINVIVKNTAPAPDGKTKGAQALAMRISGNKAAFYNCKFYGYQDT  200

Query  605   FCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGY  784
              CDD G HFFKD YIEGT DFIFG+G +LY+ T+LHV+ GD + V+TAQA  +  + +GY
Sbjct  201   VCDDTGSHFFKDCYIEGTFDFIFGSGTSLYLRTQLHVV-GDGIRVITAQAGKSTADQSGY  259

Query  785   SFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEY  964
             SF HC+VTG GEG  LGR WM   +VV+AY E++  + P GWH  P  +    T ++GEY
Sbjct  260   SFVHCRVTGTGEGIYLGRAWMTHPKVVYAYTEMTSVVNPSGWHHNPDISR-DKTVFYGEY  318

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             K  GPG+    R  + + +   E ++F++ G+I+ SKWLLPP
Sbjct  319   KCYGPGSLKHKRVPYTQDLDATEARRFLTLGYIQGSKWLLPP  360



>gb|AAM65347.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   352 bits (904),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 229/341 (67%), Gaps = 3/341 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTI  247
             VF+DD  PIP  K +V  WF++++ P   RK L+P L  AEA P+ I V   G G+FKT+
Sbjct  2     VFADDLTPIPEGKPQVVQWFNTHVGPLVQRKGLDPALVAAEAAPRIINVNPKG-GEFKTL  60

Query  248   KEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGT  427
              +AI SVP GNT+RVII + PG Y E++ I R KPFI+L G     P I    TAA+ GT
Sbjct  61    TDAIKSVPAGNTKRVIIKMAPGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  120

Query  428   VMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTF  607
             V SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+ AAFYN + +GFQDT 
Sbjct  121   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  180

Query  608   CDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYS  787
             CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V+ A A  + EE++GYS
Sbjct  181   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEENSGYS  239

Query  788   FAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYK  967
             F HCKVTG G    LGR WM+  +VV+AY E++  + P GW       H   T ++GEYK
Sbjct  240   FVHCKVTGTGGVIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKTPAH-DKTVFYGEYK  298

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +GPG+    R  F + + D+E  +F+S G+I+ SKWLLPP
Sbjct  299   CSGPGSHKAKRVPFTQDIDDKEANRFLSLGYIQGSKWLLPP  339



>ref|XP_007207707.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
 gb|EMJ08906.1| hypothetical protein PRUPE_ppa025119mg [Prunus persica]
Length=371

 Score =   353 bits (906),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/359 (47%), Positives = 243/359 (68%), Gaps = 3/359 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             V+  ++VT++L      V +DD+ P+PA+  +VN+WF++N++    R+  L+P L  AE 
Sbjct  10    VHAALIVTLILLTAIIAVANDDT-PVPADYSQVNTWFNNNVKSYKERQGTLDPALVTAEV  68

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 ++V K+G G+FKTI +A++S+P  NT+RVI+ IG G Y E++ I R KPF++ +G 
Sbjct  69    GQTVVKVMKDGSGEFKTITDAVNSIPADNTKRVIVYIGGGEYNEKITIPRNKPFVTFYGS  128

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++   S A + GT+ SATVI E DYF+A  + I NS+P+P     G QA+AL  S
Sbjct  129   PTNMPTLTFSSGAPKYGTMDSATVIAESDYFVAVNLIIKNSSPKPARNSVGQQALALRVS  188

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G  +A +N RL GFQDT CDDKG HFFKD +IEGTVDFIFG+GK+LY++TELHV+  + M
Sbjct  189   GTKSALFNCRLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGDNEM  248

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HC +TG G G  LGR W    RVVF+Y  +S+ I P GW+
Sbjct  249   TVITAQARDSASEDTGYSFVHCNITGTGNGTYLGRAWRISPRVVFSYTGMSEVITPAGWN  308

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                 +     T ++GEYK +GPG+ +  R  + K++ ++++K F++ G+I+ SKWLLPP
Sbjct  309   N-KNRPERDSTVFYGEYKCSGPGSNMVGRVKYAKQLNEEQIKPFLNLGYIQGSKWLLPP  366



>ref|XP_002277202.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38546.3| unnamed protein product [Vitis vinifera]
Length=369

 Score =   352 bits (904),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/341 (51%), Positives = 230/341 (67%), Gaps = 6/341 (2%)
 Frame = +2

Query  77    DDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             +D+  IP++K ++  WF ++IQ    R+  L+P L +AE   K I+V K+G G+F T+  
Sbjct  26    NDNAQIPSDKSQLAPWFRNSIQKYKLRRTTLDPALVEAEDSVKIIKVSKSGGGNFNTVMA  85

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++SVP GNT+RVII IG G Y E++KI R+KPFI+ +G  +D P +    TAA+ GTV 
Sbjct  86    AVNSVPAGNTRRVIIWIGGGEYEEKIKIDRDKPFITFYGSPEDMPKLSFDGTAAEFGTVD  145

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             SAT+IVE DYFMA  I +INS+PRPDGKRKGAQAVAL  SGD AAFYN RL GFQDT CD
Sbjct  146   SATLIVESDYFMAVNIIVINSSPRPDGKRKGAQAVALRVSGDKAAFYNCRLIGFQDTLCD  205

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFF   Y+EGTVD+IFG+GK+LY+ TELH       +V+TAQA++   ED GYSF 
Sbjct  206   DRGRHFFHGCYVEGTVDYIFGSGKSLYLSTELHTKGDGGFSVITAQARNLESEDNGYSFV  265

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--PGKTHYGGTTYFGEYK  967
             HC ++G G    LGR WM+  +VVF+Y  +S  + P GW     P +       ++GEYK
Sbjct  266   HCTLSGTGGNTFLGRAWMSRPKVVFSYTFMSPVVSPLGWSNNIHPERESL---VFYGEYK  322

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               GPGA  + R  F K++ D     FI+  +I+AS WLLPP
Sbjct  323   CMGPGADTSKRSKFTKELDDDGATPFITLNYIDASTWLLPP  363



>ref|XP_006399225.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
 gb|ESQ40678.1| hypothetical protein EUTSA_v10013901mg [Eutrema salsugineum]
Length=364

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 231/344 (67%), Gaps = 4/344 (1%)
 Frame = +2

Query  62    PGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDF  238
             P V +DD+ PIP  K +V  WF +N+ P ++RK  L+P L  AEA+P+ I V K G G+F
Sbjct  21    PMVLADDTTPIPEAKPQVEQWFKTNVGPLASRKGTLDPALVAAEAEPRIINVNKKG-GEF  79

Query  239   KTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQ  418
              T+ +A+ SVP GNT+RVII +GPG Y E++ I R KPFI+L G     P I    TAA+
Sbjct  80    TTLTDALKSVPAGNTKRVIIKMGPGEYREKVTIDRNKPFITLMGQPNAMPIISFDGTAAK  139

Query  419   DGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQ  598
              GTV SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+ AAFYN + +GFQ
Sbjct  140   YGTVDSASLIILSDYFMAVNIVVKNTAPMPDGKTKGAQALSMRISGNKAAFYNCKFYGFQ  199

Query  599   DTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDT  778
             DT CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V+TA A  + EE +
Sbjct  200   DTICDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVITAHAGKSAEEKS  258

Query  779   GYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFG  958
             GYSF HCKVTG G G  LGR WM+  +VV+AY E++  + P GW       H   T ++G
Sbjct  259   GYSFVHCKVTGDGNGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQENKMPAH-DKTVFYG  317

Query  959   EYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             EYK +GPG+    R  F + +   E  +F+S G+I+ S WLLPP
Sbjct  318   EYKCSGPGSHKAKRVPFTQDIDATEANRFLSLGYIQGSAWLLPP  361



>ref|XP_002277388.2| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
 emb|CBI38548.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 228/355 (64%), Gaps = 3/355 (1%)
 Frame = +2

Query  41    VLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVC  217
             V    + P     D   IP +  ++ SWF+  IQ  + R+  L+P L KAE + K I+V 
Sbjct  17    VFFFLVLPSTVLADDPQIPDDAIQLASWFNDVIQSHNLRRTTLDPVLVKAEERVKIIKVS  76

Query  218   KNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSII  397
             K G G+F  +  A+DSVP GNTQRVII IG G Y E++KI R KPFI+ +G   D P + 
Sbjct  77    KGGGGNFNKVMAAVDSVPAGNTQRVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPMLS  136

Query  398   GCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYN  577
                TAA+ GTV SAT+IVE DYFMA  I +INS+PRP+G+R G QAVA+  SGD AAFYN
Sbjct  137   FDGTAAKFGTVDSATLIVESDYFMAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFYN  196

Query  578   VRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI-EGDNMAVVTAQA  754
              +L GFQDT CDD+GRHFF   YIEGTVDFIFG+GK+LY+ TELH    G   +V+TAQA
Sbjct  197   CKLVGFQDTLCDDRGRHFFHGCYIEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQA  256

Query  755   QHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTH  934
             +    ED GYSF HC+V+G G    LGR WM+  RVVF+Y  +S  + P GW        
Sbjct  257   RKLESEDNGYSFVHCRVSGSGSNTYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFHPE  315

Query  935   YGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                  ++GEYK  GPGA  + R  F K + D  V+ F++  +IEASKWLLPP ++
Sbjct  316   RDSLVFYGEYKCMGPGANTSKRAKFAKMLDDDGVRPFVTLNYIEASKWLLPPPRL  370



>ref|XP_010523329.1| PREDICTED: pectinesterase PPME1-like [Tarenaya hassleriana]
Length=362

 Score =   351 bits (901),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 232/342 (68%), Gaps = 7/342 (2%)
 Frame = +2

Query  74    SDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIK  250
             + D+ PIP NK ++  WF +N+ P + RK +L+P L  AEA P+ IRV KNG GDFKT+ 
Sbjct  22    TGDATPIPQNKAQLQQWFRANVAPLAQRKGSLDPALVAAEAAPRVIRVNKNGGGDFKTLN  81

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTV  430
              AI+S+P GNT+RVII +GPG Y E++ I R KPF++L+G     P +    TAA+ GTV
Sbjct  82    AAINSIPAGNTKRVIIKLGPGEYREKVTIDRNKPFVTLYGQPNAMPVLTYDGTAAKYGTV  141

Query  431   MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SAT IV  DYFMA  +   NSAP PDG+ KGAQA+A   SG+ AAFYN + +G+QDT C
Sbjct  142   DSATFIVLSDYFMAVNVIFKNSAPMPDGRMKGAQALAARVSGNKAAFYNCKFYGYQDTVC  201

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             DD G HFFKD YIEGT DFIFG+G +LY++T+L+V+ G+ + V+TA+A  +  + +GY F
Sbjct  202   DDIGNHFFKDCYIEGTFDFIFGSGTSLYLNTQLNVV-GNGIRVITAEAGKSVSDPSGYVF  260

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW--HGVPGKTHYGGTTYFGEY  964
             AH +VTG G G  LGR WM+  +VV+AY E++  + P GW  + +PG+     T ++ EY
Sbjct  261   AHSRVTGTGTGIYLGRAWMSHPKVVYAYTEMTSIVAPAGWQQNSIPGRDK---TVFYREY  317

Query  965   KNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             K  GPG+ +  R  F + +   E   F+S G+I+ SKWLLPP
Sbjct  318   KCYGPGSNIAKRVPFTRSLNPTEAGHFLSLGYIQGSKWLLPP  359



>emb|CAB87930.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
Length=342

 Score =   350 bits (897),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 228/341 (67%), Gaps = 3/341 (1%)
 Frame = +2

Query  68    VFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTI  247
             VF+DD  PIP  K +V  WF++++ P + RK L+P L  AEA P+ I V   G G+FKT+
Sbjct  2     VFADDLTPIPEGKPQVVQWFNTHVGPLAQRKGLDPALVAAEAAPRIINVNPKG-GEFKTL  60

Query  248   KEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGT  427
              +AI SVP GNT+RVII +  G Y E++ I R KPFI+L G     P I    TAA+ GT
Sbjct  61    TDAIKSVPAGNTKRVIIKMAHGEYREKVTIDRNKPFITLMGQPNAMPVITYDGTAAKYGT  120

Query  428   VMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTF  607
             V SA++I+  DYFMA  I + N+AP PDGK KGAQA+++  SG+ AAFYN + +GFQDT 
Sbjct  121   VDSASLIILSDYFMAVNIVVKNTAPAPDGKTKGAQALSMRISGNFAAFYNCKFYGFQDTI  180

Query  608   CDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYS  787
             CDD G HFFKD Y+EGT DFIFG+G ++Y+ T+LHV+ GD + V+ A A  + EE +GYS
Sbjct  181   CDDTGNHFFKDCYVEGTFDFIFGSGTSMYLGTQLHVV-GDGIRVIAAHAGKSAEEKSGYS  239

Query  788   FAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYK  967
             F HCKVTG G G  LGR WM+  +VV+AY E++  + P GW       H   T ++GEYK
Sbjct  240   FVHCKVTGTGGGIYLGRAWMSHPKVVYAYTEMTSVVNPTGWQENKTPAH-DKTVFYGEYK  298

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +GPG+    R  F + + D+E   F+S G+I+ SKWLLPP
Sbjct  299   CSGPGSHKAKRVPFTQDIDDKEANCFLSLGYIQGSKWLLPP  339



>gb|EYU20154.1| hypothetical protein MIMGU_mgv1a008641mg [Erythranthe guttata]
Length=367

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/357 (51%), Positives = 238/357 (67%), Gaps = 5/357 (1%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKH  205
             V+VTVLL  L        S PIPA+  ++NSWF+ N+   ++RK  L PELA AEA PK 
Sbjct  14    VLVTVLLS-LPVARSGGGSEPIPADASQINSWFNKNVGDAASRKATLAPELAAAEANPKV  72

Query  206   IRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDR  385
             I+V  +G GDFKTI +A+ S+P GN  RVI+SIGPG Y E++ +   KPF++L GD  + 
Sbjct  73    IKVRADGSGDFKTINDAVKSIPDGNKNRVIVSIGPGKYKEKVTVGANKPFVTLRGDAGNM  132

Query  386   PSIIGCSTAAQD-GTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
             P+I+   TA +  G V SAT+  E DYF A  + ++N+APRPDGK   AQAVAL   G  
Sbjct  133   PTIVYDDTAKKSKGVVYSATLSAESDYFSAVNLKVVNTAPRPDGKMVDAQAVALKIIGKY  192

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             A+ YN +L+GFQDT  DDKG+HF+KD YIEGT DFI+G+  ++Y++TELH+I GD +AV+
Sbjct  193   ASIYNCKLYGFQDTLFDDKGKHFYKDCYIEGTYDFIWGSAASIYLNTELHIISGDPLAVI  252

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              A A+    E  GY FAHCKVTG G    LGR W  ++RVV+A+ ++ DA+ P+GW+   
Sbjct  253   AANARSASAEPNGYVFAHCKVTGTGAMGYLGRSWYPYARVVYAFSDLGDAVNPDGWYTGT  312

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPA  1093
             GK +   T YFGEY N G   K   R +F KK+ D EVK FIS  FI+ S WLLPP+
Sbjct  313   GKDN--KTVYFGEYNNKGSAGKFDKRASFAKKLSDAEVKPFISLDFIQGSTWLLPPS  367



>ref|XP_010109161.1| Pectinesterase PPME1 [Morus notabilis]
 gb|EXC21090.1| Pectinesterase PPME1 [Morus notabilis]
Length=359

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 239/357 (67%), Gaps = 5/357 (1%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHI  208
             ++T+LL      V   D   +P NK +++SWF+ N++P + RK+ L+P L  AE   + I
Sbjct  7     LLTILLS--VAAVLGSDYSAVPPNKAQLHSWFNQNVRPVNERKSTLDPALVAAEQGRRVI  64

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V K+G G+FK I +AI+SVP+ N +RVII IGPG Y E++ I R K F++L+G+   +P
Sbjct  65    TVRKDGTGNFKRITDAINSVPSNNNKRVIIKIGPGEYREKITIDRTKRFVTLYGNPNAKP  124

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
             ++    TA Q GTV S T+I   DYF+A+ + I N+AP+PDGKRKGAQA AL  SGD +A
Sbjct  125   TLSYGGTAEQYGTVDSGTLIALADYFVAANLIIKNTAPKPDGKRKGAQASALRISGDKSA  184

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
              YN R+ GFQDT CDD+G HFFKD YIEGTVDFIFG+G ++Y++TELHV++   + V+TA
Sbjct  185   VYNCRILGFQDTICDDRGYHFFKDCYIEGTVDFIFGSGTSIYLNTELHVVQDSGIEVITA  244

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
             QA+ +  ++TGYSF HC VTG G    LGR WM+  +VV+ Y  + +AI P+GW      
Sbjct  245   QARQS-NDNTGYSFLHCAVTGTGSNTFLGRAWMSRPKVVYIYTNMGNAINPQGWSD-NFH  302

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
                  T ++GEYKN+G GA +  R  + K++   + K +++ GFI+ S WLLPP  V
Sbjct  303   PERDSTVFYGEYKNSGSGANMVKRVKYSKELTYDQAKPYMTLGFIKGSSWLLPPPNV  359



>ref|XP_009136509.1| PREDICTED: putative pectinesterase 63 isoform X2 [Brassica rapa]
Length=338

 Score =   347 bits (890),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 232/356 (65%), Gaps = 27/356 (8%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPK  202
              L++  +L+    P V+ +D+ PIP NK+ +  WF++N++                    
Sbjct  7     SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVR--------------------  46

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
                  +NG+GDFKT+ EAI+SVP GN +RVII +G G Y E++ I R KPFI+L+GD   
Sbjct  47    -----QNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNA  101

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TAA+ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+ 
Sbjct  102   MPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVI  220

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GWH   
Sbjct  221   TAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHE-N  279

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +T    T ++GEYK +GPG++   R  + + + + E   FIS G+I+ S WLLPP
Sbjct  280   TQTERDKTVFYGEYKCSGPGSRKEKRVKYTQDIDNIEANSFISLGYIQGSSWLLPP  335



>emb|CAN78808.1| hypothetical protein VITISV_030725 [Vitis vinifera]
Length=368

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 177/341 (52%), Positives = 225/341 (66%), Gaps = 6/341 (2%)
 Frame = +2

Query  92    IPANKD---EVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAI  259
             IP + D   ++ SWF+  IQ  + R+  L+P L KAE + K I+V K G G+F  +  A+
Sbjct  2     IPKSLDDAIQLASWFNDXIQSHNLRRTTLDPVLVKAEERVKIIKVSKGGGGNFNKVMAAV  61

Query  260   DSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSA  439
             DSVP GNTQRVII IG G Y E++KI R KPFI+ +G   D P +    TAA+ GTV SA
Sbjct  62    DSVPAGNTQRVIIWIGGGVYEEKIKIDRSKPFITFYGSPDDMPMLSFDGTAAKFGTVDSA  121

Query  440   TVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDK  619
             T+IVE DYFMA  I +INS+PRP+G+R G QAVA+  SGD AAFYN +L GFQDT CDD+
Sbjct  122   TLIVESDYFMAVNIIVINSSPRPEGRRNGGQAVAVRVSGDKAAFYNCKLVGFQDTLCDDR  181

Query  620   GRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI-EGDNMAVVTAQAQHTREEDTGYSFAH  796
             GRHFF   YIEGTVDFIFG+GK+LY+ TELH    G   +V+TAQA+    ED GYSF H
Sbjct  182   GRHFFHGCYIEGTVDFIFGSGKSLYLSTELHAKGAGGEFSVITAQARKLESEDNGYSFVH  241

Query  797   CKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTG  976
             C+V+G G    LGR WM+  RVVF+Y  +S  + P GW             ++GEYK  G
Sbjct  242   CRVSGSGSNTYLGRAWMSRPRVVFSYTNMSTVVHPLGWSD-NFHPERDSLVFYGEYKCMG  300

Query  977   PGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             PGA  + R  F K + D  V+ F++  +IEASKWLLPP ++
Sbjct  301   PGANTSKRAKFAKMLDDDGVRPFVTLNYIEASKWLLPPPRL  341



>ref|XP_007216116.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
 gb|EMJ17315.1| hypothetical protein PRUPE_ppa018812mg [Prunus persica]
Length=375

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 241/357 (68%), Gaps = 8/357 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
              V++T+LL        +DDS PIP++  +V SWF +N++P + RK  L+  L  AE  PK
Sbjct  15    FVIITILL--AASTTAADDSTPIPSDGSQVGSWFDNNVKPLAERKGALDAALVTAEDGPK  72

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G+FKT+ +AI+S+P  NT+RV++ IG G Y E++ I + KPF++L+G  K+
Sbjct  73    LIKVMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKN  132

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P+++   TA + GTV S T+IVE DYF A+ I + NSAP PDG R GAQAVAL  SGD 
Sbjct  133   MPTLMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDK  192

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN +  GFQDT  D KG HFFKD YIEGTVDFIFG GK+LY++TE+HV+E  N+ V+
Sbjct  193   AAFYNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVLE-RNITVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGVG--EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             TAQ Q    ED G+SF HCK+TG        LGR W +   VVFAY ++++ + PE W+ 
Sbjct  252   TAQ-QRDALEDNGFSFVHCKITGTTYVRSTYLGRAWGSSPTVVFAYTDMANVVHPERWND  310

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
               G        ++GE++N+GPG+ ++ +  + KK+ D E K F+S G+I+ SKWLLP
Sbjct  311   F-GHPERSNNMFYGEFQNSGPGSNISGQARYTKKLSDVEAKSFLSLGYIQGSKWLLP  366



>ref|XP_008229317.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=375

 Score =   345 bits (885),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 240/357 (67%), Gaps = 8/357 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
              +++T+LL        +DDS PIPA+  +V SWF +N++P +  K  L+  L  AE  PK
Sbjct  15    FIIITILL--AANTTAADDSTPIPADGSQVGSWFDNNVKPLAECKGELDAALVTAEDGPK  72

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I+V K+G G+FKT+ +AI+S+P  NT+RV++ IG G Y E++ I + KPF++L+G  K+
Sbjct  73    LIKVMKDGSGNFKTLTDAINSIPERNTKRVVVYIGGGVYNEKINIPQNKPFVTLYGSPKN  132

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P+++   TA + GTV S T+IVE DYF A+ I + NSAP PDG R GAQAVAL  SGD 
Sbjct  133   MPTLMFDGTAEKYGTVYSGTLIVESDYFRAANIIVTNSAPEPDGIRSGAQAVALQISGDK  192

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN +  GFQDT  D KG HFFKD YIEGTVDFIFG GK+LY++TE+HVIE  N+ V+
Sbjct  193   AAFYNCKFIGFQDTLYDYKGLHFFKDCYIEGTVDFIFGKGKSLYLNTEIHVIE-HNITVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGVG--EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             TAQ Q    ED G+SF HCK+TG     G  LGR W +   VVFAY ++++ + PE W+ 
Sbjct  252   TAQ-QRDALEDNGFSFVHCKITGTTYVRGTYLGRAWGSSPTVVFAYTDMANVVHPERWND  310

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
               G        ++GE++N+ PG+ ++ +  + KK+ D E K F+S G+I+ SKWLLP
Sbjct  311   F-GHPERSNNMFYGEFQNSSPGSNISRQARYTKKLSDAEAKSFLSLGYIQGSKWLLP  366



>ref|XP_007153340.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
 gb|ESW25334.1| hypothetical protein PHAVU_003G027000g [Phaseolus vulgaris]
Length=369

 Score =   343 bits (879),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 234/362 (65%), Gaps = 3/362 (1%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAK  184
             K V   + VT+++ +L   V   DD  P+P++K E+ SWF SN+     RK +L+P+L  
Sbjct  4     KYVYCSIKVTLMVVFLTTQVVLPDDDTPMPSDKTELGSWFQSNVGTLRKRKGSLDPKLVA  63

Query  185   AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
             AE   K ++V ++G G++KTI +A+ S+P+GNT RVI+ IGPGNY E++ + + KPF++ 
Sbjct  64    AEEGAKVVKVMQDGSGEYKTISDALRSIPSGNTMRVILYIGPGNYHEKITVEKTKPFVTF  123

Query  365   HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
             +G   + P++    TA Q GTV SAT+IV  DYF+A+ I I NSAPRPD    G QAVAL
Sbjct  124   YGKPGNMPNLTYDGTARQYGTVDSATLIVLSDYFVAANIIISNSAPRPDENSVGGQAVAL  183

Query  545   TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
               SGD A FYN  L+G+QDT  DD  RHFFKD  I+G VD+IFG+GK+LYV+ E+  +  
Sbjct  184   RISGDKATFYNCELYGYQDTLLDDANRHFFKDCLIQGYVDYIFGSGKSLYVNCEIRTLGD  243

Query  725   DNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPE  904
             +    +TAQA+  ++ED G+SF HC++TG G    LGR W  +S V+FAYC +++    +
Sbjct  244   EGFTFITAQARKNKQEDNGFSFVHCELTGTGSDTYLGRAWFGYSTVIFAYCNMANIFNKQ  303

Query  905   GWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
              W        +  T YFGEYKN GPG+ +  R    K++ + EVK ++  G IE SKW+L
Sbjct  304   AWSD-NNHPEFDKTLYFGEYKNRGPGSDVRGRSPLAKQLSESEVKPYLGIGMIEGSKWIL  362

Query  1085  PP  1090
             PP
Sbjct  363   PP  364



>ref|XP_002511042.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF51644.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=364

 Score =   342 bits (877),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 237/357 (66%), Gaps = 6/357 (2%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKP  199
             Q  +V ++L      V S D+ P+P     +  WF +N++P + RK  L+P L  AEA P
Sbjct  12    QYAIVAIVLTATI--VSSADTTPMPDAASGIAGWFSANVKPLADRKGTLDPALEAAEANP  69

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             K I+V  +G G+FKTI +A+ S+P+GNTQRVI+ IGPG Y E++ I R+KPF++  G   
Sbjct  70    KTIKVRLDGSGEFKTITDAVKSIPSGNTQRVIVDIGPGTYKEKITIERDKPFVTFLGP-P  128

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
             +  +I    TA + GTV SAT+ VE +YF+A+ + I N+APRPDGKR GAQA+A+   G 
Sbjct  129   NMATIAFGGTAQEFGTVYSATLQVESEYFIAANLIIQNTAPRPDGKRPGAQALAVRIGGS  188

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFY V++ GFQDT CDDKG HFFKD YIEGTVDFIFG+GK++Y++TE++V+      V
Sbjct  189   KAAFYKVKMLGFQDTLCDDKGFHFFKDCYIEGTVDFIFGSGKSIYLNTEINVLTDAEPTV  248

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TAQA+    EDTG+SF HC V G G GALLGR WM   RVVFAY  ++  + PEGW   
Sbjct  249   ITAQARQG-SEDTGFSFVHCSVGGTGTGALLGRAWMEAPRVVFAYTAMTGVVNPEGWSS-  306

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                        FGEYKNTGPGA    R  F K++ + EV  F+S GFIE SKWLLPP
Sbjct  307   NNHPEREAKVVFGEYKNTGPGAAPAGRVKFSKQLTEAEVAPFLSLGFIEGSKWLLPP  363



>ref|XP_008449624.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449625.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
 ref|XP_008449626.1| PREDICTED: pectinesterase PPME1-like [Cucumis melo]
Length=368

 Score =   342 bits (877),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/338 (50%), Positives = 223/338 (66%), Gaps = 3/338 (1%)
 Frame = +2

Query  83    SIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAI  259
             S PIP  K ++++WF  N++P + RK  L+P L  AE     I+V  +G GDFKTI EAI
Sbjct  27    STPIPVEKSQIDAWFSQNVKPLADRKAELDPALVAAEENATIIKVMSDGTGDFKTITEAI  86

Query  260   DSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSA  439
              SVP  N +RV+ISIG G Y E+LKI R KPF++L+G  K  P +     AA+ GTV SA
Sbjct  87    ASVPADNKKRVMISIGDGIYKEKLKIDRNKPFVTLYGSPKGMPKLTFDGDAAKFGTVYSA  146

Query  440   TVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDK  619
             T+IVE DYF A+ + I NS+PRPDG RKGAQA+A    G  AA YN +  GFQDT CDD 
Sbjct  147   TLIVEADYFTAANLVIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFTGFQDTLCDDD  206

Query  620   GRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHC  799
             G HF+KD +I+GTVDFIFG G +LYV+T+L V     +AV+TA ++    + +GYSF HC
Sbjct  207   GLHFYKDCFIQGTVDFIFGKGTSLYVNTQLDVAGDGGLAVITAHSREQESDGSGYSFVHC  266

Query  800   KVTGV-GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTG  976
              +TG  G+   LGR WM  SRVVFAY  ++D I PEGW+ +     +  T  FGEYK +G
Sbjct  267   SITGTGGKNTFLGRAWMPRSRVVFAYTTMADIIHPEGWNDMK-HAGFDKTVMFGEYKCSG  325

Query  977   PGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             PG+  T R  + K++ D EV  F+S  ++++ KWLLPP
Sbjct  326   PGSVSTERVPYGKQLSDAEVNPFLSLAYVQSEKWLLPP  363



>ref|XP_006485036.1| PREDICTED: pectinesterase PPME1-like [Citrus sinensis]
Length=370

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 229/340 (67%), Gaps = 7/340 (2%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSV  268
             IP  K ++ SWF +N++P + RK  L+P L+ A+A  + I+V ++G G+FKTI +AI+S+
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  269   PTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVI  448
             P GNT+RVI+SIG G Y E++KI R KPFI+ +G     P++    TA + GTV SAT+I
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  449   VEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRH  628
             VE DYFMA  I I NS+PRPDGKR+GAQAVAL  SG  AAFYN ++ GFQDT CDD+G H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  629   FFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVT  808
             FFKD +I+GTVDFIFG+GK+LY+ TEL  +    + V+TA A+ +  ED G++F HC + 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  809   GVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG--VPGKTHYGGTTYFGEYKNTGPG  982
             G G G  LGR W    RVV+AY  + + +   GW     P +     T ++GEYK +GPG
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSDNFRPERRQ---TVFYGEYKCSGPG  330

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL-PPAKV  1099
             A    R  + K++ D E + F+   +++ ++W+L PPAKV
Sbjct  331   ASPAERVEYTKQLSDAEARPFLVLDYVQGNQWILPPPAKV  370



>gb|KDO57708.1| hypothetical protein CISIN_1g039631mg [Citrus sinensis]
Length=369

 Score =   340 bits (873),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 230/344 (67%), Gaps = 7/344 (2%)
 Frame = +2

Query  80    DSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             D   IP  K ++ SWF +N++P + RK  L+P L+ A+A  + I+V ++G G+FKTI +A
Sbjct  29    DGAVIPPEKSQIGSWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDA  88

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMS  436
             I+S+P GNT+RVI+SIG G Y E++KI R KPFI+ +G     P++    TA + GTV S
Sbjct  89    INSIPQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDS  148

Query  437   ATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDD  616
             AT+IVE DYFMA  I I NS+PRPDGKR+GAQAVAL  SG  AAFYN ++ GFQDT CDD
Sbjct  149   ATLIVESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDD  208

Query  617   KGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAH  796
             +G HFFKD +I+GTVDFIFG+GK+LY+ TEL  +    + V+TA A+ +  ED G++F H
Sbjct  209   RGNHFFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVH  268

Query  797   CKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG--VPGKTHYGGTTYFGEYKN  970
             C + G G G  LGR W    RVV+AY  + + +   GW     P +     T ++GEYK 
Sbjct  269   CTIEGSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSDNFRPERRQ---TVFYGEYKC  325

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL-PPAKV  1099
             +GPGA    R  + K++ D E + F+   +++ ++W+L PPAKV
Sbjct  326   SGPGASPAERVEYTKQLSDAEARPFLVLDYVQGNQWILPPPAKV  369



>ref|XP_006437032.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
 gb|ESR50272.1| hypothetical protein CICLE_v10031872mg [Citrus clementina]
Length=370

 Score =   340 bits (873),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 165/340 (49%), Positives = 229/340 (67%), Gaps = 7/340 (2%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSV  268
             IP  K ++ SWF +N++P + RK  L+P L+ A+A  + I+V ++G G+FKTI +AI+S+
Sbjct  34    IPPEKSQIESWFTANVKPYTERKTTLDPALSTAQAGQRVIKVNQDGSGEFKTINDAINSI  93

Query  269   PTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVI  448
             P GNT+RVI+SIG G Y E++KI R KPFI+ +G     P++    TA + GTV SAT+I
Sbjct  94    PQGNTKRVILSIGAGEYVEKIKIDRSKPFITFYGSPDAMPNVTFGGTAKEYGTVDSATLI  153

Query  449   VEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRH  628
             VE DYFMA  I I NS+PRPDGKR+GAQAVAL  SG  AAFYN ++ GFQDT CDD+G H
Sbjct  154   VESDYFMAVNIIIANSSPRPDGKREGAQAVALRISGTKAAFYNCKIIGFQDTLCDDRGNH  213

Query  629   FFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVT  808
             FFKD +I+GTVDFIFG+GK+LY+ TEL  +    + V+TA A+ +  ED G++F HC + 
Sbjct  214   FFKDCHIQGTVDFIFGSGKSLYLSTELRAMGDTGLTVITAHARESESEDNGFAFVHCTIE  273

Query  809   GVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG--VPGKTHYGGTTYFGEYKNTGPG  982
             G G G  LGR W    RVV+AY  + + +   GW     P +     T ++GEYK +GPG
Sbjct  274   GSGNGTYLGRAWKNSPRVVYAYTTMGNVVNRAGWSDNFRPERRQ---TVFYGEYKCSGPG  330

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL-PPAKV  1099
             A    R  + K++ D E + F+   +++ ++W+L PPAKV
Sbjct  331   ASPAERVEYTKQLSDAEARPFLVLDYVQGNQWILPPPAKV  370



>ref|XP_006280767.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
 gb|EOA13665.1| hypothetical protein CARUB_v10026738mg [Capsella rubella]
Length=338

 Score =   338 bits (868),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/355 (48%), Positives = 227/355 (64%), Gaps = 27/355 (8%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKH  205
             L++  +L+    P VF +D+ PIP NK  +  WF++N++                     
Sbjct  8     LIVTILLVVITSPVVFGNDAAPIPQNKGRIEQWFNTNVK---------------------  46

Query  206   IRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDR  385
                 +NG+G FKTI EAI SV  GNT+RVII +GPG Y E++ I R KPFI+L+G     
Sbjct  47    ----QNGRGHFKTITEAIKSVGEGNTRRVIIKVGPGVYKEKVTIDRSKPFITLYGHPNAM  102

Query  386   PSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMA  565
             P +    TAAQ GTV SAT+IV  DYFMA  I + NSAP PDGK+KGAQA+++  SG+ A
Sbjct  103   PVLTYDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKKKGAQALSMRISGNKA  162

Query  566   AFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVT  745
             AFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+ 
Sbjct  163   AFYNCKFYGYQDTVCDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVIA  221

Query  746   AQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPG  925
             AQA  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW     
Sbjct  222   AQAGKSAEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQE-NR  280

Query  926   KTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +T    T ++GEYK +GPG+    R  + + + D E   FIS G+I+ S WLLPP
Sbjct  281   ETERDKTVFYGEYKCSGPGSHKEKRVKYTQDIDDIEANYFISLGYIQGSSWLLPP  335



>ref|XP_009362807.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=368

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/357 (48%), Positives = 237/357 (66%), Gaps = 6/357 (2%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
             L+++T++L      + +DD+IPIP++  +V SWF +N++  + RK+ L+P L  AE  P+
Sbjct  14    LMIITIILTSSTAAI-ADDTIPIPSDSSQVASWFDNNVKTYNVRKSTLDPALVAAEHAPQ  72

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V ++G G+FKTI +AI+S+P GNT+RV + I  G Y E++ I   KPF++L+G  K 
Sbjct  73    VINVMQDGGGNFKTITDAINSIPAGNTKRVFVYIKGGVYNEKITIPHNKPFVTLYGSPKS  132

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P+I    TA + GTV S T+IVE DYF A  + IINSAP PDG R+GAQAVAL  SG+ 
Sbjct  133   MPNITFDGTAQKYGTVYSGTLIVESDYFKAVNLVIINSAPEPDGIREGAQAVALQISGNK  192

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN ++ G+QDT  D KG H FKD +I+GTVDFIFG GK+LY++TE+HV+E  N+ V+
Sbjct  193   AAFYNCKMIGYQDTLYDYKGLHLFKDCFIQGTVDFIFGKGKSLYLNTEIHVVE-RNLTVI  251

Query  743   TAQAQHTREEDTGYSFAHCKVTGV--GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             TAQ + +  ED+G+SF HCK+TG        LGR W +   VV AY +I+D + PE W  
Sbjct  252   TAQQRDSASEDSGFSFVHCKITGTTYARRTYLGRAWGSSPNVVVAYTDIADIVHPERWSD  311

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
               G        ++GEY N G G+ +T +  + +K+ D E K FIS G I+ SKWLLP
Sbjct  312   F-GHPERESNLFYGEYNNWGQGSNITGQARYTRKLSDAEAKPFISLGNIQGSKWLLP  367



>ref|XP_002866448.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42707.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 227/359 (63%), Gaps = 33/359 (9%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPK  202
              L++  +L+    P VF +D+ PIP NK  +  WF++N++                    
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVK--------------------  46

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
                  +NG+G FKTI EAI+SV  GNT+RVII IGPG Y E++ I R KPFI+L+G    
Sbjct  47    -----QNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRNKPFITLYGHPNA  101

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TAAQ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+ 
Sbjct  102   MPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVI  220

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA A  +  E +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW    
Sbjct  221   TAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQ---  277

Query  923   GKTHYGG---TTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +    G   T ++GEYK TG G+    R  + + + D E K FIS G+I+ S WLLPP
Sbjct  278   -ENREAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDVEAKYFISLGYIQGSSWLLPP  335



>ref|XP_006399226.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
 gb|ESQ40679.1| hypothetical protein EUTSA_v10013913mg [Eutrema salsugineum]
Length=361

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/363 (46%), Positives = 230/363 (63%), Gaps = 14/363 (4%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V   + +  P V + D+ PIP ++ ++  WF +N+ P S RK  L+P L  AEA  +
Sbjct  6     LAIVAFFVAFASPVVLATDTAPIPEDRSQIPEWFKTNVAPYSQRKGTLDPALDAAEASRQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G G+FKTI EAI S+PTGN  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    VITVDQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGS  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAAQ GTV SAT+I+  DYFMA+ + I N++P P    +G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + HGFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW----  910
             TA A+ +  E  GY+F HCKVTG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  244   TAHARESENEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWKENL  303

Query  911   -HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
              HG      Y  T ++GEYK  GPG+ L  R  F + +   EV+ F++ G+I+ S WLLP
Sbjct  304   QHG------YDKTVFYGEYKCFGPGSHLEKRVPFTQDVDQNEVRPFLTLGYIKGSTWLLP  357

Query  1088  PAK  1096
             P K
Sbjct  358   PPK  360



>ref|NP_200976.1| putative pectinesterase 63 [Arabidopsis thaliana]
 sp|Q9FKF3.2|PME63_ARATH RecName: Full=Putative pectinesterase 63; Short=PE 63; AltName: 
Full=Pectin methylesterase 63; Short=AtPME63; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED97505.1| putative pectinesterase 63 [Arabidopsis thaliana]
Length=338

 Score =   336 bits (862),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 172/359 (48%), Positives = 227/359 (63%), Gaps = 33/359 (9%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPK  202
              L++  +L+    P VF +D+ PIP NK  +  WF++N++                    
Sbjct  7     SLIVTILLVVITSPVVFGNDAAPIPENKGRIEQWFNTNVK--------------------  46

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
                  +NG+G FKTI EAI+SV  GNT+RVII IGPG Y E++ I R KPFI+L+G    
Sbjct  47    -----QNGRGHFKTITEAINSVRAGNTRRVIIKIGPGVYKEKVTIDRSKPFITLYGHPNA  101

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TAAQ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+ 
Sbjct  102   MPVLTFDGTAAQYGTVDSATLIVLSDYFMAVNIILKNSAPMPDGKRKGAQALSMRISGNK  161

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  162   AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVI  220

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA A  +  E +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW    
Sbjct  221   TAHAGKSAAEKSGYSFVHCKVTGTGTGIYLGRSWMSHPKVVYAYTDMSSVVNPSGWQ---  277

Query  923   GKTHYGG---TTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              +    G   T ++GEYK TG G+    R  + + + D E K FIS G+I+ S WLLPP
Sbjct  278   -ENREAGRDKTVFYGEYKCTGTGSHKEKRVKYTQDIDDIEAKYFISLGYIQGSSWLLPP  335



>gb|KFK25128.1| hypothetical protein AALP_AA8G069700 [Arabis alpina]
Length=361

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 169/363 (47%), Positives = 229/363 (63%), Gaps = 14/363 (4%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V  L+ +  P V + D+ PIP ++ ++  WFH+N+ P S RK  L+P L  AEA   
Sbjct  6     LAIVAFLVVFASPVVLATDTDPIPEDRSKIPQWFHTNVAPYSKRKGTLDPALDAAEASRL  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G G+FKTI EA+ S+P GN  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    IITVNQQGGGNFKTINEAVKSIPAGNKNRVIIKLAPGIYNEKVTIDIARPFVTLLGQPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+IV  DYFMA+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWSDYFMAANLVIKNTAPMPKPGSQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYNCRFYGFQDTLCDDKGTHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW----  910
             TAQ + +  E  GY+F HCKVTG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  244   TAQGRQSDNEQNGYTFVHCKVTGTGNGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWKENL  303

Query  911   -HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
              HG      Y  T Y+GEYK  G G+ L  R  F + +   EV+ F++ G+I+ S WLLP
Sbjct  304   LHG------YDKTVYYGEYKCFGAGSHLEKRVPFTQDVDQNEVRPFLTLGYIKGSAWLLP  357

Query  1088  PAK  1096
             P K
Sbjct  358   PPK  360



>ref|XP_010491360.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   335 bits (858),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 228/356 (64%), Gaps = 4/356 (1%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQP-PSTRKNLNPELAKAEAKP  199
              L ++ +L+ +  P V +DD  PIPA K +V  WF +N+QP P+ R  L+P+L  AEA P
Sbjct  6     SLSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASP  65

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             + I V + G GDF +I  AI S+P GN  RVII + PG Y E++ +   +PF++L G   
Sbjct  66    RIITVNQKGGGDFTSINAAIKSIPVGNKVRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPG  125

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGD  559
                ++    T+A+ GTV SAT+IV   YFMA+ ++I+N+AP P    +G QA+A+  + D
Sbjct  126   AETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINAD  184

Query  560   MAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAV  739
              AAFYN R +GFQDT CDD+G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V
Sbjct  185   KAAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRV  243

Query  740   VTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV  919
             +TA  +    + +GYSF HCKVTGVG G  LGR WM+  +VV+AY E+S  + P GW   
Sbjct  244   ITAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQEN  303

Query  920   PGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
               + H   T ++GEY  TGPG+    R    + + ++E   F+S G+I+ S WLLP
Sbjct  304   RVRAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_007204487.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
 gb|EMJ05686.1| hypothetical protein PRUPE_ppa019696mg [Prunus persica]
Length=368

 Score =   334 bits (857),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 158/340 (46%), Positives = 226/340 (66%), Gaps = 5/340 (1%)
 Frame = +2

Query  74    SDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIK  250
             +DD   +  +  +VN+WF++N+ P   R+  L+P L  AE     ++V K+  G+FKTI 
Sbjct  28    ADDETLVVTDHPQVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTIT  87

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTV  430
              A++S+P  NT+RVI+ IG G Y E++ I R K F++ +G   + P++    TA + GTV
Sbjct  88    GAVNSIPVDNTKRVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTV  147

Query  431   MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SATVI E DYF+A+ + I NS+P+PDGKR G QA+AL  SG+ +A +N RL GFQDT C
Sbjct  148   DSATVIAESDYFVAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLC  207

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             DDKG HFF+D +IEGTVDFIFG+GK+LY+   LHV+  + M V+ AQA+++  EDTGYSF
Sbjct  208   DDKGNHFFQDCFIEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSF  264

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
              HC +TG G G  LGR W    RVVFAY  +S+ I P  W+    +     T ++GEYK 
Sbjct  265   VHCNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITPADWNN-KNRPKRDRTVFYGEYKC  323

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +GP + +  R  + K++ ++++K F+S  +I+ SKWLLPP
Sbjct  324   SGPASSMVGRVKYTKQLNEEQIKPFLSLSYIQGSKWLLPP  363



>ref|XP_010662219.1| PREDICTED: putative pectinesterase 63 [Vitis vinifera]
Length=373

 Score =   334 bits (857),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 224/344 (65%), Gaps = 7/344 (2%)
 Frame = +2

Query  80    DSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             D + IP +K ++ +WF   I+    R+  L+PEL KAE   K I+V K+G GDFKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMS  436
             ++SVP GN  RVII IG G Y E++KI R KPF++ +G     P +    TAA+ GTV S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  437   ATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDD  616
             A++IVE  YFM   I +INS+P+PDGKRKGAQAVAL  SGD AAFYN +L GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  617   KGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI-EGDNMAVVTAQAQHTREEDTGYSFA  793
             + RHFFK  YIEGTVDFIFG+GK++++ TE+H + +G    V+TA A++   EDTGYSF 
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--PGKTHYGGTTYFGEYK  967
             HC ++G G    LGR WM   +VVF++  +S  + P GW     P +       +FGEY 
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSNNLHPDRD---SMVFFGEYN  326

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
               GPGA ++ R  F KK+     K +IS  +I AS WLLPP  +
Sbjct  327   CLGPGANMSRRAKFTKKLDFNGAKPYISLNYIRASSWLLPPPNL  370



>emb|CAN66682.1| hypothetical protein VITISV_005088 [Vitis vinifera]
Length=373

 Score =   334 bits (856),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 224/344 (65%), Gaps = 7/344 (2%)
 Frame = +2

Query  80    DSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             D + IP +K ++ +WF   I+    R+  L+PEL KAE   K I+V K+G GDFKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNHKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMS  436
             ++SVP GN  RVII  G G Y E++KI R KPF++ +G     P +    TAA+ GTV S
Sbjct  90    VNSVPXGNXXRVIIWXGGGVYEEKIKIDRTKPFVTFYGSPDXMPMLSFDGTAAKYGTVDS  149

Query  437   ATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDD  616
             A++IVE  YFM   I +INS+P+PDGKRKGAQAVAL  SGD AAFYN +L GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  617   KGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI-EGDNMAVVTAQAQHTREEDTGYSFA  793
             + RHFFK+ YIEGTVDFIFG+GK+L++ TE+H + +G    V+TA A++   EDTGYSF 
Sbjct  210   RNRHFFKECYIEGTVDFIFGSGKSLFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--PGKTHYGGTTYFGEYK  967
             HC ++G G    LGR WM   +VVF++  +S  + P GW     P +       +FGEY 
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSNNLHPDRD---SMVFFGEYN  326

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
               GPGA ++ R  F KK+     K +IS  +I AS WLLPP  +
Sbjct  327   CLGPGANMSRRAKFTKKLDFNGAKPYISLNYIGASSWLLPPPNL  370



>ref|XP_010252431.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=370

 Score =   334 bits (856),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 220/345 (64%), Gaps = 12/345 (3%)
 Frame = +2

Query  83    SIPIPANKDEVNSWFHSNIQPPSTRKN---------LNPELAKAEAKPKHIRVCKNGKGD  235
             S  +   + E++ W   +IQ    RK          L P L  AEA  + I+V KNG GD
Sbjct  26    STALSQGETEIDRWIQKHIQAYVARKEELREGVDTALEPALKAAEASRRVIKVRKNGAGD  85

Query  236   FKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAA  415
             F+T+ EAI ++P GNT+R I+ IGPG + E++K+ R +PF++     KD+P+++   TA 
Sbjct  86    FRTVTEAISTIPAGNTKRTIVWIGPGVFEEKIKVNRSQPFVTFFALPKDKPTLVYHGTAK  145

Query  416   QDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGF  595
               GTV SA+VIVE DYFMA  I   NSAP PDGKR+GAQAVA+  SGDMAAFY     GF
Sbjct  146   DYGTVDSASVIVESDYFMAVNIIFKNSAPEPDGKREGAQAVAMRISGDMAAFYGCSFIGF  205

Query  596   QDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREED  775
             QDT CDDKGRHFFKD YIEGTVD+IFGNGK++Y++TELH +  +  A +TAQA+   ++D
Sbjct  206   QDTLCDDKGRHFFKDCYIEGTVDYIFGNGKSIYLNTELHSVS-NRTAFITAQARERVDDD  264

Query  776   TGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYF  955
             +GYSF HCK+TG GE   LGR W    RVV+AY  +   +K EGW    G      T ++
Sbjct  265   SGYSFIHCKITGNGE-TYLGRAWKDRGRVVYAYTYMGTHVKAEGWSNF-GVASRDKTVFY  322

Query  956   GEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             GEY+  GPGA    R  FVK +  QE + F+S  +I    WLLPP
Sbjct  323   GEYECKGPGAATKRRVPFVKLLTKQEAEPFLSLTYIHGITWLLPP  367



>ref|NP_196359.1| putative pectinesterase 49 [Arabidopsis thaliana]
 sp|Q9LY18.1|PME49_ARATH RecName: Full=Probable pectinesterase 49; Short=PE 49; AltName: 
Full=Pectin methylesterase 49; Short=AtPME49; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87931.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAM63813.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AAO22596.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAO50592.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AED91155.1| putative pectinesterase 49 [Arabidopsis thaliana]
Length=361

 Score =   333 bits (855),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 162/356 (46%), Positives = 230/356 (65%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V +L+ +  P V +DD  PIPA++ ++  WF +N++P S R+  L+PEL  AEA  +
Sbjct  6     LALVALLVFFASPVVLADDITPIPADRAQIPQWFMANVKPFSQRRGTLDPELEAAEASRR  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V +NG GDFKTI  AI S+P  N  RVII + PG Y E++ +   +P+++L G    
Sbjct  66    VIIVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTVDVGRPYVTLLGKPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    TAA+ GTV SAT+IV    F+A+ +NIIN++P P    +G QA+A+  +GD 
Sbjct  126   ETNLTYAGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD+G HFFK+ YIEGT DFIFG G +LY+ T+LH + GD + V+
Sbjct  185   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              A  + +  E  GYSF HCKVTGVG G  LGR WM+  +VV++Y E+S  + P GW    
Sbjct  244   AAHNRQSTTEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQENR  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              + H   T ++GEY  TGPG+    R    + + ++E  +F++ G+I+ SKWLLPP
Sbjct  304   VRAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEASQFLTLGYIKGSKWLLPP  358



>ref|XP_010452709.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/355 (46%), Positives = 227/355 (64%), Gaps = 4/355 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQP-PSTRKNLNPELAKAEAKPK  202
             L ++ +L+ +  P V +DD  PIPA K +V  WF +N+QP P+ R  L+P L  AEA P+
Sbjct  7     LSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPALEAAEASPR  66

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G GDF +I  AI S+P GN  RVII + PG Y E++ +   +PF++L G    
Sbjct  67    IITVNQKGGGDFTSINAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGA  126

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    T+A+ GTV SAT+IV   YFMA+ ++I+N+AP P    +G QA+A+  + D 
Sbjct  127   ETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINADK  185

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD+G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  186   AAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  244

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  +    + +GYSF HCKVTGVG G  LGR WM+  +VV+AY E+S  + P GW    
Sbjct  245   TAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENR  304

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
              + H   T ++GEY  TGPG+    R    + + ++E   F+S G+I+ S WLLP
Sbjct  305   VREH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_007204920.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
 gb|EMJ06119.1| hypothetical protein PRUPE_ppa026195mg, partial [Prunus persica]
Length=332

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 222/328 (68%), Gaps = 5/328 (2%)
 Frame = +2

Query  110   EVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQ  286
             +VN+WF++N+ P   R+  L+P L  AE     ++V K+  G+FKTI  A++S+P  NT+
Sbjct  4     QVNTWFNNNVNPYKERQGTLDPALVTAEVGQTVVKVMKDRSGEFKTITGAVNSIPVDNTK  63

Query  287   RVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYF  466
             RVI+ IG G Y E++ I R K F++ +G   + P++    TA + GTV SATVI E DYF
Sbjct  64    RVIVYIGGGEYNEKITIPRNKSFVTFYGSPTNIPTLTFAGTAQKYGTVDSATVIAESDYF  123

Query  467   MASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSY  646
             +A+ + I NS+P+PDGKR G QA+AL  SG+ +A +N RL GFQDT CDDKG HFF+D +
Sbjct  124   VAANLIIKNSSPKPDGKRVGEQALALRVSGNKSALFNCRLIGFQDTLCDDKGNHFFQDCF  183

Query  647   IEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGA  826
             IEGTVDFIFG+GK+LY+   LHV+  + M V+ AQA+++  EDTGYSF HC +TG G G 
Sbjct  184   IEGTVDFIFGSGKSLYL---LHVLGNNEMTVIIAQARNSASEDTGYSFVHCNITGTGNGT  240

Query  827   LLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPN  1006
              LGR W    RVVFAY  +S+ I P  W+    +     T ++GEYK +GP + +  R  
Sbjct  241   YLGRAWRTSPRVVFAYTSMSEVITPADWNN-KNRPKRDRTVFYGEYKCSGPASSMVGRVK  299

Query  1007  FVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             + K++ ++++K F+S  +I++SKWLLPP
Sbjct  300   YTKQLNEEQIKPFLSLSYIQSSKWLLPP  327



>ref|XP_009122340.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
 emb|CDX70038.1| BnaA10g23870D [Brassica napus]
Length=361

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/356 (46%), Positives = 229/356 (64%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L M+  L+ +  P V +DD  PIP +K +V +WF +N+QP S R+  L+P L  AEA P+
Sbjct  6     LTMIAFLVIFALPAVVADDITPIPEDKAQVEAWFKANVQPYSARRGTLDPVLDAAEASPQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G GDFKTI EAI S+P GNT+RVII + PG Y E++ +   +PF++L G    
Sbjct  66    IINVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    TA++ GT+ SAT+I+   YF+A+ +++ N+AP P    +G QA+A+  +GD 
Sbjct  126   ETNLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  + +  +  GYSF HCK+TGVG G  LGR WM+  +VV+AY E+S  + P GW    
Sbjct  244   TAHNRQSENQQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENR  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              + +   T ++GEY  TGPG+    R    + +   E   F++ G+I+ S WLLPP
Sbjct  304   NREN-DKTVFYGEYMCTGPGSHKEKRVAHTQDIDKNEANGFLTLGYIKGSLWLLPP  358



>ref|XP_010423211.1| PREDICTED: probable pectinesterase 49 [Camelina sativa]
Length=362

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/355 (46%), Positives = 228/355 (64%), Gaps = 4/355 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQP-PSTRKNLNPELAKAEAKPK  202
             L ++ +L+ +  P V +DD  PIPA K +V  WF +N+QP P+ R  L+P+L  AEA P+
Sbjct  7     LSLIALLVVFAPPVVLADDITPIPAEKAQVEPWFKANVQPFPARRGTLDPDLEAAEASPR  66

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G GDF ++  AI S+P GN  RVII + PG Y E++ +   +PF++L G    
Sbjct  67    IITVNQKGGGDFTSVNAAIKSIPVGNKIRVIIKLAPGVYKEKVTVDVGRPFVTLLGKPGA  126

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    T+A+ GTV SAT+IV   YFMA+ ++I+N+AP P    +G QA+A+  + D 
Sbjct  127   ETNLTFHGTSAKYGTVESATLIVWAKYFMAANLHILNTAPMPKPGTQG-QALAMRINADK  185

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD+G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  186   AAFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  244

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  +    + +GYSF HCKVTGVG G  LGR WM+  +VV+AY E+S  + P GW    
Sbjct  245   TAHNRQNSNDQSGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPSGWQENR  304

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
              + H   T ++GEY  TGPG+    R    + + ++E   F+S G+I+ S WLLP
Sbjct  305   VREH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>ref|XP_009130989.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
Length=361

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 228/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V  L+ +  P V + D+ PIP ++ ++  WF +N+ P S RK  L+P L  AE   +
Sbjct  6     LTIVAFLVAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPSLEAAETARQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G  +FKTI EAI S+PTGN  RV+I + PG Y E++ I   +PFI+L G    
Sbjct  66    VITVNQKGGANFKTINEAIKSIPTGNKNRVVIKLAPGVYNEKVTIDVARPFITLLGQPGS  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAAQ GTV SAT+IV  DYF+A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E+S  + P GW    
Sbjct  244   TAQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGWRENF  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+    R  + + +   EV+ F++ G+I+ S WLLPP K
Sbjct  304   NR-GYDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSTWLLPPPK  360



>emb|CBI38549.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   333 bits (854),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 170/344 (49%), Positives = 224/344 (65%), Gaps = 7/344 (2%)
 Frame = +2

Query  80    DSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             D + IP +K ++ +WF   I+    R+  L+PEL KAE   K I+V K+G GDFKT+ +A
Sbjct  30    DDLQIPNDKTQLTAWFGRTIKNYKLRRATLDPELVKAEDNLKIIKVSKSGGGDFKTVTDA  89

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMS  436
             ++SVP GN  RVII IG G Y E++KI R KPF++ +G     P +    TAA+ GTV S
Sbjct  90    VNSVPEGNAGRVIIWIGGGVYEEKIKIDRTKPFVTFYGSPDHMPMLSFDGTAAKYGTVDS  149

Query  437   ATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDD  616
             A++IVE  YFM   I +INS+P+PDGKRKGAQAVAL  SGD AAFYN +L GFQDT CDD
Sbjct  150   ASLIVESHYFMMVNIIVINSSPKPDGKRKGAQAVALRISGDKAAFYNSKLIGFQDTLCDD  209

Query  617   KGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI-EGDNMAVVTAQAQHTREEDTGYSFA  793
             + RHFFK  YIEGTVDFIFG+GK++++ TE+H + +G    V+TA A++   EDTGYSF 
Sbjct  210   RNRHFFKKCYIEGTVDFIFGSGKSIFLSTEVHAMGDGAMPTVITAHARNLESEDTGYSFV  269

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--PGKTHYGGTTYFGEYK  967
             HC ++G G    LGR WM   +VVF++  +S  + P GW     P +       +FGEY 
Sbjct  270   HCTISGTGSTTFLGRAWMDRPKVVFSHTYMSSVVNPLGWSNNLHPDR---DSMVFFGEYN  326

Query  968   NTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
               GPGA ++ R  F KK+     K +IS  +I AS WLLPP  +
Sbjct  327   CLGPGANMSRRAKFTKKLDFNGAKPYISLNYIRASSWLLPPPNL  370



>ref|XP_002871270.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47529.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   332 bits (851),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 163/356 (46%), Positives = 230/356 (65%), Gaps = 4/356 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V +L+ +  P V +DD  PIPA++  ++ WF +N++P S R+  L+P+L  AEA  +
Sbjct  6     LSLVALLVFFASPVVLADDITPIPADRALISQWFKANVKPFSQRRGTLDPDLEAAEASRR  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V +NG GDFKTI  AI S+P  N  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    VITVNQNGGGDFKTINAAIKSIPLANKNRVIIKLAPGIYHEKVTIDIGRPFVTLLGKPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    TAA+ GTV SAT+IV    F+A+ +NIIN++P P    +G QA+A+  +GD 
Sbjct  126   ETNLTYDGTAAKYGTVESATLIVWATNFLAANLNIINTSPMPKPGTQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD+G HFFK+ YIEGT DFIFG G +LY+ T+LH + GD + V+
Sbjct  185   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLTTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
              A  + +  E  GYSF HCKVTGVG G  LGR WM+  +VV++Y E+S  + P GW    
Sbjct  244   AAHNRQSTNEQNGYSFVHCKVTGVGTGIYLGRAWMSHPKVVYSYTEMSSVVNPSGWQENR  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              + H   T ++GEY  TGPG+    R    + + ++E  +F++ G+I+ SKWLLPP
Sbjct  304   VRAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANQFLTLGYIKGSKWLLPP  358



>ref|NP_196360.1| putative pectinesterase 50 [Arabidopsis thaliana]
 sp|Q9LY17.1|PME50_ARATH RecName: Full=Probable pectinesterase 50; Short=PE 50; AltName: 
Full=Pectin methylesterase 50; Short=AtPME50; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB87932.1| pectin methyl-esterase-like protein [Arabidopsis thaliana]
 gb|AED91156.1| putative pectinesterase 50 [Arabidopsis thaliana]
Length=361

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 165/358 (46%), Positives = 227/358 (63%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +  P V + D+ PIP N+ ++  WF +N++P S RK  L+P L  AEA  +
Sbjct  6     MSVVAFLVVFASPVVLATDTDPIPENRAQIPQWFKTNVKPYSQRKGTLDPALEAAEAARQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G  +FKT+ EAI S+PTGN  RVII + PG Y E++ I   +PFI+L G    
Sbjct  66    IITVNQKGGANFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFITLLGQPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAAQ GTV SAT+IV  +YF A+ + I N+AP P    +G QA+A+  + D 
Sbjct  126   ETVLTYHGTAAQYGTVESATLIVWAEYFQAAHLTIKNTAPMPKPGSQG-QALAMRINADK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ R HGFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQ + +  E  GY+F HCKVTG G G  LGR WM+  +VV+A+ E++  + P GW    
Sbjct  244   TAQGRQSATEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENL  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+ L  R  + + +   EV  F++ G+I+ S WLLPP K
Sbjct  304   NR-GYDKTVFYGEYKCFGPGSHLEKRVPYTQDIDKNEVTPFLTLGYIKGSTWLLPPPK  360



>ref|XP_002871271.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47530.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/358 (46%), Positives = 228/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +  P V + D+ PIP  + ++  WF +N++P S RK  L+P L  AEA  +
Sbjct  6     MSVVAFLVVFASPLVLATDTDPIPETRAQIPQWFKANVKPYSQRKGTLDPALEAAEAARQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G  +FKTI EAI S+PTGN  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    IITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+IV  +YF+A+ + I N+AP P    +G QA+A+  + D 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWAEYFLAAHLTIKNTAPMPKPGSQG-QALAMRINADK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ R HGFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCRFHGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQ + +  E  GY+F HCKVTG G G  LGR WM+  +VV+A+ E++  + P GW    
Sbjct  244   TAQGRQSANEQNGYTFVHCKVTGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENL  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+ L  R  + + +   EV+ F+S G+I+ S WLLPP K
Sbjct  304   NRG-YDKTVFYGEYKCFGPGSHLEKRVPYTQDIDQNEVRPFLSLGYIKGSTWLLPPPK  360



>ref|XP_004156059.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
 gb|KGN48070.1| hypothetical protein Csa_6G428030 [Cucumis sativus]
Length=370

 Score =   332 bits (851),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 222/340 (65%), Gaps = 5/340 (1%)
 Frame = +2

Query  83    SIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             S PIP  K ++  WF  N++P + R    L+P LA AE     I+V  +G G+FKT+ EA
Sbjct  27    SPPIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEA  86

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRPSIIGCSTAAQDGTVM  433
             I SVP  N +RV+I IG G Y E+LKI R KPF++L+G D K+ P +     AA+ GTV 
Sbjct  87    IASVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVY  146

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             SAT+IVE DYF A+ + I NS+PRPDG RKGAQA+A    G  AA YN +  GFQDT CD
Sbjct  147   SATLIVEADYFTAANLIIENSSPRPDGVRKGAQALAARFMGTKAAIYNCKFLGFQDTLCD  206

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D G HF+KD +I+GTVDFIFG G +LY++T+L V     +AV+TA ++    + +GYSF 
Sbjct  207   DDGLHFYKDCFIQGTVDFIFGKGTSLYLNTQLDVAGDGGLAVITAHSREQEADTSGYSFV  266

Query  794   HCKVTGV-GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
             HC +TG  G+   LGR WM  SRVVFAY  I+D I PEGW+ +     +  T  FGEYK 
Sbjct  267   HCSITGTGGKNTYLGRAWMPRSRVVFAYTTIADIIHPEGWNDMK-HAGFDKTVMFGEYKC  325

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +GPGA  T R  + K++ D EVK F+   ++++ KWLLPP
Sbjct  326   SGPGAVSTGRVAYGKQLTDVEVKPFLGLEYVQSEKWLLPP  365



>gb|KFK25127.1| hypothetical protein AALP_AA8G069600 [Arabis alpina]
Length=363

 Score =   330 bits (845),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/356 (46%), Positives = 229/356 (64%), Gaps = 6/356 (2%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN---LNPELAKAEAKPK  202
             MV  L+ +  P V +DD  PIPA+K +V  WF ++++P S R+    L+P L  AE  P+
Sbjct  8     MVAFLIVFAFPVVLADDVTPIPADKAQVEPWFKTHVKPFSVRRGRGILDPALEAAEVAPR  67

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V   G G+FK+I EAI S+PTGNT+RVII + PG Y E++ I   +PF++L G    
Sbjct  68    TITVNPKGGGNFKSINEAIKSIPTGNTKRVIIKLAPGVYHEKVTIDVGRPFVTLLGKPGA  127

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    TAA+ GTV SAT+IV    F+A+ +NIIN+ P P    +G QA+A+  +GD 
Sbjct  128   ETNLTYDGTAAKFGTVESATLIVWATNFIAANLNIINTNPMPKAGTQG-QALAMRINGDK  186

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY  R +GFQDT CDD+G HFFK  YIEGT DFIFG G +LY++T LH + GD + V+
Sbjct  187   AAFYRCRFYGFQDTLCDDRGNHFFKGCYIEGTYDFIFGRGASLYLNTHLHAV-GDGLRVI  245

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  + +  E +GY+F HCKVTGVG G  LGR WM+  +VV+AY E+S  + P GW    
Sbjct  246   TAHNRQSNNEQSGYAFVHCKVTGVGTGIYLGRSWMSHPKVVYAYTEMSSVVNPSGWAENR  305

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              + H   T ++GEY+  GPG++   R    +++ ++E   F+S G+I+ S WLLPP
Sbjct  306   QRAH-DKTVFYGEYQCKGPGSQKEKRVAHTQEIDNKEANHFLSLGYIKGSSWLLPP  360



>emb|CDX81050.1| BnaC03g03040D [Brassica napus]
Length=361

 Score =   329 bits (843),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 227/358 (63%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L +V  L+ +  P V + D+ PIP ++ ++  WF +N+ P S RK  L+P L  AE   +
Sbjct  6     LTIVAFLIAFASPVVLATDTAPIPEDRSQIPQWFQTNVAPYSQRKGTLDPALEAAETARQ  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G  +FKTI EAI S+PTGN  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    IITVNQKGGANFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDVARPFVTLLGQPGS  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAAQ GTV SAT+IV  DYF+A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETILTYHGTAAQYGTVESATLIVWSDYFLAANLIIKNTAPMPKPGAQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQA+ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E+S  + P GW    
Sbjct  244   TAQARQSDTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMSSVVNPAGWRENF  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  G G+    R  + + +   EV+ F++ G+I+ S WLLPP K
Sbjct  304   NR-GYDKTVFYGEYKCFGAGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSTWLLPPPK  360



>ref|XP_010491359.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   328 bits (842),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 229/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +  P V + D+ PIP N+ ++  WF +N++P S RK  L+P L  AEA   
Sbjct  6     MSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSMRKGKLDPALDAAEASRL  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G G+FKTI EAI S+PTGN  RVII + PG Y E++ +   +PFI+L G    
Sbjct  66    IITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFITLLGQPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+IV  DYF A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWADYFQAANLIIRNTAPMPKPGSQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQ++ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  244   TAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENF  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+ +  R  + + +   EV+ FIS G+I+ S WLLP  K
Sbjct  304   NR-GYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPAPK  360



>ref|XP_010423208.1| PREDICTED: probable pectinesterase 50 isoform X1 [Camelina sativa]
 ref|XP_010423209.1| PREDICTED: probable pectinesterase 50 isoform X2 [Camelina sativa]
Length=361

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/358 (45%), Positives = 229/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +  P V + D+ PIP N+ ++  WF +N++P S RK  L+P L  AEA   
Sbjct  6     MSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEASRL  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G G+FKTI EAI S+PTGN  RVII + PG Y E++ +   +PF++L G    
Sbjct  66    IITVNQKGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTVDIARPFVTLLGQLGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+IV  DYF A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQ++ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  244   TAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENF  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+ +  R  + + +   EV+ FIS G+I+ S WLLP  K
Sbjct  304   NR-KYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPAPK  360



>ref|XP_006289803.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
 gb|EOA22701.1| hypothetical protein CARUB_v10003407mg [Capsella rubella]
Length=362

 Score =   327 bits (839),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/358 (44%), Positives = 230/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +    V + D+ PIP N+ +++ WF +N++P S RK  L+P L  AEA  +
Sbjct  7     MFVVAFLVFFASSVVLATDTDPIPENRAQISQWFQTNVKPYSQRKGTLDPALDAAEASRR  66

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G G+FKT+ EAI S+PTGN  RVII + PG Y E++ I   +PF++L G    
Sbjct  67    VITVNQKGGGNFKTLNEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGA  126

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+I+  +YF A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  127   ETVLTYHGTAAKYGTVESATLIIWSEYFQAANLIIRNTAPMPKPGTQG-QALAMRINGDK  185

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             A+FYN R +GFQDT CDD+G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  186   ASFYNCRFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  244

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  +    + +GY+FAHCK+TG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  245   TAHGRQNANDQSGYTFAHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENL  304

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              K  Y  T ++GEYK  GPG+ +  R  + + +   EV+ F++ G I+ SKWLLPP K
Sbjct  305   NKG-YDKTVFYGEYKCFGPGSHVEKRVPYTQDIDQNEVRPFLTLGKIQGSKWLLPPPK  361



>gb|KHN28380.1| Putative pectinesterase 48, partial [Glycine soja]
Length=313

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 211/309 (68%), Gaps = 1/309 (0%)
 Frame = +2

Query  164   LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVR  343
             ++P L  AE   K ++V ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI +
Sbjct  1     VDPALVTAEEGAKVVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEK  60

Query  344   EKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRK  523
              KPF++L+G  +  P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  
Sbjct  61    TKPFVTLYGVPEKMPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTP  120

Query  524   GAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDT  703
             G QAVAL  SGD AAFYN +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV T
Sbjct  121   GGQAVALRISGDKAAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVST  180

Query  704   ELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEI  883
             EL  +  + + V+ AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +
Sbjct  181   ELRTLGDNGITVIVAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNM  240

Query  884   SDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFI  1063
             SD +   GW       H   T  FGEY+N+GPGA    R    K++ + EVK +I+   I
Sbjct  241   SDIVNKLGWSNNNHPEH-DKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMI  299

Query  1064  EASKWLLPP  1090
             E SKWLLPP
Sbjct  300   EGSKWLLPP  308



>ref|XP_010452708.1| PREDICTED: probable pectinesterase 50 [Camelina sativa]
Length=361

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/358 (46%), Positives = 228/358 (64%), Gaps = 4/358 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             + +V  L+ +  P V + D+ PIP N+ ++  WF +N++P S RK  L+P L  AEA   
Sbjct  6     MSVVAFLVFFASPVVLATDTDPIPENRAQIPQWFQNNVKPYSQRKGKLDPALDAAEASRL  65

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V   G G+FKTI EAI S+PTGN  RVII + PG Y E++ I   +PF++L G    
Sbjct  66    IITVRYTGGGNFKTINEAIKSIPTGNKNRVIIKLAPGVYNEKVTIDIARPFVTLLGQPGA  125

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
                +    TAA+ GTV SAT+IV  DYF A+ + I N+AP P    +G QA+A+  +GD 
Sbjct  126   ETVLTYHGTAAKYGTVESATLIVWSDYFQAANLIIRNTAPMPKPGSQG-QALAMRINGDK  184

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFY+ + +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  185   AAFYSCKFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  243

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TAQ++ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E++  + P GW    
Sbjct  244   TAQSRSSANEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRKNF  303

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
              +  Y  T ++GEYK  GPG+ +  R  + + +   EV+ FIS G+I+ S WLLP  K
Sbjct  304   NR-GYDKTVFYGEYKCFGPGSHVAKRVPYTQDIDQNEVRPFISLGYIKGSTWLLPAPK  360



>ref|XP_008449623.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=369

 Score =   327 bits (837),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 230/366 (63%), Gaps = 8/366 (2%)
 Frame = +2

Query  8     KKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELA  181
             K  +N L +   ++           S  IP  K +++ W+  N++    R    L+PEL 
Sbjct  2     KYCINALRLTRWIMFLEAFAAILAASPLIPTEKSQLDEWYWENVKAFGNRNKAELDPELV  61

Query  182   KAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFIS  361
              AE     I+V  +G GDFKTI EAI+SVP GNT+R++I IG G Y E+LKI R KPF++
Sbjct  62    AAEESATVIKVRGDGSGDFKTIAEAIESVPIGNTKRIVIWIGGGVYKEKLKIDRNKPFVT  121

Query  362   LHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVA  541
             L+G   + P++     A++ GTV SAT+IVE DYF A+ + I NS+PRPDG RKGAQA+A
Sbjct  122   LYGSPNNMPNLTFDGDASKYGTVYSATLIVEADYFTAANLVIENSSPRPDGVRKGAQALA  181

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
                 G+ AA YN +  GFQDT CDD G H +KD +I+GTVDFIFG G +LY++T+L V+ 
Sbjct  182   ARIRGNKAAIYNCKFIGFQDTLCDDDGLHLYKDCFIQGTVDFIFGKGTSLYLNTQLDVVG  241

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGV-GEGALLGRGWMAFSRVVFAYCEISDAIK  898
                + V+ A ++    + +GYSF HC +TG  G    LGR W   SRVVFAY  ++D I 
Sbjct  242   NGGLGVIAAHSRDQESDGSGYSFVHCSITGTGGRNTYLGRAWRPRSRVVFAYTTMADIIH  301

Query  899   PEGWHGVPGKTHYG--GTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEAS  1072
             PEGW+ +    H+G   T  FGEYK  GPG+K + R  + K++  +EV+ F+S G++++ 
Sbjct  302   PEGWNDM---NHFGYDKTVLFGEYKCWGPGSKSSERVKYSKQLSYEEVEPFVSLGYVQSE  358

Query  1073  KWLLPP  1090
             KWLLPP
Sbjct  359   KWLLPP  364



>ref|XP_006286828.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
 gb|EOA19726.1| hypothetical protein CARUB_v10003776mg [Capsella rubella]
Length=362

 Score =   326 bits (836),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 160/355 (45%), Positives = 224/355 (63%), Gaps = 4/355 (1%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPK  202
             L ++  L+ +  P V +DD  PIPA K +V  WF +N++P S RK  L+P L  AEA P+
Sbjct  7     LSLIAFLVAFATPVVLADDITPIPAEKAQVEPWFKANVKPLSERKGTLDPLLEAAEASPR  66

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              I V + G GDF TI  AI S+P  N +RVI+ + PG Y E++ I   +PF++L G    
Sbjct  67    IITVNQKGGGDFTTINAAIKSIPLENKKRVIVKLAPGVYKEKVTIDIGRPFVTLLGKPGA  126

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
               ++    T+A+ GTV SAT+I+   YFMA+ +N+IN++P P    +G QA+A+  +GD 
Sbjct  127   ETNLTFDGTSAKYGTVESATLIIWAQYFMAANLNLINTSPMPKPGTQG-QALAMRINGDK  185

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN R +GFQDT CDD+G HFFK+ YIEGT DFIFG G +LY++T+LH + GD + V+
Sbjct  186   AAFYNCRFYGFQDTLCDDRGNHFFKNCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVI  244

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA  +    E  GYSF HCK+TG G G  LGR WM+  +VV+AY E++  + P GW    
Sbjct  245   TAHNRQNDNEQNGYSFVHCKITGDGTGIYLGRAWMSHPKVVYAYTEMTSVVNPSGWQENR  304

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
                H   T ++GEY  TGPG+    R    + + ++E   F+S G+I+ S WLLP
Sbjct  305   TPAH-DKTVFYGEYMCTGPGSHKAKRVAHTQDIDNKEANHFLSLGYIKGSSWLLP  358



>gb|KHG22980.1| Pectinesterase PPME1 -like protein [Gossypium arboreum]
Length=363

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 233/363 (64%), Gaps = 21/363 (6%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEAKPK  202
             ++ +++LL    P V S    PIP +K +V +WF+  I+P   R K L+PEL +A  +P+
Sbjct  15    VICISILL--FAPIVVSQ---PIPVDKSQVETWFNDIIKPVKERGKTLDPELVEAGTEPR  69

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              IRV + G G+F TI + I+SVP+GN + VIISIGPG+Y E+++I R KPFI+L GD K+
Sbjct  70    IIRVMQGGGGEFNTITKTIESVPSGNGKHVIISIGPGSYKEKIRIERNKPFITLVGDPKN  129

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P++    T  Q GTV  A  I+E  YF+ + +NI+N+ PRPDGK  GAQAVAL  SGD 
Sbjct  130   MPNLTFDGTVKQYGTVDGAAFIIESSYFVGANLNIVNTPPRPDGKMVGAQAVALRVSGDR  189

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHV---IEGD-N  730
             +AFYN ++ GFQD   DD+G HFFKD +I GTVDFIF +G  LY+++E+ V   +EGD  
Sbjct  190   SAFYNCKIIGFQDILFDDRGNHFFKDCHIRGTVDFIFRSGTFLYLNSEIFVEGDLEGDPE  249

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             MAV+T QA+ +  EDTGYSFAH ++T       LGR W +  RVV++Y E+ + + P G 
Sbjct  250   MAVITIQARKSSSEDTGYSFAHGRITETANDVFLGRAWKSSLRVVYSYTEMDEIVHPGGC  309

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                        T Y+GEYK TG  +    R  FVK++ D E + F+   ++E +KWLLPP
Sbjct  310   -----------TVYYGEYKCTGKASTPATREKFVKQLSDAEAQPFLVLDYVEGTKWLLPP  358

Query  1091  AKV  1099
               V
Sbjct  359   PTV  361



>ref|XP_008228727.1| PREDICTED: pectinesterase PPME1-like [Prunus mume]
Length=353

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 226/346 (65%), Gaps = 3/346 (1%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
             V+  + VT++L      V +DD  P+PA+  +VN+WF++N+     ++  L+  L  AE 
Sbjct  10    VHAALTVTLILLTATIAV-ADDDTPVPADHSQVNTWFNNNVNSYKEQQGMLDHALVTAEV  68

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 ++V K+G G+FKTI + I+S+P  NT+RVI+ IG G Y E++ I R  PF++ +G 
Sbjct  69    GQTIVKVMKDGSGEFKTITDVINSIPADNTKRVIMYIGGGEYNEKITIPRNIPFVTFYGS  128

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++    T  + GTV SATVI E DYF+A+ + I NS+PRPDGK+ G QA+AL  S
Sbjct  129   PTNMPTLTFAGTTQKYGTVDSATVIAESDYFVAANLIIKNSSPRPDGKKVGEQALALRVS  188

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ +A +N +L GFQDT CDDKG HFFKD +IEGTVDFIFG+GK+LY++TELHV+  + M
Sbjct  189   GNKSALFNCKLIGFQDTLCDDKGNHFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEM  248

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+TAQA+ +  EDTGYSF HC +TG G G  LGR W    RVVFAY  + + I P GW+
Sbjct  249   TVITAQARDSALEDTGYSFVHCNITGTGNGTYLGRAWRTSPRVVFAYTSMFEVITPAGWN  308

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFIS  1051
                 +     T ++GEYK +GPG+ +  R  + K++ ++ +    S
Sbjct  309   N-KNRPERDSTVFYGEYKCSGPGSSMVGRVKYTKQLNEEIISHAFS  353



>ref|XP_009125689.1| PREDICTED: probable pectinesterase 50 [Brassica rapa]
 emb|CDY55180.1| BnaAnng13710D [Brassica napus]
Length=361

 Score =   325 bits (832),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 228/356 (64%), Gaps = 4/356 (1%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHI  208
             +V  ++ ++ P V + D+ PIP  + ++  WF +N+ P S RK  L+P L  AEA    +
Sbjct  8     IVAFIVAFILPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V + G  +FK+I EAI S+P GN +RVII + PG YTE++ +   +PF++L G    + 
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
              +    TAAQ GTV SAT+I+  DYFMA+ + I N++P P    +G QA+A+  +GD AA
Sbjct  128   VLTYHGTAAQYGTVESATLIIWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDYAA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FY    +GFQDT CDDKG HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+TA
Sbjct  187   FYTCSFYGFQDTLCDDKGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITA  245

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
             Q++ +  E  GY+F HCK+TG G G  LGR WM+  +V++A+ E++  + P GW     +
Sbjct  246   QSRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVIYAFTEMTSVVNPSGWRENFNR  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
               Y  T ++GEYK  GPG+    R  + + +   EV+ F++ G+I+ SKWLLPP K
Sbjct  306   A-YDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSKWLLPPPK  360



>emb|CDY14045.1| BnaC02g01620D [Brassica napus]
Length=361

 Score =   324 bits (831),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 158/356 (44%), Positives = 228/356 (64%), Gaps = 4/356 (1%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHI  208
             +V  ++ ++ P V + D+ PIP  + ++  WF +N+ P S RK  L+P L  AEA    +
Sbjct  8     IVAFIVAFVLPVVLATDTAPIPEVRAQIPQWFKTNVAPYSQRKGTLDPALDAAEAARIIV  67

Query  209   RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
              V + G  +FK+I EAI S+P GN +RVII + PG YTE++ +   +PF++L G    + 
Sbjct  68    TVNQKGGANFKSINEAIKSIPIGNKKRVIIKLAPGIYTEKVTVDVGRPFVTLLGQPGSQT  127

Query  389   SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
              +    TAAQ GTV SAT+IV  DYFMA+ + I N++P P    +G QA+A+  +GD AA
Sbjct  128   VLTYHGTAAQYGTVESATLIVWSDYFMAANLIIKNTSPMPKPGSQG-QALAMRINGDYAA  186

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             FY    +GFQDT CDD+G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+TA
Sbjct  187   FYTCSFYGFQDTLCDDRGNHFFKDCYIEGTYDFIFGRGASLYLNTKLHAV-GDGLRVITA  245

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK  928
             Q++ +  E  GY+F HCK+TG G G  LGR WM+  +VV+A+ E++  + P GW     +
Sbjct  246   QSRQSNTEQNGYTFVHCKITGTGTGIYLGRSWMSHPKVVYAFTEMTSVVNPSGWRENFNR  305

Query  929   THYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAK  1096
               Y  T ++GEYK  GPG+    R  + + +   EV+ F++ G+I+ SKWLLPP K
Sbjct  306   A-YDKTVFYGEYKCFGPGSHQEKRVPYTQDVDQNEVRPFLTLGYIKGSKWLLPPPK  360



>ref|XP_007038214.1| Pectinesterase isoform 2, partial [Theobroma cacao]
 gb|EOY22715.1| Pectinesterase isoform 2, partial [Theobroma cacao]
Length=314

 Score =   322 bits (824),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 167/315 (53%), Positives = 214/315 (68%), Gaps = 18/315 (6%)
 Frame = +2

Query  32   MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEAKPKHI  208
            + T+L+  L P V S +S PIP +K ++ +WF++NI+P S R   ++P LAKAE     I
Sbjct  15   ICTILV--LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAAHII  72

Query  209  RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
            +V K+G GDF TI +AI SVP+GNT+RVIISIG G+Y E+++I R KPFI+ +GD ++ P
Sbjct  73   KVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPRNMP  132

Query  389  SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
            ++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPDG   GAQAV+L  SGD AA
Sbjct  133  NLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGDKAA  192

Query  569  FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
            FYN ++ GFQDT CDD+G HFFKD YI GTVDFIFG+GK+LY+           + V+TA
Sbjct  193  FYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYL----------GVTVITA  242

Query  749  QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGV--P  922
            QA+ +  E+TGYSF HC VTG   GA LGR W    RVVFAY  +S  I P GW     P
Sbjct  243  QARESSSENTGYSFVHCTVTGTASGAYLGRAWKTSPRVVFAYTNMSSVIHPLGWSDNLHP  302

Query  923  GKTHYGGTTYFGEYK  967
             +     T +FGEYK
Sbjct  303  ERAK---TVFFGEYK  314



>gb|KDP39969.1| hypothetical protein JCGZ_03500 [Jatropha curcas]
Length=404

 Score =   323 bits (829),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/322 (51%), Positives = 215/322 (67%), Gaps = 4/322 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSV  268
             +P  + EVN+WF +N++P + RK  LN +L  AEA PK I V  +G G+FKTI +A+ S+
Sbjct  1     MPEAEAEVNAWFEANVKPLADRKGTLNADLEAAEATPKTITVRADGSGEFKTITDAVKSI  60

Query  269   PTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVI  448
             P  N QRVI+ IGPG YTE++ + ++KPF+S  G   ++  I    TA + GTV SAT+ 
Sbjct  61    PAKNAQRVIVDIGPGTYTEKITVEKDKPFVSFVGV-PEKTIIEFAGTAHEYGTVYSATLQ  119

Query  449   VEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRH  628
             VE D+F+ S + I N+AP PDGKR GAQAVA   +G M++FYN R  GFQDT CDDKG H
Sbjct  120   VESDFFVGSGLVIKNTAPAPDGKRPGAQAVAFRIAGSMSSFYNCRFIGFQDTICDDKGFH  179

Query  629   FFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVT  808
             FFKD Y+EGTVDFIFG+GK++Y++T+L V++   M V+ AQA+    EDTG+SF HC V 
Sbjct  180   FFKDCYVEGTVDFIFGSGKSIYLNTQLEVLQDKEMTVIVAQARGNA-EDTGFSFVHCSVA  238

Query  809   GVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAK  988
             G  +GA LGR WM   + VFAY  IS+ I PEGW             +FGE+KN+GPGA 
Sbjct  239   GKAKGAYLGRAWMPAPKAVFAYSTISEVICPEGWSNNE-HPEREPEIFFGEFKNSGPGAA  297

Query  989   LTARPNFVKKMKDQEVKKFISF  1054
                R  F K++ + EVK FIS 
Sbjct  298   ADGRVKFAKQLTEAEVKPFISL  319


 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +2

Query  845   MAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMK  1024
             M   + +FAY  IS+ I PEGW             +FGE+KN+GPGA    R  F K++ 
Sbjct  321   MPAPKAIFAYSTISEVICPEGWSNNE-HPEREPEIFFGEFKNSGPGAAPDGRAKFAKQLT  379

Query  1025  DQEVKKFISFGFIEASKWLLPPAKV  1099
             + EVK FIS  +IE SKWLLPP K+
Sbjct  380   EAEVKPFISLIYIEGSKWLLPPPKL  404



>emb|CDP21978.1| unnamed protein product, partial [Coffea canephora]
Length=263

 Score =   318 bits (814),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 150/263 (57%), Positives = 199/263 (76%), Gaps = 3/263 (1%)
 Frame = +2

Query  17   VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
            +N+ ++ + LL    P V SDD++P PA+K ++NSWF  N+QP ++RK+ L+P L  AEA
Sbjct  3    LNKAILFSTLL--FIPLVLSDDTVPAPADKAQLNSWFEQNVQPLASRKDTLDPALVAAEA  60

Query  194  KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
             P+ I++  +G G+FKTI +AI+S+P  NT RVIIS+GPGNYTE++KI R KPFI++ GD
Sbjct  61   NPRIIKLKSDGSGEFKTIADAINSIPNDNTNRVIISLGPGNYTEKIKIERNKPFITIIGD  120

Query  374  DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
              + P+++    AA+ GTV SAT+IVE DYF A+ + + NSAPRP+G  KGAQA+A+   
Sbjct  121  PNNMPTLVFDGNAAKYGTVESATLIVESDYFNAANLILANSAPRPNGDVKGAQALAVRIG  180

Query  554  GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
            GD A+FYN +  GFQDT CDDKG+H FKD YIEGTVDFIFGNGK++Y++ ELHVI GD  
Sbjct  181  GDKASFYNCKFLGFQDTLCDDKGKHLFKDCYIEGTVDFIFGNGKSIYLNVELHVIPGDQQ  240

Query  734  AVVTAQAQHTREEDTGYSFAHCK  802
            A +TAQA+HT  EDTGYSF HCK
Sbjct  241  AWITAQARHTDAEDTGYSFVHCK  263



>ref|XP_008376964.1| PREDICTED: probable pectinesterase 48 [Malus domestica]
Length=316

 Score =   319 bits (818),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 150/299 (50%), Positives = 213/299 (71%), Gaps = 3/299 (1%)
 Frame = +2

Query  17   VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEA  193
            V+  +++T+LL        +DD+ PIP++  ++N+WF +N +P + R++ L+P +  AEA
Sbjct  10   VHAALIMTILLTATV--ATADDNTPIPSDHSQINTWFDNNXKPYTERQSTLDPAVVTAEA  67

Query  194  KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                I+V ++GKGDFKT+ +AI+S+P GNT+RVI+  G G Y E++ I R KPF++L+G 
Sbjct  68   GQTVIKVMQDGKGDFKTVTDAINSIPAGNTKRVIVHXGGGEYNEKIXIPRNKPFVTLYGS  127

Query  374  DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
              + P++    TA + GTV SATVI E DYF+A+ + I NS+PRPDGKR GAQAVAL  S
Sbjct  128  PXNMPNLTFDGTAQKYGTVNSATVIAESDYFVAANLLIKNSSPRPDGKRVGAQAVALRVS  187

Query  554  GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
            G+ +A YN +L GFQDT CDD+G H FKD YIEGTVDFI+G+GK+LY++TELHV+    +
Sbjct  188  GNNSALYNCKLVGFQDTLCDDRGNHLFKDCYIEGTVDFIWGSGKSLYLNTELHVLGDTGI  247

Query  734  AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             V+TAQA+ +  EDTGYSF HC +TG+G G  LGR W    +VV+AY  +++ + P GW
Sbjct  248  TVITAQARDSASEDTGYSFVHCNITGIGSGTYLGRAWRVRPQVVYAYTSMTEVVNPAGW  306



>ref|XP_010109162.1| putative pectinesterase 50 [Morus notabilis]
 gb|EXC21091.1| putative pectinesterase 50 [Morus notabilis]
Length=361

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/364 (47%), Positives = 230/364 (63%), Gaps = 8/364 (2%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAE  190
             M  Q  ++T+L+      V ++  +PIP N+ +VN+WF+ NI+P   RK  L+P L KAE
Sbjct  1     MAVQAALLTILVA-TATVVLANGDVPIPENEAQVNTWFNQNIRPFGERKGTLDPNLVKAE  59

Query  191   AKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHG  370
                K IRV K+G  DFK I +AI ++P  NT+RVII IGPG Y E++ I   +P++SL G
Sbjct  60    EGVKIIRVRKDGSEDFKKIADAIKTIPAWNTKRVIIDIGPGEYHEKVLIDYNQPYVSLVG  119

Query  371   DD-KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALT  547
                KDRP+I   +TA Q GTV SATVIV   YF+A+ +   NSAPRPD  +K  QA+A  
Sbjct  120   SSPKDRPTITYGATAKQYGTVDSATVIVLAPYFVAANLIFKNSAPRPDPYKKDGQALAFR  179

Query  548   QSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGD  727
              +GD AAF+N +  GFQDT CDD+G HFFKD YIEGTVDFIFG G +LY++ +L VI   
Sbjct  180   INGDKAAFFNSKFIGFQDTLCDDRGYHFFKDCYIEGTVDFIFGRGTSLYLNADLFVIGDK  239

Query  728   NMAVVTAQAQHTREEDTGYSFAHCKVTGVGEG-ALLGRGWMAFSRVVFAYCEISDAIKPE  904
              + V+TAQ +  R   TGYSF H ++ G G     LGR W   ++VV+ Y  +S+ I+P 
Sbjct  240   GLTVITAQGRGDRVS-TGYSFVHSRIEGTGNSTTFLGRPWGDKTKVVYTYTYMSNVIQPG  298

Query  905   GWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             GW      +      Y+GEYK+ GPG+    R  F K++   +VK FI+ G+I+AS WLL
Sbjct  299   GWS---DNSQTSKNFYYGEYKSVGPGSSKGKRAKFSKQLTFDQVKPFITLGYIKASTWLL  355

Query  1085  PPAK  1096
             P  K
Sbjct  356   PAPK  359



>gb|KGN48072.1| hypothetical protein Csa_6G428290 [Cucumis sativus]
Length=368

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 232/364 (64%), Gaps = 6/364 (2%)
 Frame = +2

Query  11    KMVNQLVMVTVLLHYLCP--GVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPEL  178
             K+    + +T L+ +L     + +  S  +P +K ++ +WF  N++P + R    L+P +
Sbjct  2     KLRMDALAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAV  61

Query  179   AKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFI  358
               AE     ++V  +G GDFKT+ EAI SVP  N  RV+I IG G Y E+L I + KPFI
Sbjct  62    VAAEGNVTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFI  121

Query  359   SLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
             +L G  K+ P++     A++ GTV SAT+IVE DYF+A+ + I N++PRP+G RK AQA+
Sbjct  122   TLCGTPKNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQAL  180

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             A    G  +AFYN +  GFQDT CDD G H +KD +I+GTVDF+FG G +LY++TEL+V+
Sbjct  181   AARFRGTKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVV  240

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIK  898
                  AV+TA ++    + +GYSF HC +TG G+   LGR WM  SRV+FAY  + D I 
Sbjct  241   GEGQFAVITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIFAYTSMIDIIH  300

Query  899   PEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             PEGW+ +     +  T  FGEYK +GPGA  T R  + K++ + EVK ++S  F++++KW
Sbjct  301   PEGWNDMK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKW  359

Query  1079  LLPP  1090
             LLPP
Sbjct  360   LLPP  363



>ref|XP_004289004.1| PREDICTED: pectinesterase PPME1-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   321 bits (822),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 219/345 (63%), Gaps = 15/345 (4%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK------------NLNPELAKAEAKPKHIRVCKNGKGD  235
             IP N+ +++ W   N++    RK            + + ELA AE   + IRV K+G GD
Sbjct  29    IPENEADLDDWIVRNMREYDKRKAVLNTRSDVPGTHFDTELAAAEDAGRVIRVKKDGTGD  88

Query  236   FKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAA  415
             FKT+ +A+ S+PTGN +RV++ IG G Y E++ +   KPF++ +GD  D PSI    TAA
Sbjct  89    FKTVTDAVKSIPTGNKRRVVVWIGGGEYREKILVEMTKPFVTFYGDKNDMPSITYDGTAA  148

Query  416   QDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGF  595
               GT  SATV VE DYF+A  I  +NSAP PDG RK AQAVA+  SGD AAFYN +  GF
Sbjct  149   VYGTWNSATVAVESDYFVAVNIAFVNSAPMPDGIRKDAQAVAMRISGDKAAFYNCKFMGF  208

Query  596   QDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREED  775
             QDT CDDKGRHFFKD +I+GTVDFIFGNGK+LY+ + L+ +  + + V+TA  +   ++D
Sbjct  209   QDTLCDDKGRHFFKDCFIQGTVDFIFGNGKSLYLKSTLNSV-ANGVGVITAHGRSEAQDD  267

Query  776   TGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYF  955
             TG+SF +C + G G+  LLGR W   +RVVFAY  + + +  +GW      T    T Y+
Sbjct  268   TGFSFVYCTIKGTGD-TLLGRAWRGRARVVFAYTYMGNLVDRKGWSDYNDNTR-ASTVYY  325

Query  956   GEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             GEYK +GPG+    R  + K + D E + FIS  FI+ +KW+LPP
Sbjct  326   GEYKCSGPGSSSNERVKYAKMLSDVEARPFISLTFIQGTKWVLPP  370



>ref|XP_004140272.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   319 bits (817),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 160/358 (45%), Positives = 230/358 (64%), Gaps = 6/358 (2%)
 Frame = +2

Query  29    VMVTVLLHYLCP--GVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAK  196
             + +T L+ +L     + +  S  +P +K ++ +WF  N++P + R    L+P +  AE  
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  197   PKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD  376
                ++V  +G GDFKTI EAI SVP  N  RV+I IG G Y E+L I + KPFI+L G  
Sbjct  64    VTIVKVMGDGTGDFKTITEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  377   KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
             K+ P++     A++ GTV SAT+IVE DYF+A+ + I N++PRP+G RK AQA+A    G
Sbjct  124   KNVPTLSFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  557   DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
               +AFYN +  GFQDT CDD G H +KD +I+GTVDF+FG G +LY++TEL+V+     A
Sbjct  183   TKSAFYNCKFFGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  737   VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             V+TA ++    + +GYSF HC +TG G+   LGR WM  SRV+FAY  + D I PEGW+ 
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWND  302

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +     +  T  FGEYK +GPGA  T R  + K++ + EVK ++S  F++++KWLLPP
Sbjct  303   MK-HAGFDKTVMFGEYKCSGPGAVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  359



>ref|XP_004140273.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=364

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/358 (44%), Positives = 230/358 (64%), Gaps = 6/358 (2%)
 Frame = +2

Query  29    VMVTVLLHYLCP--GVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAK  196
             + +T L+ +L     + +  S  +P +K ++ +WF  N++P + R    L+P +  AE  
Sbjct  4     LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  197   PKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD  376
                ++V  +G GDFKT+ EAI SVP  N  RV+I IG G Y E+L I + KPFI+L G  
Sbjct  64    VTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  377   KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
             K+ P++     A++ GTV SAT+IVE DYF+A+ + I N++PRP+G RK AQA+A    G
Sbjct  124   KNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  557   DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
               +AFYN +  GFQDT CDD G H +KD +I+GTVDF+FG G +LY++TEL+V+     A
Sbjct  183   TKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  737   VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHG  916
             V+TA ++    + +GYSF HC +TG G+   LGR WM  SRV+FAY  + D I PEGW+ 
Sbjct  243   VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWND  302

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +     +  T  FGEYK +GPG+  T R  + K++ + EVK ++S  F++++KWLLPP
Sbjct  303   MK-HAGFDKTVMFGEYKCSGPGSVSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  359



>gb|KDP39971.1| hypothetical protein JCGZ_03502 [Jatropha curcas]
Length=548

 Score =   323 bits (829),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 231/366 (63%), Gaps = 14/366 (4%)
 Frame = +2

Query  14    MVNQLVMVTVLLHYLCPGVF------SDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNP  172
             M+ +L ++  + + +   VF      SDD+ PIP  + EVN+ F +N++P + RK  LN 
Sbjct  1     MIKRLSLLAFVEYAIIAIVFTATTVTSDDAAPIPEAEAEVNACFEANVKPLADRKGTLNA  60

Query  173   ELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             +L  AEA PK I+V  +G G+FKTI EA+  +P  N QRVI+ IGPG YTE++ + ++KP
Sbjct  61    DLEAAEATPKTIKVRADGSGEFKTITEAVKRIPAKNAQRVIVDIGPGTYTEKITVEKDKP  120

Query  353   FISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQ  532
             F+S  G   ++  I    TA + GTV SAT+ VE D+F+ S + I N+AP PDGKR GAQ
Sbjct  121   FVSFVGV-PEKTIIEFAGTAHEYGTVYSATLQVESDFFVGSGLVIKNTAPAPDGKRPGAQ  179

Query  533   AVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELH  712
             AVA   +G M++FYN R  GFQDT CDDKG HFFKD Y+EGTVDFIFG+GK++Y++T+L 
Sbjct  180   AVAFRIAGSMSSFYNCRFIGFQDTICDDKGFHFFKDCYVEGTVDFIFGSGKSIYLNTQLE  239

Query  713   VIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDA  892
             V++   M V+ AQA+    EDTG+SF HC V G  +GA LGR WM   + VFAY  IS+ 
Sbjct  240   VLQDKEMTVIVAQAR-GNAEDTGFSFVHCSVAGKAKGAYLGRAWMPAPKAVFAYSTISEV  298

Query  893   IKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEV----KKFISFGF  1060
             I PEGW             +FGE+KN+GPGA    R  F K++ + E+    K F S   
Sbjct  299   ICPEGWSN-NEHPEREPEIFFGEFKNSGPGAAADGRVKFAKQLTEAEIGDAKKTFSSMST  357

Query  1061  IEASKW  1078
                + W
Sbjct  358   DNLAAW  363



>gb|KGN48071.1| hypothetical protein Csa_6G428040 [Cucumis sativus]
Length=339

 Score =   317 bits (811),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/335 (47%), Positives = 220/335 (66%), Gaps = 4/335 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDS  265
             +P +K ++ +WF  N++P + R    L+P +  AE     ++V  +G GDFKTI EAI S
Sbjct  2     VPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGNVTIVKVMGDGTGDFKTITEAIAS  61

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATV  445
             VP  N  RV+I IG G Y E+L I + KPFI+L G  K+ P++     A++ GTV SAT+
Sbjct  62    VPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTPKNVPTLSFDGVASKYGTVYSATL  121

Query  446   IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGR  625
             IVE DYF+A+ + I N++PRP+G RK AQA+A    G  +AFYN +  GFQDT CDD G 
Sbjct  122   IVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRGTKSAFYNCKFLGFQDTLCDDDGL  180

Query  626   HFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKV  805
             H +KD +I+GTVDF+FG G +LY++TEL+V+     AV+TA ++    + +GYSF HC +
Sbjct  181   HLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFAVITAHSREQEADASGYSFVHCSI  240

Query  806   TGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGA  985
             TG G+   LGR WM  SRV+FAY  + D I PEGW+ +     +  T  FGEYK +GPGA
Sbjct  241   TGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWNDMK-HAGFDKTVMFGEYKCSGPGA  299

Query  986   KLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               T R  + K++ + EVK ++S  F++++KWLLPP
Sbjct  300   VSTGRVAYGKQLTEAEVKPYLSLEFVQSAKWLLPP  334



>ref|XP_007204919.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
 gb|EMJ06118.1| hypothetical protein PRUPE_ppa020130mg [Prunus persica]
Length=350

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/359 (43%), Positives = 225/359 (63%), Gaps = 24/359 (7%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEA  193
             V+  + +T+L+        +DD  P+PA+  +VN+WF++N+ P   R+  L+P L   E 
Sbjct  10    VHAALTMTLLILPTAIIAVADDDTPVPADHSQVNTWFNNNVNPYKERQGTLDPTLVTDEV  69

Query  194   KPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD  373
                 I+V K+G G+FKTI +A++S+PT NT+ VI+ IG G Y E++ I R KPFI+ +G 
Sbjct  70    GQTVIKVMKDGSGEFKTITDAVNSIPTNNTKHVIVYIGGGEYNEKITIPRNKPFITFYGS  129

Query  374   DKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQS  553
               + P++    TA + GTV SATVIVE DYF+A+   I              +A+AL   
Sbjct  130   PTNMPTLTFAGTAQKYGTVDSATVIVESDYFVAANFII--------------KALALRVL  175

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             G+ +A +N RL GFQDT CDDKG +FFKD +IEGTVDFIFG+GK+LY++TELHV+  + M
Sbjct  176   GNKSALFNCRLIGFQDTLCDDKGNYFFKDCFIEGTVDFIFGSGKSLYLNTELHVLGNNEM  235

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              V+T QA+ +  EDTGYSF +C +TG G G  LGR W    RVVFAY  +S+ I   GW+
Sbjct  236   TVITTQARDSASEDTGYSFLYCNITGTGNGTYLGRAWRTSPRVVFAYTSMSEVITSAGWN  295

Query  914   GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
                            +YK +GPG+ +  R  + K++ ++++K F+S  +I+ SKWLLPP
Sbjct  296   DKNRPE---------QYKCSGPGSSMVGRVKYTKQLNEEQIKPFLSLSYIQGSKWLLPP  345



>ref|XP_002277518.1| PREDICTED: putative pectinesterase 63 isoform X2 [Vitis vinifera]
Length=379

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 230/371 (62%), Gaps = 21/371 (6%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR---------KNLN  169
             V  L++ +  + ++ P V SD +  IP++  ++++W  +NI+    R          +L+
Sbjct  13    VTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLD  71

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P L  AEA+   I+V K+G GDFKTI +A++S+P GN +R +I IG G Y E++ I R K
Sbjct  72    PILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSK  131

Query  350   PFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGA  529
             PFI+L+G   D PSI    TA + GTV SATV VE DYFMA  I  +NSAP PDGKR GA
Sbjct  132   PFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGA  191

Query  530   QAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTEL  709
             QAVA+  SGD AAF+N    GFQDT CDD+GRHFFKD  I+GTVDFIFG+GK+LY++T +
Sbjct  192   QAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMI  251

Query  710   HVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISD  889
               +    + V+TAQA+    + +G++F HC ++G G+   LGR W    RVVFAY  +  
Sbjct  252   QSV-AKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLRPRVVFAYTYMGT  309

Query  890   AIKPEGW----HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFG  1057
              I  EGW    H    K     T Y+GEY   GPGA  + R  F K +  +E K F+S  
Sbjct  310   LINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLLTGEEAKPFLSMT  364

Query  1058  FIEASKWLLPP  1090
             +I  +KWLLPP
Sbjct  365   YINGNKWLLPP  375



>emb|CBI27759.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   318 bits (814),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/371 (46%), Positives = 230/371 (62%), Gaps = 21/371 (6%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR---------KNLN  169
             V  L++ +  + ++ P V SD +  IP++  ++++W  +NI+    R          +L+
Sbjct  25    VTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLD  83

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P L  AEA+   I+V K+G GDFKTI +A++S+P GN +R +I IG G Y E++ I R K
Sbjct  84    PILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSK  143

Query  350   PFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGA  529
             PFI+L+G   D PSI    TA + GTV SATV VE DYFMA  I  +NSAP PDGKR GA
Sbjct  144   PFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVNSAPMPDGKRVGA  203

Query  530   QAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTEL  709
             QAVA+  SGD AAF+N    GFQDT CDD+GRHFFKD  I+GTVDFIFG+GK+LY++T +
Sbjct  204   QAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLNTMI  263

Query  710   HVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISD  889
               +    + V+TAQA+    + +G++F HC ++G G+   LGR W    RVVFAY  +  
Sbjct  264   QSV-AKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLRPRVVFAYTYMGT  321

Query  890   AIKPEGW----HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFG  1057
              I  EGW    H    K     T Y+GEY   GPGA  + R  F K +  +E K F+S  
Sbjct  322   LINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLLTGEEAKPFLSMT  376

Query  1058  FIEASKWLLPP  1090
             +I  +KWLLPP
Sbjct  377   YINGNKWLLPP  387



>ref|XP_008391732.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=365

 Score =   316 bits (810),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/342 (46%), Positives = 220/342 (64%), Gaps = 9/342 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK------NLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             IP N  +++SW   N++  + RK        + +L  AE   + I V K+G G F+T+ +
Sbjct  27    IPPNFSQLDSWIXHNMRDYANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTD  86

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++S+P+GNT+RV++ IG G YTE++ +   KPF++ +GD  D PSI    TA + GT  
Sbjct  87    AVNSIPSGNTRRVVVFIGGGVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  146

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             S+TV VE DYF+A  I  +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT  D
Sbjct  147   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  206

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFFKD +++GTVDFIFGNGK+LY++  +H +  + M V+TA A+   E+D+G++F 
Sbjct  207   DRGRHFFKDCHVQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARENVEDDSGFAFV  265

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNT  973
             HC +TG G+   LGR W    RVVFAY  +   I  +GW      T    T Y+GEYK  
Sbjct  266   HCNITGTGD-TFLGRAWRERPRVVFAYAYMGSLINKQGWSDYM-HTERDKTVYYGEYKCM  323

Query  974   GPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             GPG+  + R  + + + D+E K F+S  FI+ +KW+LPP K+
Sbjct  324   GPGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPKL  365



>ref|XP_008242288.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=370

 Score =   316 bits (810),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 218/342 (64%), Gaps = 9/342 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK------NLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             IP +  ++++W   NI+  + RK        + +L  AE   K I V K+G GDFKT+ +
Sbjct  32    IPPHLSQLDTWIVHNIRDYANRKATQATLRFDSKLLSAEYAVKIITVKKDGTGDFKTVTD  91

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++S+P+ NT+RV++ I  G Y E++ +   +PF++ +GD  D PSI    TA + GT  
Sbjct  92    AVNSIPSWNTRRVVVFIRGGEYREKILVDASRPFVTFYGDKNDVPSITFDGTALKYGTWD  151

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             SATV V+ DYF+A  I  +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT CD
Sbjct  152   SATVAVDADYFVAVNIAFVNSAPMPDGNRPGAQAVAMRISGDKAAFHNCRFIGFQDTLCD  211

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFFKD YI+GTVDFIFGNGK+LY++  +H +  + M V+TA A+    +D+G++F 
Sbjct  212   DRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAFV  270

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNT  973
             HC +TG G+   LGR W   +RVVFAY  +   I  +GW      +    T Y+GEYK  
Sbjct  271   HCNITGTGD-TFLGRAWRDRARVVFAYTNMGSLINSQGWSDAM-HSERDKTVYYGEYKCM  328

Query  974   GPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             GPG+  T R  + K + D+E K F+S  FI  +KW+LPP K+
Sbjct  329   GPGSSSTGRVKYAKMLSDEEAKPFLSMTFIRGTKWVLPPPKL  370



>ref|XP_009343360.1| PREDICTED: putative pectinesterase 63 [Pyrus x bretschneideri]
Length=366

 Score =   316 bits (809),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 220/342 (64%), Gaps = 9/342 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK------NLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             IP N  +++SW   N++  + RK        + +L  AE   + I V K+G G F+T+ +
Sbjct  28    IPPNFSQLDSWIAHNMRGYTNRKATQATLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTD  87

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++S+P+GNT+RV++ IG G YTE++ +   KPF++ +GD  D PSI    TA + GT  
Sbjct  88    AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             S+TV VE DYF+A  I  +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT  D
Sbjct  148   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFFKD +I+GTVDFIFGNGK+LY++  +H +  + M V+TA A+   E+D+G++F 
Sbjct  208   DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNTIHSV-ANGMGVITAHARANVEDDSGFAFV  266

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNT  973
             HC +TG G+   LGR W    RVVFAY  +   I  +GW      T    T Y+GEYK  
Sbjct  267   HCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGWSDYM-HTERDKTVYYGEYKCM  324

Query  974   GPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             GPG+  + R  + + + D+E K F+S  FI+ +KW+LPP K+
Sbjct  325   GPGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPKL  366



>ref|XP_010483849.1| PREDICTED: putative pectinesterase 63 [Camelina sativa]
Length=309

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/296 (52%), Positives = 203/296 (69%), Gaps = 2/296 (1%)
 Frame = +2

Query  203   HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
              ++V +NG+G FKTI EAI SV  GNT RVII +GPG Y E++ I R KPFI+L+G    
Sbjct  13    RVQVEQNGRGHFKTITEAIKSVQAGNTGRVIIKVGPGVYKEKVTIDRNKPFITLYGHPNA  72

Query  383   RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
              P +    TA + GTV SAT+IV  DYFMA  I + N+AP PDGK KGAQA+++  SG+ 
Sbjct  73    MPVLTYDGTALRYGTVDSATLIVLSDYFMAINIIVKNNAPMPDGKMKGAQALSMRISGNK  132

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  133   AAFYNCKFYGYQDTICDDAGNHFFKDCYIEGTFDFIFGSGRSLYLGTQLNVV-GDGIRVI  191

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
             TA A  + +E +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GW    
Sbjct  192   TAHAGKSAQEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWQ-EN  250

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               T    T ++GEYK TGPG++   R  F + + D + K FIS G+I+ S WLLPP
Sbjct  251   RDTGRDKTVFYGEYKCTGPGSRKEKRVKFTQYIDDIKAKYFISLGYIQGSSWLLPP  306



>ref|XP_006572810.1| PREDICTED: uncharacterized protein LOC100306177 isoform X2 [Glycine 
max]
Length=328

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/296 (52%), Positives = 210/296 (71%), Gaps = 2/296 (1%)
 Frame = +2

Query  29   VMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
            + VT+++ +L   V  SDD++PIPANK ++  W+++N+ P   RK+ ++P L  AE   K
Sbjct  10   IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAK  69

Query  203  HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
             ++V ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  + 
Sbjct  70   VVKVMQDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  383  RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
             P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD 
Sbjct  130  MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  563  AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
            AAFYN +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV TEL  +  + + V+
Sbjct  190  AAFYNCKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVSTELRTLGDNGITVI  249

Query  743  TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +SD +   GW
Sbjct  250  VAQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGW  305



>ref|XP_009348900.1| PREDICTED: putative pectinesterase 63 isoform X1 [Pyrus x bretschneideri]
Length=366

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 219/342 (64%), Gaps = 9/342 (3%)
 Frame = +2

Query  92    IPANKDEVNSWF------HSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             IP N  +++SW       ++N++        + ++  AE   + I V K+G G F+T+ +
Sbjct  28    IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++S+P+GNT+RV++ IG G YTE++ +   KPF++ +GD  D PSI    TA + GT  
Sbjct  88    AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             S+TV VE DYF+A  I  +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT  D
Sbjct  148   SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFFKD +I+GTVDFIFGNGK+LY++  +H +  + M V+TA A+   E+D+G++F 
Sbjct  208   DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNT  973
             HC +TG G+   LGR W    RVVFAY  +   I  +GW      T    T ++GEYK  
Sbjct  267   HCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGWSDYM-HTERDKTVFYGEYKCM  324

Query  974   GPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             GPG+  + R  + + + D+E K F+S  FI+ +KW+LPP K+
Sbjct  325   GPGSSSSGRVKYARMLSDEEAKPFLSLTFIKGTKWVLPPPKI  366



>ref|XP_010656088.1| PREDICTED: putative pectinesterase 63 isoform X1 [Vitis vinifera]
Length=382

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 170/374 (45%), Positives = 230/374 (61%), Gaps = 24/374 (6%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR---------KNLN  169
             V  L++ +  + ++ P V SD +  IP++  ++++W  +NI+    R          +L+
Sbjct  13    VTTLLLASQFMIFI-PAVVSDKTKHIPSDTSKLDAWIATNIREYRQRIWESKKGLHSSLD  71

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P L  AEA+   I+V K+G GDFKTI +A++S+P GN +R +I IG G Y E++ I R K
Sbjct  72    PILVAAEAEVNVIKVRKDGTGDFKTITDALNSIPKGNLKRTVIWIGGGEYWEKITIDRSK  131

Query  350   PFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINII---NSAPRPDGKR  520
             PFI+L+G   D PSI    TA + GTV SATV VE DYFMA  I  +   NSAP PDGKR
Sbjct  132   PFITLYGSTADMPSITYDGTAFKYGTVDSATVAVESDYFMAVNIAFVVRTNSAPMPDGKR  191

Query  521   KGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVD  700
              GAQAVA+  SGD AAF+N    GFQDT CDD+GRHFFKD  I+GTVDFIFG+GK+LY++
Sbjct  192   VGAQAVAMRISGDKAAFHNCMFIGFQDTLCDDRGRHFFKDCQIQGTVDFIFGDGKSLYLN  251

Query  701   TELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCE  880
             T +  +    + V+TAQA+    + +G++F HC ++G G+   LGR W    RVVFAY  
Sbjct  252   TMIQSV-AKGVGVITAQARENVADTSGFAFVHCNISGSGD-TYLGRAWRLRPRVVFAYTY  309

Query  881   ISDAIKPEGW----HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFI  1048
             +   I  EGW    H    K     T Y+GEY   GPGA  + R  F K +  +E K F+
Sbjct  310   MGTLINGEGWSDNLHADRDK-----TVYYGEYMCEGPGATPSGRVKFAKLLTGEEAKPFL  364

Query  1049  SFGFIEASKWLLPP  1090
             S  +I  +KWLLPP
Sbjct  365   SMTYINGNKWLLPP  378



>gb|EPS69429.1| hypothetical protein M569_05334, partial [Genlisea aurea]
Length=305

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/302 (50%), Positives = 210/302 (70%), Gaps = 8/302 (3%)
 Frame = +2

Query  5    RKKMVNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAK  184
            R+ +++ L++  V +    P    +D + IPA+K ++++WF+ N+   +T   L+  +A 
Sbjct  5    RRTLLHLLLVTAVYIARSEP----EDEL-IPADKSQLDTWFNRNVGQKAT---LSTAVAD  56

Query  185  AEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISL  364
            AEAK   I V K+G G FKTI +A+ SVP  N  RV+I IGPGNYTE+++I R KP ++L
Sbjct  57   AEAKTTVISVSKDGSGKFKTIGDALKSVPENNKNRVVIHIGPGNYTEKIRIERSKPHVTL  116

Query  365  HGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVAL  544
            +GD K+ P ++   +AA+   + SAT+IVEGDYF A  + I+NS+PRPDGK K AQA AL
Sbjct  117  YGDPKNMPVLVYGESAAKVNIIESATLIVEGDYFSAVNLVIVNSSPRPDGKIKLAQAAAL  176

Query  545  TQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEG  724
              SGD A+FYN R HGFQDT  DD GRH FKD YIEGTVDFI G+G++LY++TE+HVI G
Sbjct  177  RTSGDGASFYNCRFHGFQDTILDDAGRHLFKDCYIEGTVDFICGSGQSLYLNTEVHVIPG  236

Query  725  DNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPE  904
            + M  +TA A+ T  +  GYSF HC++TG GE A LGR W  ++RV+++Y ++SD + P 
Sbjct  237  EPMGFITAHARKTTGDPGGYSFVHCRITGAGETAYLGRPWYPYARVIYSYSQLSDVVNPS  296

Query  905  GW  910
            GW
Sbjct  297  GW  298



>ref|XP_006474682.1| PREDICTED: putative pectinesterase 63-like [Citrus sinensis]
Length=369

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/366 (46%), Positives = 227/366 (62%), Gaps = 25/366 (7%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN----------LNP  172
             +L + TVL H           IP+ A+K E  +W   N++  + RK           ++ 
Sbjct  14    RLSITTVLAH--------PKQIPLDASKLE--AWIGENMREFTERKAQLAQGKNDTVVDH  63

Query  173   ELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
              LA AE   + I V K+G+GDFKT+ +A+ S+P+GNT+RV++ IG G Y E++ + R K 
Sbjct  64    VLAAAEDGFRVITVRKDGRGDFKTVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKD  123

Query  353   FISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQ  532
             F++  GD  D P I+   TA   GTV SATV VE DYF+A+ +  +NSAP PDGKR GAQ
Sbjct  124   FVTFFGDPFDMPKIVFNGTALHFGTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQ  183

Query  533   AVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELH  712
             AVA+  SGD AAF+N +  G+QDT CDDKGRHFFKD YI+GTVDFIFGNGK+LY+ T + 
Sbjct  184   AVAMRISGDKAAFHNCKFMGYQDTLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-  242

Query  713   VIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDA  892
             V   + + V+TAQA+    +D+G++F HC +TG G+   LGR W    RVVFAY  +   
Sbjct  243   VSVANGLGVITAQAREQVNDDSGFTFVHCNITGSGD-TYLGRAWKERPRVVFAYTYMGTL  301

Query  893   IKPEGW-HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
             I  +GW  G   + H   T Y+GEYK  GPGA  + R  F K + + E K F+S  ++  
Sbjct  302   INSQGWAAGEQAQNH--KTVYYGEYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNG  359

Query  1070  SKWLLP  1087
             +KWLLP
Sbjct  360   NKWLLP  365



>gb|KHN47850.1| Putative pectinesterase 63 [Glycine soja]
Length=300

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/295 (53%), Positives = 201/295 (68%), Gaps = 5/295 (2%)
 Frame = +2

Query  218   KNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSII  397
             ++G G+FKTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  +  P++ 
Sbjct  2     QDGSGEFKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEKMPNLT  61

Query  398   GCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYN  577
                TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD AAFYN
Sbjct  62    FGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYN  121

Query  578   VRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYV----DTELHVIEGDNMAVVT  745
              +++GFQDT CDD+ RHFFKD  I+GT+D+IFG+GK+LYV     TEL  +  + + V+ 
Sbjct  122   CKMYGFQDTICDDRNRHFFKDCLIQGTMDYIFGSGKSLYVVSKISTELRTLGDNGITVIV  181

Query  746   AQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPG  925
             AQA+ +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +SD +   GW     
Sbjct  182   AQARKSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSNMSDIVNKLGWSNNNH  241

Query  926   KTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               H   T  FGEY+N+GPGA    R    K++ + EVK +I+   IE SKWLLPP
Sbjct  242   PEH-DKTVRFGEYQNSGPGADPKGRATITKQLSETEVKPYITLAMIEGSKWLLPP  295



>emb|CDY02121.1| BnaA03g40460D [Brassica napus]
Length=302

 Score =   308 bits (790),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/323 (48%), Positives = 208/323 (64%), Gaps = 27/323 (8%)
 Frame = +2

Query  23   QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPK  202
             L++  +L+    P V+ +D+ PIP NK+ +  WF++N++                    
Sbjct  7    SLILTILLVVITWPVVYGNDATPIPQNKNRIEQWFNNNVR--------------------  46

Query  203  HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
                 +NG+GDFKT+ EAI+SVP GN +RVII +G G Y E++ I R KPFI+L+GD   
Sbjct  47   -----QNGRGDFKTLTEAINSVPVGNKERVIIKLGHGEYKEKVTIDRNKPFITLYGDPNA  101

Query  383  RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
             P +    TAA+ GTV SAT+IV  DYFMA  I + NSAP PDGKRKGAQA+++  SG+ 
Sbjct  102  MPVLTFDGTAAEYGTVDSATLIVLSDYFMAINIIVKNSAPMPDGKRKGAQALSMRISGNK  161

Query  563  AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
            AAFYN + +G+QDT CDD G HFFKD YIEGT DFIFG+G++LY+ T+L+V+ GD + V+
Sbjct  162  AAFYNCKFYGYQDTICDDTGNHFFKDCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVI  220

Query  743  TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVP  922
            TA A  + EE +GYSF HCKVTG G G  LGR WM+  +VV+AY ++S  + P GWH   
Sbjct  221  TAHAGKSTEEKSGYSFVHCKVTGTGTGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWHK-N  279

Query  923  GKTHYGGTTYFGEYKNTGPGAKL  991
             +T    T ++GEY    P   L
Sbjct  280  TQTERDKTVFYGEYNWLLPPHSL  302



>gb|KHN15646.1| Putative pectinesterase 63 [Glycine soja]
Length=296

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/291 (53%), Positives = 199/291 (68%), Gaps = 1/291 (0%)
 Frame = +2

Query  218   KNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSII  397
             ++G G+FKTI +AI+SVP GNT+RVI+ IG GNY E++KI R KPF++L+G  +  P++ 
Sbjct  2     QDGSGEFKTITDAINSVPNGNTKRVIVFIGAGNYNEKIKIERTKPFVTLYGVPEKMPNLT  61

Query  398   GCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYN  577
                TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD AAFYN
Sbjct  62    FGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDKAAFYN  121

Query  578   VRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQ  757
              ++ GFQDT CDD+ +HFFKD  I+GT+D+IFG+GK+LY+ TEL  +  + + V+ AQA+
Sbjct  122   CKMFGFQDTICDDRNKHFFKDCLIQGTMDYIFGSGKSLYMSTELRTLGDNGITVIVAQAR  181

Query  758   HTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHY  937
              +  ED  YSF HC VTG G G  LGR WM+  RVVFAY  +S  +   GW       H 
Sbjct  182   KSETEDNAYSFVHCDVTGTGTGTFLGRAWMSHPRVVFAYSTMSGIVNKLGWSNNNHPEH-  240

Query  938   GGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               T  FGEY+NTGPGA    R    K++ + EVK +I+   IE SKWLLPP
Sbjct  241   DKTVRFGEYQNTGPGADPKGRAPITKQLSETEVKPYITLAMIEGSKWLLPP  291



>ref|XP_007202075.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
 gb|EMJ03274.1| hypothetical protein PRUPE_ppa005976mg [Prunus persica]
Length=434

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 218/342 (64%), Gaps = 9/342 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK------NLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
             IP +  ++++W   N++  + RK        + +L  AE   K I V K+G GDFKT+ +
Sbjct  96    IPPHLSQLDTWIVHNMRDYANRKATQVTLRFDSKLLSAEYAFKIITVKKDGTGDFKTVTD  155

Query  254   AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
             A++S+P+ N +RV++ I  G Y E++ +   +PF++ +GD  D PSI    TA + GT  
Sbjct  156   AVNSIPSWNKRRVVVFIDGGEYREKILVDVSRPFVTFYGDKNDVPSITFDGTALKYGTWD  215

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             SATV +E DYF+A  I  +NSAP PDGKR GAQAVA+  SGD AAF++ R  GFQDT CD
Sbjct  216   SATVAIEADYFVAVNIAFVNSAPMPDGKRPGAQAVAMRISGDKAAFHSCRFIGFQDTLCD  275

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D+GRHFFKD YI+GTVDFIFGNGK+LY++  +H +  + M V+TA A+    +D+G++F 
Sbjct  276   DRGRHFFKDCYIQGTVDFIFGNGKSLYLNNRIHSV-ANGMGVITAHAREDAADDSGFAFV  334

Query  794   HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNT  973
             HC +TG G+   LGR W   +RVVFAY  +   I  +GW      +    T Y+GEYK  
Sbjct  335   HCNITGTGD-TFLGRAWRDRARVVFAYTYMGSLIDSQGWSDA-KHSERDKTVYYGEYKCM  392

Query  974   GPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPAKV  1099
             GPG+  T R  + K + D+E K F+S  FI  +KW+LPP K+
Sbjct  393   GPGSSSTGRVKYAKMLSDEEAKPFLSMTFIRGTKWVLPPPKL  434



>gb|KDO73799.1| hypothetical protein CISIN_1g047018mg [Citrus sinensis]
Length=369

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 228/366 (62%), Gaps = 25/366 (7%)
 Frame = +2

Query  23    QLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN----------LNP  172
             +L + TVL H           IP+ A+K E  +W   N++  + RK           ++ 
Sbjct  14    RLSITTVLAH--------PKQIPLDASKLE--AWIGENMREFTERKAQLAQGKNDTVVDH  63

Query  173   ELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
              LA AE   + I V K+G+GDFKT+ +A+ S+P+GNT+RV++ IG G Y E++ + R K 
Sbjct  64    VLAAAEDGFRVITVRKDGRGDFKTVTDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKD  123

Query  353   FISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQ  532
             F++  GD  D P I+   TA   GTV SATV VE DYF+A+ +  +NSAP PDGKR GAQ
Sbjct  124   FVTFFGDPFDMPKIVFNGTALHFGTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQ  183

Query  533   AVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELH  712
             AVA+  SGD AAF+N +  G+QDT CDDKGRHFFKD YI+GTVDFIFGNGK+LY+ T + 
Sbjct  184   AVAMRISGDKAAFHNCKFIGYQDTLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-  242

Query  713   VIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDA  892
             V   + + V+TAQA+    +D+G++F HC +TG G+   LGR W    RV+FAY  +   
Sbjct  243   VSVANGLGVITAQAREQVNDDSGFTFVHCNITGSGD-TYLGRAWKERPRVLFAYTYMGTL  301

Query  893   IKPEGW-HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
             I  +GW  G   ++H   T Y+GEYK  GPGA  + R  F K + + E K F+S  ++  
Sbjct  302   INSQGWAAGEHSQSH--KTVYYGEYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNG  359

Query  1070  SKWLLP  1087
             +KWLLP
Sbjct  360   NKWLLP  365



>ref|XP_011039979.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 223/369 (60%), Gaps = 17/369 (5%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN----------LNPE  175
             L+++T+    + P   S   + +PA+  +V +W   NI   + RK+          L+  
Sbjct  10    LLLITLQAIQIIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  176   LAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPF  355
             LA AE + + IRV K+G  DF TI +A++++   N +R+II IG G Y E++ I   KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPF  128

Query  356   ISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQA  535
             ++ +GD  D P I+   TA+Q GT+ SATV VE DYFMA  +  +NSAP P+  R G QA
Sbjct  129   VTFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQA  188

Query  536   VALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHV  715
             VA+  SGD AAF+N +  GFQDT CDD+GRHFFKD Y+ GTVDFIFGNGK+LY++T +  
Sbjct  189   VAMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIAS  248

Query  716   IEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAI  895
             +  +   V+TAQA+    ED+G++F HC +TG G    LGR W    RVVFAY  +   I
Sbjct  249   V-AEGTGVITAQAREHVTEDSGFTFIHCNLTGFGNDTYLGRAWKQRPRVVFAYTYMGHLI  307

Query  896   KPEGWHG--VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
               EGW     P +    GT Y+GEYK  GPG+    R ++ K +   E K F+S  +I  
Sbjct  308   NDEGWSTWKFPERE---GTVYYGEYKCAGPGSSSFGRVSYAKSLSKAEAKPFLSMTYING  364

Query  1070  SKWLLPPAK  1096
             +KWL+PP K
Sbjct  365   NKWLIPPPK  373



>ref|XP_006381567.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
 gb|ERP59364.1| hypothetical protein POPTR_0006s13930g [Populus trichocarpa]
Length=375

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 222/369 (60%), Gaps = 17/369 (5%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN----------LNPE  175
             L+++T+      P   S   + +PA+  +V +W   NI   + RK+          L+  
Sbjct  10    LLLITLQAIQTIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  176   LAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPF  355
             LA AE + + IRV K+G  DF TI +A++++P  N +R II IG G Y E++ I   KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIPKDNKRRTIIQIGGGEYWEKITIKCNKPF  128

Query  356   ISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQA  535
             I+ +GD  D P I+   TA+Q GT+ SATV VE DYFMA  +  +NSAP P+  R G QA
Sbjct  129   ITFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPLPNVNRTGGQA  188

Query  536   VALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHV  715
             V++  SGD AAF+N +  GFQDT CDD+GRHFFKD Y+ GTVDFIFGNGK+LY++T +  
Sbjct  189   VSMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIDS  248

Query  716   IEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAI  895
             +  +   V+TAQA+    ED+G++F HC +TG+G    LGR W    RVVFAY  +   I
Sbjct  249   V-AEGTGVITAQAREHVTEDSGFTFIHCNLTGLGNNTYLGRAWKQRPRVVFAYTYMGHLI  307

Query  896   KPEGWHG--VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
               EGW     P +    GT Y+GEYK  GPG+    R  + K +   E K F+S  +I  
Sbjct  308   NDEGWSTWKFPERE---GTVYYGEYKCAGPGSSSFGRVPYTKSLSKAEAKPFLSMTYING  364

Query  1070  SKWLLPPAK  1096
             +KWL+PP K
Sbjct  365   NKWLIPPPK  373



>ref|XP_006452876.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
 gb|ESR66116.1| hypothetical protein CICLE_v10010655mg [Citrus clementina]
Length=369

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 219/343 (64%), Gaps = 15/343 (4%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN----------LNPELAKAEAKPKHIRVCKNGKGDFK  241
             IP +  ++ +W   N++  + RK           ++  LA AE   + I V K+G+GDFK
Sbjct  27    IPLDASKLEAWIGENMREFTERKAQLAQGKNDTVVDHVLAAAEDGFRVITVRKDGRGDFK  86

Query  242   TIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQD  421
             TI +A+ S+P+GNT+RV++ IG G Y E++ + R K F++  GD  D P I+   TA   
Sbjct  87    TITDAVKSIPSGNTRRVVVKIGGGEYWEKITVERSKDFVTFFGDPFDMPKIVFNGTALHF  146

Query  422   GTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQD  601
             GTV SATV VE DYF+A+ +  +NSAP PDGKR GAQAVA+  SGD AAF+N +  G+QD
Sbjct  147   GTVNSATVAVESDYFVAANVAFVNSAPMPDGKRLGAQAVAMRISGDKAAFHNCKFIGYQD  206

Query  602   TFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTG  781
             T CDDKGRHFFKD YI+GTVDFIFGNGK+LY+ T + V   + + V+TAQA+    +D+G
Sbjct  207   TLCDDKGRHFFKDCYIQGTVDFIFGNGKSLYLRTTI-VSVANGLGVITAQAREQVNDDSG  265

Query  782   YSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW-HGVPGKTHYGGTTYFG  958
             ++F HC +TG G+   LGR W    RV+FAY  +   I  +GW  G   ++H   T Y+G
Sbjct  266   FTFVHCNITGSGD-TYLGRAWKERPRVLFAYTYMGTLINSQGWAAGEHSQSH--KTVYYG  322

Query  959   EYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
             EYK  GPGA  + R  F K + + E K F+S  ++  +KWLLP
Sbjct  323   EYKCMGPGASSSGRVKFAKLLSEAEAKPFLSMTYLNGNKWLLP  365



>ref|XP_004169214.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
 gb|KGN48073.1| hypothetical protein Csa_6G428540 [Cucumis sativus]
Length=373

 Score =   308 bits (789),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/336 (45%), Positives = 217/336 (65%), Gaps = 4/336 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN--LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDS  265
             IP  K E++ W+  +++  + R    L+ EL  AE     I+V  +G GDFKTI EAI+S
Sbjct  31    IPTEKSELDGWYSEHVKSFNKRDKMKLDSELVAAEENATVIKVRGDGSGDFKTITEAIES  90

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATV  445
             VP  NT+RV+I IG G Y E+LKI R KPF++L+G   + P++     A++ GTV SAT+
Sbjct  91    VPACNTKRVVIWIGGGVYKEKLKIDRNKPFVTLYGSPNNMPNLTFDGDASKYGTVYSATL  150

Query  446   IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGR  625
              VE DYF A+ + I NS+PRPDGKRKG QA+A    G+  A YN +  GFQDT CDD+G 
Sbjct  151   TVEADYFTAANLIIENSSPRPDGKRKGEQALAARIWGNKVAIYNCKFIGFQDTLCDDRGL  210

Query  626   HFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKV  805
             H +KD +I+GTVDFIFG G +LY++T+L V+    + V+ A ++    E +G+SF HC +
Sbjct  211   HLYKDCFIQGTVDFIFGGGTSLYLNTQLDVVVDGGLGVIAAHSREQESECSGFSFVHCSI  270

Query  806   TGV-GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             TG  G    LGR W   SRVVFAY  ++D I P+GW+ +     Y  T  FGEYK +G G
Sbjct  271   TGTGGRNTYLGRAWRPRSRVVFAYTTMADIIHPKGWNDMD-NFGYDKTVSFGEYKCSGLG  329

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +  + R  + K++ D++V++F+S  ++++  WLLPP
Sbjct  330   SNFSKRVQYGKQLSDEKVQQFVSLEYLKSDTWLLPP  365



>ref|XP_004140274.1| PREDICTED: probable pectinesterase 48-like [Cucumis sativus]
Length=373

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 217/336 (65%), Gaps = 4/336 (1%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN--LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDS  265
             IP  K E++ W+  +++  + R    L+ EL  AE     I+V  +G GDFKTI EAI+S
Sbjct  31    IPTEKSELDGWYSEHVKSFNKRDKMKLDSELVAAEENATVIKVRGDGSGDFKTITEAIES  90

Query  266   VPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATV  445
             VP  NT+RV+I IG G Y E+LKI R KPF++L+G   + P++     A++ GTV SAT+
Sbjct  91    VPACNTKRVVIWIGGGVYKEKLKIDRNKPFVTLYGSPNNMPNLTFDGDASKYGTVYSATL  150

Query  446   IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGR  625
              VE DYF A+ + I NS+PRPDGKRKG QA+A    G+  A YN +  GFQDT CDD+G 
Sbjct  151   TVEADYFTAANLIIENSSPRPDGKRKGEQALAARIWGNKVAIYNCKFIGFQDTLCDDRGL  210

Query  626   HFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKV  805
             H +KD +I+GTVDF+FG G +LY++T+L V+    + V+ A ++    E +G+SF HC +
Sbjct  211   HLYKDCFIQGTVDFVFGKGTSLYLNTQLDVVVDGGLGVIAAHSREQESECSGFSFVHCSI  270

Query  806   TGV-GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             TG  G    LGR W   SRVVFAY  ++D I P+GW+ +     Y  T  FGEYK +G G
Sbjct  271   TGTGGRNTYLGRAWRPRSRVVFAYTTMADIIHPKGWNDMD-NFGYDKTVSFGEYKCSGLG  329

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +  + R  + K++ D++V++F+S  ++++  WLLPP
Sbjct  330   SNFSKRVQYGKQLSDEKVQQFVSLEYLKSDTWLLPP  365



>ref|XP_011016271.1| PREDICTED: putative pectinesterase 63 [Populus euphratica]
Length=375

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/369 (43%), Positives = 222/369 (60%), Gaps = 17/369 (5%)
 Frame = +2

Query  26    LVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKN----------LNPE  175
             L+++T+    + P   S   + +PA+  +V +W   NI   + RK+          L+  
Sbjct  10    LLLITLQAIQIIPTAISTTKL-VPADISKVKAWVAKNINDFNDRKSNDSKGIPRIVLDEL  68

Query  176   LAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPF  355
             LA AE + + IRV K+G  DF TI +A++++   N +R+II IG G Y E++ I   KPF
Sbjct  69    LASAEDRLRLIRVAKDGFADFTTISDALETIQKDNKRRIIIQIGGGEYWEKITIKCNKPF  128

Query  356   ISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQA  535
             ++ +GD  D P I+   TA+Q GT+ SATV VE DYFMA  +  +NSAP P+  R G QA
Sbjct  129   VTFYGDPMDIPRIVFNGTASQYGTIYSATVAVESDYFMAVNVAFVNSAPMPNVNRTGGQA  188

Query  536   VALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHV  715
             VA+  SGD AAF+N +  GFQDT CDD+GRHFFKD Y+ GTVDFIFGNGK+LY++T +  
Sbjct  189   VAMRISGDKAAFHNCKFIGFQDTLCDDRGRHFFKDCYVRGTVDFIFGNGKSLYLNTTIAS  248

Query  716   IEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAI  895
             +  +   V+TAQA+    ED+G++F HC +TG G    LGR W     VVFAY  +   I
Sbjct  249   V-AEGTGVITAQAREHVTEDSGFTFIHCNLTGFGNDTYLGRAWKQRPSVVFAYTYMGHLI  307

Query  896   KPEGWHG--VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
               EGW     P +    GT Y+GEYK  GPG+    R ++ K +   E K F+S  +I  
Sbjct  308   NDEGWSTWKFPERE---GTVYYGEYKCAGPGSSSFGRVSYAKSLSKAEAKPFLSMTYING  364

Query  1070  SKWLLPPAK  1096
             +KWL+PP K
Sbjct  365   NKWLIPPPK  373



>ref|XP_008344163.1| PREDICTED: putative pectinesterase 63 [Malus domestica]
Length=324

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/324 (46%), Positives = 210/324 (65%), Gaps = 3/324 (1%)
 Frame = +2

Query  128   HSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIG  307
             ++N +        + +L  AE   + I V K+G G F+T+ +A++S+P+GNT+RV++ IG
Sbjct  4     YANRKATQXTLRFDAQLLSAEEIVRIITVRKDGTGQFRTVTDAVNSIPSGNTRRVVVFIG  63

Query  308   PGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINI  487
              G YTE++ +   KPF++ +GD  D PSI    TA + GT  S+TV VE DYF+A  I  
Sbjct  64    GGVYTEKVLVDASKPFVTFYGDQNDVPSITFDGTALKYGTWNSSTVAVESDYFVAVNIAF  123

Query  488   INSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDF  667
             +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT  DD+GRHFFKD +++GTVDF
Sbjct  124   VNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLDDRGRHFFKDCHVQGTVDF  183

Query  668   IFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWM  847
             IFGNGK+LY++  +H +  + M V+TA A+   E+D+G++F HC +TG G+   LGR W 
Sbjct  184   IFGNGKSLYLNNTIHSV-ANGMGVITAHARENVEDDSGFAFVHCNITGTGD-TFLGRAWR  241

Query  848   AFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKD  1027
                RVVFAY  +   I  +GW      T    T Y+GEYK  GPG+  + R  + + + D
Sbjct  242   ERPRVVFAYAYMGSLINKQGWSDYM-HTERDKTVYYGEYKCMGPGSSSSGRVKYARMLSD  300

Query  1028  QEVKKFISFGFIEASKWLLPPAKV  1099
             +E K F+S  FI+ +KW+LPP K+
Sbjct  301   EEAKPFLSLTFIKGTKWVLPPPKL  324



>ref|XP_009402033.1| PREDICTED: putative pectinesterase 63 [Musa acuminata subsp. 
malaccensis]
Length=394

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/322 (47%), Positives = 206/322 (64%), Gaps = 8/322 (2%)
 Frame = +2

Query  140   QPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNY  319
             +PPS    L P LA+ E   + + V K+G GDF+TI +AI S+P+GNT R +I IGPG Y
Sbjct  79    EPPSA-PTLEPLLAETERSGRVVTVRKDGNGDFRTITDAIKSIPSGNTARTVIKIGPGVY  137

Query  320   TERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSA  499
              E++ + + +P+++ +G     P+I    TAA+ GT  SATV VE  YF+AS +   N+A
Sbjct  138   REKILVDQSRPYVTFYGQPGAMPTISFDGTAARYGTANSATVAVESSYFVASNVIFENTA  197

Query  500   PRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGN  679
             P P    +GAQAVA+  SGDMAAFYN + +G+QDT CDD GRHFFK+ +I GTVDFIFGN
Sbjct  198   PMPVDGVQGAQAVAMRISGDMAAFYNCKFYGYQDTLCDDTGRHFFKNCFIRGTVDFIFGN  257

Query  680   GKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSR  859
             G+++Y + E+  +  DN+A +TAQA+    + +G+SF HC +TG G  A L R W   SR
Sbjct  258   GRSIYQNCEIESV-ADNVAYITAQARSNISDKSGFSFIHCNITGTGN-AFLSRAWREMSR  315

Query  860   VVFAYCEISDAIKPEGW--HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQE  1033
             VVF+Y  +   I P GW   GV G+     T YFGEYK  GPGA    R  + + + D++
Sbjct  316   VVFSYTHMGRLIDPRGWDNKGVAGRNR---TVYFGEYKCLGPGAVTDGRVKYARLLNDKQ  372

Query  1034  VKKFISFGFIEASKWLLPPAKV  1099
              + F++  FI+A  WLLPP  V
Sbjct  373   ARPFLTMDFIQAQSWLLPPPAV  394



>ref|XP_004144054.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 ref|XP_004159358.1| PREDICTED: probable pectinesterase 50-like [Cucumis sativus]
 gb|KGN66331.1| Pectinesterase [Cucumis sativus]
Length=394

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 215/340 (63%), Gaps = 9/340 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN-------LNPELAKAEAKPKHIRVCKNGKGDFKTIK  250
             IPA+  +++ W   N++  + RK        L+  LA+AE   + I V K+G+G+F TI 
Sbjct  43    IPADSSKLDEWIGHNMKEYNDRKTNETGIKALDRRLAEAEDCVQLITVRKDGRGNFSTIT  102

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTV  430
             EAIDS+P+GN +RV++ IG G Y E++ I   KPF++L+G    RP I    TA++ GTV
Sbjct  103   EAIDSIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQKGKRPMITFDGTASEFGTV  162

Query  431   MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SATV VE DYF+A  +  +NSAP P+    G QAVA+  SGD AAF+     GFQDT C
Sbjct  163   KSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRISGDKAAFHGCHFIGFQDTLC  222

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             DD+GRHFFKD Y++GTVDFIFGNGK+LY+ T ++ +  +   V+TAQA+    +++G++F
Sbjct  223   DDRGRHFFKDCYVQGTVDFIFGNGKSLYLKTTINSV-AEGTGVITAQAREDATDESGFTF  281

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
             A+C +TG G+   LGR W   +RVVFAY  +   I  EGW      +    + Y+GEYK 
Sbjct  282   AYCNITGTGD-TYLGRAWKERTRVVFAYTYMGTLINTEGWSDKMHGSQPRKSMYYGEYKC  340

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              GPGA  + R  + + + D E K F+S  +I  +KWLLPP
Sbjct  341   KGPGATPSGRVKYARILSDVEAKAFLSMTYIHGNKWLLPP  380



>ref|XP_008450966.1| PREDICTED: putative pectinesterase 63 [Cucumis melo]
Length=394

 Score =   300 bits (768),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 215/340 (63%), Gaps = 9/340 (3%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK-------NLNPELAKAEAKPKHIRVCKNGKGDFKTIK  250
             IPA+  +++ W   N++  + RK        L+  LA+AE   + I V K+G+G+F TI 
Sbjct  43    IPADSSKLDEWIAHNMREYNDRKMNETGIKALDRRLAEAEDCVRLITVRKDGRGNFSTIT  102

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTV  430
             EAI+S+P+GN +RV++ IG G Y E++ I   KPF++L+G    RP I    TA++ GTV
Sbjct  103   EAIESIPSGNRRRVVVWIGGGVYREKITIDASKPFVTLYGQKGKRPVITFDGTASEFGTV  162

Query  431   MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SATV VE DYF+A  +  +NSAP P+    G QAVA+  SGD AAF+     GFQDT C
Sbjct  163   KSATVAVESDYFVAVNLTFVNSAPMPELGGTGGQAVAMRISGDKAAFHECHFIGFQDTLC  222

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             DD+GRHFF+D YI+GTVDFIFGNGK+LY+ T ++ +  + + V+TAQA+    +++G++F
Sbjct  223   DDRGRHFFRDCYIQGTVDFIFGNGKSLYLKTTINSV-AEGIGVITAQAREDATDESGFTF  281

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
             A+C +TG G    LGR W   +RVVFAY  +   I  EGW      +    + Y+GEYK 
Sbjct  282   AYCNITGTGN-TYLGRAWKERTRVVFAYTYMGTLINTEGWSDKMHGSQPRKSMYYGEYKC  340

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              GPGA  + R  + + + D E K F+S  +I  +KWLLPP
Sbjct  341   KGPGATSSGRVKYARILSDVEAKAFLSMTYIHGNKWLLPP  380



>ref|XP_002516214.1| Pectinesterase-3 precursor, putative [Ricinus communis]
 gb|EEF46216.1| Pectinesterase-3 precursor, putative [Ricinus communis]
Length=378

 Score =   293 bits (751),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 157/346 (45%), Positives = 206/346 (60%), Gaps = 16/346 (5%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN----------LNPELAKAEAKPKHIRVCKNGK--GD  235
             +P +  ++ +W   NI   + RK+          LN  LA AE+  + I V K      D
Sbjct  33    VPKDISKLKTWVADNINQFNNRKSDLSERIPRIILNKRLADAESSVRVITVAKRDDQFAD  92

Query  236   FKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAA  415
             F++I +AIDS+P  N QR II I  G Y E++ I   KPFI+L+GD  D P I+   TAA
Sbjct  93    FQSISDAIDSIPINNKQRRIIWIKGGEYFEKITINTSKPFITLYGDPGDMPKIVFNGTAA  152

Query  416   QDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGF  595
             + GTV SATV VE  YFMA  I  +NSAP PD  + GAQAVA+  SGD AAF+N +  GF
Sbjct  153   RYGTVYSATVAVESKYFMAVNIAFVNSAPMPDVNKTGAQAVAMRISGDKAAFHNCKFVGF  212

Query  596   QDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREED  775
             QDT CDD+GRH F+D YI GTVDFIFGNGK+LY++T +  +      V+TAQA+ +  + 
Sbjct  213   QDTLCDDRGRHVFRDCYIVGTVDFIFGNGKSLYLNTTIETV-AQGTGVITAQARESVTDS  271

Query  776   TGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK-THYGGTTY  952
             + ++F HC +TG+G    LGR W    RVVFAY  +   I   GW    GK      T Y
Sbjct  272   SEFTFIHCNLTGIGNNTYLGRAWKERPRVVFAYAYMGSLINAAGWS--TGKHPESNETVY  329

Query  953   FGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +GEYK  GPGA  + R  + K + D+E K F+S   I  +KWL+PP
Sbjct  330   YGEYKCKGPGAFSSGRVKYAKLLSDEEAKPFLSMTCINGNKWLIPP  375



>gb|KDP33954.1| hypothetical protein JCGZ_07525 [Jatropha curcas]
Length=374

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/344 (45%), Positives = 205/344 (60%), Gaps = 14/344 (4%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRKN---------LNPELAKAEAKPKHIRVCKNGK-GDFK  241
             +P    ++ SW   NI+  +  K+         L+  L  AE   + I V KN    DF+
Sbjct  31    VPIEYSKLRSWVSDNIKDFNRHKSEDSEGTPIVLDERLVAAEDGVRVITVAKNSTVADFE  90

Query  242   TIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQD  421
             TI +AI+SVP  NT R II I  G Y E++ +   KPFI+L+G+  D P I+   TA+  
Sbjct  91    TITDAINSVPVNNTARRIIWIRGGEYWEKITVNVSKPFITLYGEAADMPMIVFNGTASVY  150

Query  422   GTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQD  601
             GT+ SATV VE DYFMA  +  +N+AP PD    GAQAVA+  SGD AAFYN +  GFQD
Sbjct  151   GTIYSATVAVESDYFMAVNVVFLNAAPMPDVNITGAQAVAMRISGDKAAFYNCKFVGFQD  210

Query  602   TFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTG  781
             T CDD+GRHFFKD Y+ GTVDFIFGNGK+LY++T +  +  +   V+TAQ +   EE++G
Sbjct  211   TLCDDRGRHFFKDCYVVGTVDFIFGNGKSLYLNTTIESV-ANETGVITAQGRENTEEESG  269

Query  782   YSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGK-THYGGTTYFG  958
             ++F HC +TG+G    LGR W    RVVFAY  +   I   GW    GK      T Y+G
Sbjct  270   FTFIHCNLTGIGNNTYLGRAWKVRPRVVFAYTYMGSIINGAGWS--TGKHPESNETAYYG  327

Query  959   EYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             EY   GPGA    R  + K + ++E K F+S  +I  +KWL+PP
Sbjct  328   EYMCKGPGASSDGRVKYAKLLSEEEAKPFLSMTYINGNKWLIPP  371



>ref|XP_010259713.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=336

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/324 (48%), Positives = 208/324 (64%), Gaps = 10/324 (3%)
 Frame = +2

Query  137   IQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGN  316
             I  P    +L+  LA AE   K I+V  +G G+FKT+ +A+ S+PT N +RV+ISIGPG 
Sbjct  20    IVLPIGGDSLDAALADAEKSKKVIKVNLDGSGEFKTVTDALKSIPTDNKERVVISIGPGE  79

Query  317   YTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINS  496
             Y E  KI  +KPFI+ +G  ++ P++    TA + GTV SA+V+V  DYF+A+ I + NS
Sbjct  80    YVE--KITVDKPFITFYGSPQNMPTLSFGGTAHEYGTVDSASVMVLADYFVAANIIMKNS  137

Query  497   APRPDGKRK--GAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFI  670
             AP P G+ +  G QAVA+  SGD AAFYN R  GFQDT    KGRH+FKD Y+EGTVDF+
Sbjct  138   APIPTGQFRFNGGQAVAMRVSGDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFV  197

Query  671   FGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMA  850
             FG GKTL+++TE+  I  + + ++ AQA+    ED G+SF HCKVTG G+   LGR W  
Sbjct  198   FGGGKTLFMNTEIRSIS-NELVMIVAQARKNASEDNGFSFVHCKVTGTGD-IYLGRPWFP  255

Query  851   FSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVK-KMKD  1027
             + R++FA+ ++   + P GWH     T      YF EYKNTGPG+    RP +VK K+ D
Sbjct  256   YGRIIFAFTDMCAQVNPLGWHEGAFPTT---NVYFVEYKNTGPGSNTDKRPAWVKTKLSD  312

Query  1028  QEVKKFISFGFIEASKWLLPPAKV  1099
              EV+ F+S GFI    WL PP  +
Sbjct  313   AEVQPFLSTGFINGDDWLTPPPSL  336



>ref|XP_004140271.1| PREDICTED: pectinesterase PPME1-like [Cucumis sativus]
Length=353

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 207/340 (61%), Gaps = 22/340 (6%)
 Frame = +2

Query  83    SIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEA  256
             S PIP  K ++  WF  N++P + R    L+P LA AE     I+V  +G G+FKT+ EA
Sbjct  27    SPPIPVEKSQLAGWFTENVKPFAVRNKAELDPALATAEENATVIKVMSDGTGNFKTVTEA  86

Query  257   IDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD-KDRPSIIGCSTAAQDGTVM  433
             I SVP  N +RV+I IG G Y E+LKI R KPF++L+G D K+ P +     AA+ GTV 
Sbjct  87    IASVPADNKKRVVIWIGVGVYKEKLKIDRNKPFVTLYGSDPKNMPKLTFDGDAAKYGTVY  146

Query  434   SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
             SAT+IVE DYF A+ + I     + + K K             AA YN +  GFQDT CD
Sbjct  147   SATLIVEADYFTAANLII----EKNNIKTK-------------AAIYNCKFLGFQDTLCD  189

Query  614   DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
             D G H +KD +I+GTVDF+FG G +LY++T+L V     +A VTA ++    + +GYSF 
Sbjct  190   DDGLHLYKDCFIQGTVDFVFGKGTSLYLNTQLDVAGDGGLAGVTAHSREQEADTSGYSFV  249

Query  794   HCKVTGV-GEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
             HC +TG  G+   LGR WM  SRVVFAY  I+D I PEGW+ +     +  T  FGEYK 
Sbjct  250   HCSITGTGGKNTYLGRAWMPRSRVVFAYTTIADIIHPEGWNDMK-HAGFDKTVMFGEYKC  308

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +GPGA  T R  + K++ D EVK F+   ++++ KWLLPP
Sbjct  309   SGPGAVSTGRVAYGKQLTDVEVKPFLGLEYVQSEKWLLPP  348



>ref|XP_010243601.1| PREDICTED: pectinesterase PPME1-like, partial [Nelumbo nucifera]
Length=341

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 154/305 (50%), Positives = 204/305 (67%), Gaps = 9/305 (3%)
 Frame = +2

Query  188   EAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLH  367
             E   K I+V  +G GDFKT+ +AI+S+P GN  R+++SIGPG Y E++K+   KPF++ +
Sbjct  40    EKNKKVIKVNADGSGDFKTMTDAINSIPAGNKDRIVLSIGPGEYVEKIKVDGNKPFVTFY  99

Query  368   GDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQ--AVA  541
             G     P++    T+ + GTV SA+VIV  DYF+A+ I   N+AP P G+  G    AVA
Sbjct  100   GAPGSMPTLSFHGTSGEYGTVDSASVIVLSDYFVAANIIFKNTAPPPSGQGSGQGGQAVA  159

Query  542   LTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIE  721
             +  SGDMAAFYN +  GFQDT  DDKGRH+FKD YIEGTVDFIFG+GK+LY++TELH + 
Sbjct  160   MRISGDMAAFYNCKFIGFQDTLLDDKGRHYFKDCYIEGTVDFIFGSGKSLYMNTELHSVA  219

Query  722   GDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKP  901
              D +AV+TAQA+ +  ED GYSF HC VTG G+   LGR W  F +V+FA  E+ D + P
Sbjct  220   KD-LAVITAQARKSDSEDDGYSFVHCTVTGTGD-IYLGRPWFPFGKVIFANTELCDKVNP  277

Query  902   EGWH-GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVK-KMKDQEVKKFISFGFIEASK  1075
              GWH GV   T      +F EY+NTGPG+    RP +VK K+ D EV+ F+S  +I+   
Sbjct  278   VGWHVGVGVATD---NVFFVEYQNTGPGSNTDKRPTWVKTKLSDAEVQPFLSTKYIDGDN  334

Query  1076  WLLPP  1090
             WL PP
Sbjct  335   WLQPP  339



>ref|XP_007154546.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
 gb|ESW26540.1| hypothetical protein PHAVU_003G127700g [Phaseolus vulgaris]
Length=343

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 198/317 (62%), Gaps = 8/317 (3%)
 Frame = +2

Query  170   PELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREK  349
             P  +      K IRV  +G GDF+T+ EA++S+P+GN +RV++ IG G Y E++ + R K
Sbjct  28    PPNSSLNVADKVIRVRGDGSGDFRTVTEAVNSIPSGNKRRVVVWIGMGEYREKVTVDRSK  87

Query  350   PFISLHG-----DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDG  514
             PF++ +G     D    P I   +TA + GTV SATV V+ DYF+A  +  +NS+PRPD 
Sbjct  88    PFVTFYGERNESDSHTMPIITYHATALKYGTVDSATVAVDSDYFVAVNVAFVNSSPRPDE  147

Query  515   KRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLY  694
                GAQA+A+  SGD AAFYN +   FQDT CDDKGRHFFKD YI+G+ DFIFGNGK++Y
Sbjct  148   NSVGAQALAMRISGDKAAFYNCKFVSFQDTLCDDKGRHFFKDCYIQGSYDFIFGNGKSIY  207

Query  695   VDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVVFA  871
             + + +  +    ++V+TAQ + +  EDTG++F HC +TG G     LGR W    RVVFA
Sbjct  208   LRSRIESV-AKGLSVITAQGRESIGEDTGFTFLHCNITGSGNRNTYLGRAWRKSPRVVFA  266

Query  872   YCEISDAIKPEGWH-GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFI  1048
             Y  ++  I+  GW      +     T Y+GEYK TG GA  + R  F K + D+E K F+
Sbjct  267   YTYMASLIRARGWFTNQLSQPKSNNTIYYGEYKCTGAGAVSSGRVKFRKILSDEEAKPFM  326

Query  1049  SFGFIEASKWLLPPAKV  1099
             S  +I   KW++PP K+
Sbjct  327   SMAYIHGGKWVVPPPKL  343



>ref|XP_007219703.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
 gb|EMJ20902.1| hypothetical protein PRUPE_ppa024066mg, partial [Prunus persica]
Length=330

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 205/336 (61%), Gaps = 40/336 (12%)
 Frame = +2

Query  92    IPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSV  268
             +PA+  +VN+WF++N++P + R   L+  LA AEA  K I+V K+G+G FKTI +A++S 
Sbjct  27    LPADHSQVNTWFNNNVKPYTARNGTLDSTLAMAEASQKVIKVNKDGRGQFKTIADAVNSN  86

Query  269   PTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVI  448
             P GNT+RVI+ IG G Y E++ I + KPF++ +G      ++    TA + GTV S TVI
Sbjct  87    PVGNTKRVIVYIG-GVYNEKITIPQNKPFVTFYGSPTTMSTLTFAGTAQKYGTVDSTTVI  145

Query  449   VEGDYFMASCINII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKG  622
              E DYF+A+   ++  NS+PRPDGKR G QA+AL  S + +A +N RL GFQDT CDD+G
Sbjct  146   AESDYFVAAITLLLRYNSSPRPDGKRVGEQALALRVSSNKSALFNCRLIGFQDTLCDDRG  205

Query  623   RHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCK  802
              HFFKD +IEGT                LHV+  + M V+TAQA+ +  EDTG SF HC 
Sbjct  206   NHFFKDCFIEGT----------------LHVLGNNEMTVITAQARDSTSEDTGDSFVHCN  249

Query  803   VTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPG  982
             +T +G G  LG+ W    RVVFAY  I                    T ++GEYK + PG
Sbjct  250   ITEIGNGTYLGKVWRTSPRVVFAYTSI--------------------TVFYGEYKCSSPG  289

Query  983   AKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             + +  R  + K++  +++K F+S  +I+ SKWLLPP
Sbjct  290   SSMVERVKYAKQLTGEQIKPFLSLDYIQGSKWLLPP  325



>ref|XP_009123158.1| PREDICTED: probable pectinesterase 49 [Brassica rapa]
Length=295

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 192/295 (65%), Gaps = 3/295 (1%)
 Frame = +2

Query  206   IRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDR  385
             ++V + G GDFKTI EAI S+P GNT+RVII + PG Y E++ +   +PF++L G     
Sbjct  1     MQVNQEGGGDFKTINEAIKSIPIGNTKRVIIKLAPGVYHEKVTVDVGRPFVTLMGKPGAE  60

Query  386   PSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMA  565
              ++    TA++ GT+ SAT+I+   YF+A+ +++ N+AP P    +G QA+A+  +GD A
Sbjct  61    TNLTFDGTASKFGTMESATLIIWAKYFVAANLHVKNTAPMPKAGTQG-QALAMRINGDKA  119

Query  566   AFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVT  745
             AFYN R +GFQDT CDD G HFFKD YIEGT DFIFG G +LY++T+LH + GD + V+T
Sbjct  120   AFYNCRFYGFQDTLCDDIGNHFFKDCYIEGTYDFIFGRGASLYLNTQLHAV-GDGLRVIT  178

Query  746   AQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPG  925
             A  + +  +  GYSF HCK+TGVG G  LGR WM+  +VV+AY E+S  + P GW     
Sbjct  179   AHNRQSENQQNGYSFVHCKITGVGTGIYLGRAWMSHPKVVYAYTEMSSVVNPTGWQENRN  238

Query  926   KTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             + +   T ++GEY  TGPG+    R    + +   E   F++ G+I+ S WLLPP
Sbjct  239   REN-DKTVFYGEYMCTGPGSHKEKRVAHTQDIDKNEANGFLTLGYIKGSLWLLPP  292



>ref|XP_010259712.1| PREDICTED: pectinesterase PPME1-like [Nelumbo nucifera]
Length=337

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/301 (48%), Positives = 196/301 (65%), Gaps = 14/301 (5%)
 Frame = +2

Query  200   KHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             K I+V ++G G+FKT+ EA+ S+P  N +RV+ISIGPG Y E  KI  +KPFI+ +G  +
Sbjct  42    KVIKVNQDGSGEFKTVTEALKSIPKYNKERVVISIGPGEYVE--KITVDKPFITFYGSPQ  99

Query  380   DRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRK--GAQAVALTQS  553
             + P++    TA + GTV SA+V+V  +YF+A  I + NSAP P GK +  G QAVA+  S
Sbjct  100   NMPTLSFDGTAHEYGTVDSASVMVLANYFVAVNIIMKNSAPIPTGKFRFNGGQAVAMRVS  159

Query  554   GDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNM  733
             GD AAFYN R  GFQDT    KGRH+FKD Y+EGTVDF+FG GKTL+++TE+  +  + +
Sbjct  160   GDKAAFYNCRFIGFQDTLLAYKGRHYFKDCYVEGTVDFVFGGGKTLFMNTEIRSVSNE-L  218

Query  734   AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
              ++ AQA+    ED G+SF HC VTG G+   LGR W  + R++FA+ E+   + P GWH
Sbjct  219   VMIVAQARKNASEDNGFSFVHCNVTGTGD-IYLGRPWFPYGRIIFAFTELCAQVNPLGWH  277

Query  914   --GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVK-KMKDQEVKKFISFGFIEASKWLL  1084
                VP         YF EYKNTGPG+ +  RP +VK K+ D EV+ F+S  FI    WL 
Sbjct  278   EGAVPTT-----NVYFVEYKNTGPGSNIDKRPAWVKTKLTDAEVQPFLSTAFINGDDWLT  332

Query  1085  P  1087
             P
Sbjct  333   P  333



>ref|XP_004174112.1| PREDICTED: pectinesterase PPME1-like, partial [Cucumis sativus]
Length=309

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 136/299 (45%), Positives = 193/299 (65%), Gaps = 5/299 (2%)
 Frame = +2

Query  29   VMVTVLLHYLCP--GVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAK  196
            + +T L+ +L     + +  S  +P +K ++ +WF  N++P + R    L+P +  AE  
Sbjct  4    LAITTLVTFLATFTAILAVPSPMVPVDKTQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  197  PKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD  376
               ++V  +G GDFKTI EAI SVP  N  RV+I IG G Y E+L I + KPFI+L G  
Sbjct  64   VTIVKVMGDGTGDFKTITEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  377  KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
            K+ P++     A++ GTV SAT+IVE DYF+A+ + I N++PRP+G RK AQA+A    G
Sbjct  124  KNVPTLSFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  557  DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
              +AFYN +  GFQDT CDD G H +KD +I+GTVDF+FG G +LY++TEL+V+     A
Sbjct  183  TKSAFYNCKFFGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  737  VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH  913
            V+TA ++    + +GYSF HC +TG G+   LGR WM  SRV+FAY  + D I PEGW+
Sbjct  243  VITAHSREQEADASGYSFVHCSITGNGKDTYLGRAWMPRSRVIFAYTSMIDIIHPEGWN  301



>ref|XP_003541318.1| PREDICTED: putative pectinesterase 63-like [Glycine max]
Length=347

 Score =   274 bits (701),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 195/306 (64%), Gaps = 14/306 (5%)
 Frame = +2

Query  221   NGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD----DKDR-  385
             +G GDF+T+ +A++S+P+GN +RV++ IG G Y E++ + R KPF++ +G+    D D  
Sbjct  43    DGAGDFRTVTDAVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDND  102

Query  386   -----PSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
                  P I   +TA + GTV SATV V+ DYF+A  +  +NS+PRP+    GAQA+A+  
Sbjct  103   SRDIMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRI  162

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
             SGD AAF+N +  GFQDT CDDKGRHFFKD YI+GT DFIFGNGK++Y+ + +  +  + 
Sbjct  163   SGDKAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESV-ANG  221

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEG-ALLGRGWMAFSRVVFAYCEISDAIKPEG  907
             ++V+TAQ + +  EDTG++F HC +TG G G   LGR W    RVVFAY  +   I  +G
Sbjct  222   LSVITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQG  281

Query  908   W--HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
             W  + V        T Y+GEY+  GPGA  + R  F K +  +E K F+S  +I    W+
Sbjct  282   WFNNQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKFRKILSKEEAKPFLSMAYIHGGTWV  341

Query  1082  LPPAKV  1099
             +PP K+
Sbjct  342   VPPPKL  347



>ref|XP_003609956.1| Pectinesterase [Medicago truncatula]
 gb|AES92153.1| pectinesterase [Medicago truncatula]
Length=345

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/320 (43%), Positives = 197/320 (62%), Gaps = 22/320 (7%)
 Frame = +2

Query  164   LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVR  343
             L   L  AE   + +RV K+G GDF T+ +A+ S+P+GN +RV++ IG G Y E++ + R
Sbjct  40    LEEHLTAAETTVRVVRVRKDGTGDFTTVTDAVKSIPSGNKRRVVVWIGMGEYREKITVDR  99

Query  344   EKPFISLHG-----DDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRP  508
              K F++ +G     D+   P I   +TA + GT+ SATV V+ DYF+A  +  +NS+P P
Sbjct  100   SKRFVTFYGERNGKDNDMMPIITYDATALRYGTLDSATVAVDADYFVAVNVAFVNSSPMP  159

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
             D    G QA+A+  SGD AAFYN +  GFQDT CDD G+HFFKD +I+GT DFIFGNGK+
Sbjct  160   DENSVGGQALAMRISGDKAAFYNCKFIGFQDTLCDDYGKHFFKDCFIQGTYDFIFGNGKS  219

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVG-EGALLGRGWMAFSRVV  865
             +Y++    +  G N  V+TAQ +    +DTG++F HC +TG G     LGRGW    RVV
Sbjct  220   IYLN---RLQRGLN--VITAQGRERMSDDTGFTFVHCNITGSGHRNTYLGRGWRRSPRVV  274

Query  866   FAYCEISDAIKPEGWHGVPGKTHYGG--TTYFGEYKNTGPGAKLTARPNFVKKMKDQEVK  1039
             FAY  +   +   GW+      H+G   T +FGEYK +GPGA    R N+ + + D+E K
Sbjct  275   FAYTYMDSVVNSRGWY------HHGSNETIFFGEYKCSGPGA---VRLNYKRILSDEEAK  325

Query  1040  KFISFGFIEASKWLLPPAKV  1099
              F+S  +I   +W+ PP K+
Sbjct  326   HFLSMAYIHGEQWVRPPPKL  345



>gb|KHN07870.1| Putative pectinesterase 63 [Glycine soja]
Length=337

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/306 (45%), Positives = 193/306 (63%), Gaps = 15/306 (5%)
 Frame = +2

Query  221   NGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGD----DKDR-  385
             NG GDF T+  A++S+P+GN +RV++ IG G Y E++ + R KPF++ +G+    D D  
Sbjct  34    NGAGDFTTV-TAVNSIPSGNKRRVVVWIGRGVYREKITVDRSKPFVTFYGERNGNDNDND  92

Query  386   -----PSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
                  P I   +TA + GTV SATV V+ DYF+A  +  +NS+PRP+    GAQA+A+  
Sbjct  93    SRDIMPIITYDATALRYGTVDSATVAVDADYFVAVNVAFVNSSPRPEENSVGAQALAMRI  152

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
             SGD AAF+N +  GFQDT CDDKGRHFFKD YI+GT DFIFGNGK++Y+ + +  +  + 
Sbjct  153   SGDKAAFFNCKFIGFQDTLCDDKGRHFFKDCYIQGTYDFIFGNGKSIYLRSTIESV-ANG  211

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEG-ALLGRGWMAFSRVVFAYCEISDAIKPEG  907
             ++V+TAQ + +  EDTG++F HC +TG G G   LGR W    RVVFAY  +   I  +G
Sbjct  212   LSVITAQGRESMAEDTGFTFLHCNITGSGNGNTYLGRAWKKSPRVVFAYTYMGSLINTQG  271

Query  908   W--HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
             W  + V        T Y+GEY+  GPGA  + R  F K +  +E K F+S  +I    W+
Sbjct  272   WFNNQVAHAKSNNQTIYYGEYRCMGPGAVSSGRVKFRKILSKEEAKPFLSMAYIHGGTWV  331

Query  1082  LPPAKV  1099
             +PP K+
Sbjct  332   VPPPKL  337



>ref|XP_009348902.1| PREDICTED: putative pectinesterase 63 isoform X2 [Pyrus x bretschneideri]
Length=335

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/279 (47%), Positives = 183/279 (66%), Gaps = 8/279 (3%)
 Frame = +2

Query  92   IPANKDEVNSWF------HSNIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKE  253
            IP N  +++SW       ++N++        + ++  AE   + I V K+G G F+T+ +
Sbjct  28   IPPNFSQLDSWIAHNMRGYTNLKATQATLRFDAQILSAEEIVRIITVRKDGTGQFRTVTD  87

Query  254  AIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVM  433
            A++S+P+GNT+RV++ IG G YTE++ +   KPF++ +GD  D PSI    TA + GT  
Sbjct  88   AVNSIPSGNTRRVVVFIGGGVYTEKILVDASKPFVTFYGDQNDVPSITFDGTALKYGTWN  147

Query  434  SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCD  613
            S+TV VE DYF+A  I  +NSAP PDG R GAQAVA+  SGD AAF+N R  GFQDT  D
Sbjct  148  SSTVAVESDYFVAVNIAFVNSAPMPDGIRPGAQAVAMRISGDKAAFHNCRFIGFQDTLLD  207

Query  614  DKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFA  793
            D+GRHFFKD +I+GTVDFIFGNGK+LY++  +H +  + M V+TA A+   E+D+G++F 
Sbjct  208  DRGRHFFKDCHIQGTVDFIFGNGKSLYLNNMIHSV-ANGMGVITAHARENVEDDSGFAFV  266

Query  794  HCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
            HC +TG G+   LGR W    RVVFAY  +   I  +GW
Sbjct  267  HCNITGTGD-TFLGRAWRERPRVVFAYTYMGSLIDKQGW  304



>ref|XP_007038215.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
 gb|EOY22716.1| Pectin lyase-like superfamily protein, putative isoform 3 [Theobroma 
cacao]
Length=293

 Score =   264 bits (675),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/247 (55%), Positives = 178/247 (72%), Gaps = 3/247 (1%)
 Frame = +2

Query  32   MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEAKPKHI  208
            + T+L+  L P V S +S PIP +K ++ +WF++NI+P S R   ++P LAKAE     I
Sbjct  15   ICTILV--LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAAHII  72

Query  209  RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
            +V K+G GDF TI +AI SVP+GNT+RVIISIG G+Y E+++I R KPFI+ +GD ++ P
Sbjct  73   KVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPRNMP  132

Query  389  SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
            ++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPDG   GAQAV+L  SGD AA
Sbjct  133  NLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGDKAA  192

Query  569  FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
            FYN ++ GFQDT CDD+G HFFKD YI GTVDFIFG+GK+LY++T L+V     + V+TA
Sbjct  193  FYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLNTVLYVDGQKGVTVITA  252

Query  749  QAQHTRE  769
            Q    R 
Sbjct  253  QNCFLRR  259



>ref|XP_006843862.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
 gb|ERN05537.1| hypothetical protein AMTR_s00007p00264370 [Amborella trichopoda]
Length=365

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 141/337 (42%), Positives = 200/337 (59%), Gaps = 13/337 (4%)
 Frame = +2

Query  107   DEVNSWFHSNIQPPSTRK---------NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAI  259
             ++ +SW  +N      R           +   LA AE   K + VCK+G  D+ T++ A+
Sbjct  26    NDFHSWLENNKAMYEARMGQIANGINVTMEDALAVAENGTKVLVVCKDGSCDYGTLQAAV  85

Query  260   DSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSA  439
             DS+P GNTQR I+ I PG Y E++ + R KPF++  GD  + P+I     +A+ GT  SA
Sbjct  86    DSIPVGNTQRYILKIKPGLYKEKVNVPRTKPFVTFLGDPINMPTISYNGNSAKYGTWNSA  145

Query  440   TVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDK  619
             TVIVE DYF+A  +   NS+PRP    +G QAVAL  SGD AAFY  R  GFQDT CDD 
Sbjct  146   TVIVEADYFIAMNVIFENSSPRPKDGEEG-QAVALRISGDKAAFYRCRFIGFQDTLCDDV  204

Query  620   GRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHC  799
             GRH FK+ +I+GTVDFIFG  ++LY + E++ +     A +TAQA+ +  ++ G+SF +C
Sbjct  205   GRHLFKNCFIQGTVDFIFGAARSLYSNCEINSVATGRTA-ITAQARSSESDEGGFSFVNC  263

Query  800   KVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGP  979
             K+TG G+ A L R W  +SRV+FA   + + I   GW    G T    T ++GEY+  GP
Sbjct  264   KITGTGQ-ATLSRAWRKYSRVIFARTYMGNLIDKLGWDN-HGYTDRDQTVFYGEYQCFGP  321

Query  980   GAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             GA +  R  + KK++ ++VK F+   +I    WL  P
Sbjct  322   GATMDGRVPYAKKLRTEDVKPFLDVTYILGRTWLRTP  358



>ref|XP_004174171.1| PREDICTED: probable pectinesterase 49-like, partial [Cucumis 
sativus]
Length=286

 Score =   256 bits (655),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 183/284 (64%), Gaps = 5/284 (2%)
 Frame = +2

Query  29   VMVTVLLHYLCP--GVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK--NLNPELAKAEAK  196
            + +T L+ +L     + +  S  +P +K ++ +WF  N++P + R    L+P +  AE  
Sbjct  4    LAITTLVTFLATFTAILAVPSPMVPVDKAQLEAWFSENVKPFADRNKAELDPAVVAAEGN  63

Query  197  PKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDD  376
               ++V  +G GDFKT+ EAI SVP  N  RV+I IG G Y E+L I + KPFI+L G  
Sbjct  64   VTIVKVMSDGTGDFKTVTEAIASVPVNNKNRVVIWIGEGVYKEKLTIEKNKPFITLCGTP  123

Query  377  KDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSG  556
            K+ P++     A++ GTV SAT+IVE DYF+A+ + I N++PRP+G RK AQA+A    G
Sbjct  124  KNVPTLTFDGVASKYGTVYSATLIVEADYFVAANLIIENTSPRPNG-RKEAQALAARFRG  182

Query  557  DMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMA  736
              +AFYN +  GFQDT CDD G H +KD +I+GTVDF+FG G +LY++TEL+V+     A
Sbjct  183  TKSAFYNCKFLGFQDTLCDDDGLHLYKDCFIQGTVDFVFGKGTSLYLNTELNVVGEGQFA  242

Query  737  VVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
            V+TA ++    + +GYSF HC +TG G+   LGR WM  SRV+F
Sbjct  243  VITAHSREQEADASGYSFVHCSITGNGKDTFLGRAWMPRSRVIF  286



>ref|XP_007038216.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY22717.1| Pectin lyase-like superfamily protein, putative isoform 4 [Theobroma 
cacao]
Length=283

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/248 (54%), Positives = 175/248 (71%), Gaps = 5/248 (2%)
 Frame = +2

Query  32   MVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTR-KNLNPELAKAEAKPKHI  208
            + T+L+  L P V S +S PIP +K ++ +WF++NI+P S R   ++P LAKAE     I
Sbjct  15   ICTILV--LAPVVLSQNSSPIPVDKSQLKAWFNANIKPASARGSTIDPALAKAEVAAHII  72

Query  209  RVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRP  388
            +V K+G GDF TI +AI SVP+GNT+RVIISIG G+Y E+++I R KPFI+ +GD ++ P
Sbjct  73   KVKKDGSGDFDTITKAIASVPSGNTKRVIISIGGGSYREKIRIDRSKPFITFYGDPRNMP  132

Query  389  SIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
            ++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPDG   GAQAV+L  SGD AA
Sbjct  133  NLSYDGTARQYGTVDSATLIVESDYFVAANIVIQNTAPRPDGVMVGAQAVSLRISGDKAA  192

Query  569  FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
            FYN ++ GFQDT CDD+G HFFKD YI GTVDFIFG+GK+LY+   + VI   N  +   
Sbjct  193  FYNCKIIGFQDTLCDDRGNHFFKDCYIRGTVDFIFGSGKSLYLG--VTVITAQNCFLRRI  250

Query  749  QAQHTREE  772
            Q Q  R +
Sbjct  251  QVQGKRSK  258



>ref|NP_001234964.1| uncharacterized protein LOC100306177 precursor [Glycine max]
 gb|ACU14235.1| unknown [Glycine max]
Length=248

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 170/232 (73%), Gaps = 2/232 (1%)
 Frame = +2

Query  29   VMVTVLLHYLCPGV-FSDDSIPIPANKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPK  202
            + VT+++ +L   V  SDD++PIPANK ++  W+++N+ P   RK+ ++P L  AE   K
Sbjct  10   IQVTLVVAFLTTKVVLSDDTVPIPANKAQLGEWYNTNVGPLDQRKSTVDPALVTAEEGAK  69

Query  203  HIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKD  382
             ++V ++G G++KTI +AI S+P+GNT+RVII IG GNY E++KI + KPF++L+G  + 
Sbjct  70   VVKVMQDGSGEYKTITDAIKSIPSGNTKRVIIYIGAGNYNEKIKIEKTKPFVTLYGVPEK  129

Query  383  RPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
             P++    TA Q GTV SAT+IVE DYF+A+ I I N+APRPD K  G QAVAL  SGD 
Sbjct  130  MPNLTFGGTAQQYGTVDSATLIVESDYFVAANIMISNTAPRPDPKTPGGQAVALRISGDK  189

Query  563  AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
            AAFYN +++GFQDT CDD+ RHFFKD  I+ T+D+IFG+GK+LYV TEL  +
Sbjct  190  AAFYNCKMYGFQDTICDDRNRHFFKDCLIQSTMDYIFGSGKSLYVSTELRTL  241



>ref|XP_010262227.1| PREDICTED: putative pectinesterase 63 [Nelumbo nucifera]
Length=357

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 149/366 (41%), Positives = 211/366 (58%), Gaps = 25/366 (7%)
 Frame = +2

Query  32    MVTVLLHYLCPGVFSDDSIPIPANKD--EVNSWFHSNIQPPSTRKN---------LNPEL  178
             M+T+L+  L P VFS D  P   + D    ++W  ++++    RK+         L+  L
Sbjct  1     MITMLI-VLAPIVFSQDQEPENTSNDPTSFDNWIENSMKTFYERKDQIRQGEDVVLDDAL  59

Query  179   AKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFI  358
             A+AE   K I+V K+G GDFKT+ +AI S+P+GN QR+I+ IGPG Y E++ + + KPF+
Sbjct  60    AQAEKSSKVIKVRKDGTGDFKTVADAIASIPSGNKQRIILWIGPGEYAEKITVDKSKPFL  119

Query  359   SLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEGDYFMASCINIINSAPRPD--GKRKGAQ  532
             + +G  ++ P I+    A       SA+V VE DYFMA+ I   NSAP  D  G  +G +
Sbjct  120   TFYGSPENMP-ILSSHGA-------SASVTVESDYFMAANIIFKNSAPETDGKGGGQGGE  171

Query  533   AVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELH  712
             A A+  SGD A FY+    G   +  DDKGRH FKD YIE T++FI GNGK+LY+ TE+H
Sbjct  172   AAAMRISGDKAVFYSCNFTGSDKSLYDDKGRHLFKDCYIESTLNFISGNGKSLYMFTEIH  231

Query  713   VIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDA  892
                  N A++T+  +    EDTGY F +C  TG G    LG+ W A  RV+FA  +I   
Sbjct  232   SKAKTN-ALITSSTKEKENEDTGYCFVYCNFTGSGH-IYLGQEWRAKGRVIFANADIGLQ  289

Query  893   IKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEAS  1072
             I P+G     GKT    T Y+ EY  +GPG+     P +V+ + D E + F+S  ++  S
Sbjct  290   ISPQG-SSDGGKTTDEKTIYYAEYNCSGPGSCADKPPPYVRMLSDAEAQPFVSMTYVHGS  348

Query  1073  KWLLPP  1090
              WLLPP
Sbjct  349   TWLLPP  354



>ref|XP_007219211.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
 gb|EMJ20410.1| hypothetical protein PRUPE_ppa017319mg, partial [Prunus persica]
Length=270

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/282 (47%), Positives = 178/282 (63%), Gaps = 29/282 (10%)
 Frame = +2

Query  74   SDDSIPIPANKDEVNSWFHSNIQPPSTRK-NLNPELAKAEAKPKHIRVCKNGKGDFKTIK  250
            ++DS PIPA+  +V SWF +N++P + RK  L+  +  AE  PK I+V K+G G+FKT+ 
Sbjct  5    ANDSTPIPADGSQVGSWFDNNVKPLTERKGTLDAAIVTAEDGPKLIKVMKDGSGNFKTLT  64

Query  251  EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTV  430
            EAI+S+P  NT+RV++ IG G Y E++KI + KPF++L+G   + P++    TA + GTV
Sbjct  65   EAINSIPERNTKRVVVYIGGGVYNEKIKIPQNKPFVTLYGSPNNMPNLTFDGTAQKYGTV  124

Query  431  MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
             S T+IVE DYF A+  NII +   PDG R  AQAVAL  SGD A+FYN +  GFQDT  
Sbjct  125  YSGTLIVESDYFRAA--NIIVT---PDGIRPDAQAVALQISGDKASFYNCKFFGFQDTLY  179

Query  611  DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
            D KG HFFKD YI+GTVDFIFG GK+LY+                     +  ED  +SF
Sbjct  180  DYKGLHFFKDCYIQGTVDFIFGKGKSLYL---------------------SASEDNEFSF  218

Query  791  AHCKVTGVG--EGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             HCK+TG     G  LGR W +   VVFAY +++D + PE W
Sbjct  219  VHCKITGTTYVRGTYLGRAWGSSPTVVFAYTDMADVVHPERW  260



>ref|XP_004495886.1| PREDICTED: probable pectinesterase 53-like [Cicer arietinum]
Length=380

 Score =   250 bits (638),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 135/322 (42%), Positives = 190/322 (59%), Gaps = 10/322 (3%)
 Frame = +2

Query  149   STRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTER  328
             +T + L+ +L +AE+K   I V +NG  DFKTI EAI+S+P  NT+R I+SI PG Y E+
Sbjct  55    ATEQGLDLKLRQAESKIVRITVNQNGTADFKTITEAINSIPLNNTRRYIVSIAPGTYREK  114

Query  329   LKIVREKPFISLHGDDKDRPSIIGCSTA---AQDGTVM----SATVIVEGDYFMASCINI  487
             + I ++KPFI+  GD  DRP+I G  T     +DGT +    ++TV VE  YF+A  IN 
Sbjct  115   ITIPKKKPFITFLGDAMDRPTITGNDTKGMIGRDGTELKTFNTSTVAVEARYFIAININF  174

Query  488   INSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDF  667
              N+A R D   K  Q VAL  S +  AFYN   +G QDT  D KG H+FK+  I+GTVDF
Sbjct  175   ENTA-RHDNASKEEQGVALRVSANKTAFYNCSFYGAQDTLYDHKGLHYFKNCLIKGTVDF  233

Query  668   IFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWM  847
             IFG G++ Y +  +H        +   +        +G+SF + KVTG G+   LGR W 
Sbjct  234   IFGYGRSFYENCHIHSTTKTKSYITAQRRSKNTSMASGFSFKNSKVTGSGQ-TYLGRPWG  292

Query  848   AFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKD  1027
              +SRVVF+Y  + + I PEGW     +  Y    Y+GEYK +GPG+ L+ R  + + + D
Sbjct  293   NYSRVVFSYTYMDNTILPEGWSDWNHEHRYLN-AYYGEYKCSGPGSNLSERVPWARNLTD  351

Query  1028  QEVKKFISFGFIEASKWLLPPA  1093
             QE + F+   FIE + WL+ P+
Sbjct  352   QEAQPFLGTHFIEGNTWLISPS  373



>ref|XP_010679463.1| PREDICTED: probable pectinesterase 53 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 205/354 (58%), Gaps = 28/354 (8%)
 Frame = +2

Query  104   KDEVNSWFHSNIQ------------------PPSTRKNLNPELAKAEAKPKHIRVCKNGK  229
             + E  SW + N+Q                  P    K+L+ +L  AE     + V +NG 
Sbjct  32    QQEYESWLNWNVQNHRQRRPHTLPQPNTAATPAGPSKDLDVKLKNAETNKVRLTVNQNGT  91

Query  230   GDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCST  409
             GD++TI EAID++P  NT+RVI+ I PG Y E++ I + KPFIS  GD  + P+I G  T
Sbjct  92    GDYRTITEAIDNIPLRNTRRVILDISPGIYREKIHIPKTKPFISFVGDSSNPPTITGNDT  151

Query  410   AA--QDGTVM----SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAF  571
             A+   DGT +    SATV V+ DYF+A  I   N+A    GK  G QAVAL  SG  A+F
Sbjct  152   ASVTHDGTPLHTFQSATVAVDADYFVALNIIFENTATHEVGK-AGEQAVALRISGTKASF  210

Query  572   YNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQ  751
             Y    +G QDT  D KG H+F++ +I+G+VDFIFG G++ Y +  ++ I    +A VTAQ
Sbjct  211   YEASFYGSQDTLYDHKGLHYFRNCFIQGSVDFIFGYGRSFYENCTINSI-AKKVASVTAQ  269

Query  752   AQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKT  931
              +     ++G+SF  CKVTG G    LGR W  +SRVV+++  +   + P GW+   GK+
Sbjct  270   KRSKSSMESGFSFKDCKVTGSGL-VYLGRAWGDYSRVVYSFSFLDKLVLPLGWNNW-GKS  327

Query  932   HYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPPA  1093
             +   + Y+GEYK +GPG+ +T R ++ + + D+E + FI   ++E   WL+ P+
Sbjct  328   NRDKSVYYGEYKCSGPGSNMTGRVHWARALTDKEAEPFIGTYYVEGDTWLISPS  381



>ref|XP_007145123.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
 gb|ESW17117.1| hypothetical protein PHAVU_007G212000g [Phaseolus vulgaris]
Length=370

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 192/338 (57%), Gaps = 19/338 (6%)
 Frame = +2

Query  122   WFHSNIQPPSTRKNL--------NPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTG  277
             W   N++    RKN+        + +L +AE+    I V ++G  DFKTI EA++S+P  
Sbjct  37    WVSCNMKKYDERKNILKSKWKVADLKLRQAESNKVIITVSQDGSADFKTISEALNSIPPR  96

Query  278   NTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQD-------GTVMS  436
             NT RVI+SI PG Y E++ I R  PFI+L G+  + P+I G  TA+         GT  S
Sbjct  97    NTMRVIVSISPGVYREKVMIPRTMPFITLSGEAGNPPTITGNDTASASKRNGTPLGTFHS  156

Query  437   ATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDD  616
             ATV V+  YF+A  I   NSAP   G R+G Q VAL  SG  AAFYN   +G QDT  D 
Sbjct  157   ATVAVDASYFVAINIKFENSAPHEIG-RRGEQGVALRISGTKAAFYNCSFNGAQDTLYDH  215

Query  617   KGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAH  796
             KG HFF +  I+G+VDFIFG  ++LY +  L+      +A +TAQ +     D+G+SF +
Sbjct  216   KGLHFFHNCSIQGSVDFIFGYARSLYQNCYLNSTT-KKVASITAQKRTNSSLDSGFSFQN  274

Query  797   CKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTG  976
             C VTG G+   LGR W  +SRVVF+Y  + + + P+GW    G        Y+GEY  +G
Sbjct  275   CTVTGSGK-VYLGRAWGDYSRVVFSYTYMDNLVLPKGWSDW-GDQKRDSRVYYGEYMCSG  332

Query  977   PGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             PGA +  R  + + + D+E K FI   FIE   WL+ P
Sbjct  333   PGANMAGRVPWARVLTDEEAKPFIGTQFIEGDTWLISP  370



>gb|KHG12918.1| putative pectinesterase 53 -like protein [Gossypium arboreum]
Length=377

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 142/376 (38%), Positives = 211/376 (56%), Gaps = 25/376 (7%)
 Frame = +2

Query  17    VNQLVMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRK----------NL  166
             ++ +V+V V+ +Y      S +    P ++ E   W   N +   +++           L
Sbjct  9     ISLIVLVLVICNYSSTTSASSN----PGSETEFEKWLGWNARNHRSKRLAADRSLVMSVL  64

Query  167   NPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVRE  346
             +  L  AE     I V ++G GDFKTI EA++S+P  NT+RVI+ I PG Y E++ I R 
Sbjct  65    DDNLVIAEKNNVMINVSRDGSGDFKTINEALNSIPLRNTRRVILVIKPGIYREKITIPRT  124

Query  347   KPFISLHGDDKDRPSIIG---CSTAAQDG----TVMSATVIVEGDYFMASCINIINSAPR  505
              PFI+  GD  + P+I G    S++++DG    T  SATV V+ +YF+A  I   N+ P 
Sbjct  125   MPFITFQGDANNPPTITGNDTASSSSKDGRPLKTFQSATVAVDANYFVAINIKFENTVPH  184

Query  506   PDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGK  685
               G  KG QAVA+  SG  AAFYN   +G QDT  D KG H+F + +I+G+VDFIFG G+
Sbjct  185   TIGS-KGGQAVAVRISGTKAAFYNCSFYGDQDTLYDHKGLHYFNNCFIQGSVDFIFGYGR  243

Query  686   TLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGAL-LGRGWMAFSRV  862
             +LY +  L+ I    +A +TAQ + +    +G+SF    VTG G G + LGR W  +SRV
Sbjct  244   SLYENCYLNSI-AKKVASLTAQKRSSASMASGFSFKDSVVTGNGTGLVYLGRAWGEYSRV  302

Query  863   VFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKK  1042
             VF+Y  +   ++P+GW    G        Y+GEYK +GPGA LT R  + + + D+E + 
Sbjct  303   VFSYTFMDKVVRPQGWSDW-GNPKRDDRAYYGEYKCSGPGANLTGRVPWARILTDEEAEP  361

Query  1043  FISFGFIEASKWLLPP  1090
             F+   ++E   WL+ P
Sbjct  362   FLGTYYVEGDTWLINP  377



>ref|XP_010094410.1| putative pectinesterase 53 [Morus notabilis]
 gb|EXB55991.1| putative pectinesterase 53 [Morus notabilis]
Length=381

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/317 (42%), Positives = 186/317 (59%), Gaps = 11/317 (3%)
 Frame = +2

Query  161   NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIV  340
             +L+  L KAE     I V ++G GDF TI +A++++P  NT+RVII+I PG Y E++ I 
Sbjct  68    SLDERLKKAEMNKMRIAVSQDGSGDFTTISQALNAIPPRNTRRVIINIKPGVYREKINIP  127

Query  341   REKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSA  499
             R  PF++L GD  D P+I G  TA+  G       T  SATV VE +YF+A  I   N+A
Sbjct  128   RSMPFVTLFGDADDPPTITGNDTASGTGKNGKPLRTFQSATVAVEANYFVALNIKFENTA  187

Query  500   PRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGN  679
             P   G RKG QAVA+  SG  AAFYN   +G QDT  D KG H+F + +I+G+VDFIFG 
Sbjct  188   PHVVGFRKG-QAVAVRISGSKAAFYNCSFYGTQDTLYDHKGLHYFYNCFIQGSVDFIFGY  246

Query  680   GKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSR  859
             G++ Y    LH      +A +TAQ + T   ++G+SF    VTG G+   LGR W  +SR
Sbjct  247   GRSFYEKCYLHST-AKKVAFLTAQKRTTSSLESGFSFKDSVVTGSGQ-LYLGRAWGDYSR  304

Query  860   VVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVK  1039
             VVF+Y  +   + P+GW    G        Y+GEYK +GPGA L  R  + + + D+E +
Sbjct  305   VVFSYTFMDKIVLPQGWSDW-GDQKRDSQVYYGEYKCSGPGANLKGRVAWARILSDEEAQ  363

Query  1040  KFISFGFIEASKWLLPP  1090
              FI   +++   WL+ P
Sbjct  364   PFIGTYYVDGDTWLISP  380



>gb|KDP28296.1| hypothetical protein JCGZ_14067 [Jatropha curcas]
Length=375

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 140/340 (41%), Positives = 199/340 (59%), Gaps = 19/340 (6%)
 Frame = +2

Query  110   EVNSWFHSNIQPPSTRK----NLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTG  277
             E   W   N++    R     +L+ +L KAE     I V +NG GDF TI +AI S+P+ 
Sbjct  37    EYYQWVSWNVKNHRRRSILESSLDDKLRKAEMNSVRITVNQNGPGDFNTIGDAIKSIPSR  96

Query  278   NTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMS  436
             NT+RVII+I PG Y E++ I R  PFI+  G+  D P I G  TA+ +G       T  S
Sbjct  97    NTRRVIIAIKPGVYREKISIPRTLPFITFLGESSDPPIITGNDTASVNGKDGMPLKTFQS  156

Query  437   ATVIVEGDYFMASCINII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
             ATV V+ +YF+A  INII  N+AP   G R G QAVAL  SG  AAFY+   +G QDT  
Sbjct  157   ATVAVDANYFVA--INIIFENTAPHEIGSR-GGQAVALRISGTKAAFYSCSFYGNQDTLY  213

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             D KG H+F + +I+G+VDFIFG+G++LY +  L+ +    +A +TAQ ++    ++G+SF
Sbjct  214   DHKGLHYFNNCFIQGSVDFIFGSGRSLYQNCRLNSVT-KKVASLTAQKRNNSSLESGFSF  272

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
               C VTG G    LGR W  +SRVVF+Y  +   + P+GW+   G        ++GEYK 
Sbjct  273   KDCVVTGSGL-VYLGRAWGDYSRVVFSYTYMEKVVLPQGWNDW-GDQKRDARVFYGEYKC  330

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +GPGA  T R  + + + D++ K FI   +++   WL+ P
Sbjct  331   SGPGANYTGRVPWARILTDEDAKPFIGTYYVDGDTWLISP  370



>ref|XP_001769271.1| predicted protein [Physcomitrella patens]
 gb|EDQ65983.1| predicted protein [Physcomitrella patens]
Length=370

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 144/364 (40%), Positives = 203/364 (56%), Gaps = 20/364 (5%)
 Frame = +2

Query  29    VMVTVLLHYLCPGVFSDDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKPKH-  205
             ++VTV L  +C    +  S  +P  ++EV + F S +Q    +       AK        
Sbjct  10    LLVTVAL--VCSAEPAQGSQKVPETREEVIASFASWVQRVGEKHAAWERAAKTATTADEF  67

Query  206   --------IRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFIS  361
                     I V ++G G+FKT+ EA++S+P  +   V I +  G Y ER+ I + K FI+
Sbjct  68    ASKVGETVIVVDQSGAGNFKTVNEALNSIPEHSKSPVTIKVNAGTYNERVVIPKSKEFIT  127

Query  362   LHGDDKDRPSIIGCSTAAQDGTV-MSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
             L G  +D   I   + A   GT   SAT  V   +F A  I+  NS+P PDG  +  QAV
Sbjct  128   LQGAGRDVTKITASNAAGNSGTTYTSATFGVSAPHFTARNISFENSSPPPDGGAQ-QQAV  186

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             AL  +GDM AFY    +G QDT  D +GRHFFKD+ I GTVDFIFG+GK+LY + EL V+
Sbjct  187   ALRTTGDMNAFYGCAFYGHQDTLYDHRGRHFFKDTLIVGTVDFIFGDGKSLYKNCELRVL  246

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGAL-LGRGWMAFSRVVFAYCEISDAI  895
                  + +TAQ + +  EDTGYSF +CKVTG G   + LGR W  +SRV+FA+ E ++ I
Sbjct  247   PSSGGS-LTAQKRLSGSEDTGYSFVNCKVTGSGPPQVYLGRAWGPYSRVIFAFTEFANII  305

Query  896   KPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEA  1069
             KPEGW+  G P +     T ++G YK  GPGA   +R  + K++ D E   F+S  +I+ 
Sbjct  306   KPEGWYNWGDPSREK---TVFYGMYKCFGPGASSPSRAYYSKELTDAEAAPFLSLNYIDG  362

Query  1070  SKWL  1081
               W+
Sbjct  363   GLWV  366



>ref|XP_011040796.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=399

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 195/335 (58%), Gaps = 13/335 (4%)
 Frame = +2

Query  131   SNIQPPST--RKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISI  304
             S +Q P    +  L+ +L +AE     + V ++G GDFKTI EA +S+P  NT+RVII+I
Sbjct  57    STVQTPGADGKFVLDGKLRQAEMNSVRVTVSQDGTGDFKTITEATNSIPPYNTRRVIIAI  116

Query  305   GPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDY  463
              PG Y E++ I R  PF++  GD  + P+I G  TA+  G       T  SATV V+ +Y
Sbjct  117   KPGVYREKIFIPRTMPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDANY  176

Query  464   FMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDS  643
             F+A  +   N+AP   G ++G QAVAL  SG  AAFYN   +G QDT  D KG H+F + 
Sbjct  177   FVAISMKFENTAPHVIGTKQG-QAVALRISGTKAAFYNCSFYGNQDTLYDHKGLHYFNNC  235

Query  644   YIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEG  823
             +I+G+VDFIFG+G++ Y +  L+ I    +A +TAQ +      +G+SF    +TG G  
Sbjct  236   FIQGSVDFIFGSGRSFYENCHLNSI-AKKVASLTAQKRSNSSLASGFSFKDSTITGSGL-  293

Query  824   ALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARP  1003
               LGR W  +SRV+F+Y  +   I P+GW+   G        Y+GEY+ TGPGA LT R 
Sbjct  294   IYLGRAWGDYSRVIFSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYQCTGPGANLTGRV  352

Query  1004  NFVKKMKDQEVKKFISFGFIEASKWLLPPAKV*AP  1108
              + + + D+E + FI   ++E   WL+ P  + +P
Sbjct  353   AWARVLTDEEARPFIGTYYVEGDTWLISPENLSSP  387



>ref|XP_010276487.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nelumbo nucifera]
Length=392

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 191/326 (59%), Gaps = 15/326 (5%)
 Frame = +2

Query  140   QPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNY  319
             +P +  K L+ +L KAE     +RV ++G GD+ +I+EA+D +P  NT+RVI+ I PG Y
Sbjct  66    RPAADLKGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVY  125

Query  320   TERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASC  478
              E++ I R +PFI+  GD  + P+I G  TA+  G       T  SATV V  DYF+A  
Sbjct  126   REKILIPRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVA--  183

Query  479   INII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIE  652
             INII  N+AP   G   G QAVAL  SG+ AAF+N   +G QDT  D KG H+F + +I+
Sbjct  184   INIIFENTAPHDIGS-TGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQ  242

Query  653   GTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALL  832
             G+VDFIFG G++LY +  L+ I    +A +TAQ +      +G+SF    VTG G    L
Sbjct  243   GSVDFIFGYGRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTGSGL-VYL  300

Query  833   GRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFV  1012
             GR W   SRV+F+Y  +   + P+GW    G      + Y+GEYK +GPGA LT R  + 
Sbjct  301   GRAWGDRSRVIFSYTYMDKVVLPQGWSDW-GDQKRESSVYYGEYKCSGPGANLTGRVRWA  359

Query  1013  KKMKDQEVKKFISFGFIEASKWLLPP  1090
             + + D+E K FI   ++    WLL P
Sbjct  360   RTLTDKEAKPFIGAYYVNGKTWLLSP  385



>ref|XP_006349162.1| PREDICTED: probable pectinesterase 53-like [Solanum tuberosum]
Length=386

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 132/325 (41%), Positives = 192/325 (59%), Gaps = 15/325 (5%)
 Frame = +2

Query  143   PPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYT  322
             P     +L+P+L  AE     I V ++G G+F TIKEA+ S+P  N +RVI+ I PG Y 
Sbjct  67    PAPVSSSLDPKLIYAEMNKMIISVSQDGSGNFNTIKEALASIPLYNKRRVILDIKPGVYR  126

Query  323   ERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCI  481
             E++ I R  PF++  GD  + P I G  TA+  G       T  SATV V+ DYF+A  I
Sbjct  127   EKINIPRSLPFVTFRGDSSNPPRITGNDTASATGTGGTPLKTFQSATVSVDADYFIA--I  184

Query  482   NII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEG  655
             N+I  N+AP   G   G QAVAL  SG+ AAFYN   +G QDT  D KG H+F + +I+G
Sbjct  185   NVIFENTAPHVVGT-AGEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQG  243

Query  656   TVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLG  835
             +VDFIFG G++LY + +L+ +    +A +TAQ +      +G+SF +  +TG G    LG
Sbjct  244   SVDFIFGYGRSLYENCQLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITGTGS-VYLG  301

Query  836   RGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVK  1015
             R W  +SRV+F+Y  + + + P GW+   GKT      Y+GEY+ +GPGA +T R  + +
Sbjct  302   RAWGDYSRVIFSYTYMDNIVLPLGWNDW-GKTIRDSRVYYGEYRCSGPGANMTGRVPWAR  360

Query  1016  KMKDQEVKKFISFGFIEASKWLLPP  1090
              + D+E   FI   +++ + WL+ P
Sbjct  361   ILNDEEAMPFIETYYVDGNSWLMHP  385



>ref|XP_006853729.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
 gb|ERN15196.1| hypothetical protein AMTR_s00056p00166920 [Amborella trichopoda]
Length=379

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 134/301 (45%), Positives = 175/301 (58%), Gaps = 11/301 (4%)
 Frame = +2

Query  203   HIRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDK  379
             ++ V KN  KGDF TI+ AIDS+P  N  RV+I + PG YTE++ I   K FI++ G   
Sbjct  79    YLTVDKNPAKGDFTTIQSAIDSLPFINLVRVVIKVNPGTYTEKVIIPAMKAFITIEGAGA  138

Query  380   DRPSIIGCSTAAQ-------DGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAV  538
             DR  +    TA          GT  SAT  V   YF+A  I   N+ P P     G QAV
Sbjct  139   DRTEVQWGDTAQTVGPTGQPIGTFNSATFAVNSPYFIAKNITFKNTTPVPKPGASGKQAV  198

Query  539   ALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVI  718
             A   S D AAF   +  G QDT  D  GRH++KD YIEG+VDFIFGNG +LY    +H I
Sbjct  199   AFRISADTAAFLGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNGLSLYEGCHVHAI  258

Query  719   EGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIK  898
               +N   +TAQ + +  EDTG+SF +CKVTG G    LGR W AFSRVVFAY  + + I 
Sbjct  259   -ANNYGALTAQNRMSLLEDTGFSFVNCKVTGSG-ALYLGRAWGAFSRVVFAYTYMDNIII  316

Query  899   PEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKW  1078
             P GW+   G  +   T ++G+YK  GPGA    R ++ +++ D+E K FIS  FI+ S+W
Sbjct  317   PRGWYNW-GDPNREMTVFYGQYKCAGPGASFAGRVSWSRELTDEEAKPFISLSFIDGSEW  375

Query  1079  L  1081
             +
Sbjct  376   I  376



>ref|XP_010276488.1| PREDICTED: probable pectinesterase 53 isoform X2 [Nelumbo nucifera]
Length=391

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 136/326 (42%), Positives = 191/326 (59%), Gaps = 16/326 (5%)
 Frame = +2

Query  140   QPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNY  319
             +P +  K L+ +L KAE     +RV ++G GD+ +I+EA+D +P  NT+RVI+ I PG Y
Sbjct  66    RPAADLKGLDTKLKKAELNKVRVRVSQDGTGDYSSIQEALDDIPLKNTRRVILEINPGVY  125

Query  320   TERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASC  478
              E++ I R +PFI+  GD  + P+I G  TA+  G       T  SATV V  DYF+A  
Sbjct  126   REKILIPRSQPFITFLGDSANPPTITGNDTASGTGRDGKPLKTFQSATVGVNADYFVA--  183

Query  479   INII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIE  652
             INII  N+AP   G   G QAVAL  SG+ AAF+N   +G QDT  D KG H+F + +I+
Sbjct  184   INIIFENTAPHDIGS-TGEQAVALRISGNKAAFHNCSFYGSQDTLYDHKGLHYFNNCFIQ  242

Query  653   GTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALL  832
             G+VDFIFG G++LY +  L+ I    +A +TAQ +      +G+SF    VTG G    L
Sbjct  243   GSVDFIFGYGRSLYENCYLNSIS-KKVASLTAQKRTNISLSSGFSFKDSVVTGSGL-VYL  300

Query  833   GRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFV  1012
             GR W   SRV+F+Y  +   + P+GW     +     + Y+GEYK +GPGA LT R  + 
Sbjct  301   GRAWGDRSRVIFSYTYMDKVVLPQGWSDWGDQKRE--SVYYGEYKCSGPGANLTGRVRWA  358

Query  1013  KKMKDQEVKKFISFGFIEASKWLLPP  1090
             + + D+E K FI   ++    WLL P
Sbjct  359   RTLTDKEAKPFIGAYYVNGKTWLLSP  384



>ref|XP_002320279.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
 gb|EEE98594.2| hypothetical protein POPTR_0014s11240g [Populus trichocarpa]
Length=381

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 133/329 (40%), Positives = 192/329 (58%), Gaps = 13/329 (4%)
 Frame = +2

Query  131   SNIQPPST--RKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISI  304
             S +Q P    +  L+ +L +AE     + V ++G G+FKTIKEAI+S+P  NT+RVII+I
Sbjct  57    STVQTPGADGKLVLDGKLRQAEMNSVRVTVSQDGNGEFKTIKEAINSIPPYNTRRVIIAI  116

Query  305   GPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDY  463
              PG Y E++ I R  PF++  GD  + P+I G  TA+  G       T  SATV V+ +Y
Sbjct  117   KPGVYREKIFIPRTFPFVTFLGDSSEPPTITGNDTASVSGKDGKPLRTYQSATVAVDANY  176

Query  464   FMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDS  643
             F+A  +   N+AP   G ++  QAVAL  SG  AAFYN    G QDT  D KG H+F + 
Sbjct  177   FVAISMKFENTAPHVIGTKQ-EQAVALRISGTKAAFYNCSFFGDQDTLYDHKGLHYFNNC  235

Query  644   YIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEG  823
             +I+G+VDFIFG+G++ Y +  L+ +    +A +TAQ +      +G+SF    +TG G  
Sbjct  236   FIQGSVDFIFGSGRSFYENCHLNSV-AKKVASLTAQKRSNSSLASGFSFKDSTITGSGL-  293

Query  824   ALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARP  1003
               LGR W  +SRV+F+Y  +   I P+GW+   G        Y+GEYK TGPGA LT R 
Sbjct  294   IYLGRAWGDYSRVIFSYTFMDKIILPQGWNDW-GDQRRDSRVYYGEYKCTGPGANLTGRV  352

Query  1004  NFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
              + + + D+E + FI   ++E   WL+ P
Sbjct  353   AWARVLTDEEARPFIGTYYVEGDTWLISP  381



>ref|XP_008801747.1| PREDICTED: probable pectinesterase 53 [Phoenix dactylifera]
Length=386

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 143/388 (37%), Positives = 205/388 (53%), Gaps = 35/388 (9%)
 Frame = +2

Query  8     KKMVNQLVMVTVLLHYLCPGVFSDDSIPI---PAN-KDEVNSWFHSNIQPPST-------  154
             K   N L+ + +L  +L P      S P+   P N +DE   W   N+Q           
Sbjct  4     KLHTNSLLPLVLLTFFLLP------STPLSSYPNNERDEFMKWISWNVQNHKRTVALQLN  57

Query  155   ---------RKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIG  307
                       ++L+ +LAKAEA      V +NG G +K+I+EAIDS+P  NT+RVI+ I 
Sbjct  58    SNSGVLHGGSRSLDMKLAKAEAAATRYIVSQNGSGSYKSIREAIDSIPLHNTRRVILEIR  117

Query  308   PGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYF  466
              G Y E++ I +   FI+  G+    P I G  TAA  G       T  S TV V  +YF
Sbjct  118   SGIYREKIVIPKSMSFITFLGNGASPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYF  177

Query  467   MASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSY  646
             +A+ I   N+AP P+    G QAVAL  SGD AAFYN   +G QDT  D KG H+F + +
Sbjct  178   VAANIKFENTAPYPEVGTTGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCF  237

Query  647   IEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGA  826
             I+G+VDFIFG G++LY +  L+ I    +A + AQ    +  ++G+SF    +TG G   
Sbjct  238   IQGSVDFIFGYGRSLYENCYLNSIT-KRVASLAAQKGSLKTMESGFSFLRSTITGSGL-V  295

Query  827   LLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPN  1006
              LGR W   SRVVF+Y  +   + PEGW+    +       Y+GEY+ +GPGA  T R +
Sbjct  296   YLGRAWGDHSRVVFSYTYMDKVVIPEGWNSWGIQRPETSGVYYGEYQCSGPGANWTGRVH  355

Query  1007  FVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             + + + D+E + F+   ++    WLL P
Sbjct  356   WARLLTDKEAQPFLGTYYVYGDSWLLGP  383



>ref|XP_002965129.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
 gb|EFJ33967.1| hypothetical protein SELMODRAFT_167160 [Selaginella moellendorffii]
Length=359

 Score =   236 bits (601),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 126/318 (40%), Positives = 183/318 (58%), Gaps = 9/318 (3%)
 Frame = +2

Query  149   STRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTER  328
             +TR  L     +     + + V ++G GDF T+++A++++P GN QRV I IGPG Y E+
Sbjct  41    ATRNLLQSFSTEGHLAARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEK  100

Query  329   LKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINI  487
             + +   KPF++  G   DR  I+  STA+  G          +A+V + G  F+A  I+ 
Sbjct  101   VVVPATKPFLTFQGAGIDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISF  160

Query  488   INSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDF  667
              N+AP P     G QA A   SGDMAAFYN   +G QDT CDD GRH+FK  +I+G++DF
Sbjct  161   QNTAPPPPPGVNGRQAAAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDF  220

Query  668   IFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWM  847
             IFGNG++LY   ELH I  D+   V AQ + ++ E+TG+SF +CKVTG G    LGR   
Sbjct  221   IFGNGRSLYEQCELHSI-ADSYGSVAAQDRQSQTENTGFSFVNCKVTGTGI-LYLGRAMG  278

Query  848   AFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKD  1027
              +SR+V++     + I   GW           T  FG+YK  GPGA  + R  + +++ D
Sbjct  279   PYSRIVYSNSYFDNIIDVRGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARELSD  338

Query  1028  QEVKKFISFGFIEASKWL  1081
              EV  F+S  F++ ++WL
Sbjct  339   MEVTPFLSLSFVDGTQWL  356



>ref|XP_010914653.1| PREDICTED: probable pectinesterase 53 [Elaeis guineensis]
Length=386

 Score =   236 bits (603),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/318 (41%), Positives = 185/318 (58%), Gaps = 9/318 (3%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             + L+ +LAKAEA      V ++G G++K+I+EAIDS+P  NT+RVI+ I PG Y E++ I
Sbjct  68    RALDVKLAKAEAAAVRYIVSQDGSGNYKSIREAIDSIPLHNTRRVILEIRPGIYREKIVI  127

Query  338   VREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINS  496
              +   F++  G+    P I G  TAA  G       T  S TV V  +YF+A+ I   N+
Sbjct  128   PKSMSFVTFLGNGTSPPVITGNDTAATRGKDGVPLNTFHSPTVAVNANYFIAANIKFENT  187

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP P+    G QAVAL  SGD AAFYN   +G QDT  D KG H+F + +I+G+VDFIFG
Sbjct  188   APYPEVGTMGGQAVALRISGDKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQGSVDFIFG  247

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFS  856
              G++LY +  L+ I    +A +TAQ    +  ++G+SF    +TG G    LGR W   S
Sbjct  248   YGRSLYENCYLNSI-AKRVASLTAQKGSIKTMESGFSFVRSAITGSGL-VYLGRAWGDHS  305

Query  857   RVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEV  1036
             RVVF+Y  +   + PEGW+    +       Y+GEY+ +GPGA  T R ++ + + D+E 
Sbjct  306   RVVFSYTFMDKVVIPEGWNSWRIQQPETSGVYYGEYQCSGPGANWTGRVHWARLLTDEEA  365

Query  1037  KKFISFGFIEASKWLLPP  1090
             + F+   +I    WLL P
Sbjct  366   QPFLGTYYIYGDSWLLGP  383



>ref|XP_002962215.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
 gb|EFJ37475.1| hypothetical protein SELMODRAFT_165098 [Selaginella moellendorffii]
Length=359

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 185/318 (58%), Gaps = 9/318 (3%)
 Frame = +2

Query  149   STRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTER  328
             +TR  L     +     + + V ++G GDF T+++A++++P GN QRV I IGPG Y E+
Sbjct  41    ATRNLLQSFSTEGHLAARILVVDQSGNGDFVTVQDAVNAIPDGNDQRVTIRIGPGIYWEK  100

Query  329   LKIVREKPFISLHGDDKDRPSIIGCSTAAQ---DGTVMSA----TVIVEGDYFMASCINI  487
             + +   KPF++  G   DR  I+  STA+    DG  ++A    +V + G  F+A  I+ 
Sbjct  101   VVVPATKPFLTFQGAGIDRSLIVWNSTASDLGPDGQPLTAYRTASVTIVGANFIARDISF  160

Query  488   INSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDF  667
              N+AP P     G QA A   SGDMAAFYN   +G QDT CDD GRH+FK  +I+G++DF
Sbjct  161   QNTAPPPPPGVNGRQAAAFRISGDMAAFYNCGFYGAQDTLCDDVGRHYFKGCFIQGSIDF  220

Query  668   IFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWM  847
             IFGNG++LY   ELH I  D+   V AQ + ++ E+TG+SF +CKVTG G    LGR   
Sbjct  221   IFGNGRSLYEQCELHSI-ADSYGSVAAQDRQSQTENTGFSFVNCKVTGTGI-LYLGRAMG  278

Query  848   AFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKD  1027
              +SR+V++     + I   GW           T  FG+YK  GPGA  + R  + +++ D
Sbjct  279   PYSRIVYSNSYFDNIIDVRGWDDWDHDASRDRTVSFGQYKCYGPGATSSLRVPWARELSD  338

Query  1028  QEVKKFISFGFIEASKWL  1081
              EV  F+S  F++ ++WL
Sbjct  339   MEVTPFLSLSFVDGTQWL  356



>ref|XP_003632380.2| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
 emb|CAN79461.1| hypothetical protein VITISV_042494 [Vitis vinifera]
 emb|CBI36991.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   236 bits (602),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 130/318 (41%), Positives = 186/318 (58%), Gaps = 11/318 (3%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             K L+ +L+KAE     + V ++G  D+ TI +A+ ++P  NT+RVI+ I PG Y E++ +
Sbjct  68    KALDIKLSKAEMNKVTMTVSQDGTADYTTISDALHTIPLYNTRRVILVIKPGVYREKVTV  127

Query  338   VREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINS  496
              R  PF++  GD  D P+I G  TA+  G       T  SATV V+ +YF+A  I   N+
Sbjct  128   PRALPFVTFLGDASDPPTITGNDTASVIGRNGVPLKTFQSATVGVDANYFVAINIKFENT  187

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP   G   G QAVAL  SG  AAFYN   +G QDT  D  G H+F + +I+G+VDFIFG
Sbjct  188   APHVIGS-AGGQAVALRISGTKAAFYNCSFYGSQDTLYDHTGLHYFNNCFIQGSVDFIFG  246

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFS  856
              G++LY +  L+ +    +A +TAQ + T    +G+SF  C VTG G    LGR W  +S
Sbjct  247   YGRSLYENCSLNSV-AKKVASLTAQKRSTSSMASGFSFKDCVVTGSGT-VYLGRAWGDYS  304

Query  857   RVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEV  1036
             RVVF+Y  +   + P+GW    GK       Y+GEYK +GPGA LTAR  +   M D+E 
Sbjct  305   RVVFSYTFMDKLVLPQGWSDW-GKKKLDSRVYYGEYKCSGPGANLTARVPWAHMMTDEEA  363

Query  1037  KKFISFGFIEASKWLLPP  1090
             + F++  +++   WL+ P
Sbjct  364   EPFLATHYVDGDTWLISP  381



>ref|XP_009787978.1| PREDICTED: probable pectinesterase 53 isoform X1 [Nicotiana sylvestris]
Length=393

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 135/326 (41%), Positives = 191/326 (59%), Gaps = 16/326 (5%)
 Frame = +2

Query  140   QPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNY  319
             Q PS+  +L+P L  AE     I V + G G+FKTIKEA+ S+P  N +RVI+ I PG Y
Sbjct  75    QVPSS-SSLDPRLRNAELNKILISVNQEGIGNFKTIKEALASIPVYNKRRVILDIKPGVY  133

Query  320   TERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASC  478
              E++ I R  PF++  GD  D P I G  TAA  G       T  SATV V+ DYF+A  
Sbjct  134   REKINIPRSLPFVTFRGDSSDPPRITGNDTAAAAGTDGRPLKTFQSATVSVDADYFVA--  191

Query  479   INII--NSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIE  652
             IN+I  N+A    G   G QAVAL  SG+ AAFY+   +G QDT  D KG H+F + +++
Sbjct  192   INVIFENTAAHVVGS-VGEQAVALRISGNKAAFYDCSFYGSQDTLYDHKGLHYFNNCFVQ  250

Query  653   GTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALL  832
             G+VDFIFG G++LY +  L+ +    +A +TAQ +      +G+SF +  +TG G    L
Sbjct  251   GSVDFIFGYGRSLYENCHLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITGTGS-VYL  308

Query  833   GRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFV  1012
             GR W  +SRV+F+Y  + + + P GW    GKT      Y+GEY+ +GPGA +T R  + 
Sbjct  309   GRAWGDYSRVIFSYTYMDEIVLPLGWSDW-GKTSRDSRVYYGEYRCSGPGANMTGRVPWA  367

Query  1013  KKMKDQEVKKFISFGFIEASKWLLPP  1090
             + + D+E   FI   +I+ + WL+ P
Sbjct  368   RILTDEEAMPFIGTYYIDGNSWLIHP  393



>ref|XP_004229371.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=387

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/326 (39%), Positives = 188/326 (58%), Gaps = 11/326 (3%)
 Frame = +2

Query  134   NIQPPSTRKNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPG  313
             ++ PP    + +P+L  AE     I V ++G  +F TIKEA+ ++P  N +RVI+ I PG
Sbjct  65    HVPPPPVSSSFDPKLIYAEMNKMIITVSQDGSSNFNTIKEALATIPLYNKRRVILDIKPG  124

Query  314   NYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQD-------GTVMSATVIVEGDYFMA  472
              Y E++ I R  PF++  GD  + P I G  TA+          T  SATV V+ DYF+A
Sbjct  125   VYREKINIPRSSPFVTFRGDSSNPPRITGNDTASATRTGGTPLKTFQSATVSVDADYFIA  184

Query  473   SCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIE  652
               +   N+AP   G   G QAVAL  SG+ AAFYN   +G QDT  D KG H+F + +I+
Sbjct  185   INVIFENTAPHVVGT-AGEQAVALRISGNKAAFYNCSFYGSQDTLYDHKGLHYFNNCFIQ  243

Query  653   GTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALL  832
             G+VDFIFG G++LY + +L+ +    +A +TAQ +      +G+SF +  +TG G    L
Sbjct  244   GSVDFIFGYGRSLYENCQLNSV-AKKVASLTAQKRTNSSILSGFSFKNSTITGTGS-VYL  301

Query  833   GRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFV  1012
             GR W  +SRV+F+Y  + + + P GW+   GKT      Y+GEY+ +GPGA +T R  + 
Sbjct  302   GRAWGDYSRVIFSYTYMDNIVLPLGWNDW-GKTTRDSRVYYGEYRCSGPGANITGRVPWA  360

Query  1013  KKMKDQEVKKFISFGFIEASKWLLPP  1090
             + + D+E   FI   +++   WL+ P
Sbjct  361   RILNDEEAMPFIGTYYVDGDSWLIHP  386



>ref|XP_010267113.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=379

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/311 (43%), Positives = 182/311 (59%), Gaps = 14/311 (5%)
 Frame = +2

Query  179   AKAEAKPKHI-RVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK +  P +I  V KN   GDF +I++AIDS+P  N  RV+I +  G YTE++ I   K 
Sbjct  71    AKNKLFPSYILTVSKNPAAGDFTSIQDAIDSLPFINLVRVVIKVNAGVYTEKVNIPPLKS  130

Query  353   FISLHGDDKDRPSIIGCSTAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRP  508
             FI++ G   D+ +I+     AQ         GT  SAT  V   YF+A  I + N+ P P
Sbjct  131   FITIEGAGADK-TIVQWGDTAQTLGPRGQPIGTFNSATFAVNSAYFIAKNITLKNTNPLP  189

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  G QAVA   SGD AAF   R  G QDT  D  GRH++KD YIEG+VDFIFGNG +
Sbjct  190   PPGAVGKQAVAFRISGDTAAFLGCRFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLS  249

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
             L+    +H I   N   VTAQ + +  EDTG+SF +C+VTG G    LGR W  FSRVVF
Sbjct  250   LFEGCNVHAI-AQNYGAVTAQNRMSLLEDTGFSFVNCRVTGSG-ALYLGRAWGTFSRVVF  307

Query  869   AYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFI  1048
             AY  + D + P+GW+   G  +   T ++G+YK TGPGA    R ++ +++ D+E K FI
Sbjct  308   AYTYMDDIVIPKGWYNW-GDPNREMTVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFI  366

Query  1049  SFGFIEASKWL  1081
             +  FI+ S+W+
Sbjct  367   TLSFIDGSEWI  377



>ref|XP_007051206.1| Pectinesterase [Theobroma cacao]
 gb|EOX95363.1| Pectinesterase [Theobroma cacao]
Length=388

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 192/330 (58%), Gaps = 12/330 (4%)
 Frame = +2

Query  128   HSNIQPPSTR-KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISI  304
              S IQ P  + + L+ EL  AE     I V ++G GDF+TI EA+ S+P+ N++RVI+ I
Sbjct  62    ESLIQSPGAKGRVLDDELRMAEMNKVRINVGQDGSGDFRTINEALSSIPSRNSRRVILVI  121

Query  305   GPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAA---QDG----TVMSATVIVEGDY  463
              PG Y E++ I R  PFI+  GD  + P+I G  TA+   +DG    T  SATV V+ +Y
Sbjct  122   KPGIYREKVVIPRTLPFITFLGDASNPPTITGNDTASGPGKDGMPLKTFQSATVAVDANY  181

Query  464   FMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDS  643
             F+A  +   N+ P   G R G QAVAL  SG  AAFYN   +G QDT  D KG H+  + 
Sbjct  182   FVAINMKFENTVPHQIGSR-GGQAVALRISGTKAAFYNCSFYGDQDTLYDHKGLHYLNNC  240

Query  644   YIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEG  823
             +I+G+VDFIFG G++LY +  ++ I    +A +TAQ +      +G+SF  C VTG   G
Sbjct  241   FIQGSVDFIFGYGRSLYENCTVNSIS-KKVASLTAQKRSNASLASGFSFKDCVVTGSSPG  299

Query  824   AL-LGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTAR  1000
              + LGR W  +SRVVF+Y  +   + P+GW    G      + Y+GEYK +GPGA  T R
Sbjct  300   MVYLGRAWGDYSRVVFSYTFMDRVVLPQGWSDW-GDRKRDASVYYGEYKCSGPGANFTGR  358

Query  1001  PNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
               + + + ++E + FI   ++E   WL+ P
Sbjct  359   VPWARILTEEEAEPFIGTYYVEGDTWLISP  388



>ref|XP_003579301.1| PREDICTED: putative pectinesterase 63 [Brachypodium distachyon]
Length=412

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/324 (42%), Positives = 186/324 (57%), Gaps = 14/324 (4%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             K L+ +L+ AEA      V  NGKG F+TI EAI ++P  N QRVI+ I PG Y E+  I
Sbjct  92    KLLDADLSAAEAAKVRYVVSPNGKGKFRTISEAIKAIPEKNKQRVILDIQPGTYKEKFLI  151

Query  338   VREKPFISLHGDDKDRPSIIGCSTA-------AQDGTVMSATVIVEGDYFMASCINIINS  496
                KPF++  G+ ++ P I    TA       A  GT+ SATV +E DYFMAS I   N 
Sbjct  152   PTTKPFVTFLGNPRNPPVITWDDTAGTRGKDGAPIGTLGSATVAIESDYFMASGIVFKNH  211

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP      KG QAVAL   G  AAFYN    G QDT  D+KG H+FK+  ++G+VDFIFG
Sbjct  212   APLAPPGAKGGQAVALRVFGTKAAFYNCTFDGGQDTLYDNKGLHYFKNCVVKGSVDFIFG  271

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQHTRE----EDTGYSFAHCKVTGVGEGALLGRGW  844
              G++LYVD  +  +    +AV+TAQ Q +R      ++G+SF  CK+ G+G+   LGR W
Sbjct  272   FGRSLYVDCTMVSVT-SQVAVLTAQ-QRSRSIAEATESGFSFVRCKIMGMGQ-IYLGRAW  328

Query  845   MAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMK  1024
                SRVV+++ ++   + P GW G   +       Y+GEYK +GPGA  T R  + + + 
Sbjct  329   GDSSRVVYSFTDMGKEVIPVGWDGWNVEKPERTGVYYGEYKCSGPGAMSTQRIGWARVLD  388

Query  1025  DQEVKKFISFGFIEASKWLLPPAK  1096
             D + + F    F+  + W+LPP K
Sbjct  389   DTQARPFTGSHFVYGNSWILPPPK  412



>emb|CBI27989.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 181/312 (58%), Gaps = 16/312 (5%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK +  P + I V KN   GDF++I++AIDS+P+ N  RV+I +  G YTE++ I   K 
Sbjct  5     AKNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKS  64

Query  353   FISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAPRPD  511
             FI++ G   D+  +    TA   G       T  SAT  V   YF+A  I   N+ P P 
Sbjct  65    FITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPA  124

Query  512   GKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTL  691
                 G QAVA   SGD AAF   +  G QDT  D  GRH++KD YIEG+VDFIFGN  +L
Sbjct  125   PGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSL  184

Query  692   YVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFA  871
             +    +H I   N   +TAQ + +  EDTG+SF +CKVTG G    LGR W  FSRVVFA
Sbjct  185   FEGCHVHAI-AQNTGALTAQGRSSLLEDTGFSFVNCKVTGSG-ALFLGRAWGPFSRVVFA  242

Query  872   YCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKF  1045
             Y  + D I P+GW+  G P +     T ++G+YK TGPGA    R ++ +++ DQE K F
Sbjct  243   YTYMDDIIIPKGWYNWGDPSREM---TVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPF  299

Query  1046  ISFGFIEASKWL  1081
             IS  +I+ S+W+
Sbjct  300   ISLSYIDGSEWI  311



>gb|KEH25488.1| pectinesterase [Medicago truncatula]
Length=338

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 127/317 (40%), Positives = 188/317 (59%), Gaps = 12/317 (4%)
 Frame = +2

Query  164   LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVR  343
             L+ +L +AEA P  I+V K+    FKTI+EA++S+P  N +RVI+SI  G Y E  KI+ 
Sbjct  27    LDFKLRQAEANPVIIKVSKDASSKFKTIQEALNSIPPQNNRRVIVSIAAGVYRE--KILV  84

Query  344   EKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAP  502
             + PFI+  GD  D+P +IG  TA   G       T+ SATV V+ DYF+A  +   N+A 
Sbjct  85    KLPFITFLGDPTDQPIVIGNDTAHDIGGDGKPLRTLNSATVAVDSDYFIAVNMKFQNTAS  144

Query  503   RPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNG  682
              P       QAVAL  SG+ +AFYN   +GFQDT  D +G H+F++ +I+G+VDFIFG+G
Sbjct  145   -PRIGSNDDQAVALRTSGNKSAFYNCSFYGFQDTLYDHQGLHYFENCFIQGSVDFIFGHG  203

Query  683   KTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRV  862
             ++LY    +  I  + M  +TAQ +     ++G+S  +    G G+   LGR W  +SRV
Sbjct  204   RSLYEGCIIKSI-AEKMGFITAQDRSKESMESGFSIQNSHAIGSGK-VYLGRPWGVYSRV  261

Query  863   VFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKK  1042
             +++Y  + + I P+GW       +   T Y+GEYK TG G+ L  RP +V ++ D E ++
Sbjct  262   IYSYTSMDNLIFPQGWDDTMDNQNRSLTVYYGEYKCTGLGSNLAGRPPWVHRLTDTEARQ  321

Query  1043  FISFGFIEASKWLLPPA  1093
             FI   FI+   WL+ P+
Sbjct  322   FIGTQFIQGDTWLVRPS  338



>ref|XP_002531506.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF30860.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=367

 Score =   233 bits (595),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 136/311 (44%), Positives = 182/311 (59%), Gaps = 12/311 (4%)
 Frame = +2

Query  179   AKAEAKP-KHIRVCKNGK-GDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK + KP   I+V K  K GDF T+K+A++S+P  N  RVIISIG G Y E+++I     
Sbjct  58    AKNKFKPCLTIKVNKKSKSGDFVTLKKALNSIPVINNCRVIISIGAGTYREKIEIPGSMS  117

Query  353   FISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAPRPD  511
             +I+L G    + +I    TA + G       T  SAT  +   YF+A  I   N AP P 
Sbjct  118   YITLEGAGAGKTTIEWDDTADKQGQGGHLLGTYGSATFAINSPYFIAKNITFKNKAPSPP  177

Query  512   GKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTL  691
                 G QAVAL  S D AAF   +  G QDT  D  GRH+FK+ YIEG+VDFIFGNG +L
Sbjct  178   SGALGKQAVALRISADTAAFIGCKFIGAQDTLYDHIGRHYFKECYIEGSVDFIFGNGLSL  237

Query  692   YVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFA  871
             Y D  LH I  ++   +TAQ + +  E+TG+SF +CKVTG G    LGR W  FSRVVFA
Sbjct  238   YDDCHLHAIT-NSFGALTAQKRESMLEETGFSFVNCKVTGSG-ALYLGRAWGTFSRVVFA  295

Query  872   YCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFIS  1051
             Y  +   I P GW+   G  +   T ++G+YK +GPGA+   R ++ +++ +QE K F+S
Sbjct  296   YTYMDKIITPTGWYDW-GDKNREMTVFYGQYKCSGPGAQFGGRVSWSRELTEQEAKPFVS  354

Query  1052  FGFIEASKWLL  1084
               FI+   WLL
Sbjct  355   IDFIDGQDWLL  365



>ref|XP_010093131.1| putative pectinesterase 8 [Morus notabilis]
 gb|EXB53583.1| putative pectinesterase 8 [Morus notabilis]
Length=405

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 133/322 (41%), Positives = 187/322 (58%), Gaps = 13/322 (4%)
 Frame = +2

Query  161   NLNPELAKAEAKPKHIR-VCKNGKGDFKTIKEAIDSVPTG--NTQRVIISIGPGNYTERL  331
             +  P+    +A    I  V +NG  +F T++ AID+VPT   + +R II I  G Y E++
Sbjct  85    DFQPQFPSVDANTTSILCVDRNGCCNFTTVQGAIDAVPTTPPSQKRTIIWINSGLYYEKV  144

Query  332   KIVREKPFISLHGDDKDRPSIIGCSTA-AQDGTVMSATVIVEGDYFMASCINIINSAPRP  508
              I R KP I+  G      +I+   TA +  GT  S +V V  D F+A  I+ +N AP P
Sbjct  145   TIPRTKPNITFQGQGYTSTAIVWNDTANSSRGTFFSGSVQVFSDNFIAQNISFMNVAPIP  204

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  GAQ VA+  SGD AAF+     G QDT  DDKGRH+FKD YI+G++DFIFGN ++
Sbjct  205   KPGDVGAQGVAMRVSGDQAAFWGCGFFGAQDTLHDDKGRHYFKDCYIQGSIDFIFGNARS  264

Query  689   LYVDTEL-----HVIEGDNM--AVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWM  847
             LY D  L      V EG       VTA  + +++E+TG++F +C + G G    LGR W 
Sbjct  265   LYEDCVLISMANPVAEGSKFIDGCVTAHGRTSKDENTGFAFVNCTIGGTGR-VWLGRAWR  323

Query  848   AFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKD  1027
              FSRVVFA+  +SD I PEGW+     T    T ++GEY  +GPGA ++ R  +++++ D
Sbjct  324   PFSRVVFAHTTMSDIIAPEGWNDFNDPTR-DQTIFYGEYDCSGPGANMSMRAPYIQRLND  382

Query  1028  QEVKKFISFGFIEASKWLLPPA  1093
              E   FI+  FI+A++WLLP A
Sbjct  383   TEASVFINASFIDANQWLLPHA  404



>ref|XP_010316821.1| PREDICTED: probable pectinesterase 53 [Solanum lycopersicum]
Length=362

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 138/345 (40%), Positives = 199/345 (58%), Gaps = 16/345 (5%)
 Frame = +2

Query  77    DDSIPIPANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGK-GDFKTIK  250
             D+++ +   + +  +W H      S+R +   + AK + +P K I+V KN K GDF T++
Sbjct  23    DNTLKVANEEKDYLNWIHRM----SSRNHSVFQEAKNKLEPCKFIKVNKNPKFGDFTTVQ  78

Query  251   EAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDG--  424
             +AIDS+P  N+ RV+IS+ PG Y E+++I     +I+L G    + +I    TA + G  
Sbjct  79    KAIDSIPIVNSCRVVISVSPGTYREKIEIPATMAYITLEGAASHKTTIKWDDTADRTGKS  138

Query  425   -----TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLH  589
                  T  SAT  V   YF+A  I   N AP P     G QAVAL  S D AAF N +  
Sbjct  139   GQPMGTYGSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTAAFINCKFI  198

Query  590   GFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTRE  769
             G QDT  D +GRH+FK+ YI+G+VDFIFG+G +LY +  L   +  +   +TAQ + +  
Sbjct  199   GAQDTLYDHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLRA-KTKSYGALTAQKRESLL  257

Query  770   EDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTT  949
             E+TG+SF +CKVTG G    LGR W  FSRVVFAY  +   I  +GW+    K  +  T 
Sbjct  258   EETGFSFLNCKVTGSG-ALYLGRAWGTFSRVVFAYTYMDKIITSKGWYDWGDKNRH-MTV  315

Query  950   YFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             +FG++K +GPGA    R  + +++ +QE K FIS  FI+  +WLL
Sbjct  316   FFGQFKCSGPGADHGERVKWSRELTEQEAKPFISLSFIDGHEWLL  360



>ref|NP_001067039.1| Os12g0563700 [Oryza sativa Japonica Group]
 gb|ABA98964.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30058.1| Os12g0563700 [Oryza sativa Japonica Group]
 dbj|BAG91682.1| unnamed protein product [Oryza sativa Japonica Group]
Length=414

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 139/325 (43%), Positives = 183/325 (56%), Gaps = 16/325 (5%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             K L+ EL+ AEA      V  +GKG F+TI EAI +VP  N +RVI+ I PG Y E+L I
Sbjct  92    KALDAELSAAEAGAARYVVSGDGKGKFRTITEAIKAVPEYNKKRVILDIRPGTYKEKLLI  151

Query  338   VREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINS  496
                KPFI+  G+ +  P+I+    AA  G       T++SATV VE DYFMAS I   N+
Sbjct  152   PFTKPFITFVGNPRSPPTIMWDDRAATHGKDGQPMGTMLSATVAVEADYFMASSIIFKNN  211

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP       G QAVAL   G   A YN  + G QDT  D KG H+FK+  I G+VDFIFG
Sbjct  212   APMAAPGAHGGQAVALRVFGSKVAMYNCTIDGGQDTLYDHKGLHYFKNCLIRGSVDFIFG  271

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQH---TREEDTGYSFAHCKVTGVGEGALLGRGWM  847
              G++LY D  +  +  + +AVVTAQ +        DTG+SF  CK++G+G+   LGR W 
Sbjct  272   FGRSLYADCTIESVTKE-VAVVTAQQRSKNIAEAIDTGFSFLRCKISGIGQ-IYLGRAWG  329

Query  848   AFSRVVFAYCEISDAIKPEGWHG--VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKM  1021
               SRVV++Y  +   + P GW G  V    H G   Y+GEYK +GPGA  + R  +   +
Sbjct  330   DSSRVVYSYTTMGKEVVPIGWDGWEVQKPEHSG--IYYGEYKCSGPGALPSKRIGWSLVL  387

Query  1022  KDQEVKKFISFGFIEASKWLLPPAK  1096
              D + K F    F+    W+LPP K
Sbjct  388   SDIQAKPFTGSHFVYGDSWILPPPK  412



>emb|CAN63186.1| hypothetical protein VITISV_037092 [Vitis vinifera]
Length=379

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 181/312 (58%), Gaps = 16/312 (5%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK +  P + I V KN   GDF++I++AIDS+P+ N  RV+I +  G YTE++ I   K 
Sbjct  71    AKNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPXFKS  130

Query  353   FISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAPRPD  511
             FI++ G   D+  +    TA   G       T  SAT  V   YF+A  I   N+ P P 
Sbjct  131   FITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPA  190

Query  512   GKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTL  691
                 G QAVA   SGD AAF   +  G QDT  D  GRH++KD YIEG+VDFIFGN  +L
Sbjct  191   PGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSL  250

Query  692   YVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFA  871
             +    +H I   N   +TAQ + +  EDTG+SF +CKVTG G    LGR W  FSRVVFA
Sbjct  251   FEGCHVHAI-AQNTGALTAQGRSSLLEDTGFSFVNCKVTGSG-ALFLGRAWGPFSRVVFA  308

Query  872   YCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKF  1045
             Y  + D I P+GW+  G P +     T ++G+YK TGPGA    R ++ +++ DQE K F
Sbjct  309   YTYMDDIIIPKGWYNWGDPSREM---TVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPF  365

Query  1046  ISFGFIEASKWL  1081
             IS  +I+ S+W+
Sbjct  366   ISLSYIDGSEWI  377



>ref|XP_009599854.1| PREDICTED: probable pectinesterase 53 [Nicotiana tomentosiformis]
Length=372

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/338 (41%), Positives = 198/338 (59%), Gaps = 16/338 (5%)
 Frame = +2

Query  98    ANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGK-GDFKTIKEAIDSVP  271
             AN+D   +W    I   S+R +   + AK + +P K I+V KN K GDF T+++AIDS+P
Sbjct  40    ANEDGFLNW----INLMSSRNHSVFQEAKNKFEPCKFIKVNKNPKHGDFTTVQKAIDSIP  95

Query  272   TGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTA---AQDGTVM---  433
               N+ RV+IS+ PG Y E+++I     +I+L G    + +I    TA    +DG  M   
Sbjct  96    IVNSCRVVISVSPGIYREKIEIPATMAYITLEGAGSRKTTIKWDDTADRLGKDGQPMGTY  155

Query  434   -SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SAT  V   YF+A  I   N AP P     G QAVAL  S D AAF N +  G QDT  
Sbjct  156   GSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTAAFINCKFIGAQDTLY  215

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             D +GRH+FK+ YI+G+VDFIFG+G +LY +  LH  +  +   +TAQ + +  E+TG+SF
Sbjct  216   DHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLHA-KTKSYGALTAQKRESMLEETGFSF  274

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
              +CKVTG G    LGR W  FSRVVFAY  +   I  +GW+    K  +  T ++G++K 
Sbjct  275   VNCKVTGSG-ALYLGRAWGTFSRVVFAYTYMDKIITSKGWYDWGDKNRH-MTVFYGQFKC  332

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             +GPGA    R  + +++ +QE K F+S  FI+  +WLL
Sbjct  333   SGPGANHGGRVKWSRELTEQEAKPFVSLSFIDGHEWLL  370



>emb|CDY31785.1| BnaC01g27410D [Brassica napus]
Length=264

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/308 (41%), Positives = 177/308 (57%), Gaps = 61/308 (20%)
 Frame = +2

Query  101   NKDEVNSWFHSNIQPPSTRKN-LNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTG  277
             NK+ +  WF++N+   ++RK+ L+P L  AEA P   RV +NG+GDFKT+ EAI+SVP G
Sbjct  14    NKNRIEQWFNNNVPSLASRKDTLDPALLTAEATP---RVRQNGRGDFKTLTEAINSVPVG  70

Query  278   NTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTAAQDGTVMSATVIVEG  457
             N +RVII +G                   HG+ K R  ++ C                  
Sbjct  71    NKERVIIKLG-------------------HGEYKRRI-LLQCRM----------------  94

Query  458   DYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFK  637
                               GK K  QA+++  SG+ AAFYN + +G+QDT CDD G HFFK
Sbjct  95    ------------------GKGK-EQALSMRISGNKAAFYNCKFYGYQDTICDDTGNHFFK  135

Query  638   DSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVG  817
             D YIEGT DFIFG+G++LY+ T+L+V+ GD + V+TA A  + EE +GYSF HCKVTG G
Sbjct  136   DCYIEGTFDFIFGSGRSLYLSTQLNVV-GDGLRVITAHAGKSTEEKSGYSFVHCKVTGTG  194

Query  818   EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTA  997
              G  LGR WM+  +VV+AY ++S  + P GWH    +T    T ++GEYK +GPG++   
Sbjct  195   TGIYLGRAWMSHPKVVYAYTDMSSVVNPSGWH-EKTQTERDKTVFYGEYKGSGPGSRKEK  253

Query  998   RPNFVKKM  1021
             R  + + +
Sbjct  254   RVKYTQDI  261



>ref|XP_009406173.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/293 (43%), Positives = 170/293 (58%), Gaps = 14/293 (5%)
 Frame = +2

Query  230   GDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCST  409
             GDF TI+EA+DS+P  N  RV+I +  G YTE++ +   + FI++ G   D+  +    T
Sbjct  88    GDFTTIQEAVDSLPLINLVRVVIKVNAGTYTEKVNVSPMRAFITIQGAGADKTVVQWGDT  147

Query  410   AAQ-------DGTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAA  568
             A          GT  SAT  V   YF+A  I   N+ P P     G QAV+L  SGD AA
Sbjct  148   AETLGPKKQPIGTFNSATFAVNAPYFIARNITFKNTTPVPPPGAMGKQAVSLRISGDTAA  207

Query  569   FYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTA  748
             F   +  G QDT  D  GRH++KD YIEG+VDFIFGN  +LY    +H I   N   +TA
Sbjct  208   FVGCKFLGAQDTLYDHVGRHYYKDCYIEGSVDFIFGNALSLYEGCHVHAI-AQNYGALTA  266

Query  749   QAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH--GVP  922
             Q + +  EDTG+SF +CKVTG G    LGR W  FSRV+FAY  + D I P GW+  G P
Sbjct  267   QNRMSLLEDTGFSFVNCKVTGSG-ALYLGRAWGTFSRVIFAYTYMDDIILPRGWYNWGDP  325

Query  923   GKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
              +     T ++G+YK TGPGA    R ++ +++ D+E K FIS  FI+ S+W+
Sbjct  326   NREM---TVFYGQYKCTGPGASYAGRVSWSRELTDEEAKPFISMSFIDGSEWI  375



>ref|XP_006387630.1| hypothetical protein POPTR_0746s00200g, partial [Populus trichocarpa]
 gb|ERP46544.1| hypothetical protein POPTR_0746s00200g, partial [Populus trichocarpa]
Length=296

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 126/300 (42%), Positives = 179/300 (60%), Gaps = 11/300 (4%)
 Frame = +2

Query  212   VCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPS  391
             V ++G G+FKTIKEAI+S+P  NT+RVII+I PG Y E++ I R  PF++  GD  + P+
Sbjct  1     VSQDGNGEFKTIKEAINSIPPYNTRRVIIAIKPGVYREKIFIPRTFPFVTFLGDSSEPPT  60

Query  392   IIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQ  550
             I G  TA+  G       T  SATV V+ +YF+A  +   N+AP   G ++  QAVAL  
Sbjct  61    ITGNDTASVSGKDGKPLRTYQSATVAVDANYFVAISMKFENTAPHVIGTKQ-EQAVALRI  119

Query  551   SGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDN  730
             SG  AAFYN    G QDT  D KG H+F + +I+G+VDFIFG+G++ Y +  L+ +    
Sbjct  120   SGTKAAFYNCSFFGDQDTLYDHKGLHYFNNCFIQGSVDFIFGSGRSFYENCHLNSV-AKK  178

Query  731   MAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGW  910
             +A +TAQ +      +G+SF    +TG G    LGR W  +SRV+F+Y  +   I P+GW
Sbjct  179   VASLTAQKRSNSSLASGFSFKDSTITGSGL-IYLGRAWGDYSRVIFSYTFMDKIILPQGW  237

Query  911   HGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLPP  1090
             +   G        Y+GEYK TGPGA LT R  + + + D+E + FI   ++E   WL+ P
Sbjct  238   NDW-GDQRRDSRVYYGEYKCTGPGANLTGRVAWARVLTDEEARPFIGTYYVEGDTWLISP  296



>ref|XP_010656255.1| PREDICTED: probable pectinesterase 53 [Vitis vinifera]
Length=379

 Score =   233 bits (593),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 181/312 (58%), Gaps = 16/312 (5%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK +  P + I V KN   GDF++I++AIDS+P+ N  RV+I +  G YTE++ I   K 
Sbjct  71    AKNKLFPSYAITVNKNSAAGDFRSIQDAIDSLPSINLVRVVIKVHAGVYTEKVNIPAFKS  130

Query  353   FISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINSAPRPD  511
             FI++ G   D+  +    TA   G       T  SAT  V   YF+A  I   N+ P P 
Sbjct  131   FITIEGAGADKTVVQWGDTARTIGEKGQPIGTFNSATFAVNSLYFIAKNITFKNTTPVPA  190

Query  512   GKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTL  691
                 G QAVA   SGD AAF   +  G QDT  D  GRH++KD YIEG+VDFIFGN  +L
Sbjct  191   PGAVGKQAVAFRISGDTAAFLGCKFLGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNALSL  250

Query  692   YVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFA  871
             +    +H I   N   +TAQ + +  EDTG+SF +CKVTG G    LGR W  FSRVVFA
Sbjct  251   FEGCHVHAI-AQNTGALTAQGRSSLLEDTGFSFVNCKVTGSG-ALFLGRAWGPFSRVVFA  308

Query  872   YCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKF  1045
             Y  + D I P+GW+  G P +     T ++G+YK TGPGA    R ++ +++ DQE K F
Sbjct  309   YTYMDDIIIPKGWYNWGDPSREM---TVFYGQYKCTGPGAAFAGRVSWSRELTDQEAKPF  365

Query  1046  ISFGFIEASKWL  1081
             IS  +I+ S+W+
Sbjct  366   ISLSYIDGSEWI  377



>ref|XP_009414379.1| PREDICTED: probable pectinesterase 53 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 123/318 (39%), Positives = 188/318 (59%), Gaps = 9/318 (3%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             + ++ +L+KAEA      V ++G G++++I+EAI ++P  NT+RVI+ I PG Y E++ I
Sbjct  70    RAIDLKLSKAEAAAVRYIVSQDGTGNYRSIREAIGTIPLHNTRRVILEIRPGIYREKIVI  129

Query  338   VREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINS  496
              +  PFI+L GD    P I G  TAA+ G       T  S TV V  ++F+A+ I   N+
Sbjct  130   PKSMPFITLLGDPASPPIISGNDTAAKMGDNGRALKTFRSPTVAVNSNFFLAAYIQFENT  189

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP PD  ++G QAVA+  SGD AAFYN   +G QDT  D KG H+FK+ +I+G+VDFIFG
Sbjct  190   APVPDVGQRGGQAVAVRVSGDKAAFYNCSFYGEQDTLYDHKGLHYFKNCFIQGSVDFIFG  249

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFS  856
              G++LY +  L+ +    +A +TAQ ++    ++G+SF    +TG G    LGR W   S
Sbjct  250   YGRSLYENCYLNSV-AKKVAALTAQKRNMASMESGFSFVRSTITGSGL-VYLGRAWGDHS  307

Query  857   RVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEV  1036
             RVVF+Y  +   + P+GW+            Y+GE++  GPGA  T R ++ + +  +E 
Sbjct  308   RVVFSYTFMDKVVIPQGWNSWRIHRPEASGVYYGEFQCGGPGANWTGRVHWARLLTHEEA  367

Query  1037  KKFISFGFIEASKWLLPP  1090
             + F+   ++    WLL P
Sbjct  368   QPFLGTYYVNGDSWLLGP  385



>ref|XP_008244291.1| PREDICTED: putative pectinesterase 63 [Prunus mume]
Length=239

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/224 (51%), Positives = 150/224 (67%), Gaps = 7/224 (3%)
 Frame = +2

Query  428   VMSATV--IVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQD  601
             +M A +   VE DYF A+ I + NSAP PDG R GAQAVAL  SGD AAFYN +  GFQD
Sbjct  8     IMHANIRLTVESDYFRAAYIIVTNSAPEPDGIRSGAQAVALQISGDKAAFYNCKFIGFQD  67

Query  602   TFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTG  781
             T  D KG HFFKD YI+GTVDFIFG GK+LY++T++HV+E  N+ VVTAQ Q    ED G
Sbjct  68    TLYDYKGLHFFKDCYIQGTVDFIFGKGKSLYLNTKIHVLE-QNITVVTAQ-QRDASEDNG  125

Query  782   YSFAHCKVTGVG--EGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYF  955
             +SF HCK+TG     G  LGR W +   VVFAY ++++ + PE W+   G        ++
Sbjct  126   FSFVHCKITGTTCVRGTYLGRAWGSSPIVVFAYTDMANVVHPERWNDF-GHPERSNNMFY  184

Query  956   GEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLLP  1087
             GE++N+G G+ ++ +  + KK+ D E K F+S G+I+ SKWLLP
Sbjct  185   GEFQNSGQGSNISGQARYTKKLSDAEAKSFLSLGYIQGSKWLLP  228



>ref|NP_001044216.1| Os01g0743200 [Oryza sativa Japonica Group]
 dbj|BAB91933.1| pectin methyl esterase-like [Oryza sativa Japonica Group]
 dbj|BAF06130.1| Os01g0743200 [Oryza sativa Japonica Group]
 gb|EAY75779.1| hypothetical protein OsI_03695 [Oryza sativa Indica Group]
 gb|EAZ13496.1| hypothetical protein OsJ_03413 [Oryza sativa Japonica Group]
 dbj|BAG93545.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97491.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 181/313 (58%), Gaps = 17/313 (5%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             A A A P + + V KN   GDF TI+ A+DS+P  N  RV+I +  G YTE++ I   + 
Sbjct  75    ALARAFPSYSLVVDKNPAFGDFTTIQAAVDSLPIINLVRVVIKVNAGTYTEKVNISPMRA  134

Query  353   FISLHGDDKDRPSIIGCSTAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRP  508
             FI+L G   D+  +    TA           GT  SA+  V   YF+A  I   N++P P
Sbjct  135   FITLEGAGADKTIVQWGDTADSPSGRAGRPLGTYSSASFAVNAQYFLARNITFKNTSPVP  194

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  G QAVAL  S D AAF   R  G QDT  D  GRH++K+ YIEG+VDFIFGN  +
Sbjct  195   KPGASGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKECYIEGSVDFIFGNALS  254

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
             L+ D  +H I  D  A +TAQ + +  EDTG+SF +C+VTG G    LGR W  FSRVVF
Sbjct  255   LFEDCHVHAIARDYGA-LTAQNRQSMLEDTGFSFVNCRVTGSG-ALYLGRAWGTFSRVVF  312

Query  869   AYCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKK  1042
             AY  + D I P GW+  G P +     T ++G+YK TGPGA  + R ++ +++ D+E K 
Sbjct  313   AYTYMDDIIIPRGWYNWGDPNREL---TVFYGQYKCTGPGASFSGRVSWSRELTDEEAKP  369

Query  1043  FISFGFIEASKWL  1081
             FIS  FI+ ++W+
Sbjct  370   FISLTFIDGTEWV  382



>ref|XP_011025911.1| PREDICTED: probable pectinesterase 53 [Populus euphratica]
Length=360

 Score =   231 bits (588),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 179/310 (58%), Gaps = 11/310 (4%)
 Frame = +2

Query  179   AKAEAKP-KHIRVCKNGK-GDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK + KP   I V K  + G F T+++AI+S+P  N  RV+I+IG G Y E+++I     
Sbjct  52    AKNKFKPCLTIEVSKKPRSGAFPTVQKAINSLPVINNCRVVITIGAGTYREKVEIPATMA  111

Query  353   FISLHGDDKDRPSIIGCSTAAQD------GTVMSATVIVEGDYFMASCINIINSAPRPDG  514
             +I+L G   DR  I    TA +       GT  SAT  V   YF+A  I   N AP P  
Sbjct  112   YITLQGAGADRTIIEWDDTADRMENGRPLGTFGSATFAVNSPYFIAKDITFKNKAPLPPS  171

Query  515   KRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLY  694
                G QAVAL  S D AAF + +  G QDT  D  GRH+FK  YIEG+VDFIFGNG +LY
Sbjct  172   GALGKQAVALRISADTAAFISCKFIGAQDTLYDHIGRHYFKKCYIEGSVDFIFGNGLSLY  231

Query  695   VDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAY  874
              D  LH +  ++   +TAQ + +  E+TG+SF  CKVTG G    LGR W  FSRVVFAY
Sbjct  232   EDCHLHAVT-NSFGALTAQKRQSFLEETGFSFVSCKVTGSG-ALFLGRAWGNFSRVVFAY  289

Query  875   CEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISF  1054
               +   I P GW+    K+    T +FG+YK +GPGA    R  + +++ DQ+ K FIS 
Sbjct  290   TFMDKIITPRGWYDWGDKSRQ-MTVFFGQYKCSGPGADFGRRVAWSRELTDQQAKPFISI  348

Query  1055  GFIEASKWLL  1084
             GFI+  +WLL
Sbjct  349   GFIDGHEWLL  358



>ref|XP_010249481.1| PREDICTED: probable pectinesterase 53 [Nelumbo nucifera]
Length=378

 Score =   231 bits (588),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 181/311 (58%), Gaps = 14/311 (5%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK +  P + + V KN   GDF +I++AIDS+P+ N  RV+I +  G YTE++ I   K 
Sbjct  70    AKNKLFPSYTLTVHKNPAAGDFTSIQDAIDSLPSVNLVRVVIKVNAGVYTEKVNIPPLKS  129

Query  353   FISLHGDDKDRPSIIGCSTAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRP  508
             FI++ G   D+ +I+     AQ         GT  SAT  V   YF+A  I   N+ P P
Sbjct  130   FITIEGAGADK-TIVQWGDTAQTPGPNGRPIGTFNSATFAVNSPYFIAKNITFKNTTPLP  188

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  G QAVA   SGD AAF+  +  G QDT  D  GRH++KD YIEG+VDFIFGNG +
Sbjct  189   PPGAIGKQAVAFRISGDTAAFWGCKFFGAQDTLYDHLGRHYYKDCYIEGSVDFIFGNGLS  248

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
             L+    +H I       VTAQ++ +  EDTG+SF +C+VTG G    LGR W  FSRVVF
Sbjct  249   LFEGCNVHAI-AQKYGAVTAQSRMSLLEDTGFSFVNCRVTGSG-ALYLGRAWGTFSRVVF  306

Query  869   AYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFI  1048
             AY  + + I P+GW+   G  +   T ++G+YK TGPGA    R ++ +++ D E K F 
Sbjct  307   AYTYMDNIIIPKGWYNW-GDPNRQMTVFYGQYKCTGPGASFAGRVSWSRELTDAEAKPFT  365

Query  1049  SFGFIEASKWL  1081
             S  FI+ S+W+
Sbjct  366   SLTFIDGSEWI  376



>ref|XP_011093645.1| PREDICTED: probable pectinesterase 53 isoform X2 [Sesamum indicum]
Length=386

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 184/313 (59%), Gaps = 18/313 (6%)
 Frame = +2

Query  179   AKAEAKPKH-IRVCKN-GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             AK    P + + V KN   GDF +I++A+DS+P  N  RV+I++  G YTE+++I + K 
Sbjct  78    AKNRVFPSYTLTVDKNPALGDFTSIQQALDSLPPLNLLRVVINVHAGVYTEKVRIPKLKS  137

Query  353   FISLHGDDKDRPSIIGCSTAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRP  508
             FI++ G   +  +I+     AQ         GT  SAT  V+  YF+A  I   N+ P P
Sbjct  138   FITIEGGGAES-TIVEWGDTAQTPGPKGRPLGTFASATFAVDAPYFIAKNITFKNTTPVP  196

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  G QAVA   SGD AAF   +  G QDT  D  GRH++KD YIEG+VDFIFGNG +
Sbjct  197   RAGETGTQAVAFRISGDTAAFVGCKFLGAQDTLYDHSGRHYYKDCYIEGSVDFIFGNGLS  256

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
             L+ + E+H +     A VTAQ + +  +DTG+SF +CKVTG G    LGR W  FSRVVF
Sbjct  257   LFEECEVHAVAAVTGA-VTAQGRSSMLDDTGFSFVNCKVTGSG-ALYLGRAWGPFSRVVF  314

Query  869   AYCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKK  1042
             AY  + + I P+GWH  G P +     T ++G+YK  G GA    R ++ +++ D+E K 
Sbjct  315   AYTYMDNIIIPKGWHDWGDPSRQL---TVFYGQYKCRGAGASFAGRVSWSRELSDEEAKP  371

Query  1043  FISFGFIEASKWL  1081
             FIS  FI+ S+W+
Sbjct  372   FISLSFIDGSEWI  384



>ref|XP_009802490.1| PREDICTED: probable pectinesterase 53 [Nicotiana sylvestris]
Length=372

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 138/338 (41%), Positives = 196/338 (58%), Gaps = 16/338 (5%)
 Frame = +2

Query  98    ANKDEVNSWFHSNIQPPSTRKNLNPELAKAEAKP-KHIRVCKNGK-GDFKTIKEAIDSVP  271
             AN+D   +W    I   S+R +     AK + +P K I+V KN K GDF T++EAIDS+P
Sbjct  40    ANEDGFLNW----INRISSRNHSVFHEAKNKFEPCKFIKVNKNPKHGDFTTVQEAIDSIP  95

Query  272   TGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCSTA---AQDGTVM---  433
               N+ RV+IS+ PG Y E+++I     +I+L G    + +I    TA    +DG  M   
Sbjct  96    IANSCRVVISVSPGIYREKIEIPATMAYITLEGASSRKTTIKWDDTADRVGKDGQPMGTY  155

Query  434   -SATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFC  610
              SAT  V   YF+A  I   N AP P     G QAVAL  S D AAF N +  G QDT  
Sbjct  156   GSATFAVNSPYFIAKNITFKNVAPPPPSGALGKQAVALRISADTAAFINCKFIGAQDTLY  215

Query  611   DDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSF  790
             D +GRH+FK+ YI+G+VDFIFG+G +LY +  L+  +  +   +TAQ + +  E+TG+SF
Sbjct  216   DHRGRHYFKNCYIQGSVDFIFGDGLSLYENCHLNA-KTKSYGALTAQKRESMLEETGFSF  274

Query  791   AHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWHGVPGKTHYGGTTYFGEYKN  970
              +CKVTG G    LGR W  FSRV+FAY  +   I  +GW+    K  +  T ++G++K 
Sbjct  275   VNCKVTGSG-ALYLGRAWGTFSRVIFAYTYMDKIITSKGWYDWGDKNRH-MTVFYGQFKC  332

Query  971   TGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWLL  1084
             +GPGA    R  + +++ +QE   F+S  FI+  +WLL
Sbjct  333   SGPGANHGGRVKWSRELTEQEANPFVSLSFIDGHEWLL  370



>gb|EEC69509.1| hypothetical protein OsI_38743 [Oryza sativa Indica Group]
Length=415

 Score =   231 bits (590),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 182/325 (56%), Gaps = 16/325 (5%)
 Frame = +2

Query  158   KNLNPELAKAEAKPKHIRVCKNGKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKI  337
             K L+ EL+ AEA      V  +GKG F+TI +AI +VP  N +RVI+ I PG Y E+L I
Sbjct  93    KALDAELSAAEAGAARYVVSGDGKGKFRTITDAIKAVPEYNKKRVILDIRPGTYKEKLLI  152

Query  338   VREKPFISLHGDDKDRPSIIGCSTAAQDG-------TVMSATVIVEGDYFMASCINIINS  496
                KPFI+  G+ +  P+I+    AA  G       T++SATV VE DYFMAS I   N 
Sbjct  153   PFTKPFITFVGNPRSPPTIMWDDRAATHGKDGQPMGTMLSATVAVEADYFMASGIIFKNH  212

Query  497   APRPDGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFG  676
             AP       G QAVAL   G   A YN  + G QDT  D KG H+FK+  I G+VDFIFG
Sbjct  213   APMAAPGAHGGQAVALRVFGSKVAMYNCTIDGGQDTLYDHKGLHYFKNCLIRGSVDFIFG  272

Query  677   NGKTLYVDTELHVIEGDNMAVVTAQAQH---TREEDTGYSFAHCKVTGVGEGALLGRGWM  847
              G++LY D  +  +  + +AVVTAQ +        DTG+SF  CK++G+G+   LGR W 
Sbjct  273   FGRSLYADCTIESVTKE-VAVVTAQQRSKNIAEAIDTGFSFLRCKISGIGQ-IYLGRAWG  330

Query  848   AFSRVVFAYCEISDAIKPEGWHG--VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKM  1021
               SRVV++Y  +   + P GW G  V    H G   Y+GEYK +GPGA  + R  +   +
Sbjct  331   DSSRVVYSYTTMGKEVVPIGWDGWEVQKPEHSG--IYYGEYKCSGPGALPSKRIGWSLVL  388

Query  1022  KDQEVKKFISFGFIEASKWLLPPAK  1096
              D + K F    F+    W+LPP K
Sbjct  389   SDIQAKPFTGSHFVYGDSWILPPPK  413



>ref|XP_003567104.1| PREDICTED: probable pectinesterase 53 isoform X2 [Brachypodium 
distachyon]
Length=389

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 171/295 (58%), Gaps = 15/295 (5%)
 Frame = +2

Query  227   KGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKPFISLHGDDKDRPSIIGCS  406
              GDF +I+ A+DS+P  N  RV+I +  G YTE++ I   + FI+L G   DR  +    
Sbjct  98    SGDFTSIQAAVDSLPPINLVRVVIKVNAGTYTEKVNISPMRAFITLEGAGADRTVVQWGD  157

Query  407   TAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRPDGKRKGAQAVALTQSGDM  562
             TA           GT  SA+  V   YF+A  I   N++P P     G QAVAL  S D 
Sbjct  158   TADTPAGPRGRPLGTYGSASFAVNAQYFLARNITFKNTSPVPKAGASGKQAVALRVSADN  217

Query  563   AAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKTLYVDTELHVIEGDNMAVV  742
             AAF   +  G QDT  D  GRH++KD YIEG++DFIFGN  +LY    +H I  D  A +
Sbjct  218   AAFVGCKFLGAQDTLYDHTGRHYYKDCYIEGSIDFIFGNALSLYEGCHVHAIARDYGA-L  276

Query  743   TAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVFAYCEISDAIKPEGWH--G  916
             TAQ + +  EDTG+SF +C+VTG G    LGR W  FSRVVFAY  + D I P GW+  G
Sbjct  277   TAQNRQSMLEDTGFSFVNCRVTGSG-ALYLGRAWGTFSRVVFAYTYMDDIIIPRGWYNWG  335

Query  917   VPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKKFISFGFIEASKWL  1081
              P +     T ++G+YK TGPGA  + R ++ +++ D+E K FIS  FI+ ++W+
Sbjct  336   DPSREL---TVFYGQYKCTGPGASYSGRVSWSRELTDEEAKPFISLSFIDGTEWV  387



>ref|XP_008673062.1| PREDICTED: pectinesterase isoform X1 [Zea mays]
 gb|ACR36293.1| unknown [Zea mays]
Length=391

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 173/313 (55%), Gaps = 17/313 (5%)
 Frame = +2

Query  179   AKAEAKPKHIRVCKN--GKGDFKTIKEAIDSVPTGNTQRVIISIGPGNYTERLKIVREKP  352
             A A A P +  V       GDF TI+ A+DS+P  N  RV+I +  G YTE++ +   + 
Sbjct  82    AVARASPSYSLVVDKDPALGDFTTIQAAVDSLPAINLVRVVIRVNAGTYTEKVTVSAMRA  141

Query  353   FISLHGDDKDRPSIIGCSTAAQD--------GTVMSATVIVEGDYFMASCINIINSAPRP  508
             FI+L G   D+  +    TA           GT  SA+  V   YF+A  I   N++P P
Sbjct  142   FITLEGAGADKTVVQWGDTADSPTGPKGRPLGTFNSASFAVNAQYFLARNITFKNTSPVP  201

Query  509   DGKRKGAQAVALTQSGDMAAFYNVRLHGFQDTFCDDKGRHFFKDSYIEGTVDFIFGNGKT  688
                  G QAVAL  S D AAF   R  G QDT  D  GRH++KD YI+G+VDFIFGN  +
Sbjct  202   KPGAAGKQAVALRVSADNAAFVGCRFLGAQDTLYDHSGRHYYKDCYIQGSVDFIFGNALS  261

Query  689   LYVDTELHVIEGDNMAVVTAQAQHTREEDTGYSFAHCKVTGVGEGALLGRGWMAFSRVVF  868
             LY D  +H I  D  A +TAQ + +  EDTG+SF +C+VTG G    LGR W  FSRVVF
Sbjct  262   LYEDCHVHAIARDYGA-LTAQNRQSMLEDTGFSFVNCRVTGSG-ALYLGRAWGTFSRVVF  319

Query  869   AYCEISDAIKPEGWH--GVPGKTHYGGTTYFGEYKNTGPGAKLTARPNFVKKMKDQEVKK  1042
             AY  + D I P GW   G P +     T ++G+YK TGPGA    R  +  ++ D E K 
Sbjct  320   AYTHMDDIIVPNGWFNWGDPNREL---TVFYGQYKCTGPGATYAGRVAWSHELTDDEAKP  376

Query  1043  FISFGFIEASKWL  1081
             FIS  FI+ ++W+
Sbjct  377   FISLSFIDGTEWV  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3061147228170