BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81290_g1_i1 len=3956 path=[3934:0-3955]

Length=3956
                                                                      Score     E

ref|XP_009781980.1|  PREDICTED: putative ABC transporter B family...   1850   0.0     
ref|XP_009616711.1|  PREDICTED: putative ABC transporter B family...   1845   0.0     
ref|XP_006361608.1|  PREDICTED: putative ABC transporter B family...   1806   0.0     
ref|XP_010318180.1|  PREDICTED: putative ABC transporter B family...   1801   0.0     
emb|CDP03260.1|  unnamed protein product                               1760   0.0     
ref|XP_002280453.2|  PREDICTED: putative ABC transporter B family...   1758   0.0     Vitis vinifera
ref|XP_002514211.1|  multidrug resistance protein 1, 2, putative       1754   0.0     Ricinus communis
ref|XP_007203113.1|  hypothetical protein PRUPE_ppa023915mg            1732   0.0     
ref|XP_004288891.1|  PREDICTED: putative ABC transporter B family...   1729   0.0     
ref|XP_008242496.1|  PREDICTED: putative ABC transporter B family...   1728   0.0     
ref|XP_010249502.1|  PREDICTED: putative ABC transporter B family...   1726   0.0     
ref|XP_007013043.1|  Multidrug/pheromone exporter, MDR family, AB...   1726   0.0     
ref|XP_011093634.1|  PREDICTED: putative ABC transporter B family...   1724   0.0     
ref|XP_002325023.2|  hypothetical protein POPTR_0018s09420g            1722   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011007115.1|  PREDICTED: putative ABC transporter B family...   1717   0.0     
ref|XP_010047684.1|  PREDICTED: putative ABC transporter B family...   1702   0.0     
ref|XP_010688320.1|  PREDICTED: putative ABC transporter B family...   1701   0.0     
ref|XP_003517643.1|  PREDICTED: putative ABC transporter B family...   1701   0.0     
ref|XP_009352696.1|  PREDICTED: putative ABC transporter B family...   1694   0.0     
ref|XP_006599128.1|  PREDICTED: putative ABC transporter B family...   1694   0.0     
gb|KHN16972.1|  Putative ABC transporter B family member 8             1694   0.0     
ref|XP_004513041.1|  PREDICTED: putative ABC transporter B family...   1693   0.0     
gb|EYU27272.1|  hypothetical protein MIMGU_mgv1a000349mg               1692   0.0     
ref|XP_007152910.1|  hypothetical protein PHAVU_004G170600g            1690   0.0     
gb|KDO66565.1|  hypothetical protein CISIN_1g000909mg                  1689   0.0     
ref|XP_006475597.1|  PREDICTED: putative ABC transporter B family...   1687   0.0     
ref|XP_006451287.1|  hypothetical protein CICLE_v10007269mg            1686   0.0     
ref|XP_008390760.1|  PREDICTED: putative ABC transporter B family...   1683   0.0     
ref|XP_004135803.1|  PREDICTED: putative ABC transporter B family...   1662   0.0     
gb|KEH27194.1|  ABC transporter B family protein                       1654   0.0     
ref|XP_004158455.1|  PREDICTED: LOW QUALITY PROTEIN: putative ABC...   1647   0.0     
ref|XP_008450777.1|  PREDICTED: putative ABC transporter B family...   1644   0.0     
ref|XP_011007116.1|  PREDICTED: putative ABC transporter B family...   1630   0.0     
ref|XP_010915424.1|  PREDICTED: putative ABC transporter B family...   1604   0.0     
ref|XP_008809753.1|  PREDICTED: putative ABC transporter B family...   1596   0.0     
gb|KGN66172.1|  hypothetical protein Csa_1G574890                      1580   0.0     
ref|XP_009406169.1|  PREDICTED: putative ABC transporter B family...   1558   0.0     
ref|XP_010095343.1|  Putative ABC transporter B family member 8        1557   0.0     
ref|XP_004969800.1|  PREDICTED: putative ABC transporter B family...   1550   0.0     
ref|XP_006644646.1|  PREDICTED: putative ABC transporter B family...   1545   0.0     
tpg|DAA57811.1|  TPA: hypothetical protein ZEAMMB73_975376             1537   0.0     
gb|EEC71408.1|  hypothetical protein OsI_03576                         1536   0.0     Oryza sativa Indica Group [Indian rice]
ref|NP_001044110.1|  Os01g0723800                                      1536   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_003569704.1|  PREDICTED: putative ABC transporter B family...   1532   0.0     
ref|XP_002458424.1|  hypothetical protein SORBIDRAFT_03g033290         1528   0.0     Sorghum bicolor [broomcorn]
ref|XP_010535953.1|  PREDICTED: putative ABC transporter B family...   1528   0.0     
dbj|BAJ97242.1|  predicted protein                                     1526   0.0     
emb|CAA71179.1|  P-glycoprotein homologue                              1521   0.0     Hordeum vulgare [barley]
ref|XP_010535957.1|  PREDICTED: putative ABC transporter B family...   1474   0.0     
ref|XP_009151738.1|  PREDICTED: putative ABC transporter B family...   1472   0.0     
emb|CDX85304.1|  BnaC07g26150D                                         1453   0.0     
ref|XP_006853687.1|  hypothetical protein AMTR_s00056p00132920         1449   0.0     
gb|EMS65074.1|  Putative ABC transporter B family member 8             1438   0.0     
sp|Q9LHK4.1|AB8B_ARATH  RecName: Full=Putative ABC transporter B ...   1427   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010430925.1|  PREDICTED: putative ABC transporter B family...   1424   0.0     
ref|XP_006293275.1|  hypothetical protein CARUB_v10019611mg            1357   0.0     
ref|XP_006839128.1|  hypothetical protein AMTR_s00090p00165440         1224   0.0     
ref|XP_008779540.1|  PREDICTED: putative multidrug resistance pro...   1224   0.0     
ref|XP_010552465.1|  PREDICTED: ABC transporter B family member 1...   1219   0.0     
ref|XP_004142341.1|  PREDICTED: ABC transporter B family member 1...   1218   0.0     
ref|XP_006395369.1|  hypothetical protein EUTSA_v10003530mg            1216   0.0     
ref|XP_004304964.1|  PREDICTED: ABC transporter B family member 1...   1216   0.0     
ref|XP_009335785.1|  PREDICTED: ABC transporter B family member 1...   1215   0.0     
gb|KFK33731.1|  hypothetical protein AALP_AA5G052500                   1213   0.0     
ref|XP_008458712.1|  PREDICTED: ABC transporter B family member 1...   1209   0.0     
ref|XP_007217654.1|  hypothetical protein PRUPE_ppa000356mg            1209   0.0     
emb|CDP02174.1|  unnamed protein product                               1208   0.0     
ref|XP_003633838.1|  PREDICTED: ABC transporter B family member 1...   1208   0.0     
gb|ADZ48235.1|  multidrug/pheromone exporter protein                   1207   0.0     
ref|XP_008230690.1|  PREDICTED: ABC transporter B family member 1...   1206   0.0     
ref|XP_007032373.1|  ABC transporter family protein isoform 1          1201   0.0     
gb|KDP45428.1|  hypothetical protein JCGZ_09677                        1201   0.0     
ref|XP_004951620.1|  PREDICTED: putative multidrug resistance pro...   1200   0.0     
ref|XP_006290512.1|  hypothetical protein CARUB_v10016590mg            1197   0.0     
ref|XP_006338500.1|  PREDICTED: ABC transporter B family member 1...   1197   0.0     
emb|CDY64952.1|  BnaA06g39710D                                         1196   0.0     
ref|XP_002453447.1|  hypothetical protein SORBIDRAFT_04g006100         1196   0.0     Sorghum bicolor [broomcorn]
ref|XP_008679898.1|  PREDICTED: putative multidrug resistance pro...   1196   0.0     
sp|Q6YUU5.1|MDR_ORYSJ  RecName: Full=Putative multidrug resistanc...   1195   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008368430.1|  PREDICTED: ABC transporter B family member 1...   1194   0.0     
ref|XP_002324019.2|  ABC transporter family protein                    1194   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010091939.1|  ABC transporter B family member 15                1191   0.0     
ref|XP_003571049.1|  PREDICTED: putative multidrug resistance pro...   1191   0.0     
ref|XP_010272126.1|  PREDICTED: ABC transporter B family member 1...   1191   0.0     
ref|XP_006392796.1|  hypothetical protein EUTSA_v10011187mg            1191   0.0     
ref|XP_010425612.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...   1190   0.0     
ref|XP_002877101.1|  abc transporter family protein                    1188   0.0     
ref|XP_006482504.1|  PREDICTED: ABC transporter B family member 1...   1187   0.0     
ref|XP_009765310.1|  PREDICTED: ABC transporter B family member 1...   1187   0.0     
ref|XP_010514536.1|  PREDICTED: ABC transporter B family member 1...   1185   0.0     
emb|CDX86445.1|  BnaA06g31620D                                         1185   0.0     
ref|NP_189475.1|  ABC transporter B family member 15                   1184   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008379304.1|  PREDICTED: ABC transporter B family member 1...   1183   0.0     
ref|XP_010670369.1|  PREDICTED: ABC transporter B family member 1...   1181   0.0     
ref|XP_009590357.1|  PREDICTED: ABC transporter B family member 1...   1180   0.0     
gb|AES74614.2|  ABC transporter B family protein                       1179   0.0     
ref|XP_009151889.1|  PREDICTED: ABC transporter B family member 15     1179   0.0     
ref|XP_004232253.1|  PREDICTED: ABC transporter B family member 1...   1177   0.0     
emb|CDX85192.1|  BnaC07g25030D                                         1176   0.0     
dbj|BAJ99881.1|  predicted protein                                     1172   0.0     
ref|XP_006647008.1|  PREDICTED: LOW QUALITY PROTEIN: putative mul...   1170   0.0     
gb|KHN34172.1|  ABC transporter B family member 15                     1169   0.0     
gb|KCW56134.1|  hypothetical protein EUGRSUZ_I01885                    1169   0.0     
ref|XP_009129375.1|  PREDICTED: ABC transporter B family member 1...   1168   0.0     
gb|EEE56475.1|  hypothetical protein OsJ_05694                         1166   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006431030.1|  hypothetical protein CICLE_v10010936mg            1163   0.0     
ref|XP_010029251.1|  PREDICTED: ABC transporter B family member 1...   1159   0.0     
ref|XP_010029252.1|  PREDICTED: ABC transporter B family member 1...   1157   0.0     
gb|KCW56138.1|  hypothetical protein EUGRSUZ_I01889                    1157   0.0     
ref|XP_010040632.1|  PREDICTED: ABC transporter B family member 1...   1154   0.0     
ref|XP_007151162.1|  hypothetical protein PHAVU_004G023100g            1151   0.0     
ref|XP_011035776.1|  PREDICTED: ABC transporter B family member 1...   1150   0.0     
ref|XP_006293094.1|  hypothetical protein CARUB_v10019381mg            1150   0.0     
gb|EEE56476.1|  hypothetical protein OsJ_05696                         1149   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010660995.1|  PREDICTED: ABC transporter B family member 1...   1149   0.0     
ref|XP_010030763.1|  PREDICTED: ABC transporter B family member 1...   1147   0.0     
ref|XP_009413177.1|  PREDICTED: putative multidrug resistance pro...   1147   0.0     
emb|CDY04018.1|  BnaC02g37330D                                         1145   0.0     
ref|NP_189480.1|  ABC transporter B family member 18                   1144   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EAY84812.1|  hypothetical protein OsI_06180                         1140   0.0     Oryza sativa Indica Group [Indian rice]
gb|KHN10916.1|  ABC transporter B family member 15                     1139   0.0     
ref|XP_003530842.1|  PREDICTED: ABC transporter B family member 1...   1139   0.0     
ref|NP_189477.4|  ABC transporter B family member 16                   1137   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_009111595.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...   1136   0.0     
ref|XP_002323866.1|  ABC transporter family protein                    1136   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006361363.1|  PREDICTED: ABC transporter B family member 1...   1134   0.0     
ref|XP_010425615.1|  PREDICTED: ABC transporter B family member 1...   1133   0.0     
ref|XP_003622707.1|  ABC transporter B family member                   1133   0.0     
gb|KHG27894.1|  ABC transporter B family member 15                     1131   0.0     
ref|XP_006292607.1|  hypothetical protein CARUB_v10018848mg            1131   0.0     
ref|XP_010514540.1|  PREDICTED: ABC transporter B family member 2...   1130   0.0     
ref|XP_010425616.1|  PREDICTED: ABC transporter B family member 1...   1128   0.0     
ref|XP_010514543.1|  PREDICTED: ABC transporter B family member 2...   1128   0.0     
ref|NP_189479.1|  ABC transporter B family member 17                   1127   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502833.1|  PREDICTED: ABC transporter B family member 2...   1125   0.0     
ref|XP_010425617.1|  PREDICTED: ABC transporter B family member 22     1124   0.0     
ref|XP_008645788.1|  PREDICTED: putative multidrug resistance pro...   1123   0.0     
ref|XP_003554863.1|  PREDICTED: ABC transporter B family member 1...   1121   0.0     
ref|XP_002453446.1|  hypothetical protein SORBIDRAFT_04g006090         1120   0.0     Sorghum bicolor [broomcorn]
ref|XP_010030764.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...   1118   0.0     
ref|XP_007140744.1|  hypothetical protein PHAVU_008G138100g            1118   0.0     
gb|AFW71770.1|  hypothetical protein ZEAMMB73_206152                   1117   0.0     
ref|XP_004954986.1|  PREDICTED: putative multidrug resistance pro...   1117   0.0     
ref|XP_009113936.1|  PREDICTED: ABC transporter B family member 2...   1116   0.0     
ref|XP_008230691.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...   1115   0.0     
dbj|BAB02858.1|  multidrug resistance p-glycoprotein; ABC transpo...   1115   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ABD33400.2|  Cyclic peptide transporter                             1115   0.0     Medicago truncatula
ref|XP_003618377.1|  ABC transporter B family member                   1115   0.0     
sp|Q9LSJ2.2|AB22B_ARATH  RecName: Full=ABC transporter B family m...   1114   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877103.1|  P-glycoprotein 17                                 1113   0.0     
ref|XP_006395367.1|  hypothetical protein EUTSA_v10003534mg            1113   0.0     
emb|CBI35014.3|  unnamed protein product                               1113   0.0     
ref|XP_004492229.1|  PREDICTED: ABC transporter B family member 1...   1112   0.0     
emb|CDY20020.1|  BnaA09g02310D                                         1112   0.0     
ref|XP_004954680.1|  PREDICTED: putative multidrug resistance pro...   1111   0.0     
emb|CDY00133.1|  BnaC09g01680D                                         1110   0.0     
ref|XP_004954987.1|  PREDICTED: putative multidrug resistance pro...   1110   0.0     
ref|XP_006293046.1|  hypothetical protein CARUB_v10019333mg            1108   0.0     
ref|XP_002452253.1|  hypothetical protein SORBIDRAFT_04g022480         1107   0.0     Sorghum bicolor [broomcorn]
ref|XP_002877104.1|  P-glycoprotein 18                                 1105   0.0     
ref|XP_006482503.1|  PREDICTED: ABC transporter B family member 1...   1104   0.0     
ref|XP_004952829.1|  PREDICTED: putative multidrug resistance pro...   1103   0.0     
ref|XP_003554864.1|  PREDICTED: ABC transporter B family member 1...   1102   0.0     
ref|XP_009129376.1|  PREDICTED: ABC transporter B family member 1...   1102   0.0     
ref|XP_002275969.2|  PREDICTED: putative multidrug resistance pro...   1102   0.0     Vitis vinifera
ref|XP_006292374.1|  hypothetical protein CARUB_v10018587mg            1101   0.0     
gb|KHN34176.1|  ABC transporter B family member 15                     1101   0.0     
gb|EEC72653.1|  hypothetical protein OsI_06178                         1098   0.0     Oryza sativa Indica Group [Indian rice]
ref|XP_007217335.1|  hypothetical protein PRUPE_ppa020584mg            1097   0.0     
ref|XP_010040633.1|  PREDICTED: ABC transporter B family member 1...   1097   0.0     
ref|XP_006603842.1|  PREDICTED: ABC transporter B family member 1...   1096   0.0     
gb|KHN34174.1|  ABC transporter B family member 15                     1095   0.0     
ref|XP_010430842.1|  PREDICTED: ABC transporter B family member 2...   1095   0.0     
dbj|BAJ94109.1|  predicted protein                                     1093   0.0     
ref|XP_004958185.1|  PREDICTED: putative multidrug resistance pro...   1092   0.0     
ref|NP_683599.1|  ABC transporter B family member 22                   1090   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304963.1|  PREDICTED: ABC transporter B family member 1...   1087   0.0     
ref|XP_002324687.2|  hypothetical protein POPTR_0018s13810g            1087   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007032374.1|  ABC transporter family protein isoform 2          1087   0.0     
ref|XP_002264708.1|  PREDICTED: ABC transporter B family member 1...   1085   0.0     Vitis vinifera
ref|XP_001784237.1|  ATP-binding cassette transporter, subfamily ...   1085   0.0     
gb|KDO72406.1|  hypothetical protein CISIN_1g041277mg                  1082   0.0     
ref|XP_010412435.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...   1080   0.0     
gb|KHG23986.1|  ABC transporter B family member 15                     1078   0.0     
ref|XP_011020051.1|  PREDICTED: putative multidrug resistance pro...   1073   0.0     
ref|XP_010514542.1|  PREDICTED: ABC transporter B family member 2...   1072   0.0     
ref|XP_010272127.1|  PREDICTED: ABC transporter B family member 1...   1072   0.0     
ref|XP_002309006.2|  hypothetical protein POPTR_0006s07370g            1072   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002279336.2|  PREDICTED: putative multidrug resistance pro...   1070   0.0     Vitis vinifera
gb|KDP39051.1|  hypothetical protein JCGZ_00808                        1069   0.0     
ref|XP_010425621.1|  PREDICTED: ABC transporter B family member 2...   1068   0.0     
ref|XP_011020052.1|  PREDICTED: putative multidrug resistance pro...   1066   0.0     
ref|XP_008337598.1|  PREDICTED: putative ABC transporter B family...   1063   0.0     
ref|XP_008777069.1|  PREDICTED: putative multidrug resistance pro...   1060   0.0     
gb|KCW56136.1|  hypothetical protein EUGRSUZ_I01887                    1059   0.0     
ref|XP_010930012.1|  PREDICTED: LOW QUALITY PROTEIN: putative mul...   1051   0.0     
ref|XP_008367919.1|  PREDICTED: putative ABC transporter B family...   1045   0.0     
gb|AES72134.2|  multidrug resistance-associated protein ABC domai...   1045   0.0     
ref|XP_009594378.1|  PREDICTED: putative multidrug resistance pro...   1044   0.0     
ref|XP_006370621.1|  MDR-like ABC transporter family protein           1041   0.0     
gb|EYU46633.1|  hypothetical protein MIMGU_mgv1a024403mg               1041   0.0     
ref|XP_004502504.1|  PREDICTED: putative multidrug resistance pro...   1036   0.0     
ref|XP_010645151.1|  PREDICTED: ABC transporter B family member 1...   1034   0.0     
gb|KHN24121.1|  ABC transporter B family member 18                     1029   0.0     
ref|XP_009413182.1|  PREDICTED: putative multidrug resistance pro...   1028   0.0     
ref|XP_002316977.1|  MDR-like ABC transporter family protein           1023   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_010060436.1|  PREDICTED: putative multidrug resistance pro...   1018   0.0     
ref|XP_003601883.1|  ABC transporter B family member                   1018   0.0     
ref|XP_002960680.1|  ATP-binding cassette transporter                  1017   0.0     
ref|XP_011030854.1|  PREDICTED: putative multidrug resistance pro...   1010   0.0     
ref|XP_006361362.1|  PREDICTED: ABC transporter B family member 1...   1007   0.0     
ref|XP_011097921.1|  PREDICTED: putative multidrug resistance pro...   1006   0.0     
ref|XP_008663328.1|  PREDICTED: ABC transporter B family member 1...    992   0.0     
ref|XP_004978083.1|  PREDICTED: putative multidrug resistance pro...    989   0.0     
ref|XP_002973517.1|  ATP-binding cassette transporter                   988   0.0     
ref|XP_002975549.1|  hypothetical protein SELMODRAFT_103646             985   0.0     
ref|XP_004170679.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    979   0.0     
emb|CAD41096.2|  OSJNBb0011N17.13                                       978   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CAH67685.1|  H0510A06.10                                            978   0.0     Oryza sativa [red rice]
gb|AFW58616.1|  hypothetical protein ZEAMMB73_341308                    977   0.0     
gb|KCW67202.1|  hypothetical protein EUGRSUZ_F00982                     959   0.0     
emb|CAD59591.1|  MDR-like ABC transporter                               959   0.0     Oryza sativa Japonica Group [Japonica rice]
dbj|BAF00235.1|  P-glycoprotein                                         952   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_001779184.1|  ATP-binding cassette transporter, subfamily ...    951   0.0     
emb|CAD59592.1|  MDR-like ABC transporter                               945   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017679.1|  PREDICTED: putative multidrug resistance pro...    945   0.0     
ref|XP_002979856.1|  ATP-binding cassette transporter                   932   0.0     
ref|XP_001757525.1|  ATP-binding cassette transporter, subfamily ...    909   0.0     
gb|KHG04191.1|  Putative ABC transporter B family member 8              903   0.0     
ref|XP_002976764.1|  hypothetical protein SELMODRAFT_105467             896   0.0     
ref|XP_009591470.1|  PREDICTED: ABC transporter B family member 19      894   0.0     
ref|XP_009758464.1|  PREDICTED: ABC transporter B family member 19      893   0.0     
ref|XP_003554410.1|  PREDICTED: ABC transporter B family member 1...    893   0.0     
emb|CDX86408.1|  BnaA06g31250D                                          892   0.0     
ref|XP_002967873.1|  ATP-binding cassette transporter                   890   0.0     
ref|XP_003543769.1|  PREDICTED: ABC transporter B family member 1...    889   0.0     
ref|XP_002981644.1|  hypothetical protein SELMODRAFT_421121             887   0.0     
gb|KDP45498.1|  hypothetical protein JCGZ_09747                         889   0.0     
ref|XP_004489384.1|  PREDICTED: ABC transporter B family member 1...    888   0.0     
ref|XP_011008935.1|  PREDICTED: ABC transporter B family member 19      888   0.0     
ref|XP_010108971.1|  ABC transporter B family member 19                 887   0.0     
ref|XP_002323847.1|  multidrug resistance P-glycoprotein                886   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007032497.1|  ATP binding cassette subfamily B19 isoform 1       886   0.0     
ref|XP_009347047.1|  PREDICTED: ABC transporter B family member 19      884   0.0     
gb|KHN45492.1|  ABC transporter B family member 19                      883   0.0     
ref|XP_002973102.1|  ATP-binding cassette transporter                   881   0.0     
gb|KEH24996.1|  ABC transporter B family protein                        882   0.0     
ref|XP_002517493.1|  multidrug resistance protein 1, 2, putative        882   0.0     Ricinus communis
ref|XP_007151220.1|  hypothetical protein PHAVU_004G027800g             880   0.0     
ref|XP_006395333.1|  hypothetical protein EUTSA_v10003528mg             881   0.0     
ref|XP_010528330.1|  PREDICTED: ABC transporter B family member 19      879   0.0     
ref|XP_006652374.1|  PREDICTED: ABC transporter B family member 1...    878   0.0     
ref|XP_010937072.1|  PREDICTED: ABC transporter B family member 19      878   0.0     
emb|CDP02220.1|  unnamed protein product                                878   0.0     
emb|CBI28004.3|  unnamed protein product                                869   0.0     
ref|XP_010554005.1|  PREDICTED: ABC transporter B family member 1...    877   0.0     
ref|NP_001052982.1|  Os04g0459000                                       876   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011098607.1|  PREDICTED: ABC transporter B family member 19      875   0.0     
ref|XP_002983053.1|  hypothetical protein SELMODRAFT_117529             875   0.0     
ref|XP_008379345.1|  PREDICTED: ABC transporter B family member 19      875   0.0     
gb|KHG20565.1|  ABC transporter B family member 19                      875   0.0     
gb|AIU41631.1|  ABC transporter family protein                          875   0.0     
ref|XP_002447959.1|  hypothetical protein SORBIDRAFT_06g018860          875   0.0     Sorghum bicolor [broomcorn]
ref|XP_010256924.1|  PREDICTED: ABC transporter B family member 19      874   0.0     
gb|AAP72956.1|  putative MDR-like P-glycoprotein                        874   0.0     Lactuca sativa [cultivated lettuce]
emb|CAD59581.1|  MDR-like ABC transporter                               874   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784383.1|  PREDICTED: ABC transporter B family member 19      874   0.0     
ref|XP_011085762.1|  PREDICTED: ABC transporter B family member 1...    873   0.0     
ref|XP_011017682.1|  PREDICTED: putative multidrug resistance pro...    860   0.0     
ref|XP_008663648.1|  PREDICTED: ABC transporter B family member 1...    873   0.0     
ref|XP_008459308.1|  PREDICTED: ABC transporter B family member 19      872   0.0     
ref|XP_011020058.1|  PREDICTED: putative multidrug resistance pro...    860   0.0     
ref|XP_004148691.1|  PREDICTED: ABC transporter B family member 1...    872   0.0     
emb|CDY00109.1|  BnaC09g01920D                                          871   0.0     
ref|XP_010032346.1|  PREDICTED: ABC transporter B family member 19      871   0.0     
ref|XP_007032499.1|  ATP binding cassette subfamily B19 isoform 3       869   0.0     
gb|KCW44241.1|  hypothetical protein EUGRSUZ_L023342                    860   0.0     
ref|XP_002979534.1|  hypothetical protein SELMODRAFT_177681             870   0.0     
ref|XP_004975845.1|  PREDICTED: ABC transporter B family member 1...    870   0.0     
ref|XP_006431131.1|  hypothetical protein CICLE_v10010931mg             870   0.0     
ref|XP_002283051.2|  PREDICTED: ABC transporter B family member 19      869   0.0     
ref|XP_002981381.1|  hypothetical protein SELMODRAFT_114581             868   0.0     
gb|KGN52452.1|  Multidrug resistance protein 1, 2                       872   0.0     
ref|XP_006482578.1|  PREDICTED: ABC transporter B family member 1...    868   0.0     
ref|XP_002969904.1|  ATP-binding cassette transporter                   867   0.0     
gb|KDO72551.1|  hypothetical protein CISIN_1g000856mg                   867   0.0     
gb|KCW51753.1|  hypothetical protein EUGRSUZ_J01214                     867   0.0     
ref|XP_001751653.1|  ATP-binding cassette transporter, subfamily ...    867   0.0     
emb|CDY51307.1|  BnaCnng20520D                                          867   0.0     
ref|XP_008804465.1|  PREDICTED: ABC transporter B family member 1...    866   0.0     
ref|NP_001169660.1|  uncharacterized protein LOC100383541               866   0.0     
gb|EEE61204.1|  hypothetical protein OsJ_15217                          866   0.0     
ref|XP_008668793.1|  PREDICTED: ABC transporter B family member 1...    865   0.0     
ref|XP_008341564.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    863   0.0     
ref|XP_010940643.1|  PREDICTED: ABC transporter B family member 1...    867   0.0     
ref|XP_010935700.1|  PREDICTED: ABC transporter B family member 1...    867   0.0     
ref|XP_002977745.1|  ATP-binding cassette transporter                   861   0.0     
dbj|BAK05967.1|  predicted protein                                      862   0.0     
emb|CDX89963.1|  BnaA10g01190D                                          861   0.0     
ref|XP_001759716.1|  ATP-binding cassette transporter, subfamily ...    862   0.0     
ref|XP_009396182.1|  PREDICTED: ABC transporter B family member 1...    865   0.0     
ref|XP_007154480.1|  hypothetical protein PHAVU_003G122400g             861   0.0     
ref|XP_010939542.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    860   0.0     
ref|XP_004304313.1|  PREDICTED: ABC transporter B family member 1...    859   0.0     
gb|KHG22495.1|  ABC transporter B family member 19                      858   0.0     
gb|KCW46762.1|  hypothetical protein EUGRSUZ_K00570                     857   0.0     
ref|XP_008230752.1|  PREDICTED: ABC transporter B family member 19      858   0.0     
ref|XP_010905018.1|  PREDICTED: ABC transporter B family member 4...    858   0.0     
ref|XP_010530473.1|  PREDICTED: ABC transporter B family member 1       860   0.0     
ref|XP_004495861.1|  PREDICTED: ABC transporter B family member 2...    857   0.0     
ref|NP_171753.1|  P-glycoprotein 11                                     857   0.0     
ref|XP_009414924.1|  PREDICTED: ABC transporter B family member 1...    858   0.0     
ref|XP_004508079.1|  PREDICTED: ABC transporter B family member 2...    857   0.0     
ref|XP_010091424.1|  ABC transporter B family member 11                 858   0.0     
ref|XP_007217651.1|  hypothetical protein PRUPE_ppa000359mg             856   0.0     
emb|CDX94395.1|  BnaC01g17890D                                          855   0.0     
gb|KHN45005.1|  ABC transporter B family member 11                      856   0.0     
ref|XP_006594002.1|  PREDICTED: ABC transporter B family member 1...    856   0.0     
ref|XP_002869639.1|  multidrug resistance protein 2                     853   0.0     
ref|XP_008789538.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    857   0.0     
ref|XP_003579896.1|  PREDICTED: ABC transporter B family member 1...    854   0.0     
ref|XP_007160658.1|  hypothetical protein PHAVU_001G005900g             853   0.0     
gb|KGN60047.1|  hypothetical protein Csa_3G873270                       853   0.0     
ref|XP_004508078.1|  PREDICTED: ABC transporter B family member 2...    853   0.0     
ref|XP_009765178.1|  PREDICTED: putative multidrug resistance pro...    843   0.0     
ref|XP_004164800.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    853   0.0     
ref|XP_008800555.1|  PREDICTED: ABC transporter B family member 1...    857   0.0     
ref|XP_004297085.1|  PREDICTED: ABC transporter B family member 1...    853   0.0     
ref|XP_004136487.1|  PREDICTED: ABC transporter B family member 1...    852   0.0     
ref|XP_003518599.1|  PREDICTED: ABC transporter B family member 4...    852   0.0     
ref|XP_004508080.1|  PREDICTED: ABC transporter B family member 2...    852   0.0     
ref|XP_006660395.1|  PREDICTED: ABC transporter B family member 1...    853   0.0     
emb|CDY15249.1|  BnaC05g01280D                                          851   0.0     
emb|CDX89380.1|  BnaA01g15130D                                          851   0.0     
ref|XP_010458427.1|  PREDICTED: ABC transporter B family member 1...    849   0.0     
gb|EYU27079.1|  hypothetical protein MIMGU_mgv1a020574mg                849   0.0     
ref|XP_007017851.1|  P-glycoprotein 13                                  848   0.0     
ref|XP_009119625.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    850   0.0     
ref|XP_006597506.1|  PREDICTED: ABC transporter B family member 9...    848   0.0     
gb|KHN00238.1|  ABC transporter B family member 4                       850   0.0     
gb|AES71643.2|  transporter ABC domain protein                          850   0.0     
ref|XP_001775250.1|  ATP-binding cassette transporter, subfamily ...    847   0.0     
gb|KHG13479.1|  ABC transporter B family member 13                      847   0.0     
ref|NP_172538.1|  ABC transporter B family member 10                    846   0.0     
ref|XP_002510564.1|  multidrug resistance protein 1, 2, putative        847   0.0     
ref|XP_003609881.1|  ABC transporter B family member                    847   0.0     
gb|EEC71330.1|  hypothetical protein OsI_03378                          847   0.0     
ref|XP_010540773.1|  PREDICTED: ABC transporter B family member 2...    846   0.0     
dbj|BAD12940.1|  putative P-glycoprotein 1                              849   0.0     
ref|XP_009141619.1|  PREDICTED: ABC transporter B family member 1       848   0.0     
ref|XP_003549468.1|  PREDICTED: ABC transporter B family member 1...    845   0.0     
ref|XP_006597507.1|  PREDICTED: ABC transporter B family member 9...    845   0.0     
gb|EEE55238.1|  hypothetical protein OsJ_03116                          845   0.0     
ref|XP_003544389.1|  PREDICTED: ABC transporter B family member 1...    845   0.0     
emb|CAA71277.1|  P-glycoprotein-2                                       844   0.0     
gb|AAM20507.1|  P-glycoprotein-2                                        844   0.0     
ref|XP_006413247.1|  hypothetical protein EUTSA_v10024237mg             844   0.0     
emb|CDY37953.1|  BnaC05g08210D                                          843   0.0     
ref|XP_003535294.1|  PREDICTED: ABC transporter B family member 2...    845   0.0     
emb|CDX93393.1|  BnaA06g06550D                                          843   0.0     
ref|NP_194326.2|  P-glycoprotein 2                                      844   0.0     
ref|XP_003547192.1|  PREDICTED: ABC transporter B family member 9...    844   0.0     
ref|XP_004234243.1|  PREDICTED: ABC transporter B family member 9...    843   0.0     
gb|KFK43347.1|  hypothetical protein AALP_AA1G113900                    842   0.0     
ref|XP_009139729.1|  PREDICTED: ABC transporter B family member 2       843   0.0     
ref|XP_011016204.1|  PREDICTED: ABC transporter B family member 2...    844   0.0     
ref|XP_006369863.1|  ABC transporter family protein                     843   0.0     
ref|XP_006417431.1|  hypothetical protein EUTSA_v10009914mg             842   0.0     
ref|XP_008776908.1|  PREDICTED: ABC transporter B family member 9...    842   0.0     
ref|XP_011079475.1|  PREDICTED: ABC transporter B family member 4...    843   0.0     
ref|XP_008776907.1|  PREDICTED: ABC transporter B family member 9...    842   0.0     
ref|XP_003591310.1|  ABC transporter B family member                    843   0.0     
ref|XP_011040271.1|  PREDICTED: ABC transporter B family member 1...    843   0.0     
ref|XP_010475946.1|  PREDICTED: ABC transporter B family member 1...    841   0.0     
emb|CAD40903.1|  OSJNBa0036B21.21                                       842   0.0     
ref|XP_010516925.1|  PREDICTED: ABC transporter B family member 1...    845   0.0     
gb|ABG56413.1|  MDR-like ABC transporter                                842   0.0     
ref|XP_006603843.1|  PREDICTED: ABC transporter B family member 1...    830   0.0     
ref|XP_010491749.1|  PREDICTED: ABC transporter B family member 10      840   0.0     
ref|XP_010544933.1|  PREDICTED: ABC transporter B family member 2...    842   0.0     
ref|XP_006444609.1|  hypothetical protein CICLE_v10018532mg             841   0.0     
gb|EEC77398.1|  hypothetical protein OsI_16157                          840   0.0     
ref|XP_007051287.1|  P-glycoprotein 21                                  841   0.0     
ref|XP_010035397.1|  PREDICTED: ABC transporter B family member 2...    841   0.0     
ref|XP_010505240.1|  PREDICTED: ABC transporter B family member 1       843   0.0     
ref|XP_008776905.1|  PREDICTED: ABC transporter B family member 9...    840   0.0     
ref|XP_010509416.1|  PREDICTED: ABC transporter B family member 1...    843   0.0     
ref|XP_004297068.1|  PREDICTED: ABC transporter B family member 4...    841   0.0     
ref|XP_006293439.1|  hypothetical protein CARUB_v10022511mg             843   0.0     
gb|KHN12634.1|  ABC transporter B family member 13                      838   0.0     
ref|XP_006492413.1|  PREDICTED: ABC transporter B family member 4...    841   0.0     
gb|ABG75919.1|  MDR-like ABC transporter                                840   0.0     
gb|KHN39417.1|  ABC transporter B family member 13                      838   0.0     
ref|XP_006473687.1|  PREDICTED: ABC transporter B family member 1...    839   0.0     
gb|EPS73347.1|  hypothetical protein M569_01408                         839   0.0     
gb|KDO86791.1|  hypothetical protein CISIN_1g000777mg                   840   0.0     
ref|XP_010504005.1|  PREDICTED: ABC transporter B family member 1...    838   0.0     
ref|XP_007210429.1|  hypothetical protein PRUPE_ppa000340mg             839   0.0     
ref|XP_002301961.1|  multidrug resistance P-glycoprotein                837   0.0     
gb|AES92079.2|  ABC transporter B family protein                        839   0.0     
ref|XP_007163242.1|  hypothetical protein PHAVU_001G218000g             839   0.0     
ref|XP_007051282.1|  ATP binding cassette subfamily B4 isoform 2        839   0.0     
ref|NP_181228.1|  ABC transporter B family member 1                     839   0.0     
ref|XP_009148411.1|  PREDICTED: ABC transporter B family member 10      837   0.0     
ref|XP_006410867.1|  hypothetical protein EUTSA_v10016150mg             840   0.0     
ref|XP_011034997.1|  PREDICTED: ABC transporter B family member 1...    837   0.0     
ref|XP_007145097.1|  hypothetical protein PHAVU_007G209600g             838   0.0     
gb|KHN45006.1|  ABC transporter B family member 11                      838   0.0     
ref|XP_007051281.1|  ATP binding cassette subfamily B4 isoform 1        838   0.0     
gb|KFK36572.1|  hypothetical protein AALP_AA4G140900                    839   0.0     
ref|XP_009113722.1|  PREDICTED: ABC transporter B family member 1...    836   0.0     
ref|XP_002879630.1|  ATPGP1                                             837   0.0     
ref|XP_009137566.1|  PREDICTED: ABC transporter B family member 2...    835   0.0     
ref|XP_003550577.1|  PREDICTED: ABC transporter B family member 1...    836   0.0     
ref|XP_009133103.1|  PREDICTED: ABC transporter B family member 1       838   0.0     
ref|XP_003609882.1|  ABC transporter B family member                    838   0.0     
ref|XP_002275143.2|  PREDICTED: ABC transporter B family member 1...    836   0.0     
ref|XP_003601392.1|  ABC transporter B family member                    836   0.0     
ref|XP_006594001.1|  PREDICTED: ABC transporter B family member 2...    835   0.0     
gb|KFK29108.1|  hypothetical protein AALP_AA7G090300                    833   0.0     
ref|XP_009136898.1|  PREDICTED: ABC transporter B family member 9       834   0.0     
ref|XP_009395305.1|  PREDICTED: ABC transporter B family member 1...    838   0.0     
ref|XP_010474666.1|  PREDICTED: ABC transporter B family member 1...    833   0.0     
ref|XP_002279471.2|  PREDICTED: ABC transporter B family member 1...    833   0.0     
ref|XP_006435210.1|  hypothetical protein CICLE_v10000054mg             833   0.0     
ref|XP_008465999.1|  PREDICTED: ABC transporter B family member 2...    832   0.0     
emb|CAD59580.1|  MDR-like ABC transporter                               836   0.0     
ref|XP_009385386.1|  PREDICTED: ABC transporter B family member 4...    833   0.0     
gb|EYU46880.1|  hypothetical protein MIMGU_mgv1a000319mg                833   0.0     
ref|XP_010481013.1|  PREDICTED: ABC transporter B family member 1...    832   0.0     
gb|AAM98246.1|  putative ABC transporter                                833   0.0     
gb|EYU29874.1|  hypothetical protein MIMGU_mgv1a000299mg                833   0.0     
ref|NP_191774.2|  ABC transporter B family member 21                    833   0.0     
gb|KDO84908.1|  hypothetical protein CISIN_1g000851mg                   832   0.0     
gb|EEE69159.1|  hypothetical protein OsJ_28307                          835   0.0     
ref|XP_007225446.1|  hypothetical protein PRUPE_ppa000363mg             831   0.0     
ref|XP_002892589.1|  P-glycoprotein 10                                  830   0.0     
gb|AFW59636.1|  hypothetical protein ZEAMMB73_350646                    828   0.0     
ref|XP_008798883.1|  PREDICTED: ABC transporter B family member 2...    832   0.0     
gb|KDP28335.1|  hypothetical protein JCGZ_14106                         832   0.0     
gb|KFK44669.1|  hypothetical protein AALP_AA1G288400                    831   0.0     
ref|XP_002301550.2|  hypothetical protein POPTR_0002s18850g             832   0.0     
ref|NP_192092.1|  ABC transporter B family member 5                     830   0.0     
ref|XP_002876661.1|  P-glycoprotein 21                                  832   0.0     
emb|CDY46744.1|  BnaA03g16880D                                          833   0.0     
emb|CAB71875.1|  P-glycoprotein-like proetin                            831   0.0     
ref|XP_010035399.1|  PREDICTED: ABC transporter B family member 2...    830   0.0     
ref|XP_004969643.1|  PREDICTED: ABC transporter B family member 4...    830   0.0     
gb|EEC84043.1|  hypothetical protein OsI_30303                          833   0.0     
ref|XP_010457234.1|  PREDICTED: ABC transporter B family member 1...    830   0.0     
ref|XP_008373592.1|  PREDICTED: ABC transporter B family member 2...    829   0.0     
emb|CDX92739.1|  BnaC07g39970D                                          828   0.0     
ref|XP_009104372.1|  PREDICTED: ABC transporter B family member 21      830   0.0     
ref|XP_006402405.1|  hypothetical protein EUTSA_v10005750mg             830   0.0     
ref|XP_002960296.1|  ATP-binding cassette transporter                   832   0.0     
ref|XP_011005954.1|  PREDICTED: ABC transporter B family member 4...    830   0.0     
ref|XP_006303653.1|  hypothetical protein CARUB_v10011664mg             828   0.0     
ref|XP_009360960.1|  PREDICTED: ABC transporter B family member 9...    829   0.0     
ref|XP_007032498.1|  ATP binding cassette subfamily B19 isoform 2       827   0.0     
ref|XP_010457233.1|  PREDICTED: ABC transporter B family member 1...    830   0.0     
ref|XP_007225454.1|  hypothetical protein PRUPE_ppa000316mg             829   0.0     
ref|XP_002967417.1|  hypothetical protein SELMODRAFT_87743              830   0.0     
ref|XP_009104300.1|  PREDICTED: ABC transporter B family member 5...    827   0.0     
ref|XP_007014439.1|  ABC transporter family protein, putative           817   0.0     
ref|XP_004499289.1|  PREDICTED: ABC transporter B family member 1...    826   0.0     
emb|CDX79704.1|  BnaC03g20400D                                          830   0.0     
emb|CAN71068.1|  hypothetical protein VITISV_031708                     830   0.0     
ref|XP_010457230.1|  PREDICTED: ABC transporter B family member 1...    830   0.0     
gb|AFW66244.1|  hypothetical protein ZEAMMB73_446753                    810   0.0     
gb|EYU38439.1|  hypothetical protein MIMGU_mgv1a020314mg                827   0.0     
ref|XP_010478144.1|  PREDICTED: ABC transporter B family member 1...    825   0.0     
dbj|BAM33973.1|  ATP-binding cassette protein                           826   0.0     
emb|CAN63836.1|  hypothetical protein VITISV_036111                     810   0.0     
gb|EYU46879.1|  hypothetical protein MIMGU_mgv1a000296mg                826   0.0     
ref|XP_004485973.1|  PREDICTED: ABC transporter B family member 9...    826   0.0     
gb|AAR10387.1|  P-glycoprotein 1                                        830   0.0     
ref|XP_006415715.1|  hypothetical protein EUTSA_v10006582mg             825   0.0     
ref|XP_009371200.1|  PREDICTED: ABC transporter B family member 2...    825   0.0     
gb|KHN06940.1|  ABC transporter B family member 9                       823   0.0     
gb|KGN60362.1|  hypothetical protein Csa_3G901080                       825   0.0     
ref|XP_002893495.1|  P-glycoprotein 13                                  824   0.0     
gb|KHN03224.1|  ABC transporter B family member 11                      823   0.0     
ref|XP_006356120.1|  PREDICTED: ABC transporter B family member 1...    825   0.0     
ref|XP_003520772.2|  PREDICTED: ABC transporter B family member 4...    825   0.0     
ref|XP_006397891.1|  hypothetical protein EUTSA_v10001285mg             825   0.0     
emb|CDY27639.1|  BnaA09g27680D                                          823   0.0     
ref|XP_004301784.1|  PREDICTED: ABC transporter B family member 2...    824   0.0     
gb|AES64104.2|  ABC transporter B family-like protein                   824   0.0     
ref|XP_003567552.1|  PREDICTED: ABC transporter B family member 2...    824   0.0     
ref|XP_009359806.1|  PREDICTED: ABC transporter B family member 1...    824   0.0     
ref|XP_010460561.1|  PREDICTED: ABC transporter B family member 1...    823   0.0     
ref|XP_009353526.1|  PREDICTED: ABC transporter B family member 9...    824   0.0     
ref|XP_010234151.1|  PREDICTED: ABC transporter B family member 1...    823   0.0     
ref|XP_008790456.1|  PREDICTED: ABC transporter B family member 1...    822   0.0     
ref|XP_004485974.1|  PREDICTED: ABC transporter B family member 9...    823   0.0     
ref|XP_008223620.1|  PREDICTED: ABC transporter B family member 4...    824   0.0     
ref|XP_006843046.1|  hypothetical protein AMTR_s00076p00195870          825   0.0     
emb|CDM83826.1|  unnamed protein product                                821   0.0     
ref|XP_006386686.1|  hypothetical protein POPTR_0002s18860g             822   0.0     
ref|XP_006306598.1|  hypothetical protein CARUB_v10008102mg             823   0.0     



>ref|XP_009781980.1| PREDICTED: putative ABC transporter B family member 8 [Nicotiana 
sylvestris]
Length=1245

 Score =  1850 bits (4793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 977/1218 (80%), Positives = 1094/1218 (90%), Gaps = 16/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S+ +IFRYAD IDI LMCLGT+GAIGDG+STNCLL+YVSHLFN+LGYG     ++I   
Sbjct  26    NSVAIIFRYADGIDILLMCLGTIGAIGDGISTNCLLVYVSHLFNSLGYGKTQQNNEI---  82

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M E+EKCSLYFVLLGLAVMV+ FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS
Sbjct  83    -FMEEIEKCSLYFVLLGLAVMVVAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  141

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEITNSISKDT LIQEVLSEKVPIF MHT+VF+SG+ FS YFS RL+LVA PT++
Sbjct  142   QEATTSEITNSISKDTCLIQEVLSEKVPIFFMHTTVFMSGIAFSAYFSRRLALVALPTLI  201

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLL+LS+KSFKEY KAN IV QALSSIKTIYSFTAE+S++ERYSSILDR
Sbjct  202   LLIIPGLIYGKYLLHLSEKSFKEYGKANAIVWQALSSIKTIYSFTAEKSVIERYSSILDR  261

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             TI LGMK GIAKGLAVGSTGLSFAIWA LAWYGS LIMHKGESGGRIYAAG+S+VLGGLS
Sbjct  262   TIMLGMKQGIAKGLAVGSTGLSFAIWALLAWYGSHLIMHKGESGGRIYAAGVSFVLGGLS  321

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPEVKYFTEASVAASRIF+RIDRVP+IDGED  G+VL+ IRGE+EFKNV F YP R
Sbjct  322   LGMALPEVKYFTEASVAASRIFARIDRVPEIDGEDTRGLVLENIRGEVEFKNVNFTYPCR  381

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S+VLK+ NLK+EAGKTVALVGASGSGKSTAIA++QRFYD N G+ICIDGV+I +LQ+K
Sbjct  382   PDSVVLKEFNLKIEAGKTVALVGASGSGKSTAIAMIQRFYDTNVGAICIDGVDIKSLQLK  441

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLRGQMGLVSQEHALFGTSI++NIMLGK+  SM+EVVAAAMTANAH+FI QLP+GYETK+
Sbjct  442   WLRGQMGLVSQEHALFGTSIKKNIMLGKIDASMDEVVAAAMTANAHNFITQLPEGYETKI  501

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGA LSGGQKQR+AIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  502   GERGAFLSGGQKQRVAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASIGRTTLV  561

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAP-  2036
             VAHKLST+RNADLIA+VS GCI E GSH+EL+EK+GHY +MAKLQRQFS  DQ+QS    
Sbjct  562   VAHKLSTVRNADLIAIVSSGCITELGSHNELIEKDGHYGRMAKLQRQFSSVDQEQSAKSL  621

Query  2035  -----SSNAGRQSTEKsspavlassplLIE-TAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                   S+AGRQ +   S   + +SPLLIE ++Q  P      P PSFSRLL LNL EWK
Sbjct  622   ISSVGRSSAGRQRSIIRSSPTVFASPLLIEDSSQASP-----HPPPSFSRLLLLNLPEWK  676

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QG+IGS+SAI+FG+VQP YALTIGGMISAF+SP+HEEMQ RIQK+CL+F++LCL+S  LN
Sbjct  677   QGIIGSLSAISFGSVQPVYALTIGGMISAFYSPTHEEMQFRIQKYCLIFSILCLVSFVLN  736

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             LCQHY FAYMGE LTRRIR++MLEKILTFE AWFDEE NSSGALC+RLSNEAAMVKSLVA
Sbjct  737   LCQHYNFAYMGERLTRRIRMQMLEKILTFEAAWFDEEQNSSGALCSRLSNEAAMVKSLVA  796

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ+ S+VT+AMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT KFVKAQ
Sbjct  797   DRVSLLVQSISAVTVAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITAKFVKAQ  856

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
               STQ AVEAVYNHRIVTSFGSINKVL+IFD AQDE RKEA+KKSWLAGIGIGSAQGL F
Sbjct  857   YQSTQTAVEAVYNHRIVTSFGSINKVLEIFDEAQDESRKEARKKSWLAGIGIGSAQGLAF  916

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             +CWALDFWYGGKLV+ GEIS+ DVFKTFFILVSTGKV+A+AGSMTSDLAKGSAAVASIFA
Sbjct  917   ICWALDFWYGGKLVNAGEISAADVFKTFFILVSTGKVVAEAGSMTSDLAKGSAAVASIFA  976

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I   Y+ K ++ GTNLEK++G IE+KKV+FAYPSRP + +LREF LEVKAG+S
Sbjct  977   ILDRNSLIHGSYDAKNNSSGTNLEKMTGGIEMKKVDFAYPSRPNSLVLREFSLEVKAGTS  1036

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             IGLVGKSG GKST++ALI+RFYD D GS+++DG+D+R  DIGWYRRQMALVSQEPVIYSG
Sbjct  1037  IGLVGKSGCGKSTVIALIQRFYDADRGSLKIDGMDIRLLDIGWYRRQMALVSQEPVIYSG  1096

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TI +NILFGKLDASENE++EAA+ ANAH+FISSL  GYDTECGERGVQLSGGQKQRIAIA
Sbjct  1097  TIHENILFGKLDASENEVVEAARVANAHEFISSLDNGYDTECGERGVQLSGGQKQRIAIA  1156

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAIIR PTILLLDEATSALDV+SEQVVQEALD +M+GRTT+VVAHRLNTI+NLDSI  V 
Sbjct  1157  RAIIRKPTILLLDEATSALDVQSEQVVQEALDRLMVGRTTVVVAHRLNTIRNLDSIVFVY  1216

Query  253   EGKVVEHGTYSQLKNKRG  200
             EGKVVE GTYSQLK+KRG
Sbjct  1217  EGKVVEKGTYSQLKDKRG  1234


 Score =   337 bits (863),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 211/533 (40%), Positives = 316/533 (59%), Gaps = 20/533 (4%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             ++K  L F +L L   V+   + Y ++   ER   +IR + LE IL  E  +FD ++ ++
Sbjct  718   IQKYCLIFSILCLVSFVLNLCQHYNFAYMGERLTRRIRMQMLEKILTFEAAWFDEEQNSS  777

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + ++++ +++++V + +   S     +      +W+L+LV      + I+ 
Sbjct  778   GALCSRLSNEAAMVKSLVADRVSLLVQSISAVTVAMVMGLVVAWKLALVMIAVQPLTILC  837

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  ++ K  K   ++     +A+ + + + SF +   +LE +    D + K  
Sbjct  838   FYTRKVLLSTITAKFVKAQYQSTQTAVEAVYNHRIVTSFGSINKVLEIFDEAQDESRKEA  897

Query  3097  MKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGIS---YVLGGLSL  2930
              K     G+ +GS  GL+F  WA   WYG +L+     + G I AA +    ++L  +S 
Sbjct  898   RKKSWLAGIGIGSAQGLAFICWALDFWYGGKLV-----NAGEISAADVFKTFFIL--VST  950

Query  2929  GMALPEVKYFT----EASVAASRIFSRIDRVPKIDG-----EDKSGMVLDTIRGELEFKN  2777
             G  + E    T    + S A + IF+ +DR   I G      + SG  L+ + G +E K 
Sbjct  951   GKVVAEAGSMTSDLAKGSAAVASIFAILDRNSLIHGSYDAKNNSSGTNLEKMTGGIEMKK  1010

Query  2776  VKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGV  2597
             V FAYPSRP SLVL++ +L+V+AG ++ LVG SG GKST IAL+QRFYDA+ GS+ IDG+
Sbjct  1011  VDFAYPSRPNSLVLREFSLEVKAGTSIGLVGKSGCGKSTVIALIQRFYDADRGSLKIDGM  1070

Query  2596  EINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQL  2417
             +I  L + W R QM LVSQE  ++  +I ENI+ GKL  S  EVV AA  ANAH+FI  L
Sbjct  1071  DIRLLDIGWYRRQMALVSQEPVIYSGTIHENILFGKLDASENEVVEAARVANAHEFISSL  1130

Query  2416  PQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQA  2237
               GY+T+ GERG  LSGGQKQRIAIARAII+ P ILLLDEATSALD +SE++VQ+ALD+ 
Sbjct  1131  DNGYDTECGERGVQLSGGQKQRIAIARAIIRKPTILLLDEATSALDVQSEQVVQEALDRL  1190

Query  2236  SAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
               GRTT+VVAH+L+TIRN D I  V  G ++E+G++S+L +K G +  + KLQ
Sbjct  1191  MVGRTTVVVAHRLNTIRNLDSIVFVYEGKVVEKGTYSQLKDKRGAFFNLVKLQ  1243



>ref|XP_009616711.1| PREDICTED: putative ABC transporter B family member 8 [Nicotiana 
tomentosiformis]
Length=1228

 Score =  1845 bits (4780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 972/1218 (80%), Positives = 1097/1218 (90%), Gaps = 22/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S+ +IFRYAD  DI LMCLGT+GAIGDG+STNCLL+YVSHLFN+LGYG      +I   
Sbjct  15    NSVAIIFRYADGTDILLMCLGTIGAIGDGLSTNCLLVYVSHLFNSLGYGKTQQNDEI---  71

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M E+EKCSLYFVLLGLAVM + FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS
Sbjct  72    -FMEEIEKCSLYFVLLGLAVMAVAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  130

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEITNSISKDT LIQEVLSEKVPIFLMHT+VF+SG+ FS YFSWRL+LVA PT++
Sbjct  131   QEATTSEITNSISKDTCLIQEVLSEKVPIFLMHTTVFMSGIAFSAYFSWRLALVALPTLI  190

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLL+LS+KSFKEY KAN IV QALSSIKTIYSFT E+S++ERY SILDR
Sbjct  191   LLIIPGLIYGKYLLHLSEKSFKEYGKANAIVWQALSSIKTIYSFTGEKSVIERYRSILDR  250

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             TIKLGMK GIAKGLAVGSTGLSFAIWA LAWYGS LIMHKGESGGRIYAAG+S+VLGGLS
Sbjct  251   TIKLGMKQGIAKGLAVGSTGLSFAIWALLAWYGSHLIMHKGESGGRIYAAGVSFVLGGLS  310

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPEVKY TEASVAASRIF+RIDRVP+IDGE   G+VL+ IRGE+EFKNV F YP R
Sbjct  311   LGMALPEVKYLTEASVAASRIFARIDRVPEIDGEHTGGLVLEKIRGEVEFKNVNFTYPCR  370

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+++VL++LNLK+EAGKT+ALVGASGSGKSTAIAL+QRFYD+N G+ICIDGV+I +LQ+K
Sbjct  371   PDTVVLQELNLKIEAGKTLALVGASGSGKSTAIALIQRFYDSNVGAICIDGVDIKSLQLK  430

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLRGQMGLVSQEHALFGTSI++NIM GK+  +M+EVVAAAMTANAH+FI QLP+GYETK+
Sbjct  431   WLRGQMGLVSQEHALFGTSIKKNIMFGKIDATMDEVVAAAMTANAHNFITQLPEGYETKI  490

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  491   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASIGRTTLV  550

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSC-ADQDQSFAP  2036
             VAHKLST+RNADLIAVVS GCI E GSH+EL++K+GHY +MAKLQRQFS   DQ+QS   
Sbjct  551   VAHKLSTVRNADLIAVVSSGCITELGSHNELIQKDGHYGRMAKLQRQFSSHVDQEQSAES  610

Query  2035  ------SSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                    S+AGRQS+  SSP++ AS  L+ +++Q  P        PSFSRLL LNL EWK
Sbjct  611   LISSVGRSSAGRQSSITSSPSIFASPLLIQDSSQASP--------PSFSRLLSLNLPEWK  662

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QG+ GS+SAIAFG+VQP YALTIGGMISAF+SP+HEEMQ+RIQK+C++F++LCL+S  LN
Sbjct  663   QGITGSLSAIAFGSVQPVYALTIGGMISAFYSPTHEEMQSRIQKYCMIFSILCLVSFVLN  722

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             LCQHY FAYMGEHLTRRIRL+MLEKILTFE AWFDEEHNSSGALC+RLSNEAAMVKSLVA
Sbjct  723   LCQHYNFAYMGEHLTRRIRLQMLEKILTFEAAWFDEEHNSSGALCSRLSNEAAMVKSLVA  782

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ+ S+VT+AMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT KFVKAQ
Sbjct  783   DRVSLLVQSTSAVTVAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITAKFVKAQ  842

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
               STQIA+EAVYNHRIVTSFGSINKVL+IFD AQDEPRKEA+KKSWLAG+GIGSAQGLTF
Sbjct  843   YQSTQIAMEAVYNHRIVTSFGSINKVLEIFDEAQDEPRKEARKKSWLAGVGIGSAQGLTF  902

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             +CWALDFWYGGKLV+ GEIS+ DVFKTFFILVSTGKV+A+AGSMTSDLAKGSAAVASIFA
Sbjct  903   ICWALDFWYGGKLVNAGEISAADVFKTFFILVSTGKVVAEAGSMTSDLAKGSAAVASIFA  962

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I   YN K     +NLEK++G+IE+KKV+FAYP+RP + +LREF LEVKAG+S
Sbjct  963   ILDRKSLIQGSYNAK---NNSNLEKMTGRIEMKKVDFAYPTRPNSLVLREFNLEVKAGTS  1019

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             IGLVGKSG GKST++ALI+RFYD D GS+++DG+D+R  DIGWYRRQMALVSQEPVIYSG
Sbjct  1020  IGLVGKSGCGKSTVIALIQRFYDTDRGSLKIDGMDIRLLDIGWYRRQMALVSQEPVIYSG  1079

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TI +NILFGKL ASE+E++EAA+AANAH FISSL  GYDTECGERGVQLSGGQKQRIAIA
Sbjct  1080  TIYENILFGKLHASESEVVEAARAANAHDFISSLNNGYDTECGERGVQLSGGQKQRIAIA  1139

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAIIRNPTILLLDEATSALDV+SEQVVQEALD +M+GRTT+VVAHRLNTI+N+DSIA V 
Sbjct  1140  RAIIRNPTILLLDEATSALDVQSEQVVQEALDRLMVGRTTVVVAHRLNTIRNVDSIAFVY  1199

Query  253   EGKVVEHGTYSQLKNKRG  200
             EGKVVE GTYS+LK+KRG
Sbjct  1200  EGKVVEKGTYSRLKDKRG  1217


 Score =   337 bits (864),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 210/534 (39%), Positives = 314/534 (59%), Gaps = 17/534 (3%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   ++K  + F +L L   V+   + Y ++   E    +IR + LE IL  E  +FD +
Sbjct  700   MQSRIQKYCMIFSILCLVSFVLNLCQHYNFAYMGEHLTRRIRLQMLEKILTFEAAWFDEE  759

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               ++  + + +S + ++++ +++++V + +  TS     +      +W+L+LV      +
Sbjct  760   HNSSGALCSRLSNEAAMVKSLVADRVSLLVQSTSAVTVAMVMGLVVAWKLALVMIAVQPL  819

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  ++ K  K   ++  I  +A+ + + + SF +   +LE +    D  
Sbjct  820   TILCFYTRKVLLSTITAKFVKAQYQSTQIAMEAVYNHRIVTSFGSINKVLEIFDEAQDEP  879

Query  3109  IKLGMKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGIS---YVLG  2942
              K   K     G+ +GS  GL+F  WA   WYG +L+     + G I AA +    ++L 
Sbjct  880   RKEARKKSWLAGVGIGSAQGLTFICWALDFWYGGKLV-----NAGEISAADVFKTFFIL-  933

Query  2941  GLSLGMALPEVKYFT----EASVAASRIFSRIDRVPKIDG--EDKSGMVLDTIRGELEFK  2780
              +S G  + E    T    + S A + IF+ +DR   I G    K+   L+ + G +E K
Sbjct  934   -VSTGKVVAEAGSMTSDLAKGSAAVASIFAILDRKSLIQGSYNAKNNSNLEKMTGRIEMK  992

Query  2779  NVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDG  2600
              V FAYP+RP SLVL++ NL+V+AG ++ LVG SG GKST IAL+QRFYD + GS+ IDG
Sbjct  993   KVDFAYPTRPNSLVLREFNLEVKAGTSIGLVGKSGCGKSTVIALIQRFYDTDRGSLKIDG  1052

Query  2599  VEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQ  2420
             ++I  L + W R QM LVSQE  ++  +I ENI+ GKL  S  EVV AA  ANAHDFI  
Sbjct  1053  MDIRLLDIGWYRRQMALVSQEPVIYSGTIYENILFGKLHASESEVVEAARAANAHDFISS  1112

Query  2419  LPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQ  2240
             L  GY+T+ GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+
Sbjct  1113  LNNGYDTECGERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDR  1172

Query  2239  ASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
                GRTT+VVAH+L+TIRN D IA V  G ++E+G++S L +K G +  +  +Q
Sbjct  1173  LMVGRTTVVVAHRLNTIRNVDSIAFVYEGKVVEKGTYSRLKDKRGAFFNLVNIQ  1226



>ref|XP_006361608.1| PREDICTED: putative ABC transporter B family member 8-like [Solanum 
tuberosum]
Length=1227

 Score =  1806 bits (4677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 955/1212 (79%), Positives = 1081/1212 (89%), Gaps = 11/1212 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI +IFRYAD  DI LM LGT+GAIGDG+STNCLL+YVS LFN+LGYG     +     
Sbjct  15    NSIGIIFRYADGKDILLMFLGTIGAIGDGISTNCLLVYVSQLFNSLGYGKTQQINHN---  71

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M ++EKCSLYFVLLGL VMV+ FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS
Sbjct  72    -FMEQIEKCSLYFVLLGLGVMVVAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  130

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEITN ISKDTSLIQEVLSEKVP+F+MHT+VF+SG+ FS YFSWRL++VA PTI 
Sbjct  131   QEATTSEITNGISKDTSLIQEVLSEKVPLFVMHTTVFISGIVFSAYFSWRLAIVALPTIF  190

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLLYLS KSFKEYSKANGIV QALSSIKTIYSFTAE+S++ERYS ILD 
Sbjct  191   LLIIPGLIYGKYLLYLSGKSFKEYSKANGIVEQALSSIKTIYSFTAEKSVIERYSLILDG  250

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             TIKLGMK GIAKGLAVGSTGLSFAIWA LAWYGS LIMH GESGGRIYAAG+S+VLGGLS
Sbjct  251   TIKLGMKQGIAKGLAVGSTGLSFAIWALLAWYGSHLIMHNGESGGRIYAAGVSFVLGGLS  310

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPEVKYFTEASVAASRIF RIDRVP+IDGED  G+VL+ IRGE+EF+NV F YPSR
Sbjct  311   LGMALPEVKYFTEASVAASRIFDRIDRVPEIDGEDTRGLVLEDIRGEVEFRNVMFTYPSR  370

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+++VLKDLNLK+EAGKTVALVG+SGSGKST IAL+QRFYDAN+G+ICID VEI +LQ+K
Sbjct  371   PDTVVLKDLNLKIEAGKTVALVGSSGSGKSTVIALIQRFYDANAGAICIDSVEIKSLQLK  430

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLRG+MGLVSQE+ALFGTSIRENIM GK+  +M+EVVAAAMTANAH+FI QLP+GYETK+
Sbjct  431   WLRGKMGLVSQENALFGTSIRENIMFGKVDATMDEVVAAAMTANAHNFITQLPEGYETKI  490

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQA  GRTTLV
Sbjct  491   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQAIVGRTTLV  550

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             VAHKLST+RNADLIAVVS GCI E G+H+ELMEK+G YA++AKLQRQFS  DQ+QS  P 
Sbjct  551   VAHKLSTVRNADLIAVVSNGCISELGAHNELMEKDGQYARLAKLQRQFSSIDQEQSAEPR  610

Query  2032  -SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGS  1856
              S+  R S    +   + +SPLLIE     P      P PSF+RLL LNL EWKQG+IG 
Sbjct  611   ISSVARSSAGMRASPAVTASPLLIE---DCPIQASPHPPPSFTRLLSLNLPEWKQGIIGI  667

Query  1855  ISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYC  1676
             +SAIAFG+VQP YALTIGGMISAF+SPSHEEMQ+RIQK+C++F +LCL+S+ LNLCQHY 
Sbjct  668   LSAIAFGSVQPVYALTIGGMISAFYSPSHEEMQSRIQKYCMIFIILCLVSVVLNLCQHYN  727

Query  1675  FAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLL  1496
             FAYMGE LTRRIRL+MLEKIL+FE AWFDEE NSSGALC RLSNEAAMVKSLVADR+SLL
Sbjct  728   FAYMGERLTRRIRLQMLEKILSFEAAWFDEEQNSSGALCCRLSNEAAMVKSLVADRVSLL  787

Query  1495  VQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQI  1316
             VQ+ S+VT+AMVMGL+VAWKLALVMI VQPLTILCFYTRKVLLST+T KFVKAQ  STQI
Sbjct  788   VQSTSAVTVAMVMGLIVAWKLALVMIVVQPLTILCFYTRKVLLSTMTAKFVKAQCRSTQI  847

Query  1315  AVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALD  1136
             AVEAVYNHRIVTSFGSI+KVLDIFD AQDEPRKEA+KKSWLAGIGIGSAQGLTF+CWALD
Sbjct  848   AVEAVYNHRIVTSFGSIHKVLDIFDEAQDEPRKEARKKSWLAGIGIGSAQGLTFICWALD  907

Query  1135  FWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPS  956
             FWYGGKLV+ GEIS+ DVFKTFFILVSTGKVIA+AGSMTSDLAKGS  VASIF+ILDR S
Sbjct  908   FWYGGKLVNAGEISAADVFKTFFILVSTGKVIAEAGSMTSDLAKGSTVVASIFSILDRKS  967

Query  955   IITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGK  776
             +I   +  K ++ GT   K++G+IE+KKV+F+YPSRP+  +L EF LEVKAG+SIGLVGK
Sbjct  968   LIEGSHEAKNNSIGT---KMTGRIEMKKVDFSYPSRPDRLVLHEFSLEVKAGTSIGLVGK  1024

Query  775   SGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNI  596
             SG GKST++ALI+RFYD D GS+++DG+D+R  D+GWYRR MALVSQEPVIYSGTIR+NI
Sbjct  1025  SGCGKSTVIALIQRFYDADKGSLKIDGMDIRLLDLGWYRRNMALVSQEPVIYSGTIRENI  1084

Query  595   LFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRN  416
             LFGKL+ASENE++EAAKAANAH+FISSLK GY+TECG+RGV +SGGQKQRIAIARAIIRN
Sbjct  1085  LFGKLNASENEVVEAAKAANAHEFISSLKNGYETECGDRGVTISGGQKQRIAIARAIIRN  1144

Query  415   PTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVE  236
             P+ILLLDEATSALDV+SEQ+VQEALD +M+GRTT+VVAHRLNTI+NLDSIA +SEGK++E
Sbjct  1145  PSILLLDEATSALDVQSEQLVQEALDQLMVGRTTVVVAHRLNTIRNLDSIAFISEGKILE  1204

Query  235   HGTYSQLKNKRG  200
              GTYS LK+KRG
Sbjct  1205  KGTYSYLKDKRG  1216


 Score =   339 bits (870),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 211/534 (40%), Positives = 318/534 (60%), Gaps = 17/534 (3%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   ++K  + F++L L  +V+   + Y ++   ER   +IR + LE IL  E  +FD +
Sbjct  699   MQSRIQKYCMIFIILCLVSVVLNLCQHYNFAYMGERLTRRIRLQMLEKILSFEAAWFDEE  758

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  +   +S + ++++ +++++V + +  TS     +      +W+L+LV      +
Sbjct  759   QNSSGALCCRLSNEAAMVKSLVADRVSLLVQSTSAVTVAMVMGLIVAWKLALVMIVVQPL  818

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  ++ K  K   ++  I  +A+ + + + SF +   +L+ +    D  
Sbjct  819   TILCFYTRKVLLSTMTAKFVKAQCRSTQIAVEAVYNHRIVTSFGSIHKVLDIFDEAQDEP  878

Query  3109  IKLGMKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGIS---YVLG  2942
              K   K     G+ +GS  GL+F  WA   WYG +L+     + G I AA +    ++L 
Sbjct  879   RKEARKKSWLAGIGIGSAQGLTFICWALDFWYGGKLV-----NAGEISAADVFKTFFIL-  932

Query  2941  GLSLGMALPEVKYFT----EASVAASRIFSRIDRVPKIDG--EDKSGMVLDTIRGELEFK  2780
              +S G  + E    T    + S   + IFS +DR   I+G  E K+  +   + G +E K
Sbjct  933   -VSTGKVIAEAGSMTSDLAKGSTVVASIFSILDRKSLIEGSHEAKNNSIGTKMTGRIEMK  991

Query  2779  NVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDG  2600
              V F+YPSRP+ LVL + +L+V+AG ++ LVG SG GKST IAL+QRFYDA+ GS+ IDG
Sbjct  992   KVDFSYPSRPDRLVLHEFSLEVKAGTSIGLVGKSGCGKSTVIALIQRFYDADKGSLKIDG  1051

Query  2599  VEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQ  2420
             ++I  L + W R  M LVSQE  ++  +IRENI+ GKL  S  EVV AA  ANAH+FI  
Sbjct  1052  MDIRLLDLGWYRRNMALVSQEPVIYSGTIRENILFGKLNASENEVVEAAKAANAHEFISS  1111

Query  2419  LPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQ  2240
             L  GYET+ G+RG  +SGGQKQRIAIARAII+NP ILLLDEATSALD +SE+LVQ+ALDQ
Sbjct  1112  LKNGYETECGDRGVTISGGQKQRIAIARAIIRNPSILLLDEATSALDVQSEQLVQEALDQ  1171

Query  2239  ASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
                GRTT+VVAH+L+TIRN D IA +S G I+E+G++S L +K G +  +  LQ
Sbjct  1172  LMVGRTTVVVAHRLNTIRNLDSIAFISEGKILEKGTYSYLKDKRGAFFNLVNLQ  1225



>ref|XP_010318180.1| PREDICTED: putative ABC transporter B family member 8 [Solanum 
lycopersicum]
 ref|XP_010318181.1| PREDICTED: putative ABC transporter B family member 8 [Solanum 
lycopersicum]
Length=1227

 Score =  1801 bits (4666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 953/1212 (79%), Positives = 1079/1212 (89%), Gaps = 11/1212 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI +IFRYAD  DI LM LGT+GAIGDG+STNCLL+YVS LFN+LGYG           
Sbjct  15    NSIGIIFRYADGKDILLMFLGTIGAIGDGISTNCLLVYVSQLFNSLGYGKTQQNDHN---  71

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M ++EKCSLYFVLLGL VMV+ FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS
Sbjct  72    -FMEQIEKCSLYFVLLGLGVMVVAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  130

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEITN ISKDTSLIQEVLSEKVP+F+MHT+VF+SG+ FS YFSWRL++VA PTI 
Sbjct  131   QEATTSEITNGISKDTSLIQEVLSEKVPLFVMHTTVFISGVVFSAYFSWRLAIVALPTIF  190

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLLYLS KSFKEYSKANGIV QALSSIKTIYSFTAE+S++ERYS ILD 
Sbjct  191   LLIIPGLIYGKYLLYLSGKSFKEYSKANGIVEQALSSIKTIYSFTAEKSVIERYSLILDG  250

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             TIKLGMK GIAKGLAVGSTGLSFAIWA LAWYGS LIMH GESGGRIYAAG+S+VLGGLS
Sbjct  251   TIKLGMKQGIAKGLAVGSTGLSFAIWALLAWYGSHLIMHNGESGGRIYAAGVSFVLGGLS  310

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPEVKYFTEASVAASRIF RIDRVP+IDGED  G+VL+ IRGE+EF+NVKF YPSR
Sbjct  311   LGMALPEVKYFTEASVAASRIFDRIDRVPEIDGEDTRGLVLEDIRGEVEFRNVKFTYPSR  370

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+++VLKD NLK+EAGKTVALVG+SGSGKSTAIAL+QRFYDA++G+ICID VEI +LQ+K
Sbjct  371   PDTVVLKDFNLKIEAGKTVALVGSSGSGKSTAIALIQRFYDASAGAICIDSVEIKSLQLK  430

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLRG+MGLVSQE+ALFGTSI+ENIM GK+  +M+EVVAAAMTANAH+FI QLP+GYETK+
Sbjct  431   WLRGKMGLVSQENALFGTSIKENIMFGKVDATMDEVVAAAMTANAHNFITQLPEGYETKI  490

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQA  GRTTLV
Sbjct  491   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQAIVGRTTLV  550

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             VAHKLST+RNADLIAVVS GCI E G+H ELMEK+G YA++AK QRQFS  DQ+QS  P 
Sbjct  551   VAHKLSTVRNADLIAVVSNGCISELGAHYELMEKDGQYARLAKFQRQFSSIDQEQSAEPR  610

Query  2032  -SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGS  1856
              S+  R S    +   +++SPL IE +   P      P PSF+RLL LNL EWKQG+IG 
Sbjct  611   ISSVARSSAGMRASPAVSASPLRIEDS---PIQASPHPPPSFTRLLSLNLPEWKQGIIGI  667

Query  1855  ISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYC  1676
             +SAIAFG+VQP YALTIGGMISAF+SPSHEEMQ+RIQK+C++F +LCL+S+ LNLCQHY 
Sbjct  668   LSAIAFGSVQPVYALTIGGMISAFYSPSHEEMQSRIQKYCMIFIILCLVSVVLNLCQHYN  727

Query  1675  FAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLL  1496
             FAYMGE LTRRIRL+MLEKIL+FE AWFDEE NSSGALC RLSNEAAMVKSLVADR+SLL
Sbjct  728   FAYMGERLTRRIRLQMLEKILSFEAAWFDEEQNSSGALCCRLSNEAAMVKSLVADRVSLL  787

Query  1495  VQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQI  1316
             VQ+ S+VT+AMVMGL+VAWKLALVMI VQPLTILCFYTRKVLLST+T KFVKAQ  STQI
Sbjct  788   VQSTSAVTVAMVMGLIVAWKLALVMIVVQPLTILCFYTRKVLLSTMTAKFVKAQCRSTQI  847

Query  1315  AVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALD  1136
             AVEAVYNHRIVTSFGSI+KVLDIFD AQDEPRKEA+KKSWLAGIGIGSAQGLTF+CWALD
Sbjct  848   AVEAVYNHRIVTSFGSIDKVLDIFDEAQDEPRKEARKKSWLAGIGIGSAQGLTFICWALD  907

Query  1135  FWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPS  956
             FWYGGKLV+ GEIS+ DVFKTFFILVSTGKVIA+AGSMTSDLAKGS  VASIF+ILDR S
Sbjct  908   FWYGGKLVNAGEISAADVFKTFFILVSTGKVIAEAGSMTSDLAKGSTVVASIFSILDRKS  967

Query  955   IITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGK  776
             +I      K ++ GT   K++G+IE+KKV+FAYPSRP+  +L EF LEVKAG+SIGLVGK
Sbjct  968   LIEGSNEAKNNSMGT---KMTGRIEMKKVDFAYPSRPDRLVLHEFSLEVKAGTSIGLVGK  1024

Query  775   SGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNI  596
             SG GKST++ALI+RFYD D GS+++DG+D+R  D+GWYRR MALVSQEPVIYSG+IR+NI
Sbjct  1025  SGCGKSTVIALIQRFYDADKGSLKIDGMDIRLLDLGWYRRNMALVSQEPVIYSGSIRENI  1084

Query  595   LFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRN  416
             LFGKL+ASENE++EAAKAANAH+FISSLK GY+TECG+RGV +SGGQKQRIAIARAIIRN
Sbjct  1085  LFGKLNASENEVVEAAKAANAHEFISSLKNGYETECGDRGVTISGGQKQRIAIARAIIRN  1144

Query  415   PTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVE  236
             P+ILLLDEATSALDV+SEQ+VQEALD +M+GRTT+VVAHRLNTI+NLDSIA +SEGKV+E
Sbjct  1145  PSILLLDEATSALDVQSEQLVQEALDQLMVGRTTVVVAHRLNTIRNLDSIAFISEGKVLE  1204

Query  235   HGTYSQLKNKRG  200
              GTYS LK+KRG
Sbjct  1205  KGTYSYLKDKRG  1216


 Score =   339 bits (869),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 212/534 (40%), Positives = 318/534 (60%), Gaps = 17/534 (3%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   ++K  + F++L L  +V+   + Y ++   ER   +IR + LE IL  E  +FD +
Sbjct  699   MQSRIQKYCMIFIILCLVSVVLNLCQHYNFAYMGERLTRRIRLQMLEKILSFEAAWFDEE  758

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  +   +S + ++++ +++++V + +  TS     +      +W+L+LV      +
Sbjct  759   QNSSGALCCRLSNEAAMVKSLVADRVSLLVQSTSAVTVAMVMGLIVAWKLALVMIVVQPL  818

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  ++ K  K   ++  I  +A+ + + + SF +   +L+ +    D  
Sbjct  819   TILCFYTRKVLLSTMTAKFVKAQCRSTQIAVEAVYNHRIVTSFGSIDKVLDIFDEAQDEP  878

Query  3109  IKLGMKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGIS---YVLG  2942
              K   K     G+ +GS  GL+F  WA   WYG +L+     + G I AA +    ++L 
Sbjct  879   RKEARKKSWLAGIGIGSAQGLTFICWALDFWYGGKLV-----NAGEISAADVFKTFFIL-  932

Query  2941  GLSLGMALPEVKYFT----EASVAASRIFSRIDRVPKIDG--EDKSGMVLDTIRGELEFK  2780
              +S G  + E    T    + S   + IFS +DR   I+G  E K+  +   + G +E K
Sbjct  933   -VSTGKVIAEAGSMTSDLAKGSTVVASIFSILDRKSLIEGSNEAKNNSMGTKMTGRIEMK  991

Query  2779  NVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDG  2600
              V FAYPSRP+ LVL + +L+V+AG ++ LVG SG GKST IAL+QRFYDA+ GS+ IDG
Sbjct  992   KVDFAYPSRPDRLVLHEFSLEVKAGTSIGLVGKSGCGKSTVIALIQRFYDADKGSLKIDG  1051

Query  2599  VEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQ  2420
             ++I  L + W R  M LVSQE  ++  SIRENI+ GKL  S  EVV AA  ANAH+FI  
Sbjct  1052  MDIRLLDLGWYRRNMALVSQEPVIYSGSIRENILFGKLNASENEVVEAAKAANAHEFISS  1111

Query  2419  LPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQ  2240
             L  GYET+ G+RG  +SGGQKQRIAIARAII+NP ILLLDEATSALD +SE+LVQ+ALDQ
Sbjct  1112  LKNGYETECGDRGVTISGGQKQRIAIARAIIRNPSILLLDEATSALDVQSEQLVQEALDQ  1171

Query  2239  ASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
                GRTT+VVAH+L+TIRN D IA +S G ++E+G++S L +K G +  +  LQ
Sbjct  1172  LMVGRTTVVVAHRLNTIRNLDSIAFISEGKVLEKGTYSYLKDKRGAFFNLVNLQ  1225



>emb|CDP03260.1| unnamed protein product [Coffea canephora]
Length=1229

 Score =  1760 bits (4559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 932/1223 (76%), Positives = 1058/1223 (87%), Gaps = 28/1223 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI +IFRYADW D+ LM LGT+GAIGDG STNCLLLYV+HLFN+LGYG           
Sbjct  12    NSIALIFRYADWQDLLLMFLGTIGAIGDGSSTNCLLLYVTHLFNSLGYGKTQLNHWN---  68

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M  VEKCSLYFV LGLAVMV+ FMEGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  69    -FMAVVEKCSLYFVYLGLAVMVVAFMEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  127

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEI +SISKDTSL+QEVLSEKVP+FLMH++ F+S LGFSTYFSWRL+LVA+PT++
Sbjct  128   QEATTSEIIDSISKDTSLMQEVLSEKVPLFLMHSTSFISALGFSTYFSWRLALVAFPTML  187

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIY KYLL+LSKKS +EYSKAN IVGQALSSIKT+YSFTAER I+++YSSILDR
Sbjct  188   LLIIPGLIYKKYLLFLSKKSSEEYSKANAIVGQALSSIKTVYSFTAERGIVQKYSSILDR  247

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T KLG+K GIAKGLAVGSTGL+FAIWA LAWYGS L+M+KGESGGRIYAAGIS+V+GGLS
Sbjct  248   TTKLGIKQGIAKGLAVGSTGLAFAIWALLAWYGSHLVMYKGESGGRIYAAGISFVMGGLS  307

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPEVKYFTEASVA SRIF+RIDR+P+IDG+D  G  LD +RGE+EF++V+F YPSR
Sbjct  308   LGMALPEVKYFTEASVAVSRIFNRIDRIPEIDGDDTKGTQLDKVRGEVEFQHVQFTYPSR  367

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+SLVLKD NLK+EAGKTVALVGASGSGKSTAIAL+QRFYDANSG + +DGV+I +LQ+K
Sbjct  368   PDSLVLKDFNLKIEAGKTVALVGASGSGKSTAIALVQRFYDANSGVVRVDGVDIKSLQLK  427

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQEHALF T+I+ENIM  K   +M EV+ AA  ANAHDFIRQLP GYETKV
Sbjct  428   WLRSQMGLVSQEHALFATTIKENIMFAKHDATMNEVLTAATAANAHDFIRQLPDGYETKV  487

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAII+NPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  488   GERGALLSGGQKQRIAIARAIIRNPVILLLDEATSALDSESETLVQNALDQASMGRTTLV  547

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSF---  2042
             VAHKLST+RNADLIAV+SGGC+IE GSHSEL+ KNG+YA+MAK QRQFS  D +      
Sbjct  548   VAHKLSTVRNADLIAVMSGGCVIEMGSHSELINKNGYYAKMAKFQRQFSAVDHEHHMEAS  607

Query  2041  ---APSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQ----PSPSFSRLLGLNLT  1883
                   S+ GR+S  +S              A  +P D+  +    P PSF RLL +N  
Sbjct  608   VSSVAKSSGGRRSETRSPAIF----------ASPLPVDNTPKSAPYPPPSFFRLLSMNAP  657

Query  1882  EWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsi  1703
             EWKQG+IGSISAIAFGAVQP YALTIGGMISAFFSPSHEEMQARIQ +  +F+ LCL+S+
Sbjct  658   EWKQGVIGSISAIAFGAVQPVYALTIGGMISAFFSPSHEEMQARIQTYATIFSSLCLVSM  717

Query  1702  tlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKS  1523
              +NLCQHY F YMGEHLT+RIRLR+LEKILTFE AWFDEE NSSG LC+RLS EA++VKS
Sbjct  718   VVNLCQHYNFGYMGEHLTKRIRLRVLEKILTFEPAWFDEEKNSSGVLCSRLSTEASLVKS  777

Query  1522  LVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFV  1343
             LVADRLSLLVQ  S+VTIAM+MGL+VAWKLALVMIAVQPLTILCFYTR+VLLSTIT KFV
Sbjct  778   LVADRLSLLVQTTSAVTIAMIMGLIVAWKLALVMIAVQPLTILCFYTRRVLLSTITAKFV  837

Query  1342  KAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQG  1163
             KAQ  STQIAVEAVYNHRIVTS+GSI+KVL IFD AQDE RKEA+KKS LAG+GIGSAQG
Sbjct  838   KAQYDSTQIAVEAVYNHRIVTSYGSIHKVLQIFDEAQDEARKEARKKSLLAGVGIGSAQG  897

Query  1162  LTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVAS  983
             LTFM WALDFWYGG+L+++G ISSGDVFKTFFILVSTGKVIA+AGSMTSDLAKGSAAVAS
Sbjct  898   LTFMSWALDFWYGGRLINSGNISSGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSAAVAS  957

Query  982   IFAILDRPSIITSPYNGKVDNG--GTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
             IFAILDR S+I  P   K  +G   T ++K+ G IE+KKV FAYP RPE  +L  F L V
Sbjct  958   IFAILDRKSLI--PETDKAGDGYTETKVKKICGGIEMKKVEFAYPGRPEIRVLNGFSLGV  1015

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             K G+SIGLVGKSG GKST++ALI+RFYDV GG+++VD +D+R  DIGW+RRQMALVSQEP
Sbjct  1016  KPGTSIGLVGKSGCGKSTVIALIQRFYDVTGGTVKVDQLDIRLLDIGWFRRQMALVSQEP  1075

Query  628   VIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQ  449
             VIYSG+IRDNI+FGK DASENE+++AA+AANAH+FISSL  GY+TECGERGVQLSGGQKQ
Sbjct  1076  VIYSGSIRDNIVFGKPDASENEVVDAARAANAHEFISSLINGYETECGERGVQLSGGQKQ  1135

Query  448   riaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDS  269
             RIAIARAIIRNPTILLLDEATSALD++SEQ+VQEALD IM+GRTT+VVAHRLNTIKNLDS
Sbjct  1136  RIAIARAIIRNPTILLLDEATSALDLQSEQIVQEALDRIMVGRTTVVVAHRLNTIKNLDS  1195

Query  268   IALVSEGKVVEHGTYSQLKNKRG  200
             +A VSEGKV+E G+Y QLKNKRG
Sbjct  1196  VAFVSEGKVIEQGSYGQLKNKRG  1218


 Score =   320 bits (821),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 204/527 (39%), Positives = 299/527 (57%), Gaps = 6/527 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             ++  +  F  L L  MV+   + Y +    E    +IR + LE IL  E  +FD ++ ++
Sbjct  702   IQTYATIFSSLCLVSMVVNLCQHYNFGYMGEHLTKRIRLRVLEKILTFEPAWFDEEKNSS  761

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + +  TS     +      +W+L+LV      + I+ 
Sbjct  762   GVLCSRLSTEASLVKSLVADRLSLLVQTTSAVTIAMIMGLIVAWKLALVMIAVQPLTILC  821

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  ++ K  K    +  I  +A+ + + + S+ +   +L+ +    D   K  
Sbjct  822   FYTRRVLLSTITAKFVKAQYDSTQIAVEAVYNHRIVTSYGSIHKVLQIFDEAQDEARKEA  881

Query  3097  MKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K  +  G+ +GS  GL+F  WA   WYG RLI     S G ++      V  G  +  A
Sbjct  882   RKKSLLAGVGIGSAQGLTFMSWALDFWYGGRLINSGNISSGDVFKTFFILVSTGKVIAEA  941

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG-----MVLDTIRGELEFKNVKFAYPS  2756
                     + S A + IF+ +DR   I   DK+G       +  I G +E K V+FAYP 
Sbjct  942   GSMTSDLAKGSAAVASIFAILDRKSLIPETDKAGDGYTETKVKKICGGIEMKKVEFAYPG  1001

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RPE  VL   +L V+ G ++ LVG SG GKST IAL+QRFYD   G++ +D ++I  L +
Sbjct  1002  RPEIRVLNGFSLGVKPGTSIGLVGKSGCGKSTVIALIQRFYDVTGGTVKVDQLDIRLLDI  1061

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
              W R QM LVSQE  ++  SIR+NI+ GK   S  EVV AA  ANAH+FI  L  GYET+
Sbjct  1062  GWFRRQMALVSQEPVIYSGSIRDNIVFGKPDASENEVVDAARAANAHEFISSLINGYETE  1121

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
              GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRTT+
Sbjct  1122  CGERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDLQSEQIVQEALDRIMVGRTTV  1181

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             VVAH+L+TI+N D +A VS G +IEQGS+ +L  K G +  +  LQ+
Sbjct  1182  VVAHRLNTIKNLDSVAFVSEGKVIEQGSYGQLKNKRGAFFNLLNLQK  1228



>ref|XP_002280453.2| PREDICTED: putative ABC transporter B family member 8 [Vitis 
vinifera]
Length=1238

 Score =  1758 bits (4554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 943/1222 (77%), Positives = 1065/1222 (87%), Gaps = 26/1222 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI+VIFRYADW+D+ LM LGT+GAIGDGMSTNCLL++VS L N+LGYG+           
Sbjct  21    SIVVIFRYADWVDLVLMFLGTVGAIGDGMSTNCLLVFVSRLMNSLGYGNTQKNHGN----  76

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV L LAVMV+ FMEGYCWS+TSERQVL+IRYKYLEA+LRQEVGFFDSQ
Sbjct  77    FMDEVEKCSLYFVYLALAVMVVAFMEGYCWSRTSERQVLRIRYKYLEAVLRQEVGFFDSQ  136

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKDTSLIQEVLSEKVP FLMH SVF+SGL F+TYFSWRLSLVA+P +++
Sbjct  137   EATTSEIINSISKDTSLIQEVLSEKVPTFLMHASVFISGLAFATYFSWRLSLVAFPLLLL  196

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG++YGKYLLYLSKK FKEY KAN IV QALSSIKT+YSFTAER I+ERYS+ILD+T
Sbjct  197   LIIPGMVYGKYLLYLSKKCFKEYGKANSIVEQALSSIKTVYSFTAERRIVERYSAILDKT  256

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
               LG+K GIAKGLAVGSTGLSFAIWAFL+WYGSRL+M+KGESGGRIYAAGIS++LGGLSL
Sbjct  257   TSLGIKQGIAKGLAVGSTGLSFAIWAFLSWYGSRLVMYKGESGGRIYAAGISFILGGLSL  316

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALP+VKYFTEASVAA+RIF RIDR+P+IDGED  G+VLD I GELEF++V F YPSRP
Sbjct  317   GMALPDVKYFTEASVAATRIFDRIDRIPEIDGEDDKGLVLDKILGELEFEHVNFTYPSRP  376

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +S+VLKD NLKV+AGKTVALVGASGSGKSTAIALLQRFYDA+ G I IDGV+I  LQ+KW
Sbjct  377   DSIVLKDFNLKVQAGKTVALVGASGSGKSTAIALLQRFYDADHGVIRIDGVDIRTLQLKW  436

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +RG+MGLVSQEHALFGTSI+ENI+ GK   +M+EVVAAAM ANAH+FIRQLP+GYETKVG
Sbjct  437   IRGKMGLVSQEHALFGTSIKENIIFGKPNATMDEVVAAAMAANAHNFIRQLPEGYETKVG  496

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLVV
Sbjct  497   ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLVV  556

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-----  2048
             AHKL+T+RNADLIAV++GGC+IE GSH +L+ +KNGHYA++AK+QRQFSC DQ+Q     
Sbjct  557   AHKLATVRNADLIAVMNGGCVIEIGSHHDLINKKNGHYAKLAKMQRQFSCDDQEQNSETW  616

Query  2047  -SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDH-----HHQPSPSFSRLLGLNL  1886
              S    S+AGR ST  SSPA+          A  +P D+      H P PSFSRLL LN 
Sbjct  617   ISSVARSSAGRPSTATSSPALF---------ASPLPDDNPKPAISHHP-PSFSRLLSLNS  666

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWKQGLIGS+SAIAFGAVQP YALTIGGMISAFF PSH E++AR++ + L+F+ L L+S
Sbjct  667   PEWKQGLIGSLSAIAFGAVQPVYALTIGGMISAFFLPSHAEIRARVETYSLIFSSLTLIS  726

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
             I LNL QHY FAYMG HLT+RIRL ML KILTFE AWFDEE NSSG LC+RLSNEA++VK
Sbjct  727   IILNLIQHYNFAYMGAHLTKRIRLSMLNKILTFEAAWFDEEQNSSGVLCSRLSNEASIVK  786

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLVADR+SLLVQ  SSVTIAMV+GL VAWKLALVMIAVQPLTILCFYTRKVLLS I+   
Sbjct  787   SLVADRVSLLVQTTSSVTIAMVLGLAVAWKLALVMIAVQPLTILCFYTRKVLLSNISNNV  846

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             V+AQN STQIAVEAVYNHRIVTSFGS+ KVL +FD AQ+EPRKEA KKSWLAGIG+GSA 
Sbjct  847   VEAQNQSTQIAVEAVYNHRIVTSFGSVGKVLQLFDEAQEEPRKEAMKKSWLAGIGMGSAL  906

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LTFM WALDFWYGGKLV +G+IS+GDVFKTFF+LVSTGKVIADAGSMTSDLAKGS AVA
Sbjct  907   CLTFMSWALDFWYGGKLVESGQISAGDVFKTFFVLVSTGKVIADAGSMTSDLAKGSTAVA  966

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+F ILDR S+I   YN   +  GT LEK+SG IEIKKV+FAYPSR E+ +LR+FCLEVK
Sbjct  967   SVFEILDRQSLIPGSYNAGDNMAGTKLEKMSGGIEIKKVDFAYPSRKESLVLRQFCLEVK  1026

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
              G+SIGLVGKSG GKST++ LI+RFYD D G+++VDGVD+R  D+GWYR  MALVSQEPV
Sbjct  1027  PGTSIGLVGKSGCGKSTVIGLIQRFYDADKGTVKVDGVDIRELDLGWYRMHMALVSQEPV  1086

Query  625   IYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             IYSG+IRDNILFGKLDASENE++EAA+AANAH+FISSLK GY+TECGERGVQLSGGQKQR
Sbjct  1087  IYSGSIRDNILFGKLDASENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQKQR  1146

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSI  266
             I IARAIIRNP +LLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LDSI
Sbjct  1147  ITIARAIIRNPIVLLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRLNTIKKLDSI  1206

Query  265   ALVSEGKVVEHGTYSQLKNKRG  200
             A VSEGKVVE GTY+QLK+KRG
Sbjct  1207  AFVSEGKVVERGTYAQLKSKRG  1228


 Score =   324 bits (831),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 199/527 (38%), Positives = 305/527 (58%), Gaps = 6/527 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VE  SL F  L L  +++  ++ Y ++        +IR   L  IL  E  +FD ++ ++
Sbjct  712   VETYSLIFSSLTLISIILNLIQHYNFAYMGAHLTKRIRLSMLNKILTFEAAWFDEEQNSS  771

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+ 
Sbjct  772   GVLCSRLSNEASIVKSLVADRVSLLVQTTSSVTIAMVLGLAVAWKLALVMIAVQPLTILC  831

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S    +  +++  I  +A+ + + + SF +   +L+ +    +   K  
Sbjct  832   FYTRKVLLSNISNNVVEAQNQSTQIAVEAVYNHRIVTSFGSVGKVLQLFDEAQEEPRKEA  891

Query  3097  MKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             MK     G+ +GS   L+F  WA   WYG +L+     S G ++      V  G  +  A
Sbjct  892   MKKSWLAGIGMGSALCLTFMSWALDFWYGGKLVESGQISAGDVFKTFFVLVSTGKVIADA  951

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDG-----EDKSGMVLDTIRGELEFKNVKFAYPS  2756
                     + S A + +F  +DR   I G     ++ +G  L+ + G +E K V FAYPS
Sbjct  952   GSMTSDLAKGSTAVASVFEILDRQSLIPGSYNAGDNMAGTKLEKMSGGIEIKKVDFAYPS  1011

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             R ESLVL+   L+V+ G ++ LVG SG GKST I L+QRFYDA+ G++ +DGV+I  L +
Sbjct  1012  RKESLVLRQFCLEVKPGTSIGLVGKSGCGKSTVIGLIQRFYDADKGTVKVDGVDIRELDL  1071

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
              W R  M LVSQE  ++  SIR+NI+ GKL  S  EVV AA  ANAH+FI  L  GYET+
Sbjct  1072  GWYRMHMALVSQEPVIYSGSIRDNILFGKLDASENEVVEAARAANAHEFISSLKDGYETE  1131

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
              GERG  LSGGQKQRI IARAII+NP++LLLDEATSALD +SE++VQ+ALD+   GRTT+
Sbjct  1132  CGERGVQLSGGQKQRITIARAIIRNPIVLLLDEATSALDVQSEQVVQEALDRIMVGRTTI  1191

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             VVAH+L+TI+  D IA VS G ++E+G++++L  K G +  +A LQ+
Sbjct  1192  VVAHRLNTIKKLDSIAFVSEGKVVERGTYAQLKSKRGAFFNLASLQK  1238



>ref|XP_002514211.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
 gb|EEF48165.1| multidrug resistance protein 1, 2, putative [Ricinus communis]
Length=1230

 Score =  1754 bits (4543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 940/1217 (77%), Positives = 1070/1217 (88%), Gaps = 21/1217 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+ +IFRYADW+DI LM +GT+GAIGDGMSTN LL++ SH+ N+LGYG            
Sbjct  18    SVAIIFRYADWVDILLMLMGTVGAIGDGMSTNILLVFASHIMNSLGYGKTQQNQGN----  73

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGLAVMV+ FMEGY WSKTSERQVLKIRYKYLEA+LRQEVGFFDSQ
Sbjct  74    FMVEVEKCSLYFVYLGLAVMVVAFMEGYSWSKTSERQVLKIRYKYLEAVLRQEVGFFDSQ  133

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKDTSLIQEVLSEKVPIFLMH SVF+SGL F+TYFSWRLSLVAYPT+++
Sbjct  134   EATTSEIINSISKDTSLIQEVLSEKVPIFLMHASVFISGLAFATYFSWRLSLVAYPTLLL  193

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYLL+LSKKS +EYSKAN IV QALSSIKT+YSFTAE+SI++RYS+ILD+T
Sbjct  194   LIIPGMIYGKYLLFLSKKSQREYSKANSIVEQALSSIKTVYSFTAEKSIIDRYSAILDKT  253

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K GIAKGLAVGSTGLSFAIWAFLAWYGS L+M+KGESGGRIYAAGIS++LGGLSL
Sbjct  254   SKLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSHLVMYKGESGGRIYAAGISFILGGLSL  313

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALP++KYFTEASVAA RIF+RIDRVP+IDGED  G+VL+ ++GE+EF++V+F YP+RP
Sbjct  314   GMALPDLKYFTEASVAAKRIFNRIDRVPEIDGEDTKGLVLEKMQGEIEFQHVRFTYPTRP  373

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +S+VLKD NLK EAGKTVALVGASGSGKSTAIAL+QRFYD N G + IDGV+I  L +KW
Sbjct  374   DSIVLKDFNLKAEAGKTVALVGASGSGKSTAIALVQRFYDVNGGFVKIDGVDIRTLNLKW  433

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +RG+MGLVSQEHALFG SI++NIM GKL  +M++V AAAM ANAH+FIRQLP+GYET+VG
Sbjct  434   IRGKMGLVSQEHALFGASIKDNIMFGKLDATMDQVTAAAMAANAHNFIRQLPEGYETRVG  493

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLVV
Sbjct  494   ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLVV  553

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-----  2048
             AHKLSTIRNADLIAVV+ GCIIE GSH++L+  KNGHYA +AKLQRQFS  D +Q     
Sbjct  554   AHKLSTIRNADLIAVVNNGCIIEIGSHNDLINRKNGHYANLAKLQRQFSYNDHEQNPETH  613

Query  2047  -SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQ  1871
              S    S+AGR ST +SSPA+ AS   +++  +  P  H   P PSFSRLL LN  EWKQ
Sbjct  614   VSSVGKSSAGRISTGRSSPAIFASPLPVVDIPK--PVCH---PPPSFSRLLSLNSPEWKQ  668

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
             GL+GS+SAIAFGAVQP YALTIGGMI+AFF+PSHEEM ARI+ +  +F  L L+SI +NL
Sbjct  669   GLMGSLSAIAFGAVQPFYALTIGGMIAAFFAPSHEEMHARIRTYSSIFCSLSLISIIVNL  728

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGE LT RIR+RMLEK+LTFETAWFDEE NSSGALC+RLSNEA+MVKSLVAD
Sbjct  729   VQHYNFAYMGERLTERIRIRMLEKVLTFETAWFDEEKNSSGALCSRLSNEASMVKSLVAD  788

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITT FVKAQN
Sbjct  789   RVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTNFVKAQN  848

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              STQIA EAV+NH+IVTSFGS  KVL +FD+AQ+EPRKEA+KKSWLAGIG+GSAQ LTFM
Sbjct  849   HSTQIAAEAVHNHKIVTSFGSTQKVLQLFDDAQEEPRKEARKKSWLAGIGMGSAQCLTFM  908

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WALDFWYGG LV   EIS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F I
Sbjct  909   SWALDFWYGGTLVQKREISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVFQI  968

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             LDR S+I  P +G     GT LEKL+G+IE+K+++FAYPSRPET ILR+FCLEVK+G+SI
Sbjct  969   LDRQSLI--PVDGA---SGTKLEKLTGRIEMKRIDFAYPSRPETLILRQFCLEVKSGTSI  1023

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
             GLVGKSG GKST++ LI+RFYDV+ GS++VDG+D+R  DI WYRR  ALVSQEPV+YSG+
Sbjct  1024  GLVGKSGCGKSTVIGLIQRFYDVERGSVQVDGMDIRELDILWYRRHTALVSQEPVLYSGS  1083

Query  610   IRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiar  431
             IRDNI+FGKLDA ENE++EAA+AANAH+FISSLK GY+TECGERGVQLSGGQKQRIAIAR
Sbjct  1084  IRDNIVFGKLDAGENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQKQRIAIAR  1143

Query  430   aiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSE  251
             AIIRNPTILLLDEATSALDV+SEQVVQEALD  MIGRTT+VVAHRLNTIK LDSIA V++
Sbjct  1144  AIIRNPTILLLDEATSALDVQSEQVVQEALDRTMIGRTTVVVAHRLNTIKKLDSIAFVAD  1203

Query  250   GKVVEHGTYSQLKNKRG  200
             GKVVE GTYSQLKNKRG
Sbjct  1204  GKVVEQGTYSQLKNKRG  1220


 Score =   330 bits (846),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 196/514 (38%), Positives = 299/514 (58%), Gaps = 1/514 (0%)
 Frame = -2

Query  3616  FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSI  3437
             F  L L  +++  ++ Y ++   ER   +IR + LE +L  E  +FD ++ ++  + + +
Sbjct  716   FCSLSLISIIVNLVQHYNFAYMGERLTERIRIRMLEKVLTFETAWFDEEKNSSGALCSRL  775

Query  3436  SKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygky  3257
             S + S+++ +++++V + +  TS     +      +W+L+LV      + I+        
Sbjct  776   SNEASMVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTILCFYTRKVL  835

Query  3256  llylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAK  3077
             L  ++    K  + +  I  +A+ + K + SF + + +L+ +    +   K   K     
Sbjct  836   LSTITTNFVKAQNHSTQIAAEAVHNHKIVTSFGSTQKVLQLFDDAQEEPRKEARKKSWLA  895

Query  3076  GLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYF  2900
             G+ +GS   L+F  WA   WYG  L+  +  S G ++      V  G  +  A       
Sbjct  896   GIGMGSAQCLTFMSWALDFWYGGTLVQKREISAGDVFKTFFILVSTGKVIAEAGSMTSDL  955

Query  2899  TEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNL  2720
              + S A + +F  +DR   I  +  SG  L+ + G +E K + FAYPSRPE+L+L+   L
Sbjct  956   AKGSTAVASVFQILDRQSLIPVDGASGTKLEKLTGRIEMKRIDFAYPSRPETLILRQFCL  1015

Query  2719  KVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQ  2540
             +V++G ++ LVG SG GKST I L+QRFYD   GS+ +DG++I  L + W R    LVSQ
Sbjct  1016  EVKSGTSIGLVGKSGCGKSTVIGLIQRFYDVERGSVQVDGMDIRELDILWYRRHTALVSQ  1075

Query  2539  EHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQ  2360
             E  L+  SIR+NI+ GKL     EVV AA  ANAH+FI  L  GYET+ GERG  LSGGQ
Sbjct  1076  EPVLYSGSIRDNIVFGKLDAGENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQ  1135

Query  2359  KQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNA  2180
             KQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRTT+VVAH+L+TI+  
Sbjct  1136  KQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDRTMIGRTTVVVAHRLNTIKKL  1195

Query  2179  DLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             D IA V+ G ++EQG++S+L  K G +  +A LQ
Sbjct  1196  DSIAFVADGKVVEQGTYSQLKNKRGAFFNLATLQ  1229



>ref|XP_007203113.1| hypothetical protein PRUPE_ppa023915mg [Prunus persica]
 gb|EMJ04312.1| hypothetical protein PRUPE_ppa023915mg [Prunus persica]
Length=1241

 Score =  1732 bits (4486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 928/1218 (76%), Positives = 1066/1218 (88%), Gaps = 22/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S++ IFRYADW+D+ LM LGT+GA+GDGMSTNCLL++VS L N LGYG +   +     
Sbjct  29    NSVVKIFRYADWVDVVLMVLGTVGAVGDGMSTNCLLVFVSRLMNNLGYGQSQQNNNHGIH  88

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSL FV LGLAVM++ F+EGYCWSKTSERQVLKIRYKYL+A+LRQEVGFFDS
Sbjct  89    -WMHEVEKCSLDFVYLGLAVMLVAFLEGYCWSKTSERQVLKIRYKYLKAVLRQEVGFFDS  147

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSE+ N+ISKDTSLIQEVLSEKVP F+MH+SVF+SGL FSTY SWRL+LVA+PT++
Sbjct  148   QEATTSEVINTISKDTSLIQEVLSEKVPTFVMHSSVFVSGLAFSTYLSWRLALVAFPTLL  207

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSKKS+KEY KAN IV QALSSIKT+Y+FTAER I+ERYS+IL+R
Sbjct  208   LLIIPGMIYGKYLMYLSKKSYKEYGKANSIVEQALSSIKTVYAFTAERRIVERYSAILER  267

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LGMK GIAKGLAVGSTGLSFAIW FLAWYGS L+M+KGESGGRIYAAGIS+VL GLS
Sbjct  268   TSRLGMKQGIAKGLAVGSTGLSFAIWGFLAWYGSHLVMYKGESGGRIYAAGISFVLSGLS  327

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALP+++YFTEA+VAA+RIF RIDR P IDGED  G+VLD IRGELEF  VKF YPSR
Sbjct  328   LGMALPDLRYFTEAAVAATRIFDRIDRRPLIDGEDTQGLVLDNIRGELEFIGVKFTYPSR  387

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S+VL D NLKVEAGKT+ALVGASGSGKSTAIAL+QRFYDA+ G + IDGV+I  LQ+K
Sbjct  388   PDSMVLGDFNLKVEAGKTIALVGASGSGKSTAIALVQRFYDADDGVVRIDGVDIRTLQLK  447

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R +MGLVSQEHALFGTSI+ENIM GKL  SM+EV AAAM ANAH+FIRQLPQGYETK+
Sbjct  448   WIRSKMGLVSQEHALFGTSIKENIMFGKLDASMDEVTAAAMAANAHNFIRQLPQGYETKI  507

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  508   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLV  567

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQ----  2048
             VAHKLST+RNADLIAVVSGGCIIE GSH++L+  +NGHYA++AKLQRQFSC + DQ    
Sbjct  568   VAHKLSTVRNADLIAVVSGGCIIEIGSHNQLINCQNGHYAKLAKLQRQFSCDNVDQERIS  627

Query  2047  -SFAPSSNAGRQSTEKsspavl-assplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
              S    S+AGR ST +SSPA   A SPL +ET+Q  P  H   P  SF RLL LN  EWK
Sbjct  628   VSSVTRSSAGRLSTARSSPASTFAKSPLPLETSQ--PLSH---PPTSFYRLLSLNSPEWK  682

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIGS+SAIAFG+VQP YALTIGGMISAFF  SHEEM+ARI+ + L+F+ L ++SITLN
Sbjct  683   QGLIGSLSAIAFGSVQPVYALTIGGMISAFFVQSHEEMRARIRTYSLIFSALSVISITLN  742

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FAYMGE LT+RIRL+ML+KILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  743   LLQHYNFAYMGEQLTKRIRLQMLQKILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  802

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPL ILCFYT+KVLLS+++  F+KAQ
Sbjct  803   DRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLAILCFYTKKVLLSSLSANFIKAQ  862

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVEAVYNHRIVTSFGS+ KVL++FD AQ+ PRKEA+KKSWLAG+G+GSAQ LTF
Sbjct  863   NHSTQIAVEAVYNHRIVTSFGSVGKVLELFDEAQEAPRKEARKKSWLAGLGMGSAQCLTF  922

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F 
Sbjct  923   MSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVFE  982

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I          G  NLEK++G IE+KKV+FAYPSRPET +LR+F LEVK G+S
Sbjct  983   ILDRHSLIP---------GSRNLEKVTGSIELKKVDFAYPSRPETLVLRQFSLEVKPGTS  1033

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             IGLVGKSG GKST+V LI+RFYD + GS++VDGVD+R  D+ WYRR  ALVSQEPVIYSG
Sbjct  1034  IGLVGKSGCGKSTVVGLIQRFYDAESGSVKVDGVDIRELDVQWYRRHTALVSQEPVIYSG  1093

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIRDNI+FGKLDA E+E+++AA+AANAH+FISSLK GY+TECGERGVQLSGGQKQRIAIA
Sbjct  1094  TIRDNIMFGKLDAPEDEVVKAARAANAHEFISSLKDGYNTECGERGVQLSGGQKQRIAIA  1153

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI+RNPTILLLDEATSALDV+SE +VQEALD IM+GRTT+V+AHRLNTIKNL+ IA V+
Sbjct  1154  RAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVGRTTVVIAHRLNTIKNLEMIAFVA  1213

Query  253   EGKVVEHGTYSQLKNKRG  200
             +GKVVE GTY+QLK+KRG
Sbjct  1214  DGKVVEKGTYAQLKHKRG  1231


 Score =   324 bits (831),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 197/521 (38%), Positives = 300/521 (58%), Gaps = 5/521 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +   SL F  L +  + +  ++ Y ++   E+   +IR + L+ IL  E  +FD ++ ++
Sbjct  724   IRTYSLIFSALSVISITLNLLQHYNFAYMGEQLTKRIRLQMLQKILTFETAWFDEEQNSS  783

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+ 
Sbjct  784   GALCSRLSNEASMVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLAILC  843

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  LS    K  + +  I  +A+ + + + SF +   +LE +    +   K  
Sbjct  844   FYTKKVLLSSLSANFIKAQNHSTQIAVEAVYNHRIVTSFGSVGKVLELFDEAQEAPRKEA  903

Query  3097  MKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     GL +GS   L+F  WA   WYG  L+     S G ++      V  G  +  A
Sbjct  904   RKKSWLAGLGMGSAQCLTFMSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAEA  963

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
                     + S A + +F  +DR   I G       L+ + G +E K V FAYPSRPE+L
Sbjct  964   GSMTSDLAKGSTAVASVFEILDRHSLIPGSRN----LEKVTGSIELKKVDFAYPSRPETL  1019

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VL+  +L+V+ G ++ LVG SG GKST + L+QRFYDA SGS+ +DGV+I  L V+W R 
Sbjct  1020  VLRQFSLEVKPGTSIGLVGKSGCGKSTVVGLIQRFYDAESGSVKVDGVDIRELDVQWYRR  1079

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
                LVSQE  ++  +IR+NIM GKL    +EVV AA  ANAH+FI  L  GY T+ GERG
Sbjct  1080  HTALVSQEPVIYSGTIRDNIMFGKLDAPEDEVVKAARAANAHEFISSLKDGYNTECGERG  1139

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
               LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE LVQ+ALD+   GRTT+V+AH+
Sbjct  1140  VQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVGRTTVVIAHR  1199

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             L+TI+N ++IA V+ G ++E+G++++L  K G +  +A  Q
Sbjct  1200  LNTIKNLEMIAFVADGKVVEKGTYAQLKHKRGAFFNLATCQ  1240



>ref|XP_004288891.1| PREDICTED: putative ABC transporter B family member 8-like [Fragaria 
vesca subsp. vesca]
Length=1250

 Score =  1729 bits (4479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 928/1222 (76%), Positives = 1075/1222 (88%), Gaps = 15/1222 (1%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IFRYADW+D+ LM  GT+GAIGDGMSTNCLLL+ S L N LGYG N  Q   ++GN
Sbjct  22    SVFTIFRYADWVDVVLMVFGTIGAIGDGMSTNCLLLFASRLMNNLGYGQNQMQQNNNHGN  81

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGLAVM++ F+EGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDSQ
Sbjct  82    WMDEVEKCSLYFVYLGLAVMLVAFLEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDSQ  141

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSE+ NSISKDTS +QEVLSEKVPIF MHTSVF+SGL FST+ SWRLSLVA+PT+++
Sbjct  142   EATTSEVINSISKDTSHLQEVLSEKVPIFFMHTSVFVSGLVFSTFMSWRLSLVAFPTLLL  201

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYLLYLSK+S+ EY KAN IV QALSSIKT+YSFTAER+I+ERYS+IL+RT
Sbjct  202   LIIPGMIYGKYLLYLSKQSYMEYGKANTIVEQALSSIKTVYSFTAERTIVERYSAILERT  261

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              +LG+K GIAKGLAVGSTGLSFAIWAFLAWYGS L+M++GESGGRIYAAGIS+VL GLSL
Sbjct  262   SRLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSHLVMYRGESGGRIYAAGISFVLSGLSL  321

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALP++++FTEAS+AASRIF RIDR P IDGED  G+VL+ IRGELEF +V+F YPSRP
Sbjct  322   GMALPDLRHFTEASIAASRIFDRIDRKPLIDGEDTKGIVLNNIRGELEFIDVRFTYPSRP  381

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +S+VLKD NLKVEAGKT+ALVGASGSGKSTAIAL+QRFYDA+ G + IDGV+I  LQ+KW
Sbjct  382   DSIVLKDFNLKVEAGKTIALVGASGSGKSTAIALVQRFYDADCGVVRIDGVDIKTLQLKW  441

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R +MGLVSQEHALFGTSI+ENIM GKL  +M+EV AAAM ANAH+FIRQLP+GYETK+G
Sbjct  442   IRSKMGLVSQEHALFGTSIKENIMFGKLDANMDEVTAAAMAANAHNFIRQLPEGYETKIG  501

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG+LLSGGQKQRIAIARAIIKNP+ILLLDEATSALDSESE LVQ+ALDQAS GRTTLVV
Sbjct  502   ERGSLLSGGQKQRIAIARAIIKNPIILLLDEATSALDSESETLVQNALDQASMGRTTLVV  561

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSC---ADQDQ--  2048
             AHKLST+RNADLIAVVSGGCIIE GSH++L+ + NG YA++AK+QRQFS     DQDQ  
Sbjct  562   AHKLSTVRNADLIAVVSGGCIIEIGSHNDLINRQNGQYAKLAKMQRQFSTFDNVDQDQNS  621

Query  2047  ----SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTE  1880
                 S    S+AGR ST +SSPA+ A SPL IET Q     H   P  SF RLL LN  E
Sbjct  622   DTRLSSVARSSAGRLSTARSSPAMFAKSPLAIETPQSAVLSH---PPTSFYRLLSLNSPE  678

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WKQGLIGS+SAIAFG+VQP YALT+GGMISAFF  SHEEM+ARI+ + L+F+ L L+S+T
Sbjct  679   WKQGLIGSLSAIAFGSVQPIYALTVGGMISAFFVQSHEEMRARIRTYSLIFSALSLVSMT  738

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             LNL QHY FAYMGE LT+RIRL+ML+KILTFETAWFDEEHN+SG LC+RLSNEA+MVKSL
Sbjct  739   LNLLQHYNFAYMGEQLTKRIRLKMLQKILTFETAWFDEEHNTSGQLCSRLSNEASMVKSL  798

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             VADR+SLLVQ  S+VTIAM++GL+VAWKLALVMIAVQPLTILCFYT+KVLLS+++  FVK
Sbjct  799   VADRVSLLVQTTSAVTIAMILGLIVAWKLALVMIAVQPLTILCFYTKKVLLSSLSANFVK  858

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQN STQIAVEAVYNHRIVTSFGS+ KVL IFD AQ+ PRKEA+KK+WLAGIG+GSAQ L
Sbjct  859   AQNHSTQIAVEAVYNHRIVTSFGSVGKVLQIFDKAQEAPRKEARKKAWLAGIGMGSAQCL  918

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
             TFM WALDFWYGGKLV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKG+ AVAS+
Sbjct  919   TFMSWALDFWYGGKLVKMGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGATAVASV  978

Query  979   FAILDRPSIITSPYNGKVDNG--GTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             F ILDR S+I   +N   ++G  G  LEK++GKIE++KV+FAYPSRPET +LR+F LEVK
Sbjct  979   FEILDRHSLIPGSHNVGYEDGTSGIKLEKVAGKIEMRKVDFAYPSRPETLVLRQFSLEVK  1038

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             AG+SIGLVGKSG GKST++ LI+RFYDV+ GS++VDGVD+R  D+ WYR+  ALVSQEPV
Sbjct  1039  AGTSIGLVGKSGCGKSTVIGLIQRFYDVERGSVKVDGVDIRELDVQWYRKHTALVSQEPV  1098

Query  625   IYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             IYSGTIRDNI+FGKLDASENE+ EAA+AANAH+FIS+LK+GY+TECGERGVQLSGGQKQR
Sbjct  1099  IYSGTIRDNIMFGKLDASENEVAEAARAANAHEFISALKEGYETECGERGVQLSGGQKQR  1158

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSI  266
             IAIARAI+RNPTILLLDEATSALDV+SE +VQEALD IM+GRTT+V+AHRLNTIKNL+ I
Sbjct  1159  IAIARAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVGRTTIVIAHRLNTIKNLEMI  1218

Query  265   ALVSEGKVVEHGTYSQLKNKRG  200
             A V +GKV+E GT++QLK+KRG
Sbjct  1219  AFVEDGKVIEKGTFAQLKHKRG  1240


 Score =   313 bits (802),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 203/529 (38%), Positives = 305/529 (58%), Gaps = 8/529 (2%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   SL F  L L  M +  ++ Y ++   E+   +IR K L+ IL  E  +FD +  T
Sbjct  721   RIRTYSLIFSALSLVSMTLNLLQHYNFAYMGEQLTKRIRLKMLQKILTFETAWFDEEHNT  780

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             + ++ + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+
Sbjct  781   SGQLCSRLSNEASMVKSLVADRVSLLVQTTSAVTIAMILGLIVAWKLALVMIAVQPLTIL  840

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  LS    K  + +  I  +A+ + + + SF +   +L+ +    +   K 
Sbjct  841   CFYTKKVLLSSLSANFVKAQNHSTQIAVEAVYNHRIVTSFGSVGKVLQIFDKAQEAPRKE  900

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGM  2924
               K     G+ +GS   L+F  WA   WYG +L+     S G ++      V  G  +  
Sbjct  901   ARKKAWLAGIGMGSAQCLTFMSWALDFWYGGKLVKMGQISAGDVFKTFFILVSTGKVIAE  960

Query  2923  ALPEVKYFTEASVAASRIFSRIDRVPKIDG------ED-KSGMVLDTIRGELEFKNVKFA  2765
             A        + + A + +F  +DR   I G      ED  SG+ L+ + G++E + V FA
Sbjct  961   AGSMTSDLAKGATAVASVFEILDRHSLIPGSHNVGYEDGTSGIKLEKVAGKIEMRKVDFA  1020

Query  2764  YPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINA  2585
             YPSRPE+LVL+  +L+V+AG ++ LVG SG GKST I L+QRFYD   GS+ +DGV+I  
Sbjct  1021  YPSRPETLVLRQFSLEVKAGTSIGLVGKSGCGKSTVIGLIQRFYDVERGSVKVDGVDIRE  1080

Query  2584  LQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGY  2405
             L V+W R    LVSQE  ++  +IR+NIM GKL  S  EV  AA  ANAH+FI  L +GY
Sbjct  1081  LDVQWYRKHTALVSQEPVIYSGTIRDNIMFGKLDASENEVAEAARAANAHEFISALKEGY  1140

Query  2404  ETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR  2225
             ET+ GERG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE LVQ+ALD+   GR
Sbjct  1141  ETECGERGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVGR  1200

Query  2224  TTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             TT+V+AH+L+TI+N ++IA V  G +IE+G+ ++L  K G +  +A  Q
Sbjct  1201  TTIVIAHRLNTIKNLEMIAFVEDGKVIEKGTFAQLKHKRGAFFNLASCQ  1249



>ref|XP_008242496.1| PREDICTED: putative ABC transporter B family member 8 [Prunus 
mume]
Length=1257

 Score =  1728 bits (4476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 927/1222 (76%), Positives = 1069/1222 (87%), Gaps = 17/1222 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S++ IFRYADW+D+ LM LGT+GA+GDGMSTNCLL++VS L N LGYG +   +     
Sbjct  32    NSVVKIFRYADWVDVVLMVLGTVGAVGDGMSTNCLLVFVSRLMNNLGYGQSQQNNNHGIN  91

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSL FV LGLAVM++ F+EGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  92    -WMDEVEKCSLDFVYLGLAVMLVAFLEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  150

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSE+ N+ISKDTSLIQEVLSEKVP F+MH+SVF+SGL FSTY SWRL+LVA+PT++
Sbjct  151   QEATTSEVINTISKDTSLIQEVLSEKVPTFVMHSSVFVSGLAFSTYLSWRLALVAFPTLL  210

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSKKS+KEY KAN IV QALSSIKT+Y+FTAER I+ERYS+IL+R
Sbjct  211   LLIIPGMIYGKYLMYLSKKSYKEYGKANSIVEQALSSIKTVYAFTAERRIMERYSAILER  270

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LGMK GIAKGLAVGSTGLSFAIW FLAWYGS L+M+KGESGGRIYAAGIS+VL GLS
Sbjct  271   TSRLGMKQGIAKGLAVGSTGLSFAIWGFLAWYGSHLVMYKGESGGRIYAAGISFVLSGLS  330

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALP+++YFTEA+VAA+RIF RIDR P IDGED  G+VLD IRGELEF  VKF YPSR
Sbjct  331   LGMALPDLRYFTEAAVAATRIFDRIDRRPLIDGEDTQGLVLDNIRGELEFIGVKFTYPSR  390

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S+VL+D NLKVEAGKTVALVGASGSGKSTAIAL+QRFYDA++G + IDGV+I  LQ+K
Sbjct  391   PDSVVLRDFNLKVEAGKTVALVGASGSGKSTAIALVQRFYDADNGVVRIDGVDIRTLQLK  450

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R +MGLVSQEHALFGTSI+ENIM GKL  +M+EV AAAM ANAH+FIRQLPQGYETK+
Sbjct  451   WIRSKMGLVSQEHALFGTSIKENIMFGKLDANMDEVTAAAMAANAHNFIRQLPQGYETKI  510

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  511   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLV  570

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQ----  2048
             VAHKLST+RNADLIAVVSGGCIIE GSH++L+  +NGHYA++AKLQRQFSC + DQ    
Sbjct  571   VAHKLSTVRNADLIAVVSGGCIIEIGSHNQLINCQNGHYAKLAKLQRQFSCDNVDQEQIS  630

Query  2047  -SFAPSSNAGRQSTEKsspavl-assplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
              S    S+AGR ST +SSPA   A SPL +E +Q  P  H   P  SF RLL LN  EWK
Sbjct  631   LSSVTRSSAGRLSTARSSPASTFAKSPLPLEPSQ--PLSH---PPTSFYRLLSLNSLEWK  685

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIGS+SAIAFG+VQP YALTIGGMISAFF  SHEEM+ARI+ + L+F+ L ++SITLN
Sbjct  686   QGLIGSLSAIAFGSVQPVYALTIGGMISAFFVQSHEEMRARIRTYSLIFSALSVISITLN  745

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FAYMGE LT+RIRL+ML+KILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  746   LLQHYNFAYMGEQLTKRIRLQMLQKILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  805

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPL ILCFYT+KVLLS+++  F+KAQ
Sbjct  806   DRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLAILCFYTKKVLLSSLSANFIKAQ  865

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVEAVYNHRIVTSFGS+ KVL++FD AQ+ PRKEA+KKSWLAG+G+GSAQ LTF
Sbjct  866   NHSTQIAVEAVYNHRIVTSFGSVGKVLELFDEAQEAPRKEARKKSWLAGLGMGSAQCLTF  925

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F 
Sbjct  926   MSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVFE  985

Query  973   ILDRPSIITSPYNGKVDNG----GTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             ILDR S+I    N   ++G    G  LEK++G IE+KKV+FAYPSRP+T +LR+F LEVK
Sbjct  986   ILDRHSLIPGSRNVGDEDGSSGNGIKLEKVTGSIELKKVDFAYPSRPDTLVLRQFSLEVK  1045

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
              G+SIGLVGKSG GKST+V LI+RFYD + GS++VDGVD+R  D+ WYRR  ALVSQEPV
Sbjct  1046  PGTSIGLVGKSGCGKSTVVGLIQRFYDAESGSVKVDGVDIRELDVQWYRRHTALVSQEPV  1105

Query  625   IYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             IYSGTIRDNI+FGKLDA E+E+++AA+AANAH+FISSLK GY+TECGERGVQLSGGQKQR
Sbjct  1106  IYSGTIRDNIMFGKLDAPEDEVVKAARAANAHEFISSLKDGYNTECGERGVQLSGGQKQR  1165

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSI  266
             IAIARAI+RNPTILLLDEATSALDV+SE +VQEALD IM+GRTT+V+AHR NTIKNL+ I
Sbjct  1166  IAIARAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVGRTTVVIAHRPNTIKNLEMI  1225

Query  265   ALVSEGKVVEHGTYSQLKNKRG  200
             A V++GKVVE GTY+QLK+KRG
Sbjct  1226  AFVADGKVVEKGTYAQLKHKRG  1247


 Score =   323 bits (827),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 197/530 (37%), Positives = 303/530 (57%), Gaps = 10/530 (2%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +   SL F  L +  + +  ++ Y ++   E+   +IR + L+ IL  E  +FD ++ ++
Sbjct  727   IRTYSLIFSALSVISITLNLLQHYNFAYMGEQLTKRIRLQMLQKILTFETAWFDEEQNSS  786

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+ 
Sbjct  787   GALCSRLSNEASMVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLAILC  846

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  LS    K  + +  I  +A+ + + + SF +   +LE +    +   K  
Sbjct  847   FYTKKVLLSSLSANFIKAQNHSTQIAVEAVYNHRIVTSFGSVGKVLELFDEAQEAPRKEA  906

Query  3097  MKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     GL +GS   L+F  WA   WYG  L+     S G ++      V  G  +  A
Sbjct  907   RKKSWLAGLGMGSAQCLTFMSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAEA  966

Query  2920  LPEVKYFTEASVAASRIFSRIDR---------VPKIDGEDKSGMVLDTIRGELEFKNVKF  2768
                     + S A + +F  +DR         V   DG   +G+ L+ + G +E K V F
Sbjct  967   GSMTSDLAKGSTAVASVFEILDRHSLIPGSRNVGDEDGSSGNGIKLEKVTGSIELKKVDF  1026

Query  2767  AYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEIN  2588
             AYPSRP++LVL+  +L+V+ G ++ LVG SG GKST + L+QRFYDA SGS+ +DGV+I 
Sbjct  1027  AYPSRPDTLVLRQFSLEVKPGTSIGLVGKSGCGKSTVVGLIQRFYDAESGSVKVDGVDIR  1086

Query  2587  ALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQG  2408
              L V+W R    LVSQE  ++  +IR+NIM GKL    +EVV AA  ANAH+FI  L  G
Sbjct  1087  ELDVQWYRRHTALVSQEPVIYSGTIRDNIMFGKLDAPEDEVVKAARAANAHEFISSLKDG  1146

Query  2407  YETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAG  2228
             Y T+ GERG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE LVQ+ALD+   G
Sbjct  1147  YNTECGERGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEHLVQEALDRIMVG  1206

Query  2227  RTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             RTT+V+AH+ +TI+N ++IA V+ G ++E+G++++L  K G +  +A  Q
Sbjct  1207  RTTVVIAHRPNTIKNLEMIAFVADGKVVEKGTYAQLKHKRGAFFNLATCQ  1256



>ref|XP_010249502.1| PREDICTED: putative ABC transporter B family member 8 [Nelumbo 
nucifera]
 ref|XP_010249503.1| PREDICTED: putative ABC transporter B family member 8 [Nelumbo 
nucifera]
Length=1240

 Score =  1726 bits (4471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 915/1223 (75%), Positives = 1051/1223 (86%), Gaps = 24/1223 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+ VIFRYADW+D+ LM LGT+GAIGDGMSTNCLL++ S L N+LG+G            
Sbjct  19    SVAVIFRYADWVDVVLMLLGTVGAIGDGMSTNCLLVFASRLMNSLGFGETQENQGN----  74

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M  VEKCSLYFV LGLAVM++ FMEGYCWS+TSERQVL+IRYKYLEA+LRQEVGFFDSQ
Sbjct  75    FMGGVEKCSLYFVYLGLAVMMVAFMEGYCWSRTSERQVLRIRYKYLEAVLRQEVGFFDSQ  134

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSE+ NSIS DTSL+QE+LSEKVP+FLMH SVF+SGL FS YFSWRLSLVA+P + +
Sbjct  135   EATTSEVINSISNDTSLMQELLSEKVPLFLMHMSVFISGLAFSMYFSWRLSLVAFPLVAL  194

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYLLYLSKKS+KEY KAN I+ QALSSIKT+YSFTAER I+ERYS+ILD T
Sbjct  195   LIIPGMIYGKYLLYLSKKSYKEYGKANTIIEQALSSIKTVYSFTAERRIVERYSAILDTT  254

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K GIAKGLAVGSTGLSFAIWAFLAWYGSRL+M+KGESGGRI+AAGIS+VLGGLSL
Sbjct  255   TKLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSRLVMYKGESGGRIWAAGISFVLGGLSL  314

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALPE+KYFTE SVAA+RIFSRIDR+P IDGED+ G+VL+ +RGE EF++VKF YPSRP
Sbjct  315   GMALPELKYFTETSVAATRIFSRIDRIPAIDGEDRKGLVLEQVRGEFEFESVKFTYPSRP  374

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +++VLKD +LKVEAGKTVALVGASGSGKSTAIALLQRFYDA+ G + IDGV+I  LQ+KW
Sbjct  375   DTVVLKDFSLKVEAGKTVALVGASGSGKSTAIALLQRFYDADDGVVRIDGVDIKTLQLKW  434

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +RG+MGLVSQEHALFGTSI+ENIM GK   +M+E++AA M ANAHDFIRQLP+GYETKVG
Sbjct  435   IRGKMGLVSQEHALFGTSIKENIMFGKPDATMDEIIAATMAANAHDFIRQLPEGYETKVG  494

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESE LVQ+ALDQAS GRTTLV+
Sbjct  495   ERGALLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESETLVQNALDQASMGRTTLVI  554

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ-----  2048
             AHK ST++NAD IAVV+GG IIE GSH+EL+ K NGHYA++AKLQRQFSC D +Q     
Sbjct  555   AHKFSTVKNADQIAVVNGGSIIEIGSHNELINKTNGHYARLAKLQRQFSCDDTEQTSELC  614

Query  2047  ---SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
                S    S+AGR S  K       S          +P  +   P PSF+RLL LN  EW
Sbjct  615   HMSSSVARSSAGRLSINK----SPTSFMSPFPVENPLPVSY---PPPSFTRLLLLNSPEW  667

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             K G++GS+SAI FGAVQP YA+TIGGMISAFF  SH EM+ARI+ + LVF+ L L+SI +
Sbjct  668   KNGVMGSLSAIIFGAVQPVYAITIGGMISAFFVQSHVEMRARIRTYSLVFSSLSLISILI  727

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             NL QHY FAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALC+RLSNEA+MVKSLV
Sbjct  728   NLSQHYNFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCSRLSNEASMVKSLV  787

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
             ADRLSLLVQ +S+V IAMVMGL VAWKLALVMIAVQPLTILCFYTRKVLLS+I+  F+KA
Sbjct  788   ADRLSLLVQTSSAVIIAMVMGLAVAWKLALVMIAVQPLTILCFYTRKVLLSSISLNFIKA  847

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             QN STQIAVEAVYNHRIVTSFGS+ KVL++FD AQ+EPRK A+KKSWLAGIG+GSAQ LT
Sbjct  848   QNQSTQIAVEAVYNHRIVTSFGSLGKVLELFDEAQEEPRKAARKKSWLAGIGMGSAQCLT  907

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
             FM WALDFW+GGKLV +G+IS+GDVFKTFFILVSTGKVIADAGSMTSDLAKG+ AVAS+F
Sbjct  908   FMSWALDFWFGGKLVESGQISAGDVFKTFFILVSTGKVIADAGSMTSDLAKGATAVASVF  967

Query  976   AILDRPSIITSPYN----GKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              +LDR S+I   Y+    G     G  L+K+SG IE+KKV+FAYPSRP   +LR+F LEV
Sbjct  968   EVLDRQSLIPGSYSYHGPGNGTCSGRKLDKVSGWIEMKKVDFAYPSRPGCLVLRQFSLEV  1027

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             KAG SIGLVGKSG GKST++ LI+RFYD + G+++VDG D+R  ++GWYR   ALVSQEP
Sbjct  1028  KAGKSIGLVGKSGCGKSTVIGLIQRFYDAERGTVKVDGTDIRELEVGWYRGHTALVSQEP  1087

Query  628   VIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQ  449
             VIYSG+IRDNI+FGKL+ASE+E++EAAKA+NAH FIS+LK GY+TECGERGVQLSGGQKQ
Sbjct  1088  VIYSGSIRDNIVFGKLEASESEVVEAAKASNAHDFISALKDGYETECGERGVQLSGGQKQ  1147

Query  448   riaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDS  269
             RIAIARAIIRNPTILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LDS
Sbjct  1148  RIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRLNTIKKLDS  1207

Query  268   IALVSEGKVVEHGTYSQLKNKRG  200
             IA V++GKVVE GTY+ LK+K+G
Sbjct  1208  IAFVADGKVVERGTYAHLKSKQG  1230


 Score =   314 bits (805),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 195/507 (38%), Positives = 292/507 (58%), Gaps = 10/507 (2%)
 Frame = -2

Query  3568  YCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVP  3389
             Y ++   E    +IR + LE IL  E  +FD +  ++  + + +S + S+++ ++++++ 
Sbjct  733   YNFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCSRLSNEASMVKSLVADRLS  792

Query  3388  IFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKAN  3209
             + +  +S  +  +      +W+L+LV      + I+        L  +S    K  +++ 
Sbjct  793   LLVQTSSAVIIAMVMGLAVAWKLALVMIAVQPLTILCFYTRKVLLSSISLNFIKAQNQST  852

Query  3208  GIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVGSTG-LSFAIWA  3032
              I  +A+ + + + SF +   +LE +    +   K   K     G+ +GS   L+F  WA
Sbjct  853   QIAVEAVYNHRIVTSFGSLGKVLELFDEAQEEPRKAARKKSWLAGIGMGSAQCLTFMSWA  912

Query  3031  FLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDR  2852
                W+G +L+     S G ++      V  G  +  A        + + A + +F  +DR
Sbjct  913   LDFWFGGKLVESGQISAGDVFKTFFILVSTGKVIADAGSMTSDLAKGATAVASVFEVLDR  972

Query  2851  VPKIDGEDK---------SGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKT  2699
                I G            SG  LD + G +E K V FAYPSRP  LVL+  +L+V+AGK+
Sbjct  973   QSLIPGSYSYHGPGNGTCSGRKLDKVSGWIEMKKVDFAYPSRPGCLVLRQFSLEVKAGKS  1032

Query  2698  VALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGT  2519
             + LVG SG GKST I L+QRFYDA  G++ +DG +I  L+V W RG   LVSQE  ++  
Sbjct  1033  IGLVGKSGCGKSTVIGLIQRFYDAERGTVKVDGTDIRELEVGWYRGHTALVSQEPVIYSG  1092

Query  2518  SIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaia  2339
             SIR+NI+ GKL  S  EVV AA  +NAHDFI  L  GYET+ GERG  LSGGQKQRIAIA
Sbjct  1093  SIRDNIVFGKLEASESEVVEAAKASNAHDFISALKDGYETECGERGVQLSGGQKQRIAIA  1152

Query  2338  raiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVS  2159
             RAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRTT+VVAH+L+TI+  D IA V+
Sbjct  1153  RAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRLNTIKKLDSIAFVA  1212

Query  2158  GGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
              G ++E+G+++ L  K G +  +A LQ
Sbjct  1213  DGKVVERGTYAHLKSKQGAFYNLATLQ  1239



>ref|XP_007013043.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
 gb|EOY30662.1| Multidrug/pheromone exporter, MDR family, ABC transporter family 
[Theobroma cacao]
Length=1239

 Score =  1726 bits (4470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 907/1209 (75%), Positives = 1055/1209 (87%), Gaps = 7/1209 (1%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             +IFRYADW+DI LM LGT GAIGDGMSTN L+++   + N++GYG+    +       M 
Sbjct  26    IIFRYADWVDILLMVLGTFGAIGDGMSTNWLIVFAGRIMNSMGYGNTQQNNNN----FME  81

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
             EVEKCS+YF  LGLA MV+ FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT
Sbjct  82    EVEKCSIYFTYLGLAAMVVAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  141

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             TSE+ NSISKDTSLIQEVLSEKVPIF+M++S F+SGL FS Y SWRL++V +P +++LII
Sbjct  142   TSEVINSISKDTSLIQEVLSEKVPIFVMNSSAFISGLAFSAYLSWRLAIVVFPALLLLII  201

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PG+IYGKYLLYL KK+ KEYSKAN IV QALSSIKT+YSFTAERSI+ERYS+ILDRTIKL
Sbjct  202   PGIIYGKYLLYLCKKASKEYSKANTIVEQALSSIKTVYSFTAERSIVERYSAILDRTIKL  261

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K G+AKGLAVGSTG+SFAIWAFLAWYGS L+M+KGESGGRIYAAG+S++LGGL LG+A
Sbjct  262   GLKQGMAKGLAVGSTGVSFAIWAFLAWYGSHLVMYKGESGGRIYAAGVSFILGGLCLGVA  321

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
             L ++KYFTEA++AA+RIF+RIDR P+ID ED  G+VLDTIRG++EF +VKF YPSRP+S+
Sbjct  322   LADLKYFTEATIAATRIFARIDRTPEIDSEDTKGIVLDTIRGDIEFDHVKFIYPSRPDSV  381

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VLKD NLKVEAGKTVALVGASGSGKSTAIAL+QRFYDAN G++ IDGV+I  LQ+KW+RG
Sbjct  382   VLKDFNLKVEAGKTVALVGASGSGKSTAIALVQRFYDANDGAVKIDGVDIRRLQLKWIRG  441

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
             +MGLVSQEHALFGTSIRENIM GKL  +M+EV+AAAM ANAH+F+RQLP+G+ETK+GERG
Sbjct  442   KMGLVSQEHALFGTSIRENIMFGKLDATMDEVMAAAMAANAHNFVRQLPEGFETKIGERG  501

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
             ALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLVVAHK
Sbjct  502   ALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLVVAHK  561

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS-SN  2027
             LSTIRNADLIAVV+ GCIIE GSH++L+  KNGHYAQ+AKLQRQFSC D +Q+     S+
Sbjct  562   LSTIRNADLIAVVNNGCIIEMGSHNDLISMKNGHYAQLAKLQRQFSCDDHEQNPETRLSS  621

Query  2026  AGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISA  1847
              GR ST + S A  + +        + P      P PSFSRLL LN  EWKQGL+GS+SA
Sbjct  622   VGRMSTGRLSTAKSSPALFATPVHIESPKKPVSHPPPSFSRLLSLNSPEWKQGLVGSLSA  681

Query  1846  IAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAY  1667
             IAFGAVQP YALT+GGMISAFF+ SH+EMQARI+ + L+F+ L L SI LNL QHY FAY
Sbjct  682   IAFGAVQPVYALTVGGMISAFFAKSHQEMQARIRTYALIFSSLTLFSIILNLIQHYNFAY  741

Query  1666  MGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQA  1487
             MGE LTRRIR RMLEK+L+FE AWFDEE NSSGALC+ LSN+A+MVK+LVADR+SLLVQ 
Sbjct  742   MGERLTRRIRKRMLEKMLSFEAAWFDEEKNSSGALCSSLSNQASMVKTLVADRISLLVQT  801

Query  1486  ASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVE  1307
              S+VTIAM++GL+VAWKLA+VMIAVQPLTILCFYTRKVLLS+I+T FVKAQN STQIAVE
Sbjct  802   TSAVTIAMIIGLIVAWKLAVVMIAVQPLTILCFYTRKVLLSSISTNFVKAQNQSTQIAVE  861

Query  1306  AVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWY  1127
             AVYNH+IVTSFGSI KVL +FD AQ+EPRKEA+K SWLAGIG+GSA  LTFM WALDFWY
Sbjct  862   AVYNHKIVTSFGSIGKVLQLFDKAQEEPRKEARKISWLAGIGMGSAHCLTFMSWALDFWY  921

Query  1126  GGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIIT  947
             GG+LV  GEIS+GDVFKTFF+LVSTGKVIADAGSMTSDLAKGS AVAS+F ILDR S I 
Sbjct  922   GGRLVEKGEISAGDVFKTFFVLVSTGKVIADAGSMTSDLAKGSTAVASVFEILDRQSSIP  981

Query  946   SPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGS  767
                 G+    GT LE+++GKIE+KKV+FAYPSRPET +LR+F LEVK G+S+GLVGKSG 
Sbjct  982   GS-QGEDGTSGTKLERITGKIELKKVDFAYPSRPETLVLRQFSLEVKPGTSVGLVGKSGC  1040

Query  766   GKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFG  587
             GKST++ LI+RFYDV+ GS++VDG+D+R  D+ WYRRQMALVSQEPVIYSG+IRDNI+FG
Sbjct  1041  GKSTVIGLIQRFYDVEMGSVKVDGIDIRELDVQWYRRQMALVSQEPVIYSGSIRDNIVFG  1100

Query  586   KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTI  407
             KLDASENE++EAA+AANAH+F+S+LK GY+TECGERGVQLSGGQKQRIAIARAIIRNP I
Sbjct  1101  KLDASENEVVEAARAANAHEFVSALKDGYETECGERGVQLSGGQKQRIAIARAIIRNPRI  1160

Query  406   LLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGT  227
             LLLDEATSALDV+SEQVVQEALD  M+GRTT+V+AHRLNTIK +D IA V++GKVVE GT
Sbjct  1161  LLLDEATSALDVQSEQVVQEALDRTMVGRTTVVIAHRLNTIKKVDLIAFVADGKVVERGT  1220

Query  226   YSQLKNKRG  200
             Y+QL+N +G
Sbjct  1221  YAQLRNHQG  1229


 Score =   342 bits (876),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 208/522 (40%), Positives = 315/522 (60%), Gaps = 7/522 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             +L F  L L  +++  ++ Y ++   ER   +IR + LE +L  E  +FD ++ ++  + 
Sbjct  718   ALIFSSLTLFSIILNLIQHYNFAYMGERLTRRIRKRMLEKMLSFEAAWFDEEKNSSGALC  777

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             +S+S   S+++ ++++++ + +  TS     +      +W+L++V      + I+     
Sbjct  778   SSLSNQASMVKTLVADRISLLVQTTSAVTIAMIIGLIVAWKLAVVMIAVQPLTILCFYTR  837

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S    K  +++  I  +A+ + K + SF +   +L+ +    +   K   KI 
Sbjct  838   KVLLSSISTNFVKAQNQSTQIAVEAVYNHKIVTSFGSIGKVLQLFDKAQEEPRKEARKIS  897

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G+ +GS   L+F  WA   WYG RL+  KGE S G ++      V  G  +  A   
Sbjct  898   WLAGIGMGSAHCLTFMSWALDFWYGGRLV-EKGEISAGDVFKTFFVLVSTGKVIADAGSM  956

Query  2911  VKYFTEASVAASRIFSRIDR---VPKIDGED-KSGMVLDTIRGELEFKNVKFAYPSRPES  2744
                  + S A + +F  +DR   +P   GED  SG  L+ I G++E K V FAYPSRPE+
Sbjct  957   TSDLAKGSTAVASVFEILDRQSSIPGSQGEDGTSGTKLERITGKIELKKVDFAYPSRPET  1016

Query  2743  LVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLR  2564
             LVL+  +L+V+ G +V LVG SG GKST I L+QRFYD   GS+ +DG++I  L V+W R
Sbjct  1017  LVLRQFSLEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEMGSVKVDGIDIRELDVQWYR  1076

Query  2563  GQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGER  2384
              QM LVSQE  ++  SIR+NI+ GKL  S  EVV AA  ANAH+F+  L  GYET+ GER
Sbjct  1077  RQMALVSQEPVIYSGSIRDNIVFGKLDASENEVVEAARAANAHEFVSALKDGYETECGER  1136

Query  2383  GALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAH  2204
             G  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRTT+V+AH
Sbjct  1137  GVQLSGGQKQRIAIARAIIRNPRILLLDEATSALDVQSEQVVQEALDRTMVGRTTVVIAH  1196

Query  2203  KLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             +L+TI+  DLIA V+ G ++E+G++++L    G ++++A LQ
Sbjct  1197  RLNTIKKVDLIAFVADGKVVERGTYAQLRNHQGAFSKLASLQ  1238



>ref|XP_011093634.1| PREDICTED: putative ABC transporter B family member 8 [Sesamum 
indicum]
Length=1238

 Score =  1724 bits (4464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 932/1218 (77%), Positives = 1067/1218 (88%), Gaps = 15/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS+ ++FRYAD +D+ LM LGT GAIGDGMSTNCLL+YVS LFN+LG+G ++ +   +  
Sbjct  16    SSLTILFRYADGLDVLLMLLGTFGAIGDGMSTNCLLIYVSRLFNSLGFGKSSPEDHGN--  73

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EV KCSL++V LG+AV  + FMEGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  74    -FMDEVVKCSLFYVYLGIAVTAVAFMEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  132

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEI NSISKDTSLIQEVLSEKVPIF M+ S+F++GLGFS YFSWRLSLVA+PT+ 
Sbjct  133   QEATTSEIINSISKDTSLIQEVLSEKVPIFFMNMSMFITGLGFSAYFSWRLSLVAFPTVF  192

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLLYLS+KSFKEY KAN IVGQALSSI+T+YSFTAERSI+E+YSSILDR
Sbjct  193   LLIIPGLIYGKYLLYLSRKSFKEYGKANSIVGQALSSIRTVYSFTAERSIIEKYSSILDR  252

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
                LG+K GIAKGLA+GSTGLSFAIWA LAWYGSRL+M+KGESGGRIYAAG+S+VLGGL+
Sbjct  253   AKHLGIKQGIAKGLAIGSTGLSFAIWALLAWYGSRLVMYKGESGGRIYAAGVSFVLGGLA  312

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG ALPEVKYFTEASVAASRIF RIDR+P+IDGE   G+VLD IRGELEF +V+F YPSR
Sbjct  313   LGAALPEVKYFTEASVAASRIFDRIDRIPEIDGEGSKGLVLDKIRGELEFDHVRFTYPSR  372

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+++VLKD NLK+EAGKTVALVGASGSGKSTAIAL+QRFYDAN G++ IDGV+I  LQ+K
Sbjct  373   PDAIVLKDFNLKIEAGKTVALVGASGSGKSTAIALVQRFYDANGGTVRIDGVDIRTLQLK  432

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQEHALFGTS++ENI+ GKL  +M+EV+AAAM ANAH+FIRQLP GYETK+
Sbjct  433   WLREQMGLVSQEHALFGTSVKENILFGKLDATMDEVIAAAMAANAHNFIRQLPDGYETKI  492

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAI++NPVILLLDEATSALDSESE LVQ+ALDQA  GRTTLV
Sbjct  493   GERGALLSGGQKQRIAIARAILRNPVILLLDEATSALDSESETLVQNALDQACMGRTTLV  552

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSF---  2042
             VAHKLSTIRNAD+IAVVSGG I+E G+H++L++ NGHYA++AKLQRQFS  DQ+QS    
Sbjct  553   VAHKLSTIRNADVIAVVSGGSIVEIGTHNDLIDMNGHYARLAKLQRQFSSVDQEQSVESR  612

Query  2041  ---APSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQ  1871
                A  S+ GR+S  +SSPA  AS   +  T +  P  +   P PSFSRLL LN  EWKQ
Sbjct  613   LSSAARSSTGRKSAARSSPASFASPLPVHTTPE--PLSY---PPPSFSRLLSLNSPEWKQ  667

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
             G++GS+SAIAFG +QP YALTIG MI+AFF PSH EMQARI+++ L+F+ LCL SITLN+
Sbjct  668   GVMGSLSAIAFGTIQPLYALTIGSMIAAFFVPSHAEMQARIERYALIFSSLCLASITLNV  727

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
             CQHY FAYMGE LTRRIRL+MLEKILTFE AWFDEE NSS ALC RLS+EA+MVKSLVAD
Sbjct  728   CQHYNFAYMGESLTRRIRLKMLEKILTFEAAWFDEEQNSSAALCCRLSSEASMVKSLVAD  787

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R+SLL+Q  SSVT AMV+GL+VAWKLALVMIAVQPLTILCFYTRKVLLSTIT+ FVKAQN
Sbjct  788   RVSLLIQTTSSVTTAMVIGLIVAWKLALVMIAVQPLTILCFYTRKVLLSTITSNFVKAQN  847

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              STQIA EAVYNHRIVTSFGSI KVL+IFD AQDEPRKEA+KKSWLAG+GIGSAQGLTFM
Sbjct  848   QSTQIAAEAVYNHRIVTSFGSIPKVLEIFDEAQDEPRKEARKKSWLAGVGIGSAQGLTFM  907

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
             CWALDFWYGG LV+ GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAA+ASIF I
Sbjct  908   CWALDFWYGGTLVNRGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAALASIFEI  967

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             LDR S I   Y    DNGG  LEK++G IE+K+V+FAYP RPET +LR+F LEVKAG+SI
Sbjct  968   LDRQSQILGSYTAGDDNGGMKLEKMTGSIEMKRVDFAYPGRPETLVLRDFSLEVKAGTSI  1027

Query  790   GLVGKSGSGKSTIVA-LIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             GLVGKSG GK  ++A LI+RFYDVD GS++V GVD+R  DI WYR+ MALVSQEPVIYSG
Sbjct  1028  GLVGKSGWGKQPVIAPLIQRFYDVDRGSVKVGGVDIRLLDIQWYRKHMALVSQEPVIYSG  1087

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +IRDNI+ GKL A+ENE++EAA+AANAH+FI  LK GYDTECGERGVQLSGGQKQRIAIA
Sbjct  1088  SIRDNIMLGKLGATENEVVEAARAANAHEFICGLKNGYDTECGERGVQLSGGQKQRIAIA  1147

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI+R+PTILLLDEATSALDV+SEQ VQEALD IM+GRTT+VVAHRLNTIKNLDSIA V 
Sbjct  1148  RAIVRDPTILLLDEATSALDVQSEQAVQEALDRIMVGRTTLVVAHRLNTIKNLDSIAFVM  1207

Query  253   EGKVVEHGTYSQLKNKRG  200
             +GKV+E GTY+QLKN+RG
Sbjct  1208  DGKVIERGTYNQLKNRRG  1225


 Score =   341 bits (874),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 210/531 (40%), Positives = 315/531 (59%), Gaps = 9/531 (2%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +E+ +L F  L LA + +   + Y ++   E    +IR K LE IL  E  +FD ++ +
Sbjct  707   RIERYALIFSSLCLASITLNVCQHYNFAYMGESLTRRIRLKMLEKILTFEAAWFDEEQNS  766

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             ++ +   +S + S+++ +++++V + +  TS   + +      +W+L+LV      + I+
Sbjct  767   SAALCCRLSSEASMVKSLVADRVSLLIQTTSSVTTAMVIGLIVAWKLALVMIAVQPLTIL  826

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  ++    K  +++  I  +A+ + + + SF +   +LE +    D   K 
Sbjct  827   CFYTRKVLLSTITSNFVKAQNQSTQIAAEAVYNHRIVTSFGSIPKVLEIFDEAQDEPRKE  886

Query  3100  GMKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
               K     G+ +GS  GL+F  WA   WYG  L+ ++GE S G ++      V  G  + 
Sbjct  887   ARKKSWLAGVGIGSAQGLTFMCWALDFWYGGTLV-NRGEISAGDVFKTFFVLVSTGKVIA  945

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKI-----DGEDKSGMVLDTIRGELEFKNVKFAY  2762
              A        + S A + IF  +DR  +I      G+D  GM L+ + G +E K V FAY
Sbjct  946   EAGSMTSDLAKGSAALASIFEILDRQSQILGSYTAGDDNGGMKLEKMTGSIEMKRVDFAY  1005

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIA-LLQRFYDANSGSICIDGVEINA  2585
             P RPE+LVL+D +L+V+AG ++ LVG SG GK   IA L+QRFYD + GS+ + GV+I  
Sbjct  1006  PGRPETLVLRDFSLEVKAGTSIGLVGKSGWGKQPVIAPLIQRFYDVDRGSVKVGGVDIRL  1065

Query  2584  LQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGY  2405
             L ++W R  M LVSQE  ++  SIR+NIMLGKLG +  EVV AA  ANAH+FI  L  GY
Sbjct  1066  LDIQWYRKHMALVSQEPVIYSGSIRDNIMLGKLGATENEVVEAARAANAHEFICGLKNGY  1125

Query  2404  ETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR  2225
             +T+ GERG  LSGGQKQRIAIARAI+++P ILLLDEATSALD +SE+ VQ+ALD+   GR
Sbjct  1126  DTECGERGVQLSGGQKQRIAIARAIVRDPTILLLDEATSALDVQSEQAVQEALDRIMVGR  1185

Query  2224  TTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             TTLVVAH+L+TI+N D IA V  G +IE+G++++L  + G +  +A LQ Q
Sbjct  1186  TTLVVAHRLNTIKNLDSIAFVMDGKVIERGTYNQLKNRRGAFFNLASLQLQ  1236



>ref|XP_002325023.2| hypothetical protein POPTR_0018s09420g [Populus trichocarpa]
 gb|EEF03588.2| hypothetical protein POPTR_0018s09420g [Populus trichocarpa]
Length=1230

 Score =  1722 bits (4459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 918/1220 (75%), Positives = 1057/1220 (87%), Gaps = 25/1220 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IFRYADW DI LM LGT+GAIGDGMSTNCLL++ S + N+LGYG     +      
Sbjct  16    SIANIFRYADWNDILLMLLGTVGAIGDGMSTNCLLVFASRIMNSLGYGQTRQDNYN----  71

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EV+K +  FV LGLAVMVM FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGF+DSQ
Sbjct  72    FMVEVQKVN--FVYLGLAVMVMAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFYDSQ  129

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSIS DTSL+QEVLSEKVPIFLMH SVF SGL F+TYFSWRLSLVA+PT+++
Sbjct  130   EATTSEIINSISNDTSLVQEVLSEKVPIFLMHASVFFSGLAFATYFSWRLSLVAFPTLLL  189

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYLLYLSKK+  EY KAN IV +ALSSIKTIYSFTAE+ I++RYS+ILDRT
Sbjct  190   LIIPGMIYGKYLLYLSKKARTEYGKANSIVERALSSIKTIYSFTAEKRIIDRYSAILDRT  249

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K GIAKGLAVGSTGLSFAIWAFLAWYGS L+M+KGESGGRIYAAGIS++L GLSL
Sbjct  250   TKLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSHLVMYKGESGGRIYAAGISFILSGLSL  309

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G+ALP++KYFTEASVAA+RIF RIDRVP+ID ED  G VLD I+G++ F+NV F YP RP
Sbjct  310   GIALPDLKYFTEASVAATRIFKRIDRVPEIDSEDTKGRVLDKIQGQIVFQNVSFTYPCRP  369

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +++VLKD NLKVEAGKTVALVGASGSGKSTAIALLQRFYD +SG + IDGV++  L +KW
Sbjct  370   DAVVLKDFNLKVEAGKTVALVGASGSGKSTAIALLQRFYDVDSGIVKIDGVDLRTLNLKW  429

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +RGQMGLVSQ+HALFGTSI+ENIM GKL  +M+E++AAAM ANAH+FIRQLP+GYETKVG
Sbjct  430   IRGQMGLVSQDHALFGTSIKENIMFGKLDATMDEIMAAAMAANAHNFIRQLPEGYETKVG  489

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLVV
Sbjct  490   ERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTLVV  549

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQS----  2045
             AHKLST+RNADLIAVV  G IIE GSH++L+  +NGHYA++AKLQRQFSC +Q+Q+    
Sbjct  550   AHKLSTVRNADLIAVVDNGSIIEIGSHNDLINIQNGHYAKLAKLQRQFSCDEQEQNPEIR  609

Query  2044  -FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHH----HQPSPSFSRLLGLNLTE  1880
               + +S+A RQST KSSP +          A  +P D      H P+PSFSRLL LN  E
Sbjct  610   FSSVTSSAARQSTGKSSPTIF---------ASPLPVDDSPKPVHIPAPSFSRLLSLNAPE  660

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WKQGL+GSISAI FGAVQP YALT+GGMI+A F+P+H+E++ RI+ + L+F  L L SI 
Sbjct  661   WKQGLMGSISAITFGAVQPVYALTVGGMIAALFAPNHDEVRDRIRLYSLIFCSLSLFSII  720

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             +NL QHY FAYMGE LT+RIRLRMLEKIL FETAWFDEE NSSGALC RLS EA+MVK+L
Sbjct  721   INLVQHYNFAYMGERLTKRIRLRMLEKILGFETAWFDEEENSSGALCLRLSAEASMVKTL  780

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             +ADR+ LLVQ  S+VTIAM+MGLVVAWKLA+VMIAVQPLTILCFYT+K+LLS+I+T FVK
Sbjct  781   IADRVCLLVQTTSAVTIAMIMGLVVAWKLAIVMIAVQPLTILCFYTKKILLSSISTNFVK  840

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQN STQIAVEAVYNHRIVTSF S+ KVL +FD AQ+EPRKE +KKSWLAGIG+GSAQ L
Sbjct  841   AQNRSTQIAVEAVYNHRIVTSFASVGKVLQLFDEAQEEPRKEGRKKSWLAGIGMGSAQCL  900

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
             TFM WALDFW+GG LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMTSDL+KGS AVAS+
Sbjct  901   TFMSWALDFWFGGTLVEKGEISAGDVFKTFFILVSTGKVIAEAGSMTSDLSKGSTAVASV  960

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             F ILDR S+I   Y+    + GT LEKL GKIE+KK++FAYPSRPET ILR+FCLEVK G
Sbjct  961   FKILDRQSLIPGSYHAGDGSSGTKLEKLGGKIEMKKIDFAYPSRPETLILRQFCLEVKPG  1020

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
             +S+GLVGKSG GKST++ LI+RFYDV+ GS+RVDGVD+R  DI W+R++ ALVSQEPV+Y
Sbjct  1021  TSVGLVGKSGCGKSTVIGLIQRFYDVEKGSVRVDGVDIRELDIQWFRKRTALVSQEPVLY  1080

Query  619   SGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             SG+IR+NI+FGKLDASENE++EAA+AANAH+FISSLK+GY+TECGERGVQLSGGQKQRIA
Sbjct  1081  SGSIRENIMFGKLDASENEVVEAARAANAHEFISSLKEGYETECGERGVQLSGGQKQRIA  1140

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNPTILLLDEATSALDV+SEQVVQEALD IM+ RTT+VVAHRLNTIKNLDSIA 
Sbjct  1141  IARAILRNPTILLLDEATSALDVQSEQVVQEALDRIMVRRTTIVVAHRLNTIKNLDSIAF  1200

Query  259   VSEGKVVEHGTYSQLKNKRG  200
             V++GKVVE GTY+QLKNKRG
Sbjct  1201  VADGKVVERGTYAQLKNKRG  1220


 Score =   333 bits (853),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 205/523 (39%), Positives = 309/523 (59%), Gaps = 8/523 (2%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F  L L  +++  ++ Y ++   ER   +IR + LE IL  E  +FD +E ++  + 
Sbjct  708   SLIFCSLSLFSIIINLVQHYNFAYMGERLTKRIRLRMLEKILGFETAWFDEEENSSGALC  767

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
               +S + S+++ +++++V + +  TS     +      +W+L++V      + I+     
Sbjct  768   LRLSAEASMVKTLIADRVCLLVQTTSAVTIAMIMGLVVAWKLAIVMIAVQPLTILCFYTK  827

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +   K G K  
Sbjct  828   KILLSSISTNFVKAQNRSTQIAVEAVYNHRIVTSFASVGKVLQLFDEAQEEPRKEGRKKS  887

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  +  A   
Sbjct  888   WLAGIGMGSAQCLTFMSWALDFWFGGTLV-EKGEISAGDVFKTFFILVSTGKVIAEAGSM  946

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDG-----EDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                 ++ S A + +F  +DR   I G     +  SG  L+ + G++E K + FAYPSRPE
Sbjct  947   TSDLSKGSTAVASVFKILDRQSLIPGSYHAGDGSSGTKLEKLGGKIEMKKIDFAYPSRPE  1006

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             +L+L+   L+V+ G +V LVG SG GKST I L+QRFYD   GS+ +DGV+I  L ++W 
Sbjct  1007  TLILRQFCLEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEKGSVRVDGVDIRELDIQWF  1066

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +  LVSQE  L+  SIRENIM GKL  S  EVV AA  ANAH+FI  L +GYET+ GE
Sbjct  1067  RKRTALVSQEPVLYSGSIRENIMFGKLDASENEVVEAARAANAHEFISSLKEGYETECGE  1126

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE++VQ+ALD+    RTT+VVA
Sbjct  1127  RGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEQVVQEALDRIMVRRTTIVVA  1186

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             H+L+TI+N D IA V+ G ++E+G++++L  K G +  +A LQ
Sbjct  1187  HRLNTIKNLDSIAFVADGKVVERGTYAQLKNKRGAFFDLASLQ  1229



>ref|XP_011007115.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X1 [Populus euphratica]
Length=1232

 Score =  1717 bits (4446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1216 (75%), Positives = 1057/1216 (87%), Gaps = 23/1216 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IFRYADW DI LM LGT+GAIGDGMSTNCLL++ S + N+LGYG     +       M E
Sbjct  20    IFRYADWSDILLMLLGTVGAIGDGMSTNCLLVFASRIMNSLGYGQTRQDNYN----FMVE  75

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             V+KCSL FV LGLAVMVM FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGF+DSQEATT
Sbjct  76    VQKCSLDFVYLGLAVMVMAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFYDSQEATT  135

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKDTSL+QEVLSEKVPIFLMH SVF SGL F+TYFSWRLSLVA+PT+++LIIP
Sbjct  136   SEIINSISKDTSLVQEVLSEKVPIFLMHASVFFSGLAFATYFSWRLSLVAFPTLLLLIIP  195

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G+IYGKYLLYLSKK+  EY KAN IV +ALSSIKTIYSFTAE+ I++RYS+ILDRT KLG
Sbjct  196   GMIYGKYLLYLSKKARTEYGKANSIVERALSSIKTIYSFTAEKRIIDRYSAILDRTTKLG  255

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVGSTGLSFAIWAFLAWYGS L+M+KGESGGRIYAAGIS++L GLSLG+AL
Sbjct  256   IKQGIAKGLAVGSTGLSFAIWAFLAWYGSHLVMYKGESGGRIYAAGISFILSGLSLGIAL  315

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             P++KYFTEASVAA+RIF RIDRVP+ID ED  G VL+ I+G++ F++V F YP RP+++V
Sbjct  316   PDLKYFTEASVAATRIFKRIDRVPEIDSEDTKGRVLEKIQGKIIFQHVSFTYPCRPDAVV  375

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LKD NL+VEAGKTVALVGASGSGKSTAIALLQRFYD +SG + IDGV++  L +KW+RGQ
Sbjct  376   LKDFNLEVEAGKTVALVGASGSGKSTAIALLQRFYDVDSGIVKIDGVDLRTLNLKWIRGQ  435

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTSI+ENIM GKL  +M+E++AAAM ANAH+FIRQLP+GYETKVGERGA
Sbjct  436   MGLVSQDHALFGTSIKENIMFGKLDATMDEIMAAAMAANAHNFIRQLPEGYETKVGERGA  495

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTT+VVAHKL
Sbjct  496   LLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTMVVAHKL  555

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQS-----FAP  2036
             ST+RNADLIAVV  G IIE GSH++L+  +NGHYA++AKLQRQFSC +Q+Q+      + 
Sbjct  556   STVRNADLIAVVDNGSIIEIGSHNDLINIQNGHYAKLAKLQRQFSCDEQEQNPEIRFSSV  615

Query  2035  SSNAGRQSTEKsspavlassplLIETAQKVPTDHH----HQPSPSFSRLLGLNLTEWKQG  1868
             +S+A RQST KSSPA+          A  +P D +    H P+PSFSRLL LN  EWKQG
Sbjct  616   TSSAARQSTGKSSPAIF---------ASPLPVDDNPKPVHIPAPSFSRLLSLNAPEWKQG  666

Query  1867  LIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLC  1688
             L+GSISAIAFGAVQP YALT+GGMI+AFF+P+H+E++ RI+ + L+F  L L SI +NL 
Sbjct  667   LMGSISAIAFGAVQPVYALTVGGMIAAFFAPNHDEVRDRIRIYSLIFCSLSLFSIIINLV  726

Query  1687  QHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADR  1508
             QHY FAYMGE LT+RIRLRMLEKIL FETAWFDEE NSSGAL  RLS EA+MVK+L+ADR
Sbjct  727   QHYNFAYMGERLTKRIRLRMLEKILGFETAWFDEEENSSGALSLRLSTEASMVKTLIADR  786

Query  1507  LSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNS  1328
             + LLVQ  S+VTIAM+MGLVVAWKLA+VMIAVQPLTILCFYT+K+LLS+I+T FVKAQN 
Sbjct  787   VCLLVQTTSAVTIAMIMGLVVAWKLAIVMIAVQPLTILCFYTKKILLSSISTNFVKAQNQ  846

Query  1327  STQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMC  1148
             STQIAVEAVYNHRIVTSF S+ KVL +FD AQ+EPRKE +KKSWLAGIG+GSAQ LTFM 
Sbjct  847   STQIAVEAVYNHRIVTSFASVGKVLQLFDEAQEEPRKEGRKKSWLAGIGMGSAQCLTFMS  906

Query  1147  WALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAIL  968
             WALDFW+GG LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMTSDL+KGS AVAS+F IL
Sbjct  907   WALDFWFGGTLVEKGEISAGDVFKTFFILVSTGKVIAEAGSMTSDLSKGSTAVASVFKIL  966

Query  967   DRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIG  788
             DR S+I   Y+    + GT LE L GKIE+KK++FAYPSRP+  ILR+FCLEVK G+S+G
Sbjct  967   DRQSLIPGSYHAGDGSSGTKLETLCGKIEMKKIDFAYPSRPKILILRQFCLEVKPGTSVG  1026

Query  787   LVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTI  608
             LVGKSG GKST++ LI+RFYDV+ GS+RVDGVD+R  DI W+R++ ALVSQEPV+YSG+I
Sbjct  1027  LVGKSGCGKSTVIGLIQRFYDVEKGSVRVDGVDIRELDIQWFRKRTALVSQEPVLYSGSI  1086

Query  607   RDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             R+NI+ GKLDASENE++EAA+AANAH FISSLK+GY+TECGERGVQLSGGQKQRIAIARA
Sbjct  1087  RENIMLGKLDASENEVVEAARAANAHDFISSLKEGYETECGERGVQLSGGQKQRIAIARA  1146

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I+RNPTILLLDEATSALDV+SEQVVQEALD IM+ RTT+VVAHRLNTIKNLDSIA V++G
Sbjct  1147  ILRNPTILLLDEATSALDVQSEQVVQEALDRIMVRRTTIVVAHRLNTIKNLDSIAFVADG  1206

Query  247   KVVEHGTYSQLKNKRG  200
             KVVE GTY+QLKNKRG
Sbjct  1207  KVVERGTYAQLKNKRG  1222


 Score =   334 bits (856),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 206/523 (39%), Positives = 311/523 (59%), Gaps = 8/523 (2%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F  L L  +++  ++ Y ++   ER   +IR + LE IL  E  +FD +E ++  ++
Sbjct  710   SLIFCSLSLFSIIINLVQHYNFAYMGERLTKRIRLRMLEKILGFETAWFDEEENSSGALS  769

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
               +S + S+++ +++++V + +  TS     +      +W+L++V      + I+     
Sbjct  770   LRLSTEASMVKTLIADRVCLLVQTTSAVTIAMIMGLVVAWKLAIVMIAVQPLTILCFYTK  829

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +   K G K  
Sbjct  830   KILLSSISTNFVKAQNQSTQIAVEAVYNHRIVTSFASVGKVLQLFDEAQEEPRKEGRKKS  889

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  +  A   
Sbjct  890   WLAGIGMGSAQCLTFMSWALDFWFGGTLV-EKGEISAGDVFKTFFILVSTGKVIAEAGSM  948

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDG-----EDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                 ++ S A + +F  +DR   I G     +  SG  L+T+ G++E K + FAYPSRP+
Sbjct  949   TSDLSKGSTAVASVFKILDRQSLIPGSYHAGDGSSGTKLETLCGKIEMKKIDFAYPSRPK  1008

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+   L+V+ G +V LVG SG GKST I L+QRFYD   GS+ +DGV+I  L ++W 
Sbjct  1009  ILILRQFCLEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEKGSVRVDGVDIRELDIQWF  1068

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +  LVSQE  L+  SIRENIMLGKL  S  EVV AA  ANAHDFI  L +GYET+ GE
Sbjct  1069  RKRTALVSQEPVLYSGSIRENIMLGKLDASENEVVEAARAANAHDFISSLKEGYETECGE  1128

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE++VQ+ALD+    RTT+VVA
Sbjct  1129  RGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEQVVQEALDRIMVRRTTIVVA  1188

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             H+L+TI+N D IA V+ G ++E+G++++L  K G +  +A L+
Sbjct  1189  HRLNTIKNLDSIAFVADGKVVERGTYAQLKNKRGAFFDLASLR  1231



>ref|XP_010047684.1| PREDICTED: putative ABC transporter B family member 8 [Eucalyptus 
grandis]
 ref|XP_010047685.1| PREDICTED: putative ABC transporter B family member 8 [Eucalyptus 
grandis]
 gb|KCW79641.1| hypothetical protein EUGRSUZ_C01000 [Eucalyptus grandis]
Length=1241

 Score =  1702 bits (4409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 912/1219 (75%), Positives = 1057/1219 (87%), Gaps = 21/1219 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+ +IFRYADW+D+ LM LGT GAIGDGMSTNCLL++ S L N+LG+G     +      
Sbjct  25    SVAIIFRYADWVDVVLMLLGTFGAIGDGMSTNCLLVFASRLMNSLGFGQTQQNNGH----  80

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVE+CSL FV LGLAVM++ F+EGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ
Sbjct  81    FMDEVEQCSLSFVYLGLAVMLVAFLEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  140

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKDT LI EVLSEKVPIFLMH SVF+SGL FSTYFSWRLSLVA+P +++
Sbjct  141   EATTSEIINSISKDTCLIGEVLSEKVPIFLMHASVFISGLAFSTYFSWRLSLVAFPLLLL  200

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGLIYGKYLL+LSKK  KEY KAN I+ QALSSIKT+YSFTAER ILERYSSIL+RT
Sbjct  201   LIIPGLIYGKYLLFLSKKCQKEYGKANSIIEQALSSIKTVYSFTAERRILERYSSILERT  260

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K GIAKGLAVGSTGLSFAIWAFLAWYGSRL+M+KGESGGRIYAAG+S+VL GLSL
Sbjct  261   TKLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSRLVMYKGESGGRIYAAGLSFVLSGLSL  320

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALP+VKYFTEASVAA+RIF RIDRVP+IDGE   G VLD + GE+ F +VKF YPSRP
Sbjct  321   GMALPDVKYFTEASVAAARIFDRIDRVPEIDGESPKGRVLDNMSGEIVFDHVKFTYPSRP  380

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +S+VL+D +L+VEAGKTVALVGASGSGKSTAIALLQRFYD + G + IDG +I  LQ+KW
Sbjct  381   DSVVLRDFHLEVEAGKTVALVGASGSGKSTAIALLQRFYDPDGGVVRIDGADIKTLQLKW  440

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R +MGLVSQEHALFG SI+ENI  GKL  +MEEV  AA+TANAHDFIRQLP GYETKVG
Sbjct  441   IRQKMGLVSQEHALFGASIKENIKFGKLDATMEEVTTAAITANAHDFIRQLPDGYETKVG  500

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGA LSGGQKQRIAIARA+IKNPVILLLDEATSALD ESE LVQ+ALDQAS GRTTLVV
Sbjct  501   ERGAFLSGGQKQRIAIARAVIKNPVILLLDEATSALDLESEGLVQNALDQASLGRTTLVV  560

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-----  2048
             AHKLST++NADLIAVV+GG I+E GSH +L+  K+GHYA++A+LQ QF+C +Q+Q     
Sbjct  561   AHKLSTVKNADLIAVVNGGRIVEIGSHDDLINRKDGHYAKLAELQSQFNCYEQEQGSDIP  620

Query  2047  -SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQ  1871
              S    S+AGR ST KSSP + AS   ++++ Q V       P PSF RLL  + +EWKQ
Sbjct  621   ISSVVRSSAGRLST-KSSPGIFASPLAVLDSPQLV-----SHPPPSFYRLLSYSGSEWKQ  674

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
              LIGS+SA+AFGAVQP YA+TIGGMISAFF   H EMQ RI+ + L+F+ L L+SI++NL
Sbjct  675   SLIGSLSAMAFGAVQPVYAITIGGMISAFFIQDHAEMQQRIRTYALIFSSLSLVSISVNL  734

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGEHLTRRIRLRMLE+ILTFE AWFDEE NSSGALC+RLSNEA+ VKSLVAD
Sbjct  735   LQHYNFAYMGEHLTRRIRLRMLERILTFEPAWFDEEENSSGALCSRLSNEASTVKSLVAD  794

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPLTILCFYTRKVLLS+ + KF+KAQN
Sbjct  795   RVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSSFSAKFIKAQN  854

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              STQIAVEAVYNH+IVTSFGSI KVL++FD AQDEPRKEA+KKSWLAG+G+GSAQ LTFM
Sbjct  855   QSTQIAVEAVYNHKIVTSFGSIQKVLELFDKAQDEPRKEARKKSWLAGMGMGSAQCLTFM  914

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WA DFWYGG LV  G+IS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKG+AAVAS+F I
Sbjct  915   SWAFDFWYGGTLVEKGQISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGAAAVASVFQI  974

Query  970   LDRPSIITSPYNGKVDNG--GTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             L+R S+I  P++ + ++G  GT L+K++GKI+++ V+FAYPSRP++ ILR+F LEVK G+
Sbjct  975   LNRQSLI--PWSRQAEDGGSGTLLQKVTGKIDLRNVDFAYPSRPKSLILRQFSLEVKPGT  1032

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             SIGLVGKSG GKST++ LI+RFYDV+ GS+RVDGVD+R  D+ WYR+  ALVSQEPVIYS
Sbjct  1033  SIGLVGKSGCGKSTVIGLIQRFYDVERGSVRVDGVDIREVDVHWYRKYTALVSQEPVIYS  1092

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             G+IRDNI+FGKLDA+ENE++EAA+AANA +FISSL+ GY+TECGERGVQLSGGQKQRIAI
Sbjct  1093  GSIRDNIVFGKLDATENEVVEAARAANADEFISSLEDGYETECGERGVQLSGGQKQRIAI  1152

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAIIRNPT+LLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHR+NTIK+LDSIALV
Sbjct  1153  ARAIIRNPTVLLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRINTIKDLDSIALV  1212

Query  256   SEGKVVEHGTYSQLKNKRG  200
             ++GKVVE GTY+QL NKRG
Sbjct  1213  ADGKVVERGTYAQLVNKRG  1231


 Score =   313 bits (803),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 197/530 (37%), Positives = 307/530 (58%), Gaps = 6/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             + + +   +L F  L L  + +  ++ Y ++   E    +IR + LE IL  E  +FD +
Sbjct  711   MQQRIRTYALIFSSLSLVSISVNLLQHYNFAYMGEHLTRRIRLRMLERILTFEPAWFDEE  770

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             E ++  + + +S + S ++ +++++V + +  TS     +      +W+L+LV      +
Sbjct  771   ENSSGALCSRLSNEASTVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPL  830

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L   S K  K  +++  I  +A+ + K + SF + + +LE +    D  
Sbjct  831   TILCFYTRKVLLSSFSAKFIKAQNQSTQIAVEAVYNHKIVTSFGSIQKVLELFDKAQDEP  890

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WAF  WYG  L+     S G ++      V  G  
Sbjct  891   RKEARKKSWLAGMGMGSAQCLTFMSWAFDFWYGGTLVEKGQISAGDVFKTFFVLVSTGKV  950

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKI----DGEDK-SGMVLDTIRGELEFKNVKF  2768
             +  A        + + A + +F  ++R   I      ED  SG +L  + G+++ +NV F
Sbjct  951   IAEAGSMTSDLAKGAAAVASVFQILNRQSLIPWSRQAEDGGSGTLLQKVTGKIDLRNVDF  1010

Query  2767  AYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEIN  2588
             AYPSRP+SL+L+  +L+V+ G ++ LVG SG GKST I L+QRFYD   GS+ +DGV+I 
Sbjct  1011  AYPSRPKSLILRQFSLEVKPGTSIGLVGKSGCGKSTVIGLIQRFYDVERGSVRVDGVDIR  1070

Query  2587  ALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQG  2408
              + V W R    LVSQE  ++  SIR+NI+ GKL  +  EVV AA  ANA +FI  L  G
Sbjct  1071  EVDVHWYRKYTALVSQEPVIYSGSIRDNIVFGKLDATENEVVEAARAANADEFISSLEDG  1130

Query  2407  YETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAG  2228
             YET+ GERG  LSGGQKQRIAIARAII+NP +LLLDEATSALD +SE++VQ+ALD+   G
Sbjct  1131  YETECGERGVQLSGGQKQRIAIARAIIRNPTVLLLDEATSALDVQSEQVVQEALDRIMVG  1190

Query  2227  RTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             RTT+VVAH+++TI++ D IA+V+ G ++E+G++++L+ K G +  +A  Q
Sbjct  1191  RTTIVVAHRINTIKDLDSIALVADGKVVERGTYAQLVNKRGAFFDLANRQ  1240



>ref|XP_010688320.1| PREDICTED: putative ABC transporter B family member 8 [Beta vulgaris 
subsp. vulgaris]
Length=1239

 Score =  1701 bits (4406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 893/1218 (73%), Positives = 1065/1218 (87%), Gaps = 13/1218 (1%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+ +I +YADWID  LM  G +GAI DGMSTN LL++ S + N+LG+G N  Q    N  
Sbjct  15    SVGLIIQYADWIDYLLMIFGAIGAICDGMSTNFLLIFASRIMNSLGFGQNIQQDNARN--  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGLAV+V+ FMEGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDSQ
Sbjct  73    FMSEVEKCSLYFVYLGLAVLVLAFMEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDSQ  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKDTSLIQE+LSEKVPIFLMH+S F+SG+ FS YFSWRL+LVA+PT+++
Sbjct  133   EATTSEIVNSISKDTSLIQEILSEKVPIFLMHSSSFISGIAFSAYFSWRLALVAFPTVIL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPG+IYGKYLL LSKKS+KEYSKAN I+G+ALSSIKT+YSFTAE +IL++Y+ ILD+T
Sbjct  193   LLIPGMIYGKYLLLLSKKSYKEYSKANSIIGEALSSIKTVYSFTAETTILDKYTLILDQT  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K GIAKGLAVGSTGL+FAIWAFLAWYGSRL+M+ GE+GG++YAAGI++++GG+SL
Sbjct  253   MKLGVKQGIAKGLAVGSTGLAFAIWAFLAWYGSRLVMYHGETGGKVYAAGITFIMGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G ALPE+K+FT+ASVAASRIF RIDR P IDGE + G+VLDTI+GE++F+ VKF YPSRP
Sbjct  313   GSALPEMKHFTDASVAASRIFKRIDRTPLIDGEAEKGLVLDTIQGEIQFERVKFIYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ++++L+D +LKVEAGKTVALVGASGSGKSTAIALLQRFYDAN G + IDG++I  L++KW
Sbjct  373   DTVILRDFDLKVEAGKTVALVGASGSGKSTAIALLQRFYDANEGVVKIDGIDIRRLKLKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LRGQMGLVSQ+HALFGT+I+ENIM GKL  +M+EV++AA  ANAH+FIRQLP+GYETK+G
Sbjct  433   LRGQMGLVSQDHALFGTTIKENIMFGKLDATMDEVISAAQAANAHNFIRQLPEGYETKIG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGAL+SGGQKQRIAIARAIIKNPVILLLDEATSALDSESE +VQ+ALDQAS GRTTLVV
Sbjct  493   ERGALISGGQKQRIAIARAIIKNPVILLLDEATSALDSESETIVQNALDQASLGRTTLVV  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPS-  2033
             AHKLST++NADLIAV+S G I+E GSH +L++ +GHY+++AK+Q+Q S  D DQS  PS 
Sbjct  553   AHKLSTVKNADLIAVLSNGQIMEIGSHKDLIKTDGHYSKLAKMQKQLSYNDMDQSCEPSV  612

Query  2032  -----SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQG  1868
                   +AG+ ST +SSPAV  +    +E  +   + + H P PSFSRLL LNL EWKQ 
Sbjct  613   TSSVPRSAGKLSTARSSPAVFTTPLPDLEDVES--SKNSHIP-PSFSRLLLLNLPEWKQS  669

Query  1867  LIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLC  1688
             LIGS SAIAFGAVQPTYALTIG MISAFF  +HEEM+ RI+K+CL+F+LL LLSIT NL 
Sbjct  670   LIGSFSAIAFGAVQPTYALTIGSMISAFFVENHEEMKLRIRKYCLIFSLLSLLSITFNLV  729

Query  1687  QHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADR  1508
             QH  FAYMGE LT+RIRL+MLEKIL+FE AWFD+E NSSG LC+RLSNEA MVKSLVADR
Sbjct  730   QHSSFAYMGERLTKRIRLKMLEKILSFEAAWFDDEVNSSGYLCSRLSNEATMVKSLVADR  789

Query  1507  LSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNS  1328
             + LLVQ  S+VTIAM+MGLV AWKLALVMIAVQP+TILCFYTRKVLLS+IT  FVKAQNS
Sbjct  790   VCLLVQTMSAVTIAMIMGLVTAWKLALVMIAVQPITILCFYTRKVLLSSITNNFVKAQNS  849

Query  1327  STQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMC  1148
             STQIAVEAVYNHRIVTS+G + +VL +FD AQ+EPRK+ ++KSWLAGIG+GSAQGLTFMC
Sbjct  850   STQIAVEAVYNHRIVTSYGCVGRVLGLFDEAQNEPRKQGRRKSWLAGIGMGSAQGLTFMC  909

Query  1147  WALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAIL  968
             WALDFWYGGKLV   EIS+GDVFKTFF+LVSTGKVIA+AGSMT+DLAKGSAAVAS+F IL
Sbjct  910   WALDFWYGGKLVEKKEISAGDVFKTFFVLVSTGKVIAEAGSMTTDLAKGSAAVASVFDIL  969

Query  967   DRPSII--TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             DR S I  TS   G     GT LE+++G+IE++KV+FAYP+R E+PILREF LEVK G+S
Sbjct  970   DRHSQIPVTSNSQGGGSPPGTKLERITGRIELRKVDFAYPTRTESPILREFSLEVKPGTS  1029

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             +GLVGKSG GKST++ALI+RFYDVD G+++VDGVD+R  D+ WYR+ MALVSQ+PVIYSG
Sbjct  1030  VGLVGKSGCGKSTVIALIQRFYDVDRGAVKVDGVDIRELDVVWYRKHMALVSQDPVIYSG  1089

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIRDNI+ GK+DA+E+E++EA+KAANAH+FI SLK+GY TECGERGVQLSGGQKQRIAIA
Sbjct  1090  TIRDNIVLGKIDATEHEVVEASKAANAHEFICSLKEGYQTECGERGVQLSGGQKQRIAIA  1149

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI+RNPTILLLDEATSALD++SE++VQEALD +M+GRTT+VVAHRLNTIK+LD+IA V 
Sbjct  1150  RAILRNPTILLLDEATSALDLQSERLVQEALDRVMVGRTTIVVAHRLNTIKSLDAIAFVE  1209

Query  253   EGKVVEHGTYSQLKNKRG  200
             +GKVVE GTY+QLK+KRG
Sbjct  1210  DGKVVERGTYTQLKHKRG  1227


 Score =   314 bits (805),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 195/528 (37%), Positives = 303/528 (57%), Gaps = 8/528 (2%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K  L F LL L  +    ++   ++   ER   +IR K LE IL  E  +FD +  ++
Sbjct  709   IRKYCLIFSLLSLLSITFNLVQHSSFAYMGERLTKRIRLKMLEKILSFEAAWFDDEVNSS  768

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + ++++ +++++V + +   S     +      +W+L+LV      I I+ 
Sbjct  769   GYLCSRLSNEATMVKSLVADRVCLLVQTMSAVTIAMIMGLVTAWKLALVMIAVQPITILC  828

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  ++    K  + +  I  +A+ + + + S+     +L  +    +   K G
Sbjct  829   FYTRKVLLSSITNNFVKAQNSSTQIAVEAVYNHRIVTSYGCVGRVLGLFDEAQNEPRKQG  888

Query  3097  MKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              +     G+ +GS  GL+F  WA   WYG +L+  K  S G ++      V  G  +  A
Sbjct  889   RRKSWLAGIGMGSAQGLTFMCWALDFWYGGKLVEKKEISAGDVFKTFFVLVSTGKVIAEA  948

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKID-------GEDKSGMVLDTIRGELEFKNVKFAY  2762
                     + S A + +F  +DR  +I        G    G  L+ I G +E + V FAY
Sbjct  949   GSMTTDLAKGSAAVASVFDILDRHSQIPVTSNSQGGGSPPGTKLERITGRIELRKVDFAY  1008

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINAL  2582
             P+R ES +L++ +L+V+ G +V LVG SG GKST IAL+QRFYD + G++ +DGV+I  L
Sbjct  1009  PTRTESPILREFSLEVKPGTSVGLVGKSGCGKSTVIALIQRFYDVDRGAVKVDGVDIREL  1068

Query  2581  QVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYE  2402
              V W R  M LVSQ+  ++  +IR+NI+LGK+  +  EVV A+  ANAH+FI  L +GY+
Sbjct  1069  DVVWYRKHMALVSQDPVIYSGTIRDNIVLGKIDATEHEVVEASKAANAHEFICSLKEGYQ  1128

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T+ GERG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE+LVQ+ALD+   GRT
Sbjct  1129  TECGERGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDLQSERLVQEALDRVMVGRT  1188

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             T+VVAH+L+TI++ D IA V  G ++E+G++++L  K G +  +A LQ
Sbjct  1189  TIVVAHRLNTIKSLDAIAFVEDGKVVERGTYTQLKHKRGAFFNLASLQ  1236



>ref|XP_003517643.1| PREDICTED: putative ABC transporter B family member 8-like [Glycine 
max]
 gb|KHN40386.1| Putative ABC transporter B family member 8 [Glycine soja]
Length=1241

 Score =  1701 bits (4406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 910/1218 (75%), Positives = 1042/1218 (86%), Gaps = 17/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI  I RYADWID+ LM +G +GAIGDGMSTN LLL+ S + N+LGY +N   ++    
Sbjct  22    ASIATILRYADWIDVVLMLMGAVGAIGDGMSTNVLLLFASRIMNSLGYSNNLQSTKT---  78

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSLYFV LGLA MV+ FMEGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  79    -YMAEVEKCSLYFVYLGLAAMVVAFMEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  137

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEI NSIS DTSLIQEVLSEKVP+FLMH+S F+SG+ F+TYFSWRL+LVA+PT++
Sbjct  138   QEATTSEIINSISTDTSLIQEVLSEKVPLFLMHSSSFISGVAFATYFSWRLALVAFPTLL  197

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSK + KEY KAN IV QALSSIKT+YSFTAE+ I+ RYS IL R
Sbjct  198   LLIIPGMIYGKYLIYLSKSTVKEYGKANSIVEQALSSIKTVYSFTAEKRIIGRYSDILCR  257

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LG+K GIAKG+AVGSTGLSFAIWAFLAWYGSRL+M+KGESGGRIYA+GIS+++ GLS
Sbjct  258   TSRLGIKQGIAKGIAVGSTGLSFAIWAFLAWYGSRLVMYKGESGGRIYASGISFIMCGLS  317

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ LP++KYFTEASVAASRIF  IDR P IDGED  G+VL++I G L+F++VKF YPSR
Sbjct  318   LGVVLPDLKYFTEASVAASRIFDMIDRTPLIDGEDTKGLVLESISGRLDFEHVKFTYPSR  377

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+ +VL D NL+VEAGKTVALVGASGSGKSTAIAL+QRFYDA+ G + +DGV+I +LQ+K
Sbjct  378   PDMVVLNDFNLQVEAGKTVALVGASGSGKSTAIALVQRFYDADEGVVRVDGVDIKSLQLK  437

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHA+FGTSI+ENIM GK   +M+E+VAAA  ANAH+FIRQLP+GYETK+
Sbjct  438   WIRGKMGLVSQEHAMFGTSIKENIMFGKSDATMDEIVAAASAANAHNFIRQLPEGYETKI  497

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  498   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESELLVQNALDQASMGRTTLV  557

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS---  2045
             VAHKLSTIRNADLIAVV+ G IIE G+H EL+ + NGHYA++AKLQ Q S  DQDQ+   
Sbjct  558   VAHKLSTIRNADLIAVVNSGHIIETGTHHELINRPNGHYAKLAKLQTQLSMDDQDQNQEL  617

Query  2044  ---FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                 A  S+AGR ST +   +        +   Q  P+   H P PSF+RLL LN  EWK
Sbjct  618   GALSAARSSAGRPSTAR--SSPAIFPKSPLPDDQATPSQVSH-PPPSFTRLLSLNAPEWK  674

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIG++SAIAFG+VQP YALTIGGMISAFF+ SH+EM+ RI+ +  +F  L L SI LN
Sbjct  675   QGLIGTLSAIAFGSVQPLYALTIGGMISAFFAESHQEMRHRIRTYSFIFCSLSLASIILN  734

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FAYMG  LT+RIRL MLE ILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  735   LLQHYNFAYMGAKLTKRIRLCMLENILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  794

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DRLSLLVQ  S+V IAM++GL VAWKLALVMIAVQPLTILCFYTRKVLLST++TKFVKAQ
Sbjct  795   DRLSLLVQTTSAVIIAMIIGLAVAWKLALVMIAVQPLTILCFYTRKVLLSTLSTKFVKAQ  854

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+ PRKEA+KKSWLAGIG+GSAQ LTF
Sbjct  855   NQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEAPRKEARKKSWLAGIGMGSAQCLTF  914

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFWYGG LV N EIS+GDVFKTFF+LVSTGKVIADAGSMTSDLAK S AVAS+F 
Sbjct  915   MSWALDFWYGGTLVENREISAGDVFKTFFVLVSTGKVIADAGSMTSDLAKSSTAVASVFE  974

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I  P  G   N G  LEK+SGKIE+K V+FAYPSR  TPILR+FCLEVK G S
Sbjct  975   ILDRKSLI--PKAGDNTN-GIKLEKMSGKIELKNVDFAYPSRAGTPILRKFCLEVKPGKS  1031

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             +GLVG+SG GKST++ALI+RFYDV+ GS++VD VD+R  DI WYR+ MALVSQEPVIYSG
Sbjct  1032  VGLVGRSGCGKSTVIALIQRFYDVERGSVKVDNVDIRELDIHWYRQHMALVSQEPVIYSG  1091

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +IRDNILFGK DA+ENE+IEAA+AANAH+FISSLK GY+TECGERGVQLSGGQKQRIAIA
Sbjct  1092  SIRDNILFGKQDATENEVIEAARAANAHEFISSLKDGYETECGERGVQLSGGQKQRIAIA  1151

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAIIRNP ILLLDEATSALDV+SEQVVQEALD  M+GRTT+VVAHRLNTIK LDSIA VS
Sbjct  1152  RAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRTTIVVAHRLNTIKELDSIAYVS  1211

Query  253   EGKVVEHGTYSQLKNKRG  200
             EGKV+E GTY+QL++KRG
Sbjct  1212  EGKVLEQGTYAQLRHKRG  1229


 Score =   320 bits (820),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 199/530 (38%), Positives = 309/530 (58%), Gaps = 5/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   S  F  L LA +++  ++ Y ++    +   +IR   LE IL  E  +FD +
Sbjct  712   MRHRIRTYSFIFCSLSLASIILNLLQHYNFAYMGAKLTKRIRLCMLENILTFETAWFDEE  771

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ ++++++ + +  TS  +  +      +W+L+LV      +
Sbjct  772   QNSSGALCSRLSNEASMVKSLVADRLSLLVQTTSAVIIAMIIGLAVAWKLALVMIAVQPL  831

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  LS K  K  +++  I  +A+ + + + SF +   +L  +    +  
Sbjct  832   TILCFYTRKVLLSTLSTKFVKAQNQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEAP  891

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   WYG  L+ ++  S G ++      V  G  
Sbjct  892   RKEARKKSWLAGIGMGSAQCLTFMSWALDFWYGGTLVENREISAGDVFKTFFVLVSTGKV  951

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAY  2762
             +  A        ++S A + +F  +DR   +PK  G++ +G+ L+ + G++E KNV FAY
Sbjct  952   IADAGSMTSDLAKSSTAVASVFEILDRKSLIPKA-GDNTNGIKLEKMSGKIELKNVDFAY  1010

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINAL  2582
             PSR  + +L+   L+V+ GK+V LVG SG GKST IAL+QRFYD   GS+ +D V+I  L
Sbjct  1011  PSRAGTPILRKFCLEVKPGKSVGLVGRSGCGKSTVIALIQRFYDVERGSVKVDNVDIREL  1070

Query  2581  QVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYE  2402
              + W R  M LVSQE  ++  SIR+NI+ GK   +  EV+ AA  ANAH+FI  L  GYE
Sbjct  1071  DIHWYRQHMALVSQEPVIYSGSIRDNILFGKQDATENEVIEAARAANAHEFISSLKDGYE  1130

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T+ GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRT
Sbjct  1131  TECGERGVQLSGGQKQRIAIARAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRT  1190

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             T+VVAH+L+TI+  D IA VS G ++EQG++++L  K G +  +A  Q Q
Sbjct  1191  TIVVAHRLNTIKELDSIAYVSEGKVLEQGTYAQLRHKRGAFFNLASHQIQ  1240



>ref|XP_009352696.1| PREDICTED: putative ABC transporter B family member 8 [Pyrus 
x bretschneideri]
Length=1252

 Score =  1694 bits (4388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 919/1223 (75%), Positives = 1055/1223 (86%), Gaps = 22/1223 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S++ IFRY DW+D+ LM LGT+GAIGDGMSTNCLLL+VS L N LGYG    ++  +N 
Sbjct  30    NSVVKIFRYGDWVDVVLMVLGTVGAIGDGMSTNCLLLFVSRLMNNLGYGQTQPKNHGNN-  88

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSL FV LGLAVM++ F+EGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  89    -WMDEVEKCSLDFVYLGLAVMLVAFLEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  147

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSE+ N+ISKDTSLIQEVLSEKVP F+MH+SVF+SGL FSTY SWRL+LVA+PT++
Sbjct  148   QEATTSEVINTISKDTSLIQEVLSEKVPTFVMHSSVFISGLAFSTYLSWRLALVAFPTLL  207

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSKKS+KEY KAN IV QALSSIKT+YSFTAER I++RYS+IL+R
Sbjct  208   LLIIPGMIYGKYLMYLSKKSYKEYGKANTIVEQALSSIKTVYSFTAERRIVDRYSAILER  267

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LG+K GIAKGLAVGSTGLSFAIW FLAWYGS L+M+KGESGGRIYAAGIS+VL GLS
Sbjct  268   TSRLGIKQGIAKGLAVGSTGLSFAIWGFLAWYGSHLVMYKGESGGRIYAAGISFVLSGLS  327

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALP+++YFTEA+VAA+RIF RIDR P IDGED  G+VLD IRGELEF +VKF YPSR
Sbjct  328   LGMALPDLRYFTEAAVAATRIFDRIDRKPLIDGEDTKGVVLDNIRGELEFIDVKFTYPSR  387

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P S+VLKD NLKVEAG+T+ALVGASGSGKSTAIALLQRFYDA+ G + +DGV+I  LQ+ 
Sbjct  388   PNSMVLKDFNLKVEAGRTIALVGASGSGKSTAIALLQRFYDADDGVVRVDGVDIRTLQLN  447

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R +MGLVSQEHALFGTSI+ENIM GKL  +M+EV AAAM ANAH+FIRQLP+GYETK+
Sbjct  448   WIRSKMGLVSQEHALFGTSIKENIMFGKLDANMDEVTAAAMAANAHNFIRQLPEGYETKI  507

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  508   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESEALVQNALDQASMGRTTLV  567

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCAD---QDQ-  2048
             VAHKLST+RNADLIAVV GGCIIE GSH++L+ + NGHY   AKLQRQ S  D   Q+Q 
Sbjct  568   VAHKLSTVRNADLIAVVGGGCIIEIGSHNDLINRQNGHY---AKLQRQLSTFDNVEQEQI  624

Query  2047  --SFAPSSNAGRQSTEKsspavlassplLI-ETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
               S    S+AGR ST +SSPA   +   L  ET Q V       P  SF RLL LN  EW
Sbjct  625   SVSSVSRSSAGRLSTARSSPAPAFAKSPLPNETLQLVS-----HPPTSFYRLLSLNSPEW  679

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQGLIGS+SAIAFG+VQP YALTIGGMISAFF  SHEEM+ARI+ + L+F  L L+S+TL
Sbjct  680   KQGLIGSLSAIAFGSVQPIYALTIGGMISAFFVQSHEEMRARIRTYSLIFCALSLISMTL  739

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             NL QHY FAYMGE LT+RIRLRML+KILTFETAWFDEE NSSGALC+RLSNEA+MVKSLV
Sbjct  740   NLFQHYNFAYMGEQLTKRIRLRMLQKILTFETAWFDEEQNSSGALCSRLSNEASMVKSLV  799

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
             ADR+SLLVQ  S+VTIAM++GL+VAWKLALVMI+VQPL ILCFYT+KVLLS+++  F+KA
Sbjct  800   ADRVSLLVQTTSAVTIAMILGLIVAWKLALVMISVQPLAILCFYTKKVLLSSLSANFIKA  859

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             QN STQIAVE+VYNHRIVTSFGS+ KVL +FD AQ+ PRKEA+KK+WLAGIG+GSAQ LT
Sbjct  860   QNHSTQIAVESVYNHRIVTSFGSVGKVLQLFDEAQEAPRKEARKKAWLAGIGMGSAQCLT  919

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
             FM WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F
Sbjct  920   FMSWALDFWYGGTLVKKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVF  979

Query  976   AILDRPSIITSPYNGKVDNGGT----NLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              ILDR S+I+   N    +G       LE+++G+IE KKV+FAYPSRPET +LR+F LEV
Sbjct  980   EILDRHSLISGSNNAGDGDGNNGNGIKLEEVTGRIEFKKVDFAYPSRPETLVLRQFSLEV  1039

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             K G+S GLVG SG GKST++ LI+RFYDV+ GS++VDGVD+R  DI WYRR MALVSQEP
Sbjct  1040  KPGTSTGLVGTSGCGKSTVIGLIQRFYDVERGSVKVDGVDIRDLDIQWYRRHMALVSQEP  1099

Query  628   VIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQ  449
             VIYSGTIRDNI+FGKLDA ENE+  AA+AANAH+FISSLK GYDTECGERGVQLSGGQKQ
Sbjct  1100  VIYSGTIRDNIMFGKLDAPENEVTVAARAANAHEFISSLKDGYDTECGERGVQLSGGQKQ  1159

Query  448   riaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDS  269
             RIAIARAI+RNPT+LLLDEATSALDV+SEQ+VQEALD IM+GRTT+V+AHRLNTIKNLD 
Sbjct  1160  RIAIARAILRNPTVLLLDEATSALDVQSEQLVQEALDRIMVGRTTIVIAHRLNTIKNLDM  1219

Query  268   IALVSEGKVVEHGTYSQLKNKRG  200
             IA V++GKVVE GTY+QLK KRG
Sbjct  1220  IAFVADGKVVEKGTYAQLKQKRG  1242


 Score =   326 bits (835),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 197/532 (37%), Positives = 304/532 (57%), Gaps = 10/532 (2%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   SL F  L L  M +   + Y ++   E+   +IR + L+ IL  E  +FD ++ +
Sbjct  721   RIRTYSLIFCALSLISMTLNLFQHYNFAYMGEQLTKRIRLRMLQKILTFETAWFDEEQNS  780

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+
Sbjct  781   SGALCSRLSNEASMVKSLVADRVSLLVQTTSAVTIAMILGLIVAWKLALVMISVQPLAIL  840

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  LS    K  + +  I  +++ + + + SF +   +L+ +    +   K 
Sbjct  841   CFYTKKVLLSSLSANFIKAQNHSTQIAVESVYNHRIVTSFGSVGKVLQLFDEAQEAPRKE  900

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGM  2924
               K     G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  +  
Sbjct  901   ARKKAWLAGIGMGSAQCLTFMSWALDFWYGGTLVKKGQISAGDVFKTFFILVSTGKVIAE  960

Query  2923  ALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG---------MVLDTIRGELEFKNVK  2771
             A        + S A + +F  +DR   I G + +G         + L+ + G +EFK V 
Sbjct  961   AGSMTSDLAKGSTAVASVFEILDRHSLISGSNNAGDGDGNNGNGIKLEEVTGRIEFKKVD  1020

Query  2770  FAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEI  2591
             FAYPSRPE+LVL+  +L+V+ G +  LVG SG GKST I L+QRFYD   GS+ +DGV+I
Sbjct  1021  FAYPSRPETLVLRQFSLEVKPGTSTGLVGTSGCGKSTVIGLIQRFYDVERGSVKVDGVDI  1080

Query  2590  NALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQ  2411
               L ++W R  M LVSQE  ++  +IR+NIM GKL     EV  AA  ANAH+FI  L  
Sbjct  1081  RDLDIQWYRRHMALVSQEPVIYSGTIRDNIMFGKLDAPENEVTVAARAANAHEFISSLKD  1140

Query  2410  GYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASA  2231
             GY+T+ GERG  LSGGQKQRIAIARAI++NP +LLLDEATSALD +SE+LVQ+ALD+   
Sbjct  1141  GYDTECGERGVQLSGGQKQRIAIARAILRNPTVLLLDEATSALDVQSEQLVQEALDRIMV  1200

Query  2230  GRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             GRTT+V+AH+L+TI+N D+IA V+ G ++E+G++++L +K G +  +A  QR
Sbjct  1201  GRTTIVIAHRLNTIKNLDMIAFVADGKVVEKGTYAQLKQKRGAFFNLATCQR  1252



>ref|XP_006599128.1| PREDICTED: putative ABC transporter B family member 8-like [Glycine 
max]
Length=1237

 Score =  1694 bits (4388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1218 (75%), Positives = 1051/1218 (86%), Gaps = 17/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI  I RY+DWID+ LM +G +GAIGDGMSTN LLL+ S + N+LGY +N   ++    
Sbjct  22    ASIATILRYSDWIDVVLMLMGAVGAIGDGMSTNVLLLFASRIMNSLGYSNNLQSTKT---  78

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSLYFV LGLA MV+ FMEGYCWSKTSERQVL+IRYKYLEA+LRQEVGFFD 
Sbjct  79    -YMAEVEKCSLYFVYLGLAAMVVAFMEGYCWSKTSERQVLRIRYKYLEAVLRQEVGFFDL  137

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QE TTSEI NSISKDTSLIQEVLSEKVP+FLMH+S F+SG+ F+TYFSWRL+LVA+PT++
Sbjct  138   QETTTSEIINSISKDTSLIQEVLSEKVPLFLMHSSSFISGVAFATYFSWRLALVAFPTLL  197

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSK + KEY KAN IV QALSSIKT+YSFTAE+ I+ RYS IL +
Sbjct  198   LLIIPGMIYGKYLIYLSKSTLKEYGKANSIVEQALSSIKTVYSFTAEKRIMGRYSDILCK  257

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LG+K GIAKG+AVGSTGLSFAIWAFLAWYGSRL+M+KGESGGRIYA+GIS+++ GLS
Sbjct  258   TSRLGIKQGIAKGIAVGSTGLSFAIWAFLAWYGSRLVMYKGESGGRIYASGISFIMCGLS  317

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ LP++KYFTEASVAASRIF  IDR P IDGED  G+VL++I G L+F++VKF YPSR
Sbjct  318   LGVVLPDLKYFTEASVAASRIFDMIDRTPLIDGEDTKGVVLESISGRLDFEHVKFTYPSR  377

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+ +VL+D NL+VEAGKTVALVGASGSGKSTAIAL+QRFYDA+ G + +DGV+I +LQ+K
Sbjct  378   PDMVVLRDFNLQVEAGKTVALVGASGSGKSTAIALVQRFYDADEGVVRVDGVDIKSLQLK  437

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHA+FGTSI+ENIM GK   +M+E+VAAA  ANAH+FIR+LP+GYETK+
Sbjct  438   WMRGKMGLVSQEHAMFGTSIKENIMFGKPDATMDEIVAAASAANAHNFIRELPEGYETKI  497

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  498   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESELLVQNALDQASMGRTTLV  557

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS---  2045
             VAHKLSTIRNADLIAVVSGGCIIE G+H+EL+ K NGHYA++AKLQ Q S  DQDQ+   
Sbjct  558   VAHKLSTIRNADLIAVVSGGCIIETGTHNELITKPNGHYAKLAKLQTQLSIDDQDQNPEL  617

Query  2044  ---FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                 A  S+AGR ST +SSPA+   SPLL +  Q  P+   H P PSF RLL LN  EWK
Sbjct  618   GALSATRSSAGRPSTARSSPAIFPKSPLLDD--QATPSQVSH-PPPSFKRLLSLNAPEWK  674

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIG++SAIAFG+VQP YALTIGGMISAFF+ SH+EM+ RI+ + L+F  L L SI LN
Sbjct  675   QGLIGTLSAIAFGSVQPLYALTIGGMISAFFAESHQEMRHRIRTYSLIFCSLSLASIILN  734

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FAYMG  LT+RIRL MLE ILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  735   LLQHYNFAYMGAKLTKRIRLGMLENILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  794

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DRLSLLVQ  S+VTIAM++GL VAWKLALVMIAVQPLTILCFYTRKVLLST++TKFVKAQ
Sbjct  795   DRLSLLVQTTSAVTIAMIIGLAVAWKLALVMIAVQPLTILCFYTRKVLLSTLSTKFVKAQ  854

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+ PRKEA+KKSWLAGIG+GSAQ LTF
Sbjct  855   NRSTQIAVEAVYNHRIVTSFGSITKVLWLFDEAQEAPRKEARKKSWLAGIGMGSAQCLTF  914

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFW+GG LV   EIS+GDVFKTFF+LVSTGKVIADAGSMTSDLAK S AVAS+F 
Sbjct  915   MSWALDFWFGGTLVEKREISAGDVFKTFFVLVSTGKVIADAGSMTSDLAKSSTAVASVFE  974

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I  P  G  +N G  LEK+SGKIE+K V+FAYPSR  TPILR+FCLEVK G S
Sbjct  975   ILDRKSLI--PKAGD-NNNGIKLEKMSGKIELKNVDFAYPSRVGTPILRKFCLEVKPGKS  1031

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             +GLVGKSG GKST++ALI+RFYDV  GS++VD VD+R  DI W+R+  ALVSQEPVIYSG
Sbjct  1032  VGLVGKSGCGKSTVIALIQRFYDVKRGSVKVDDVDIRELDIHWHRQHTALVSQEPVIYSG  1091

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +IRDNILFGK DA+ENE++EAA+AANA +FISSLK GY+TECGERGVQLSGGQKQRIAIA
Sbjct  1092  SIRDNILFGKQDATENEVVEAARAANAQEFISSLKDGYETECGERGVQLSGGQKQRIAIA  1151

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAIIRNP ILLLDEATSALDV+SEQVVQEALD  M+GRTT+VVAHRLNTIK LDSIA VS
Sbjct  1152  RAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRTTVVVAHRLNTIKELDSIAYVS  1211

Query  253   EGKVVEHGTYSQLKNKRG  200
             EGKV+E GTY+QL++KRG
Sbjct  1212  EGKVLEQGTYAQLRHKRG  1229


 Score =   309 bits (791),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 196/525 (37%), Positives = 304/525 (58%), Gaps = 5/525 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   SL F  L LA +++  ++ Y ++    +   +IR   LE IL  E  +FD +
Sbjct  712   MRHRIRTYSLIFCSLSLASIILNLLQHYNFAYMGAKLTKRIRLGMLENILTFETAWFDEE  771

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ ++++++ + +  TS     +      +W+L+LV      +
Sbjct  772   QNSSGALCSRLSNEASMVKSLVADRLSLLVQTTSAVTIAMIIGLAVAWKLALVMIAVQPL  831

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  LS K  K  +++  I  +A+ + + + SF +   +L  +    +  
Sbjct  832   TILCFYTRKVLLSTLSTKFVKAQNRSTQIAVEAVYNHRIVTSFGSITKVLWLFDEAQEAP  891

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   W+G  L+  +  S G ++      V  G  
Sbjct  892   RKEARKKSWLAGIGMGSAQCLTFMSWALDFWFGGTLVEKREISAGDVFKTFFVLVSTGKV  951

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAY  2762
             +  A        ++S A + +F  +DR   +PK  G++ +G+ L+ + G++E KNV FAY
Sbjct  952   IADAGSMTSDLAKSSTAVASVFEILDRKSLIPKA-GDNNNGIKLEKMSGKIELKNVDFAY  1010

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINAL  2582
             PSR  + +L+   L+V+ GK+V LVG SG GKST IAL+QRFYD   GS+ +D V+I  L
Sbjct  1011  PSRVGTPILRKFCLEVKPGKSVGLVGKSGCGKSTVIALIQRFYDVKRGSVKVDDVDIREL  1070

Query  2581  QVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYE  2402
              + W R    LVSQE  ++  SIR+NI+ GK   +  EVV AA  ANA +FI  L  GYE
Sbjct  1071  DIHWHRQHTALVSQEPVIYSGSIRDNILFGKQDATENEVVEAARAANAQEFISSLKDGYE  1130

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T+ GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRT
Sbjct  1131  TECGERGVQLSGGQKQRIAIARAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRT  1190

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMA  2087
             T+VVAH+L+TI+  D IA VS G ++EQG++++L  K G +  +A
Sbjct  1191  TVVVAHRLNTIKELDSIAYVSEGKVLEQGTYAQLRHKRGAFFNLA  1235



>gb|KHN16972.1| Putative ABC transporter B family member 8 [Glycine soja]
Length=1232

 Score =  1694 bits (4386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 914/1218 (75%), Positives = 1051/1218 (86%), Gaps = 17/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI  I RY+DWID+ LM +G +GAIGDGMSTN LLL+ S + N+LGY +N   ++    
Sbjct  17    ASIATILRYSDWIDVVLMLMGAVGAIGDGMSTNVLLLFASRIMNSLGYSNNLQSTKT---  73

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSLYFV LGLA MV+ FMEGYCWSKTSERQVL+IRYKYLEA+LRQEVGFFD 
Sbjct  74    -YMAEVEKCSLYFVYLGLAAMVVAFMEGYCWSKTSERQVLRIRYKYLEAVLRQEVGFFDL  132

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QE TTSEI NSISKDTSLIQEVLSEKVP+FLMH+S F+SG+ F+TYFSWRL+LVA+PT++
Sbjct  133   QETTTSEIINSISKDTSLIQEVLSEKVPLFLMHSSSFISGVAFATYFSWRLALVAFPTLL  192

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSK + KEY KAN IV QALSSIKT+YSFTAE+ I+ RYS IL +
Sbjct  193   LLIIPGMIYGKYLIYLSKSTLKEYGKANSIVEQALSSIKTVYSFTAEKRIMGRYSDILCK  252

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LG+K GIAKG+AVGSTGLSFAIWAFLAWYGSRL+M+KGESGGRIYA+GIS+++ GLS
Sbjct  253   TSRLGIKQGIAKGIAVGSTGLSFAIWAFLAWYGSRLVMYKGESGGRIYASGISFIMCGLS  312

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ LP++KYFTEASVAASRIF  IDR P IDGED  G+VL++I G L+F++VKF YPSR
Sbjct  313   LGVVLPDLKYFTEASVAASRIFDMIDRTPLIDGEDTKGVVLESISGRLDFEHVKFTYPSR  372

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+ +VL+D NL+VEAGKTVALVGASGSGKSTAIAL+QRFYDA+ G + +DGV+I +LQ+K
Sbjct  373   PDMVVLRDFNLQVEAGKTVALVGASGSGKSTAIALVQRFYDADEGVVRVDGVDIKSLQLK  432

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHA+FGTSI+ENIM GK   +M+E+VAAA  ANAH+FIR+LP+GYETK+
Sbjct  433   WMRGKMGLVSQEHAMFGTSIKENIMFGKPDATMDEIVAAASAANAHNFIRELPEGYETKI  492

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  493   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESELLVQNALDQASMGRTTLV  552

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS---  2045
             VAHKLSTIRNADLIAVVSGGCIIE G+H+EL+ K NGHYA++AKLQ Q S  DQDQ+   
Sbjct  553   VAHKLSTIRNADLIAVVSGGCIIETGTHNELITKPNGHYAKLAKLQTQLSIDDQDQNPEL  612

Query  2044  ---FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                 A  S+AGR ST +SSPA+   SPLL +  Q  P+   H P PSF RLL LN  EWK
Sbjct  613   GALSATRSSAGRPSTARSSPAIFPKSPLLDD--QATPSQVSH-PPPSFKRLLSLNAPEWK  669

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIG++SAIAFG+VQP YALTIGGMISAFF+ SH+EM+ RI+ + L+F  L L SI LN
Sbjct  670   QGLIGTLSAIAFGSVQPLYALTIGGMISAFFAESHQEMRHRIRTYSLIFCSLSLASIILN  729

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FAYMG  LT+RIRL MLE ILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  730   LLQHYNFAYMGAKLTKRIRLGMLENILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  789

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DRLSLLVQ  S+VTIAM++GL VAWKLALVMIAVQPLTILCFYTRKVLLST++TKFVKAQ
Sbjct  790   DRLSLLVQTTSAVTIAMIIGLAVAWKLALVMIAVQPLTILCFYTRKVLLSTLSTKFVKAQ  849

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+ PRKEA+KKSWLAGIG+GSAQ LTF
Sbjct  850   NRSTQIAVEAVYNHRIVTSFGSITKVLWLFDEAQEAPRKEARKKSWLAGIGMGSAQCLTF  909

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFW+GG LV   EIS+GDVFKTFF+LVSTGKVIADAGSMTSDLAK S AVAS+F 
Sbjct  910   MSWALDFWFGGTLVEKREISAGDVFKTFFVLVSTGKVIADAGSMTSDLAKSSTAVASVFE  969

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I  P  G  +N G  LEK+SGKIE+K V+FAYPSR  TPILR+FCLEVK G S
Sbjct  970   ILDRKSLI--PKAGD-NNNGIKLEKMSGKIELKNVDFAYPSRVGTPILRKFCLEVKPGKS  1026

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             +GLVGKSG GKST++ALI+RFYDV  GS++VD VD+R  DI W+R+  ALVSQEPVIYSG
Sbjct  1027  VGLVGKSGCGKSTVIALIQRFYDVKRGSVKVDDVDIRELDIHWHRQHTALVSQEPVIYSG  1086

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +IRDNILFGK DA+ENE++EAA+AANA +FISSLK GY+TECGERGVQLSGGQKQRIAIA
Sbjct  1087  SIRDNILFGKQDATENEVVEAARAANAQEFISSLKDGYETECGERGVQLSGGQKQRIAIA  1146

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAIIRNP ILLLDEATSALDV+SEQVVQEALD  M+GRTT+VVAHRLNTIK LDSIA VS
Sbjct  1147  RAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRTTVVVAHRLNTIKELDSIAYVS  1206

Query  253   EGKVVEHGTYSQLKNKRG  200
             EGKV+E GTY+QL++KRG
Sbjct  1207  EGKVLEQGTYAQLRHKRG  1224


 Score =   308 bits (790),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 196/525 (37%), Positives = 304/525 (58%), Gaps = 5/525 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   SL F  L LA +++  ++ Y ++    +   +IR   LE IL  E  +FD +
Sbjct  707   MRHRIRTYSLIFCSLSLASIILNLLQHYNFAYMGAKLTKRIRLGMLENILTFETAWFDEE  766

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ ++++++ + +  TS     +      +W+L+LV      +
Sbjct  767   QNSSGALCSRLSNEASMVKSLVADRLSLLVQTTSAVTIAMIIGLAVAWKLALVMIAVQPL  826

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  LS K  K  +++  I  +A+ + + + SF +   +L  +    +  
Sbjct  827   TILCFYTRKVLLSTLSTKFVKAQNRSTQIAVEAVYNHRIVTSFGSITKVLWLFDEAQEAP  886

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   W+G  L+  +  S G ++      V  G  
Sbjct  887   RKEARKKSWLAGIGMGSAQCLTFMSWALDFWFGGTLVEKREISAGDVFKTFFVLVSTGKV  946

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAY  2762
             +  A        ++S A + +F  +DR   +PK  G++ +G+ L+ + G++E KNV FAY
Sbjct  947   IADAGSMTSDLAKSSTAVASVFEILDRKSLIPKA-GDNNNGIKLEKMSGKIELKNVDFAY  1005

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINAL  2582
             PSR  + +L+   L+V+ GK+V LVG SG GKST IAL+QRFYD   GS+ +D V+I  L
Sbjct  1006  PSRVGTPILRKFCLEVKPGKSVGLVGKSGCGKSTVIALIQRFYDVKRGSVKVDDVDIREL  1065

Query  2581  QVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYE  2402
              + W R    LVSQE  ++  SIR+NI+ GK   +  EVV AA  ANA +FI  L  GYE
Sbjct  1066  DIHWHRQHTALVSQEPVIYSGSIRDNILFGKQDATENEVVEAARAANAQEFISSLKDGYE  1125

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T+ GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRT
Sbjct  1126  TECGERGVQLSGGQKQRIAIARAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRT  1185

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMA  2087
             T+VVAH+L+TI+  D IA VS G ++EQG++++L  K G +  +A
Sbjct  1186  TVVVAHRLNTIKELDSIAYVSEGKVLEQGTYAQLRHKRGAFFNLA  1230



>ref|XP_004513041.1| PREDICTED: putative ABC transporter B family member 8-like [Cicer 
arietinum]
Length=1232

 Score =  1693 bits (4385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 898/1224 (73%), Positives = 1034/1224 (84%), Gaps = 29/1224 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI +I RY DWID+ LM +G+LGAIGDGMSTN LLL+ S + N+LG  +NN+        
Sbjct  16    SISIILRYGDWIDVVLMLMGSLGAIGDGMSTNVLLLFASRIMNSLGNRNNNNSDTS----  71

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGLA MV+ FMEGYCWSKTSERQVL+IRYKYLEA+LRQEVGFFDSQ
Sbjct  72    -MSEVEKCSLYFVYLGLAAMVVAFMEGYCWSKTSERQVLRIRYKYLEAVLRQEVGFFDSQ  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             E  TSEI NSISKDTSLIQEVLSEKVP+FLM +S F+SG+ F+TYFSWRL+LVA+PT+++
Sbjct  131   ETNTSEIINSISKDTSLIQEVLSEKVPLFLMQSSSFISGIAFATYFSWRLALVAFPTLLL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYL+YLSK   KEY KAN IV QALSSIKT+YSFTAE+ I+E+YS ILDRT
Sbjct  191   LIIPGMIYGKYLIYLSKSLMKEYGKANAIVEQALSSIKTVYSFTAEKRIMEKYSEILDRT  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              +LG+K GIAKGLA+GS GLSFAIWAFLAWYGS L+M+KGESGGRIYAAGI +++ GLSL
Sbjct  251   SRLGIKQGIAKGLAIGSIGLSFAIWAFLAWYGSHLVMYKGESGGRIYAAGICFIMSGLSL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLDTIRGELEFKNVKFAYPSR  2753
             G+ LP++KYFTE S+AASRIF+ IDR+ +IDGED + G+ L  I G+L+F+NVKF YPSR
Sbjct  311   GVVLPDLKYFTEVSIAASRIFAMIDRIAEIDGEDTTKGITLQNINGKLDFENVKFTYPSR  370

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PES++L + NLKVEAGK+VALVGASGSGKSTAIALLQRFYDAN G + +DG +I +LQ+K
Sbjct  371   PESIILNNFNLKVEAGKSVALVGASGSGKSTAIALLQRFYDANEGVVRVDGFDIKSLQLK  430

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHA+FGTSI+ENIM GK   +M+E+V AA  ANAH+FIRQLPQGYETK+
Sbjct  431   WIRGKMGLVSQEHAMFGTSIKENIMFGKNDATMDEIVVAATAANAHNFIRQLPQGYETKI  490

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  491   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESELLVQNALDQASMGRTTLV  550

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQS---  2045
             VAHKLSTIRNADLIAV+S GCIIE G+H++L+   NGHYA++AKLQ Q S  DQDQ    
Sbjct  551   VAHKLSTIRNADLIAVMSNGCIIETGTHNQLINTPNGHYAKLAKLQTQLSIDDQDQIQEQ  610

Query  2044  ----FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDH-----HHQPSPSFSRLLGL  1892
                  A  S+AGR ST +SSP         I     +P D       H P PSF RLL L
Sbjct  611   TLLLSAAKSSAGRPSTARSSPV--------IFPKSPLPNDETISHVSHHPPPSFPRLLSL  662

Query  1891  NLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcl  1712
             N  EWKQGLIG++SAIA G++QP YALTIGGMISAFF+ SH+EM+ RI  +  +F  L L
Sbjct  663   NSPEWKQGLIGTLSAIALGSIQPLYALTIGGMISAFFAKSHQEMKHRIMNYSFIFTSLSL  722

Query  1711  lsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAM  1532
              SI LNL QHY FAYMG  LT+RIRL MLEKILTFET+WFDEE NSSGALC+RLSNEA+M
Sbjct  723   ASIVLNLLQHYNFAYMGAKLTKRIRLCMLEKILTFETSWFDEEKNSSGALCSRLSNEASM  782

Query  1531  VKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITT  1352
             VKSLVADRLSLLVQ  SSV IAM++GL+VAWKLALVMIAVQPLTI+CFYTRKVLLST++ 
Sbjct  783   VKSLVADRLSLLVQTTSSVAIAMIIGLIVAWKLALVMIAVQPLTIVCFYTRKVLLSTLSN  842

Query  1351  KFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGS  1172
             KFVKAQN STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+EPRKE +KK+WLAGIG+GS
Sbjct  843   KFVKAQNRSTQIAVEAVYNHRIVTSFGSITKVLKLFDEAQEEPRKEGRKKAWLAGIGMGS  902

Query  1171  AQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAA  992
             AQ LTFM WALDFW+GGKLV   EISSGDVFKTFF+LVSTGKVIA+AGSMTSDLAK S A
Sbjct  903   AQCLTFMSWALDFWFGGKLVQMREISSGDVFKTFFVLVSTGKVIAEAGSMTSDLAKSSTA  962

Query  991   VASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLE  812
             VAS+F ILDR S+I  P +G+  N G  LEK+SGKIE+K V+F+YPSR  TPIL+ FCLE
Sbjct  963   VASVFEILDRQSLI--PKDGEGTNNGIKLEKMSGKIELKNVDFSYPSRSRTPILKNFCLE  1020

Query  811   VKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQE  632
             V+ G S+GLVGKSG GKST+++LI+RFYDV+ GS+++D VD+R  DI WYR+  ALVSQE
Sbjct  1021  VRPGKSVGLVGKSGCGKSTVISLIQRFYDVEKGSLKIDNVDLRELDIHWYRQHTALVSQE  1080

Query  631   PVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
             PVIYSGTIRDNILFGK DA+ENE++EAA+AANAH FISSLK GY+TECGERGVQLSGGQK
Sbjct  1081  PVIYSGTIRDNILFGKQDATENEVVEAARAANAHDFISSLKDGYETECGERGVQLSGGQK  1140

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARAIIRNP ILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LD
Sbjct  1141  QRIAIARAIIRNPIILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRLNTIKELD  1200

Query  271   SIALVSEGKVVEHGTYSQLKNKRG  200
             SIA V EGKVVE GTY+QL++ RG
Sbjct  1201  SIAYVLEGKVVEQGTYAQLRHMRG  1224


 Score =   314 bits (804),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 197/518 (38%), Positives = 304/518 (59%), Gaps = 6/518 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             S  F  L LA +V+  ++ Y ++    +   +IR   LE IL  E  +FD ++ ++  + 
Sbjct  714   SFIFTSLSLASIVLNLLQHYNFAYMGAKLTKRIRLCMLEKILTFETSWFDEEKNSSGALC  773

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +S + S+++ ++++++ + +  TS     +      +W+L+LV      + I+     
Sbjct  774   SRLSNEASMVKSLVADRLSLLVQTTSSVAIAMIIGLIVAWKLALVMIAVQPLTIVCFYTR  833

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  LS K  K  +++  I  +A+ + + + SF +   +L+ +    +   K G K  
Sbjct  834   KVLLSTLSNKFVKAQNRSTQIAVEAVYNHRIVTSFGSITKVLKLFDEAQEEPRKEGRKKA  893

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEV  2909
                G+ +GS   L+F  WA   W+G +L+  +  S G ++      V  G  +  A    
Sbjct  894   WLAGIGMGSAQCLTFMSWALDFWFGGKLVQMREISSGDVFKTFFVLVSTGKVIAEAGSMT  953

Query  2908  KYFTEASVAASRIFSRIDR---VPKIDGE-DKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
                 ++S A + +F  +DR   +PK DGE   +G+ L+ + G++E KNV F+YPSR  + 
Sbjct  954   SDLAKSSTAVASVFEILDRQSLIPK-DGEGTNNGIKLEKMSGKIELKNVDFSYPSRSRTP  1012

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             +LK+  L+V  GK+V LVG SG GKST I+L+QRFYD   GS+ ID V++  L + W R 
Sbjct  1013  ILKNFCLEVRPGKSVGLVGKSGCGKSTVISLIQRFYDVEKGSLKIDNVDLRELDIHWYRQ  1072

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
                LVSQE  ++  +IR+NI+ GK   +  EVV AA  ANAHDFI  L  GYET+ GERG
Sbjct  1073  HTALVSQEPVIYSGTIRDNILFGKQDATENEVVEAARAANAHDFISSLKDGYETECGERG  1132

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
               LSGGQKQRIAIARAII+NP+ILLLDEATSALD +SE++VQ+ALD+   GRTT+VVAH+
Sbjct  1133  VQLSGGQKQRIAIARAIIRNPIILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHR  1192

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMA  2087
             L+TI+  D IA V  G ++EQG++++L    G +  +A
Sbjct  1193  LNTIKELDSIAYVLEGKVVEQGTYAQLRHMRGAFFNLA  1230



>gb|EYU27272.1| hypothetical protein MIMGU_mgv1a000349mg [Erythranthe guttata]
Length=1226

 Score =  1692 bits (4382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 915/1206 (76%), Positives = 1057/1206 (88%), Gaps = 17/1206 (1%)
 Frame = -2

Query  3811  RYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMREVE  3632
             RYAD +DI LM LGT GA+GDG+STNCLL+YVS LFN+LG+G++           M E+E
Sbjct  16    RYADRLDILLMVLGTFGAVGDGLSTNCLLVYVSRLFNSLGFGNSPQNHGQ----FMHEIE  71

Query  3631  KCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSE  3452
             KCSLYFV LGLAVM + FMEGYCWSKTSERQVL+IRYKYLEA+L+QEVGFFDSQEATTSE
Sbjct  72    KCSLYFVYLGLAVMAVAFMEGYCWSKTSERQVLRIRYKYLEAVLKQEVGFFDSQEATTSE  131

Query  3451  ITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgl  3272
             I NSISKDTSLIQE+LSEKVPIFLM+ S+F+SGL FS YFSW+L+LVA+PTI++LIIPGL
Sbjct  132   IINSISKDTSLIQELLSEKVPIFLMNMSMFVSGLAFSAYFSWKLALVAFPTIILLIIPGL  191

Query  3271  iygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMK  3092
             IYGKYL+YLSKKSF EY+KAN IVGQALSSIKT+Y+FTAERSI+E+YSSILD   KLG+K
Sbjct  192   IYGKYLVYLSKKSFNEYAKANTIVGQALSSIKTVYAFTAERSIIEKYSSILDGAKKLGIK  251

Query  3091  IGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPE  2912
              GIAKGLA+GSTGLSFAIW  LAWYGSRLIM+KGESGGRIYAAG+S+VLGGL+LG+ALPE
Sbjct  252   QGIAKGLAIGSTGLSFAIWGLLAWYGSRLIMYKGESGGRIYAAGVSFVLGGLALGVALPE  311

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
             VKYFTEASVAASRIF RIDR+P+ID  +  G+VL+ IRGE+EF+ V+F YPSRP++LVL 
Sbjct  312   VKYFTEASVAASRIFQRIDRIPQIDTNN--GLVLEKIRGEIEFERVQFTYPSRPDALVLN  369

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
             + +LK+EAGKTVALVGASGSGKSTAIAL+QRFYDA+ GS+ IDGV+I A+Q+KWLR QMG
Sbjct  370   NFSLKIEAGKTVALVGASGSGKSTAIALVQRFYDASGGSVRIDGVDIRAVQLKWLREQMG  429

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LVSQEHALFGTS+RENI+ GKL  +M++VVAAAM ANAH+FIRQLPQGYETK+GERG+LL
Sbjct  430   LVSQEHALFGTSVRENILFGKLDATMDDVVAAAMAANAHNFIRQLPQGYETKIGERGSLL  489

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLST  2192
             SGGQKQRIAIARAII+NPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLVVAHKLST
Sbjct  490   SGGQKQRIAIARAIIRNPVILLLDEATSALDSESETLVQNALDQASMGRTTLVVAHKLST  549

Query  2191  IRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPS--SNAGR  2018
             IRNAD++AVVSGG I+E GSH+ L++ NGHYA++AKLQRQFS  DQDQS      S+A R
Sbjct  550   IRNADVVAVVSGGSIVEIGSHNNLIKTNGHYARLAKLQRQFSALDQDQSIVEPRFSSAAR  609

Query  2017  QSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAF  1838
              S  + S     +SPL I        ++++ P PS  RLL LN  EWKQ +IGS+SA+ F
Sbjct  610   SSVSRRSSPASFASPLSIINNNNNNNNNNNYPPPSMYRLLSLNSPEWKQAVIGSLSAVIF  669

Query  1837  GAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGE  1658
             G VQP YALTIGGMISAFFS SH EMQARI+++ LVF+ LCL+SITLNLCQHY FAYMGE
Sbjct  670   GTVQPLYALTIGGMISAFFSQSHAEMQARIERYALVFSSLCLVSITLNLCQHYNFAYMGE  729

Query  1657  HLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASS  1478
              LTRRIRLRMLEK+LTFE AWFD+E NSS ALC RLSNEA+MVKS++ADRLSLL+Q  S+
Sbjct  730   CLTRRIRLRMLEKMLTFEAAWFDQEQNSSAALCFRLSNEASMVKSIIADRLSLLIQTTSA  789

Query  1477  VTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVY  1298
             VT AM++GL++AWKLALVMIAVQPLTI CFYTRKV+LSTIT KFVKAQN STQIA EAVY
Sbjct  790   VTTAMIIGLIIAWKLALVMIAVQPLTIFCFYTRKVILSTITGKFVKAQNKSTQIAAEAVY  849

Query  1297  NHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGK  1118
             NHR VTSFGSI KVL+IFD AQDEPRKEA+KKSWLAG GIGSAQGLTF+CWALDFWYGG 
Sbjct  850   NHRTVTSFGSIQKVLEIFDEAQDEPRKEARKKSWLAGAGIGSAQGLTFICWALDFWYGGT  909

Query  1117  LVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPY  938
             LV+ GEIS+GDVF+TFFILVSTGKV+A+AGSMTSDLAKGSAAVASIFAILDR S+I   Y
Sbjct  910   LVNRGEISAGDVFRTFFILVSTGKVVAEAGSMTSDLAKGSAAVASIFAILDRQSLILGSY  969

Query  937   NGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKS  758
                      NLEK+ G IEIK+V+FAYP RP+T +LR+F LEVK G++IGLVGKSG GKS
Sbjct  970   ---------NLEKMRGGIEIKRVDFAYPGRPQTLVLRDFSLEVKEGTNIGLVGKSGCGKS  1020

Query  757   TIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLD  578
             T++ALI+RFYDVD GSI+VDGV +R  DI WYR++MALVSQ+PVIYSG+IRDNIL GK+D
Sbjct  1021  TVIALIQRFYDVDCGSIKVDGVGIRLLDIEWYRKRMALVSQDPVIYSGSIRDNILLGKID  1080

Query  577   aseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLL  398
             ASENE++EAA++ANAH+FI +LK GY+TECGERGVQLSGGQKQRIAIARAIIR+P ILLL
Sbjct  1081  ASENEVVEAARSANAHEFICALKNGYETECGERGVQLSGGQKQRIAIARAIIRDPIILLL  1140

Query  397   DEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQ  218
             DEATSALDV+SEQ+VQEALD +M+GRTT+VVAHRLNTIKNLDSIA+V +GKVVE G+YSQ
Sbjct  1141  DEATSALDVQSEQLVQEALDRVMVGRTTVVVAHRLNTIKNLDSIAVVMDGKVVERGSYSQ  1200

Query  217   LKNKRG  200
             LKNKRG
Sbjct  1201  LKNKRG  1206


 Score =   336 bits (861),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 208/522 (40%), Positives = 313/522 (60%), Gaps = 7/522 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +E+ +L F  L L  + +   + Y ++   E    +IR + LE +L  E  +FD ++ +
Sbjct  698   RIERYALVFSSLCLVSITLNLCQHYNFAYMGECLTRRIRLRMLEKMLTFEAAWFDQEQNS  757

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             ++ +   +S + S+++ ++++++ + +  TS   + +      +W+L+LV      + I 
Sbjct  758   SAALCFRLSNEASMVKSIIADRLSLLIQTTSAVTTAMIIGLIIAWKLALVMIAVQPLTIF  817

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  ++ K  K  +K+  I  +A+ + +T+ SF + + +LE +    D   K 
Sbjct  818   CFYTRKVILSTITGKFVKAQNKSTQIAAEAVYNHRTVTSFGSIQKVLEIFDEAQDEPRKE  877

Query  3100  GMKIGIAKGLAVGST-GLSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
               K     G  +GS  GL+F  WA   WYG  L+ ++GE S G ++      V  G  + 
Sbjct  878   ARKKSWLAGAGIGSAQGLTFICWALDFWYGGTLV-NRGEISAGDVFRTFFILVSTGKVVA  936

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + S A + IF+ +DR   I G       L+ +RG +E K V FAYP RP+
Sbjct  937   EAGSMTSDLAKGSAAVASIFAILDRQSLILGSYN----LEKMRGGIEIKRVDFAYPGRPQ  992

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             +LVL+D +L+V+ G  + LVG SG GKST IAL+QRFYD + GSI +DGV I  L ++W 
Sbjct  993   TLVLRDFSLEVKEGTNIGLVGKSGCGKSTVIALIQRFYDVDCGSIKVDGVGIRLLDIEWY  1052

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +M LVSQ+  ++  SIR+NI+LGK+  S  EVV AA +ANAH+FI  L  GYET+ GE
Sbjct  1053  RKRMALVSQDPVIYSGSIRDNILLGKIDASENEVVEAARSANAHEFICALKNGYETECGE  1112

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAII++P+ILLLDEATSALD +SE+LVQ+ALD+   GRTT+VVA
Sbjct  1113  RGVQLSGGQKQRIAIARAIIRDPIILLLDEATSALDVQSEQLVQEALDRVMVGRTTVVVA  1172

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKL  2081
             H+L+TI+N D IAVV  G ++E+GS+S+L  K G +   A +
Sbjct  1173  HRLNTIKNLDSIAVVMDGKVVERGSYSQLKNKRGAFFNFASI  1214



>ref|XP_007152910.1| hypothetical protein PHAVU_004G170600g [Phaseolus vulgaris]
 gb|ESW24904.1| hypothetical protein PHAVU_004G170600g [Phaseolus vulgaris]
Length=1244

 Score =  1690 bits (4376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 909/1231 (74%), Positives = 1035/1231 (84%), Gaps = 44/1231 (4%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +SI  I RYADWID+ LM +G LGAIGDGMSTN LLL+ S + N+LGY  N   +     
Sbjct  26    ASITSILRYADWIDVVLMLMGALGAIGDGMSTNILLLFASRIMNSLGYSKNQQSTNT---  82

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSLYFV LGLAVMV+ FMEGYCWSKTSERQVL+IRYKYLEA+LRQEVGFFDS
Sbjct  83    -YMAEVEKCSLYFVYLGLAVMVVAFMEGYCWSKTSERQVLRIRYKYLEAVLRQEVGFFDS  141

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEI NSISKDTSLIQEVLSEKVP+FLMH+S F+SG+ F+TYFSWRL+LVA+PT+V
Sbjct  142   QEATTSEIINSISKDTSLIQEVLSEKVPLFLMHSSSFISGVAFATYFSWRLALVAFPTLV  201

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSK S +EY KAN IV QALSSIKT+YSFTAE+ I  RYS IL R
Sbjct  202   LLIIPGMIYGKYLIYLSKSSVEEYGKANSIVEQALSSIKTVYSFTAEKRISGRYSDILCR  261

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T  LG+K GIAKGLAVGSTGLSFAIWAF+AWYGSRL+M+KGESGGRIYA+GIS+++ GLS
Sbjct  262   TSSLGIKQGIAKGLAVGSTGLSFAIWAFIAWYGSRLVMYKGESGGRIYASGISFIMCGLS  321

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ LP++KYFTEASVAASRIF  IDR+P IDGED  G+VLD I G+LEF+ VKF YPSR
Sbjct  322   LGVVLPDLKYFTEASVAASRIFDMIDRIPLIDGEDTKGLVLDCISGKLEFEQVKFTYPSR  381

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+ +VL + NL+VEAGKTVALVGASGSGKSTAIAL+QRFYDA+ G + +DGV+I +LQ+K
Sbjct  382   PDMVVLSNFNLQVEAGKTVALVGASGSGKSTAIALMQRFYDADEGVVRVDGVDIKSLQLK  441

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHALFGTSI+ENIM GK   +M+E+VAAA  ANAH+FIRQLP+GYETK+
Sbjct  442   WIRGKMGLVSQEHALFGTSIKENIMFGKTDATMDEIVAAASAANAHNFIRQLPKGYETKI  501

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  502   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESESLVQNALDQASMGRTTLV  561

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS---  2045
             VAHKLSTIRNADLIAVVSGG IIE G+H EL+ + NGHYA +AKLQ Q S  DQDQ+   
Sbjct  562   VAHKLSTIRNADLIAVVSGGRIIETGTHKELINRPNGHYANLAKLQTQLSMDDQDQNSEL  621

Query  2044  ---FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPS-------------  1913
                 A  S+AGR S                 +A+  P      P P              
Sbjct  622   GAVSAARSSAGRPS-----------------SARSSPAIFPKSPLPDEATPSPVSHPPPS  664

Query  1912  FSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCL  1733
             F+RLL LN  EWKQGLIG++SAIAFG+VQP YALTIGGMISAFF+ SH EM  RI+ + L
Sbjct  665   FTRLLSLNAPEWKQGLIGTLSAIAFGSVQPLYALTIGGMISAFFAKSHLEMMHRIRTYSL  724

Query  1732  VFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCAR  1553
             +F  L L SITLNL QHY FA+MG  LT+RIRLRMLE ILTFETAWFDEE NSSGALC+R
Sbjct  725   IFCSLSLASITLNLLQHYNFAFMGAKLTKRIRLRMLENILTFETAWFDEEQNSSGALCSR  784

Query  1552  LSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKV  1373
             LSNEA+MVKSLVADRLSLLVQ  S+VT+AM++GL VAWKLALVMIAVQPLTILCFYTRKV
Sbjct  785   LSNEASMVKSLVADRLSLLVQTTSAVTVAMIIGLAVAWKLALVMIAVQPLTILCFYTRKV  844

Query  1372  LLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWL  1193
             LLST++TKFVKAQN STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+EPRKEA+KKSWL
Sbjct  845   LLSTLSTKFVKAQNQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEEPRKEARKKSWL  904

Query  1192  AGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSD  1013
             AGIG+GSAQ LTFM WALDFWYGG LV   EIS+GDVFKTFF+LVSTGKVIADAGSMTSD
Sbjct  905   AGIGMGSAQCLTFMSWALDFWYGGTLVEKREISAGDVFKTFFVLVSTGKVIADAGSMTSD  964

Query  1012  LAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPI  833
             LAK S AVAS+F ILDR S+I  P  G  +  G  LEK+SGKIE+K V+F+YPSR  TPI
Sbjct  965   LAKSSTAVASVFEILDRKSLI--PKAGD-NTSGIKLEKMSGKIELKNVDFSYPSRAGTPI  1021

Query  832   LREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQ  653
             LR+FCLEVK G+S+GLVGKSG GKST++AL++RFYDV+ G ++VD VD+R  DI WYR+ 
Sbjct  1022  LRKFCLEVKPGTSVGLVGKSGCGKSTVIALVQRFYDVERGLVKVDNVDIRELDIHWYRQH  1081

Query  652   MALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGV  473
              ALVSQEPVIYSG+IR+NILFGK DA+ENE++EAA+AANAH+FISSLK GY+TECGERGV
Sbjct  1082  TALVSQEPVIYSGSIRENILFGKQDATENEVVEAARAANAHEFISSLKSGYETECGERGV  1141

Query  472   QLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRL  293
             QLSGGQKQRIAIARAIIRNP ILLLDEATSALDV+SEQVVQEALD  M+GRTT+VVAHRL
Sbjct  1142  QLSGGQKQRIAIARAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRTTIVVAHRL  1201

Query  292   NTIKNLDSIALVSEGKVVEHGTYSQLKNKRG  200
             NTIK LDSIA VSEGKV+E GTY+QL++ RG
Sbjct  1202  NTIKELDSIAYVSEGKVMEQGTYAQLRHMRG  1232


 Score =   315 bits (807),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 199/530 (38%), Positives = 305/530 (58%), Gaps = 5/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +M  +   SL F  L LA + +  ++ Y ++    +   +IR + LE IL  E  +FD +
Sbjct  715   MMHRIRTYSLIFCSLSLASITLNLLQHYNFAFMGAKLTKRIRLRMLENILTFETAWFDEE  774

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ ++++++ + +  TS     +      +W+L+LV      +
Sbjct  775   QNSSGALCSRLSNEASMVKSLVADRLSLLVQTTSAVTVAMIIGLAVAWKLALVMIAVQPL  834

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  LS K  K  +++  I  +A+ + + + SF +   +L  +    +  
Sbjct  835   TILCFYTRKVLLSTLSTKFVKAQNQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEEP  894

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   WYG  L+  +  S G ++      V  G  
Sbjct  895   RKEARKKSWLAGIGMGSAQCLTFMSWALDFWYGGTLVEKREISAGDVFKTFFVLVSTGKV  954

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAY  2762
             +  A        ++S A + +F  +DR   +PK  G++ SG+ L+ + G++E KNV F+Y
Sbjct  955   IADAGSMTSDLAKSSTAVASVFEILDRKSLIPKA-GDNTSGIKLEKMSGKIELKNVDFSY  1013

Query  2761  PSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINAL  2582
             PSR  + +L+   L+V+ G +V LVG SG GKST IAL+QRFYD   G + +D V+I  L
Sbjct  1014  PSRAGTPILRKFCLEVKPGTSVGLVGKSGCGKSTVIALVQRFYDVERGLVKVDNVDIREL  1073

Query  2581  QVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYE  2402
              + W R    LVSQE  ++  SIRENI+ GK   +  EVV AA  ANAH+FI  L  GYE
Sbjct  1074  DIHWYRQHTALVSQEPVIYSGSIRENILFGKQDATENEVVEAARAANAHEFISSLKSGYE  1133

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T+ GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   GRT
Sbjct  1134  TECGERGVQLSGGQKQRIAIARAIIRNPKILLLDEATSALDVQSEQVVQEALDRTMVGRT  1193

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             T+VVAH+L+TI+  D IA VS G ++EQG++++L    G +  +A  Q Q
Sbjct  1194  TIVVAHRLNTIKELDSIAYVSEGKVMEQGTYAQLRHMRGAFFNLASHQIQ  1243



>gb|KDO66565.1| hypothetical protein CISIN_1g000909mg [Citrus sinensis]
Length=1230

 Score =  1689 bits (4375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 909/1219 (75%), Positives = 1059/1219 (87%), Gaps = 14/1219 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             ++I +IFR+AD  DI LM LGT+GAIGDGMSTNCLL++ S + N+LG+G   SQ      
Sbjct  8     NNIGIIFRFADRTDILLMVLGTVGAIGDGMSTNCLLVFASRIMNSLGFGQTQSQQNHHEN  67

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
              L  EVEKCSLYFV LGLAVMV+ F+EGYCWSKTSERQV+KIRYKYLEA+LRQEVGFFDS
Sbjct  68    FL-DEVEKCSLYFVYLGLAVMVVAFLEGYCWSKTSERQVVKIRYKYLEAVLRQEVGFFDS  126

Query  3472  QEATT-SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTI  3296
             Q+ATT SE+ NSISKDTSLIQE+LSEKVPIF+M+ SVF+SGL FSTYFSWRLSLVA+PT+
Sbjct  127   QDATTTSEVINSISKDTSLIQELLSEKVPIFVMNASVFISGLAFSTYFSWRLSLVAFPTL  186

Query  3295  ViliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD  3116
             ++LIIPG+IYGKYL+YLSKK++KEY KAN IV QALSSIKT+YSF+AER I++RY +ILD
Sbjct  187   LLLIIPGMIYGKYLIYLSKKAYKEYGKANAIVEQALSSIKTVYSFSAERRIIDRYEAILD  246

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              T KLG+K G AKGLAVGSTGLSFAIWAFLAWYGS L+M KGE+GG+IYAAGIS++L GL
Sbjct  247   STTKLGIKQGTAKGLAVGSTGLSFAIWAFLAWYGSHLVMFKGETGGKIYAAGISFILSGL  306

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
             SLG ALPE+KYFTEAS+AASRIF RIDRVP+IDGED  G+VLD +RGE+EF++VKF+YPS
Sbjct  307   SLGSALPELKYFTEASIAASRIFDRIDRVPEIDGEDTKGLVLDEVRGEIEFEHVKFSYPS  366

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S+VLKD NLKV+AGK+VALVGASGSGKSTAIAL+QRFYDA+ G + IDGV+I  LQ+
Sbjct  367   RPDSIVLKDFNLKVKAGKSVALVGASGSGKSTAIALVQRFYDADDGIVRIDGVDIRRLQL  426

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R +MGLVSQEHALFGTSI++NIM GKL  +M+EV+AAA  ANAH+FIRQLP+GYETK
Sbjct  427   KWVRREMGLVSQEHALFGTSIKDNIMFGKLDATMDEVIAAATAANAHNFIRQLPEGYETK  486

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTL
Sbjct  487   VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASLGRTTL  546

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ---  2048
             VVAHKLST+RNADLIAVV  GC++E G+H++L+ + +GHYA+MAKLQRQFSC DQ+    
Sbjct  547   VVAHKLSTVRNADLIAVVDNGCLVEIGTHNDLINRIDGHYAKMAKLQRQFSCDDQETIPE  606

Query  2047  ---SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
                S    S+ GR S  +SSPA+ AS   +I++ Q V     + P PSF RLL LN  EW
Sbjct  607   THVSSVTRSSGGRLSAARSSPAIFASPLPVIDSPQPVT----YLP-PSFFRLLSLNAPEW  661

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQGLIGS+SAIA G+VQPTYALTIGGMISAFF+ SH EMQ+RI+ + L+F  L L+S+  
Sbjct  662   KQGLIGSLSAIAVGSVQPTYALTIGGMISAFFAKSHSEMQSRIRTYSLIFCSLSLISLAF  721

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             NL QHY FAYMG  LT+RIRLRMLEKILTFE AWFDEE NSSGALC+RLSNEA+MVKSLV
Sbjct  722   NLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEEQNSSGALCSRLSNEASMVKSLV  781

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
             ADR+SLLVQ  S+V IAM+MGLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+++T FVKA
Sbjct  782   ADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPLTILCFYTRKVLLSSVSTNFVKA  841

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             QN STQIAVEAV NHRIVTSFGS  KVL IFD AQ+EPRK+A+KKSWLAGIG+GSAQ LT
Sbjct  842   QNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEPRKQARKKSWLAGIGMGSAQCLT  901

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
             FM WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F
Sbjct  902   FMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVF  961

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
              ILDR S+I           G+ L+K+SGKIE+++V+FAYPSRP+  +LR+F +EVK G+
Sbjct  962   KILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDFAYPSRPDALVLRQFSMEVKPGT  1021

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S+GLVGKSG GKST++ LI+RFYDV+ GS+RVDG+DVR  D+ WYR+  ALVSQEPVIY+
Sbjct  1022  SVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVRELDVHWYRKHTALVSQEPVIYA  1081

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             G IRDNI+FGKLDASENE++EAA+AANAH+FISSLK GY+TECGERGVQLSGGQ+QRIAI
Sbjct  1082  GNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQRQRIAI  1141

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAIIRNPTILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LDSIALV
Sbjct  1142  ARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMGRTTIVVAHRLNTIKKLDSIALV  1201

Query  256   SEGKVVEHGTYSQLKNKRG  200
             ++G+VVE GTY+QL + RG
Sbjct  1202  ADGRVVERGTYAQLTHMRG  1220


 Score =   308 bits (788),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 301/530 (57%), Gaps = 6/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   SL F  L L  +    ++ Y ++    R   +IR + LE IL  E  +FD +
Sbjct  700   MQSRIRTYSLIFCSLSLISLAFNLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEE  759

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ +++++V + +  TS     +      +W+L++V      +
Sbjct  760   QNSSGALCSRLSNEASMVKSLVADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPL  819

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +  
Sbjct  820   TILCFYTRKVLLSSVSTNFVKAQNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEP  879

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  
Sbjct  880   RKQARKKSWLAGIGMGSAQCLTFMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKV  939

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG-----MVLDTIRGELEFKNVKF  2768
             +  A        + S A + +F  +DR   I G  ++G       L  I G++E + V F
Sbjct  940   IAEAGSMTSDLAKGSTAVASVFKILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDF  999

Query  2767  AYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEIN  2588
             AYPSRP++LVL+  +++V+ G +V LVG SG GKST I L+QRFYD   GS+ +DG+++ 
Sbjct  1000  AYPSRPDALVLRQFSMEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVR  1059

Query  2587  ALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQG  2408
              L V W R    LVSQE  ++  +IR+NI+ GKL  S  EVV AA  ANAH+FI  L  G
Sbjct  1060  ELDVHWYRKHTALVSQEPVIYAGNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDG  1119

Query  2407  YETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAG  2228
             YET+ GERG  LSGGQ+QRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   G
Sbjct  1120  YETECGERGVQLSGGQRQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMG  1179

Query  2227  RTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             RTT+VVAH+L+TI+  D IA+V+ G ++E+G++++L    G +  +A LQ
Sbjct  1180  RTTIVVAHRLNTIKKLDSIALVADGRVVERGTYAQLTHMRGAFFNLATLQ  1229



>ref|XP_006475597.1| PREDICTED: putative ABC transporter B family member 8-like [Citrus 
sinensis]
Length=1241

 Score =  1687 bits (4368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 909/1219 (75%), Positives = 1058/1219 (87%), Gaps = 14/1219 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             ++I +IFR+AD  DI LM LGT+GAIGDGMSTNCLL++ S + N+LG+G   SQ      
Sbjct  19    NNIGIIFRFADRTDILLMVLGTVGAIGDGMSTNCLLVFASRIMNSLGFGQTQSQQNHHEN  78

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
              L  EVEKCSLYFV LGLAVMV+ F+EGYCWSKTSERQV+KIRYKYLEA+LRQEVGFFDS
Sbjct  79    FL-DEVEKCSLYFVYLGLAVMVVAFLEGYCWSKTSERQVVKIRYKYLEAVLRQEVGFFDS  137

Query  3472  QEATT-SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTI  3296
             Q+ATT SE+ NSISKDTSLIQE+LSEKVPIF+M+ SVF+SGL FSTYFSWRLSLVA+PT+
Sbjct  138   QDATTTSEVINSISKDTSLIQELLSEKVPIFVMNASVFISGLAFSTYFSWRLSLVAFPTL  197

Query  3295  ViliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD  3116
             ++LIIPG+IYGKYL+YLSKK++KEY KAN IV QALSSIKT+YSF+AER I++RY +ILD
Sbjct  198   LLLIIPGMIYGKYLIYLSKKAYKEYGKANAIVEQALSSIKTVYSFSAERRIIDRYEAILD  257

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              T KLG+K G AKGLAVGSTGLSFAIWAFLAWYGS L+M KGE+GG+IYAAGIS++L GL
Sbjct  258   STTKLGIKQGTAKGLAVGSTGLSFAIWAFLAWYGSHLVMFKGETGGKIYAAGISFILSGL  317

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
             SLG ALPE+KYFTEAS+AASRIF RIDRVP+IDGED  G+VLD +RGE+EF++VKF+YPS
Sbjct  318   SLGSALPELKYFTEASIAASRIFDRIDRVPEIDGEDTKGLVLDEVRGEIEFEHVKFSYPS  377

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S+VLKD NLKV+AGKTVALVGASGSGKSTAIAL+QRFYDA+ G + IDGV+I  LQ+
Sbjct  378   RPDSIVLKDFNLKVKAGKTVALVGASGSGKSTAIALVQRFYDADDGIVRIDGVDIRRLQL  437

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R +MGLVSQEHALFGTSI++NIM GKL  +M+EV+AAA  ANAH+FIRQLP+GYETK
Sbjct  438   KWVRREMGLVSQEHALFGTSIKDNIMFGKLDATMDEVIAAATAANAHNFIRQLPEGYETK  497

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTL
Sbjct  498   VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASLGRTTL  557

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ---  2048
             VVAHKLST+RNADLIAVV  GC++E G+H++L+ + +G YA+MAKLQRQFSC DQ+    
Sbjct  558   VVAHKLSTVRNADLIAVVDNGCLVEIGTHNDLINRIDGPYAKMAKLQRQFSCDDQETIPE  617

Query  2047  ---SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
                S    S+ GR S  +SSPA+ AS   +I++ Q V     + P PSF RLL LN  EW
Sbjct  618   THVSSVTRSSGGRLSAARSSPAIFASPLPVIDSPQPVT----YLP-PSFFRLLSLNAPEW  672

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQGLIGS+SAIA G+VQPTYALTIGGMISAFF+ SH EMQ+RI+ + L+F  L L+S+  
Sbjct  673   KQGLIGSLSAIAVGSVQPTYALTIGGMISAFFAKSHSEMQSRIRTYSLIFCSLSLISLAF  732

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             NL QHY FAYMG  LT+RIRLRMLEKILTFE AWFDEE NSSGALC+RLSNEA+MVKSLV
Sbjct  733   NLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEEQNSSGALCSRLSNEASMVKSLV  792

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
             ADR+SLLVQ  S+V IAM+MGLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+++T FVKA
Sbjct  793   ADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPLTILCFYTRKVLLSSVSTNFVKA  852

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             QN STQIAVEAV NHRIVTSFGS  KVL IFD AQ+EPRK+A+KKSWLAGIG+GSAQ LT
Sbjct  853   QNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEPRKQARKKSWLAGIGMGSAQCLT  912

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
             FM WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F
Sbjct  913   FMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVF  972

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
              ILDR S+I           G+ L+K+SGKIE+++V+FAYPSRP+  +LR+F +EVK G+
Sbjct  973   KILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDFAYPSRPDALVLRQFSMEVKPGT  1032

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S+GLVGKSG GKST++ LI+RFYDV+ GS+RVDG+DVR  D+ WYR+  ALVSQEPVIY+
Sbjct  1033  SVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVRELDVHWYRKHTALVSQEPVIYA  1092

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             G IRDNI+FGKLDASENE++EAA+AANAH+FISSLK GY+TECGERGVQLSGGQ+QRIAI
Sbjct  1093  GNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQRQRIAI  1152

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAIIRNPTILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LDSIALV
Sbjct  1153  ARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMGRTTIVVAHRLNTIKKLDSIALV  1212

Query  256   SEGKVVEHGTYSQLKNKRG  200
             ++G+VVE GTY+QL + RG
Sbjct  1213  ADGRVVERGTYAQLTHMRG  1231


 Score =   308 bits (788),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 301/530 (57%), Gaps = 6/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   SL F  L L  +    ++ Y ++    R   +IR + LE IL  E  +FD +
Sbjct  711   MQSRIRTYSLIFCSLSLISLAFNLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEE  770

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ +++++V + +  TS     +      +W+L++V      +
Sbjct  771   QNSSGALCSRLSNEASMVKSLVADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPL  830

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +  
Sbjct  831   TILCFYTRKVLLSSVSTNFVKAQNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEP  890

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  
Sbjct  891   RKQARKKSWLAGIGMGSAQCLTFMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKV  950

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG-----MVLDTIRGELEFKNVKF  2768
             +  A        + S A + +F  +DR   I G  ++G       L  I G++E + V F
Sbjct  951   IAEAGSMTSDLAKGSTAVASVFKILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDF  1010

Query  2767  AYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEIN  2588
             AYPSRP++LVL+  +++V+ G +V LVG SG GKST I L+QRFYD   GS+ +DG+++ 
Sbjct  1011  AYPSRPDALVLRQFSMEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVR  1070

Query  2587  ALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQG  2408
              L V W R    LVSQE  ++  +IR+NI+ GKL  S  EVV AA  ANAH+FI  L  G
Sbjct  1071  ELDVHWYRKHTALVSQEPVIYAGNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDG  1130

Query  2407  YETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAG  2228
             YET+ GERG  LSGGQ+QRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   G
Sbjct  1131  YETECGERGVQLSGGQRQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMG  1190

Query  2227  RTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             RTT+VVAH+L+TI+  D IA+V+ G ++E+G++++L    G +  +A LQ
Sbjct  1191  RTTIVVAHRLNTIKKLDSIALVADGRVVERGTYAQLTHMRGAFFNLATLQ  1240



>ref|XP_006451287.1| hypothetical protein CICLE_v10007269mg [Citrus clementina]
 gb|ESR64527.1| hypothetical protein CICLE_v10007269mg [Citrus clementina]
Length=1230

 Score =  1686 bits (4367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 909/1219 (75%), Positives = 1058/1219 (87%), Gaps = 14/1219 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             ++I +IFR+AD  DI LM LGT+GAIGDGMSTNCLL++ S + N+LG+G   SQ      
Sbjct  8     NNIGIIFRFADRTDILLMVLGTVGAIGDGMSTNCLLVFASRIMNSLGFGQTQSQQNHHEN  67

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
              L  EVEKCSLYFV LGLAVMV+ F+EGYCWSKTSERQV+KIRYKYLEA+LRQEVGFFDS
Sbjct  68    FL-DEVEKCSLYFVYLGLAVMVVAFLEGYCWSKTSERQVVKIRYKYLEAVLRQEVGFFDS  126

Query  3472  QEATT-SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTI  3296
             Q+ATT SE+ NSISKDTSLIQE+LSEKVPIF+M+ SVF+SGL FSTYFSWRLSLVA+PT+
Sbjct  127   QDATTTSEVINSISKDTSLIQELLSEKVPIFVMNASVFISGLAFSTYFSWRLSLVAFPTL  186

Query  3295  ViliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD  3116
             ++LIIPG+IYGKYL+YLSKK++KEY KAN IV QALSSIKT+YSF+AER I++RY +ILD
Sbjct  187   LLLIIPGMIYGKYLIYLSKKAYKEYGKANAIVEQALSSIKTVYSFSAERRIIDRYEAILD  246

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              T KLG+K G AKGLAVGSTGLSFAIWAFLAWYGS L+M KGE+GG+IYAAGIS++L GL
Sbjct  247   STTKLGIKQGTAKGLAVGSTGLSFAIWAFLAWYGSHLVMFKGETGGKIYAAGISFILSGL  306

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
             SLG ALPE+KYFTEAS+AASRIF RIDRVP+IDGED  G+VLD +RGE+EF++VKF+YPS
Sbjct  307   SLGSALPELKYFTEASIAASRIFDRIDRVPEIDGEDTKGLVLDEVRGEIEFEHVKFSYPS  366

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S+VLKD NLKV+AGKTVALVGASGSGKSTAIAL+QRFYDA+ G + IDGV+I  LQ+
Sbjct  367   RPDSIVLKDFNLKVKAGKTVALVGASGSGKSTAIALVQRFYDADDGIVRIDGVDIRRLQL  426

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R +MGLVSQEHALFGTSI++NIM GKL  +M+EV+AAA  ANAH+FIRQLP+GYETK
Sbjct  427   KWVRREMGLVSQEHALFGTSIKDNIMFGKLDATMDEVIAAATAANAHNFIRQLPEGYETK  486

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTL
Sbjct  487   VGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNALDQASLGRTTL  546

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ---  2048
             VVAHKLST+RNADLIAVV  GC++E G+H++L+ + +G YA+MAKLQRQFSC DQ+    
Sbjct  547   VVAHKLSTVRNADLIAVVDNGCLVEIGTHNDLINRIDGPYAKMAKLQRQFSCDDQETIPE  606

Query  2047  ---SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
                S    S+ GR S  +SSPA+ AS   +I++ Q V     + P PSF RLL LN  EW
Sbjct  607   THVSSVTRSSGGRLSAARSSPAIFASPLPVIDSPQPVT----YLP-PSFFRLLSLNAPEW  661

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQGLIGS+SAIA G+VQPTYALTIGGMISAFF+ SH EMQ+RI+ + L+F  L L+S+  
Sbjct  662   KQGLIGSLSAIAVGSVQPTYALTIGGMISAFFAKSHSEMQSRIRTYSLIFCSLSLISLAF  721

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             NL QHY FAYMG  LT+RIRLRMLEKILTFE AWFDEE NSSGALC+RLSNEA+MVKSLV
Sbjct  722   NLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEEQNSSGALCSRLSNEASMVKSLV  781

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
             ADR+SLLVQ  S+V IAM+MGLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+++T FVKA
Sbjct  782   ADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPLTILCFYTRKVLLSSVSTNFVKA  841

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             QN STQIAVEAV NHRIVTSFGS  KVL IFD AQ+EPRK+A+KKSWLAGIG+GSAQ LT
Sbjct  842   QNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEPRKQARKKSWLAGIGMGSAQCLT  901

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
             FM WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F
Sbjct  902   FMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVF  961

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
              ILDR S+I           G+ L+K+SGKIE+++V+FAYPSRP+  +LR+F +EVK G+
Sbjct  962   KILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDFAYPSRPDALVLRQFSMEVKPGT  1021

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S+GLVGKSG GKST++ LI+RFYDV+ GS+RVDG+DVR  D+ WYR+  ALVSQEPVIY+
Sbjct  1022  SVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVRELDVHWYRKHTALVSQEPVIYA  1081

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             G IRDNI+FGKLDASENE++EAA+AANAH+FISSLK GY+TECGERGVQLSGGQ+QRIAI
Sbjct  1082  GNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDGYETECGERGVQLSGGQRQRIAI  1141

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAIIRNPTILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLNTIK LDSIALV
Sbjct  1142  ARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMGRTTIVVAHRLNTIKKLDSIALV  1201

Query  256   SEGKVVEHGTYSQLKNKRG  200
             ++G+VVE GTY+QL + RG
Sbjct  1202  ADGRVVERGTYAQLTHMRG  1220


 Score =   308 bits (788),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 301/530 (57%), Gaps = 6/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             +   +   SL F  L L  +    ++ Y ++    R   +IR + LE IL  E  +FD +
Sbjct  700   MQSRIRTYSLIFCSLSLISLAFNLLQHYNFAYMGGRLTKRIRLRMLEKILTFEAAWFDEE  759

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + ++  + + +S + S+++ +++++V + +  TS     +      +W+L++V      +
Sbjct  760   QNSSGALCSRLSNEASMVKSLVADRVSLLVQTTSAVAIAMIMGLVVAWKLAVVMIAVQPL  819

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
              I+        L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +  
Sbjct  820   TILCFYTRKVLLSSVSTNFVKAQNRSTQIAVEAVINHRIVTSFGSAGKVLQIFDEAQEEP  879

Query  3109  IKLGMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
              K   K     G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  
Sbjct  880   RKQARKKSWLAGIGMGSAQCLTFMSWALDFWYGGTLVQKGQISAGDVFKTFFILVSTGKV  939

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG-----MVLDTIRGELEFKNVKF  2768
             +  A        + S A + +F  +DR   I G  ++G       L  I G++E + V F
Sbjct  940   IAEAGSMTSDLAKGSTAVASVFKILDRQSLIPGSSQAGDGTRGSKLQKISGKIEMRRVDF  999

Query  2767  AYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEIN  2588
             AYPSRP++LVL+  +++V+ G +V LVG SG GKST I L+QRFYD   GS+ +DG+++ 
Sbjct  1000  AYPSRPDALVLRQFSMEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEQGSVRVDGMDVR  1059

Query  2587  ALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQG  2408
              L V W R    LVSQE  ++  +IR+NI+ GKL  S  EVV AA  ANAH+FI  L  G
Sbjct  1060  ELDVHWYRKHTALVSQEPVIYAGNIRDNIVFGKLDASENEVVEAARAANAHEFISSLKDG  1119

Query  2407  YETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAG  2228
             YET+ GERG  LSGGQ+QRIAIARAII+NP ILLLDEATSALD +SE++VQ+ALD+   G
Sbjct  1120  YETECGERGVQLSGGQRQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQEALDRIMMG  1179

Query  2227  RTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             RTT+VVAH+L+TI+  D IA+V+ G ++E+G++++L    G +  +A LQ
Sbjct  1180  RTTIVVAHRLNTIKKLDSIALVADGRVVERGTYAQLTHMRGAFFNLATLQ  1229



>ref|XP_008390760.1| PREDICTED: putative ABC transporter B family member 8 [Malus 
domestica]
Length=1245

 Score =  1683 bits (4359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 906/1218 (74%), Positives = 1047/1218 (86%), Gaps = 14/1218 (1%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             +S++ IFRYADW+D+ LM LGT+GAIGDGMSTNCLL++VS L N LGYG     +  +N 
Sbjct  27    NSVLKIFRYADWVDVVLMVLGTVGAIGDGMSTNCLLVFVSRLMNNLGYGQTQQNNHGTN-  85

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVE+CSL FV LGLA M++  +EGYCWSKTSERQVLKIRYKYLEA+LRQEVGFFDS
Sbjct  86    -WMDEVERCSLDFVYLGLAXMLVAHLEGYCWSKTSERQVLKIRYKYLEAVLRQEVGFFDS  144

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSE+ N+ISKDT LIQEVLSEKVP F+MH+SVF+SGL FSTY SWRL+LVA+PT++
Sbjct  145   QEATTSEVINTISKDTFLIQEVLSEKVPTFVMHSSVFVSGLAFSTYLSWRLALVAFPTLL  204

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYGKYL+YLSK S+KEY +AN I+GQALSSIKT+YSFTAER I++RYS+IL+R
Sbjct  205   LLIIPGMIYGKYLMYLSKXSYKEYGEANIIIGQALSSIKTVYSFTAERRIVDRYSAILER  264

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T +LG+K GIAKGLAVGSTGLSFAIW FLAWYGS L+M KGESGGRIYAAGIS+VL GLS
Sbjct  265   TSRLGIKQGIAKGLAVGSTGLSFAIWGFLAWYGSHLVMFKGESGGRIYAAGISFVLSGLS  324

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALP+++YFTEA+VAA+RIF RIDR P I GED  G+VLD IRGELEF +VKF YPSR
Sbjct  325   LGMALPDLRYFTEAAVAATRIFDRIDRKPLIGGEDTKGVVLDNIRGELEFIDVKFTYPSR  384

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S+VLKD NLKVEAGKT+ALVGASGSGKSTAIALLQRFYDA+ G + +DG++I  LQ+ 
Sbjct  385   PDSMVLKDFNLKVEAGKTIALVGASGSGKSTAIALLQRFYDADDGVVRVDGIDIRTLQLN  444

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R +MGLVSQEHALFGTSIRENIM GKL  +M+EV AAAM ANAH+FIRQLP+GYETK+
Sbjct  445   WIRSKMGLVSQEHALFGTSIRENIMFGKLDANMDEVTAAAMAANAHNFIRQLPEGYETKI  504

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTT+V
Sbjct  505   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESEALVQNALDQASMGRTTMV  564

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ----  2048
             VAHKLST+RNADLIA VSGGCI E GSH++L+ + NGHYA +AKLQRQ S  D  +    
Sbjct  565   VAHKLSTVRNADLIAAVSGGCINEIGSHNDLINRQNGHYANLAKLQRQLSSFDNVEQERI  624

Query  2047  --SFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
               S    S+AGR ST +SSPA   +       + + P    H P+ SF RLL LN  EWK
Sbjct  625   SVSSVTRSSAGRLSTARSSPASAFAKS---PLSNETPQLVSHPPT-SFXRLLSLNSPEWK  680

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             QGLIGS+SAIAFG+VQP YALTIGGMISAFF P+H+EM ARI+ + L F  L L+S+TLN
Sbjct  681   QGLIGSLSAIAFGSVQPVYALTIGGMISAFFXPNHDEMCARIRTYSLTFCALSLISMTLN  740

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FA MGE LT+RIRL+ML+KILTFETAWFDEE NSSGALC+RLSNEA+MVKSLVA
Sbjct  741   LFQHYNFAXMGEQLTKRIRLQMLQKILTFETAWFDEEQNSSGALCSRLSNEASMVKSLVA  800

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPLTILCFYT+KVLLS+I+  F+KAQ
Sbjct  801   DRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTILCFYTKKVLLSSISANFIKAQ  860

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N STQIAVE+VYNHRIVTS+GS+ KVL +FD AQ+ PRKEA+KK+WLAG+G+GSAQ LTF
Sbjct  861   NHSTQIAVESVYNHRIVTSYGSVGKVLQLFDEAQEAPRKEARKKAWLAGLGMGSAQCLTF  920

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFWYGG LV  G+IS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKGS AVAS+F 
Sbjct  921   MSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGSTAVASVFE  980

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR S+I+  +N    N  T LEK++G+IE+KKV+FAYPSRPET +L +F LE +AGSS
Sbjct  981   ILDRHSLISGSHNVS-GNRKTELEKVTGRIELKKVDFAYPSRPETLVLCQFSLEAQAGSS  1039

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
              GLVG SG GKST++ LI+RFYDV  GS++VDGVD+R  DI WYRR  ALVSQEPVIYSG
Sbjct  1040  FGLVGTSGCGKSTVIGLIQRFYDVGRGSVKVDGVDIRELDIQWYRRXTALVSQEPVIYSG  1099

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIRDNI+FGKLD  ENE+ EAA+AANAH+FISSLK GY TECGERGVQLSGGQKQRIAIA
Sbjct  1100  TIRDNIMFGKLDTPENEVAEAARAANAHEFISSLKDGYVTECGERGVQLSGGQKQRIAIA  1159

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI+RNPTILLLDEATSALD++SEQ+VQEALD IM+GRTT+VVAHRLNTIKNLD IA+V 
Sbjct  1160  RAILRNPTILLLDEATSALDLQSEQLVQEALDRIMVGRTTIVVAHRLNTIKNLDMIAVVG  1219

Query  253   EGKVVEHGTYSQLKNKRG  200
             +GKVVE GTY+QL+ KRG
Sbjct  1220  DGKVVEKGTYAQLQQKRG  1237


 Score =   297 bits (760),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 196/523 (37%), Positives = 297/523 (57%), Gaps = 5/523 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   SL F  L L  M +   + Y ++   E+   +IR + L+ IL  E  +FD ++ +
Sbjct  721   RIRTYSLTFCALSLISMTLNLFQHYNFAXMGEQLTKRIRLQMLQKILTFETAWFDEEQNS  780

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + S+++ +++++V + +  TS     +      +W+L+LV      + I+
Sbjct  781   SGALCSRLSNEASMVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTIL  840

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  +S    K  + +  I  +++ + + + S+ +   +L+ +    +   K 
Sbjct  841   CFYTKKVLLSSISANFIKAQNHSTQIAVESVYNHRIVTSYGSVGKVLQLFDEAQEAPRKE  900

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGM  2924
               K     GL +GS   L+F  WA   WYG  L+     S G ++      V  G  +  
Sbjct  901   ARKKAWLAGLGMGSAQCLTFMSWALDFWYGGTLVEKGQISAGDVFKTFFILVSTGKVIAE  960

Query  2923  ALPEVKYFTEASVAASRIFSRIDRVPKIDG-EDKSG---MVLDTIRGELEFKNVKFAYPS  2756
             A        + S A + +F  +DR   I G  + SG     L+ + G +E K V FAYPS
Sbjct  961   AGSMTSDLAKGSTAVASVFEILDRHSLISGSHNVSGNRKTELEKVTGRIELKKVDFAYPS  1020

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RPE+LVL   +L+ +AG +  LVG SG GKST I L+QRFYD   GS+ +DGV+I  L +
Sbjct  1021  RPETLVLCQFSLEAQAGSSFGLVGTSGCGKSTVIGLIQRFYDVGRGSVKVDGVDIRELDI  1080

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             +W R    LVSQE  ++  +IR+NIM GKL     EV  AA  ANAH+FI  L  GY T+
Sbjct  1081  QWYRRXTALVSQEPVIYSGTIRDNIMFGKLDTPENEVAEAARAANAHEFISSLKDGYVTE  1140

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
              GERG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE+LVQ+ALD+   GRTT+
Sbjct  1141  CGERGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDLQSEQLVQEALDRIMVGRTTI  1200

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMA  2087
             VVAH+L+TI+N D+IAVV  G ++E+G++++L +K G +  +A
Sbjct  1201  VVAHRLNTIKNLDMIAVVGDGKVVEKGTYAQLQQKRGAFFNLA  1243



>ref|XP_004135803.1| PREDICTED: putative ABC transporter B family member 8-like [Cucumis 
sativus]
Length=1231

 Score =  1662 bits (4304),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 871/1208 (72%), Positives = 1030/1208 (85%), Gaps = 14/1208 (1%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             VIFRYADW+DI LM LGT+GAIGDGMSTNCLL++ S L N+LG       +     N M 
Sbjct  25    VIFRYADWVDILLMFLGTIGAIGDGMSTNCLLVFASSLMNSLG-------NGHIQQNFMD  77

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              V KCSLYFV LGL VMV+ FMEGYCWSKTSERQVLKIR+KYLEA+LRQEVGFFDSQEAT
Sbjct  78    NVNKCSLYFVYLGLVVMVLAFMEGYCWSKTSERQVLKIRHKYLEAVLRQEVGFFDSQEAT  137

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             T+++ NSISKDTSL+QEVLSEKVP+F+M++SVFLSGLGFS YFSWRL+LVA+PT+++L+I
Sbjct  138   TADVVNSISKDTSLLQEVLSEKVPLFIMNSSVFLSGLGFSAYFSWRLALVAFPTMLLLVI  197

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PG+ YGKYL++++ K  KEY KANGIV QALSSIKTIY+FTAE+ ++E Y  IL+RT ++
Sbjct  198   PGVTYGKYLVHVTNKRRKEYGKANGIVEQALSSIKTIYAFTAEKRVIENYKRILERTTRV  257

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K GIAKGLAVGS+GL+FAIW  +AWYGSRL+M+KGESGGRIYAAGIS++L GLSLG+A
Sbjct  258   GIKQGIAKGLAVGSSGLAFAIWGLIAWYGSRLVMYKGESGGRIYAAGISFILAGLSLGVA  317

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
             LP++K+ TEA +AASRIF  IDR P IDGED  G++L+ ++  +EF ++ FAYPSRP+S 
Sbjct  318   LPDLKHLTEAKIAASRIFKTIDRSPLIDGEDSKGLILNNLQPHIEFDHITFAYPSRPDSF  377

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VLKD NLK++ GKT+ALVG SGSGKST I+LLQRFYD   G + +DGV+I ALQ+KW+R 
Sbjct  378   VLKDFNLKLDPGKTLALVGPSGSGKSTVISLLQRFYDPIDGVLKVDGVDIKALQLKWIRS  437

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
             +MGLVSQ+HALFGTSI+ENI+ GKL  SMEE++ AAM ANAH+FI QLP+GYETKVGERG
Sbjct  438   KMGLVSQDHALFGTSIKENILFGKLDASMEEIMVAAMAANAHNFITQLPEGYETKVGERG  497

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
             ALLSGGQKQRIAIARAI+KNP ILLLDEATSALDSESE LVQ+ALDQAS GRTTLVVAHK
Sbjct  498   ALLSGGQKQRIAIARAIVKNPAILLLDEATSALDSESEALVQNALDQASLGRTTLVVAHK  557

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQSFAPSSNA  2024
             LSTIR AD+IAVV+GG I+E GSH++L+  KNGHYA++AKLQR  S  D +Q+    +++
Sbjct  558   LSTIRKADVIAVVNGGGIVEIGSHNDLINRKNGHYAKLAKLQRLSSYDDVEQNIEIRASS  617

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
               +S+ +SSP   A SPL +E    +P +      PSF+RLL LN  EWKQ L GS+SAI
Sbjct  618   VGRSSARSSPTFFAKSPLPMEI---LPQETSSPKPPSFTRLLSLNSPEWKQALTGSLSAI  674

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
             AFGAVQP YALT+GGMISAFF+ SH EMQARI+ + ++F  L L+SI LNL QHY FAYM
Sbjct  675   AFGAVQPIYALTVGGMISAFFAQSHYEMQARIRTYSMIFCSLSLVSIILNLVQHYNFAYM  734

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLT+RIRLR LEKILTFETAWFD+E NSSGALC+RLSNEA++VKSLVADR+SLLVQ  
Sbjct  735   GEHLTKRIRLRTLEKILTFETAWFDKEQNSSGALCSRLSNEASLVKSLVADRVSLLVQTT  794

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S VTIAM++GLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+I+T F KAQN STQIAVEA
Sbjct  795   SGVTIAMILGLVVAWKLAIVMIAVQPLTILCFYTRKVLLSSISTNFTKAQNQSTQIAVEA  854

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHRIVTSF SI KVL IFD AQ+ PR EA KKSW AGIG+GSAQ LTFM WALDFW+G
Sbjct  855   VYNHRIVTSFSSIEKVLQIFDKAQEAPRNEAVKKSWFAGIGMGSAQCLTFMSWALDFWFG  914

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             G LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMT+DLAKGSAAVAS+F ILDR S+I+ 
Sbjct  915   GTLVQKGEISAGDVFKTFFILVSTGKVIAEAGSMTTDLAKGSAAVASVFEILDRKSLISD  974

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
             P     D  G+ +EK++G IE+KKV+F YPSRP   +LR+F LEVKAG S+GLVGKSG G
Sbjct  975   PSK---DGRGSKMEKITGNIEMKKVDFWYPSRPNNMVLRQFSLEVKAGRSVGLVGKSGCG  1031

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KST++ LI RFYDV  G+++VDGVD+R  D+ WYR+ +ALVSQ+PVI+SG+IRDNILFGK
Sbjct  1032  KSTVIGLILRFYDVVKGTVKVDGVDIREMDLQWYRKHVALVSQDPVIFSGSIRDNILFGK  1091

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
             LDASENE+++AA+AANAH+FISSLK GY TECGERGVQLSGGQKQRIAIARAIIRNPTIL
Sbjct  1092  LDASENELVDAARAANAHEFISSLKDGYGTECGERGVQLSGGQKQRIAIARAIIRNPTIL  1151

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALDV+SEQVVQ+ALD IM+GRTT+VVAHRLNTIK LDSIA V++GKVVE G+Y
Sbjct  1152  LLDEATSALDVQSEQVVQQALDRIMVGRTTLVVAHRLNTIKKLDSIAFVADGKVVEQGSY  1211

Query  223   SQLKNKRG  200
             +QLKN+RG
Sbjct  1212  AQLKNQRG  1219


 Score =   313 bits (802),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 196/527 (37%), Positives = 305/527 (58%), Gaps = 5/527 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   S+ F  L L  +++  ++ Y ++   E    +IR + LE IL  E  +FD ++ +
Sbjct  705   RIRTYSMIFCSLSLVSIILNLVQHYNFAYMGEHLTKRIRLRTLEKILTFETAWFDKEQNS  764

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + SL++ +++++V + +  TS     +      +W+L++V      + I+
Sbjct  765   SGALCSRLSNEASLVKSLVADRVSLLVQTTSGVTIAMILGLVVAWKLAIVMIAVQPLTIL  824

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  +S    K  +++  I  +A+ + + + SF++   +L+ +    +     
Sbjct  825   CFYTRKVLLSSISTNFTKAQNQSTQIAVEAVYNHRIVTSFSSIEKVLQIFDKAQEAPRNE  884

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
              +K     G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  + 
Sbjct  885   AVKKSWFAGIGMGSAQCLTFMSWALDFWFGGTLV-QKGEISAGDVFKTFFILVSTGKVIA  943

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKID--GEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              A        + S A + +F  +DR   I    +D  G  ++ I G +E K V F YPSR
Sbjct  944   EAGSMTTDLAKGSAAVASVFEILDRKSLISDPSKDGRGSKMEKITGNIEMKKVDFWYPSR  1003

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P ++VL+  +L+V+AG++V LVG SG GKST I L+ RFYD   G++ +DGV+I  + ++
Sbjct  1004  PNNMVLRQFSLEVKAGRSVGLVGKSGCGKSTVIGLILRFYDVVKGTVKVDGVDIREMDLQ  1063

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W R  + LVSQ+  +F  SIR+NI+ GKL  S  E+V AA  ANAH+FI  L  GY T+ 
Sbjct  1064  WYRKHVALVSQDPVIFSGSIRDNILFGKLDASENELVDAARAANAHEFISSLKDGYGTEC  1123

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ ALD+   GRTTLV
Sbjct  1124  GERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQQALDRIMVGRTTLV  1183

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             VAH+L+TI+  D IA V+ G ++EQGS+++L  + G +  +A LQ Q
Sbjct  1184  VAHRLNTIKKLDSIAFVADGKVVEQGSYAQLKNQRGAFFNLANLQIQ  1230



>gb|KEH27194.1| ABC transporter B family protein [Medicago truncatula]
Length=1242

 Score =  1654 bits (4283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 906/1230 (74%), Positives = 1044/1230 (85%), Gaps = 36/1230 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI +I RY DWID+ LM +G LGAIGDGMSTN LLL+ S + N+LG  ++++        
Sbjct  17    SIGIILRYGDWIDVVLMLIGALGAIGDGMSTNVLLLFASRIMNSLGGSNDDNSETS----  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGL  +++ FMEGYCWSKTSERQVL+IRY Y+EA+LRQEVGFFDS+
Sbjct  73    -MSEVEKCSLYFVYLGLVALLVAFMEGYCWSKTSERQVLRIRYNYMEAVLRQEVGFFDSE  131

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             E  TSEI +SISKDTSLIQEVLSEKVP+FLM +S F+SG+ F+TYFSWRL+LVA+PT+++
Sbjct  132   ETNTSEIIDSISKDTSLIQEVLSEKVPLFLMQSSSFISGIAFATYFSWRLALVAFPTLLL  191

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+IYGKYL+YLSK S KEY KAN IV QALSSIKT+YSFTAE+ I+ERYS ILDRT
Sbjct  192   LIIPGMIYGKYLIYLSKSSMKEYGKANAIVQQALSSIKTVYSFTAEKRIMERYSDILDRT  251

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K GIAKGLAVGSTGLSFAIWAFLAWYGS L+M+KGESGGRIYAAGIS+++ GLSL
Sbjct  252   SKLGIKQGIAKGLAVGSTGLSFAIWAFLAWYGSHLVMYKGESGGRIYAAGISFIMSGLSL  311

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLDTIRGELEFKNVKFAYPSR  2753
             G+ LP++KYFTE SVAASRIF+ IDR P+ID ED + G++L+TI G+L+F++VKF YPSR
Sbjct  312   GVVLPDLKYFTEVSVAASRIFAMIDRTPEIDSEDTTKGIILETISGKLDFEHVKFTYPSR  371

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
              ES+VL D NLK+EAGKTVALVGASGSGKSTAIAL+QRFYDAN G + +DG +I +LQ+K
Sbjct  372   QESVVLSDFNLKIEAGKTVALVGASGSGKSTAIALVQRFYDANEGVVKVDGFDIKSLQLK  431

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+RG+MGLVSQEHA+FGTSI+ENIM GK   +M+E+VAA+  ANAH+FIRQLP+GYETK+
Sbjct  432   WIRGKMGLVSQEHAMFGTSIKENIMFGKNDATMDEIVAASSAANAHNFIRQLPEGYETKI  491

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTTLV
Sbjct  492   GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESELLVQNALDQASMGRTTLV  551

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQ------  2054
             VAHKLSTIRNADLIAVVS GCIIE G+H+EL+   NGHYA++AKLQ Q S  D       
Sbjct  552   VAHKLSTIRNADLIAVVSNGCIIESGTHNELINTPNGHYAKLAKLQTQLSINDDQDQNQN  611

Query  2053  -DQSF---APSSNAGRQSTEKsspavlassplLIETAQKVPTD--------HHHQPSPSF  1910
              +QS    A  S+AGR ST +SSP         I     +P D         H  PSPSF
Sbjct  612   QEQSILLSAARSSAGRTSTARSSPL--------ILPKSPLPNDIIISQVSHSHSHPSPSF  663

Query  1909  SRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLV  1730
             SRLL LN  EWKQGLIG++SAIA G++QP YALTIGGMISAFF+ SH+EM+ RI  + L+
Sbjct  664   SRLLFLNSPEWKQGLIGTLSAIANGSIQPLYALTIGGMISAFFAKSHQEMKHRIMNYSLI  723

Query  1729  FAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARL  1550
             F  L + SITLNL QHY FAYMG  LT+RIRL MLEKILTFETAWFDEE NSSGALC+RL
Sbjct  724   FTALSVASITLNLFQHYNFAYMGAKLTKRIRLCMLEKILTFETAWFDEEKNSSGALCSRL  783

Query  1549  SNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVL  1370
             SNEA+MVKSLVADR+ LLVQ AS+VTIAM++GLVVAWKLALVMIAVQPLTILCFYTRKVL
Sbjct  784   SNEASMVKSLVADRVCLLVQTASAVTIAMIIGLVVAWKLALVMIAVQPLTILCFYTRKVL  843

Query  1369  LSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLA  1190
             LST++TKFVKAQN STQIAVEAVYNHRIVTSFGSI KVL +FD AQ+ PR EA+KK+WLA
Sbjct  844   LSTLSTKFVKAQNQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEAPRMEARKKAWLA  903

Query  1189  GIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDL  1010
             GIG+GSAQ LTFMCWALDFWYGGKLV   EISSGDVFKTFF+LVSTGKVIA+AGSMTSDL
Sbjct  904   GIGMGSAQCLTFMCWALDFWYGGKLVEKREISSGDVFKTFFVLVSTGKVIAEAGSMTSDL  963

Query  1009  AKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPIL  830
             AK S AVAS+F ILDR S+I  P  G+  N G  LEKLSGKIE+K V+F+YPSR +TPIL
Sbjct  964   AKSSTAVASVFEILDRQSLI--PKAGEETN-GIKLEKLSGKIELKNVDFSYPSRAKTPIL  1020

Query  829   REFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQM  650
             R+FCLEV+ G S+GLVGKSG GKST++ALI+RFYDV+ GS++VD VD+R  DI WYR+  
Sbjct  1021  RKFCLEVRPGKSVGLVGKSGCGKSTVIALIQRFYDVERGSVKVDNVDLRELDIHWYRQHT  1080

Query  649   ALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQ  470
             ALVSQEPVIYSG+IRDNILFGK DASENE++EAA++ANAH FISSLK GY+TECGERGVQ
Sbjct  1081  ALVSQEPVIYSGSIRDNILFGKQDASENEVVEAARSANAHDFISSLKDGYETECGERGVQ  1140

Query  469   LSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLN  290
             LSGGQKQRIAIARAI+RNP ILLLDEATSALDV+SEQVVQEALD IM+GRTT+VVAHRLN
Sbjct  1141  LSGGQKQRIAIARAILRNPIILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRLN  1200

Query  289   TIKNLDSIALVSEGKVVEHGTYSQLKNKRG  200
             TIK LDSIA V EGK+VE G+YSQLK+KRG
Sbjct  1201  TIKELDSIAYVLEGKIVEQGSYSQLKHKRG  1230


 Score =   321 bits (822),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 200/522 (38%), Positives = 303/522 (58%), Gaps = 5/522 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F  L +A + +   + Y ++    +   +IR   LE IL  E  +FD ++ ++  + 
Sbjct  721   SLIFTALSVASITLNLFQHYNFAYMGAKLTKRIRLCMLEKILTFETAWFDEEKNSSGALC  780

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +S + S+++ +++++V + +   S     +      +W+L+LV      + I+     
Sbjct  781   SRLSNEASMVKSLVADRVCLLVQTASAVTIAMIIGLVVAWKLALVMIAVQPLTILCFYTR  840

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  LS K  K  +++  I  +A+ + + + SF +   +L  +    +       K  
Sbjct  841   KVLLSTLSTKFVKAQNQSTQIAVEAVYNHRIVTSFGSITKVLRLFDEAQEAPRMEARKKA  900

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEV  2909
                G+ +GS   L+F  WA   WYG +L+  +  S G ++      V  G  +  A    
Sbjct  901   WLAGIGMGSAQCLTFMCWALDFWYGGKLVEKREISSGDVFKTFFVLVSTGKVIAEAGSMT  960

Query  2908  KYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
                 ++S A + +F  +DR   +PK  GE+ +G+ L+ + G++E KNV F+YPSR ++ +
Sbjct  961   SDLAKSSTAVASVFEILDRQSLIPK-AGEETNGIKLEKLSGKIELKNVDFSYPSRAKTPI  1019

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L+   L+V  GK+V LVG SG GKST IAL+QRFYD   GS+ +D V++  L + W R  
Sbjct  1020  LRKFCLEVRPGKSVGLVGKSGCGKSTVIALIQRFYDVERGSVKVDNVDLRELDIHWYRQH  1079

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
               LVSQE  ++  SIR+NI+ GK   S  EVV AA +ANAHDFI  L  GYET+ GERG 
Sbjct  1080  TALVSQEPVIYSGSIRDNILFGKQDASENEVVEAARSANAHDFISSLKDGYETECGERGV  1139

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              LSGGQKQRIAIARAI++NP+ILLLDEATSALD +SE++VQ+ALD+   GRTT+VVAH+L
Sbjct  1140  QLSGGQKQRIAIARAILRNPIILLLDEATSALDVQSEQVVQEALDRIMVGRTTIVVAHRL  1199

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             +TI+  D IA V  G I+EQGS+S+L  K G +  +A  Q Q
Sbjct  1200  NTIKELDSIAYVLEGKIVEQGSYSQLKHKRGAFFNLANHQIQ  1241



>ref|XP_004158455.1| PREDICTED: LOW QUALITY PROTEIN: putative ABC transporter B family 
member 8-like [Cucumis sativus]
Length=1231

 Score =  1647 bits (4264),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 872/1208 (72%), Positives = 1031/1208 (85%), Gaps = 14/1208 (1%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             VIFRYADW+DI LM LGT+GAIGDGMSTNCLL++ S L N+LG       +     N M 
Sbjct  25    VIFRYADWVDILLMFLGTIGAIGDGMSTNCLLVFASSLMNSLG-------NGHIQQNFMD  77

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              V KCSLYFV LGL VMV+ FMEGYCWSKTSERQVLKIR+KYLEA+LRQEVGFFDSQEAT
Sbjct  78    NVNKCSLYFVYLGLVVMVLAFMEGYCWSKTSERQVLKIRHKYLEAVLRQEVGFFDSQEAT  137

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             T+++ NSISKDTSL+QEVLSEKVP+F+M++SVFLSGLGFS YFSWRL+LVA+PT+++L+I
Sbjct  138   TADVVNSISKDTSLLQEVLSEKVPLFIMNSSVFLSGLGFSAYFSWRLALVAFPTMLLLVI  197

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PG+ YGKYL++++ K  KEY KANGIV QALSSIKTIY+FTAE+ ++E Y  IL+RT ++
Sbjct  198   PGVTYGKYLVHVTNKRRKEYGKANGIVEQALSSIKTIYAFTAEKRVIENYKRILERTTRV  257

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K GIAKGLAVGS+GL+FAIW  +AWYGSRL+M+KGESGGRIYAAGIS++L GLSLG+A
Sbjct  258   GIKQGIAKGLAVGSSGLAFAIWGLIAWYGSRLVMYKGESGGRIYAAGISFILAGLSLGVA  317

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
             LP++K+ TEA +AASRIF  IDR P IDGED  G++L+ ++  +EF ++ FAYPSRP+S 
Sbjct  318   LPDLKHLTEAKIAASRIFKTIDRSPLIDGEDSKGLILNNLQPHIEFDHITFAYPSRPDSF  377

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VLKD NLK++ GKT+ALVG SGSGKST I+LLQRFYD   G + +DGV+I ALQ+KW+R 
Sbjct  378   VLKDFNLKLDPGKTLALVGPSGSGKSTVISLLQRFYDPIDGVLKVDGVDIKALQLKWIRS  437

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
             +MGLVSQ+HALFGTSI+ENI+ GKL  SMEE++AAAM ANAH+FI QLP+GYETKVGERG
Sbjct  438   KMGLVSQDHALFGTSIKENILFGKLDASMEEIMAAAMAANAHNFITQLPEGYETKVGERG  497

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
             ALLSGGQKQRIAIARAI+KNP ILLLDEATSALDSESE LVQ+ALDQAS GRTTLVVAHK
Sbjct  498   ALLSGGQKQRIAIARAIVKNPAILLLDEATSALDSESEALVQNALDQASLGRTTLVVAHK  557

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPSSNA  2024
             LSTIR AD+IAVV+GG I+E GSH++L+  KNGHYA++AKLQR  S  D +Q+    +++
Sbjct  558   LSTIRKADVIAVVNGGGIVEIGSHNDLINXKNGHYAKLAKLQRLSSYDDVEQNIEIRASS  617

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
               +S+ +SSP   A SPL +E    +P +      PSF+RLL LN  EWKQ L GS+SAI
Sbjct  618   VGRSSARSSPTFFAKSPLPMEI---LPQETSSPKPPSFTRLLSLNSPEWKQALTGSLSAI  674

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
             AFGAVQP YALT+GGMISAFF+ SH EMQARI+ + ++F  L L+SI LNL QHY FAYM
Sbjct  675   AFGAVQPIYALTVGGMISAFFAQSHYEMQARIRTYSMIFCSLSLVSIILNLVQHYNFAYM  734

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLT+RIRLR LEKILTFETAWFD+E NSSGALC+RLSNEA++VKSLVADR+SLLVQ  
Sbjct  735   GEHLTKRIRLRTLEKILTFETAWFDKEQNSSGALCSRLSNEASLVKSLVADRVSLLVQTT  794

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S VTIAM++GLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+I+T F KAQN STQIAVEA
Sbjct  795   SGVTIAMILGLVVAWKLAIVMIAVQPLTILCFYTRKVLLSSISTNFTKAQNQSTQIAVEA  854

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHRIVTSF SI KVL IFD AQ+ PR EA KKSW AGIG+GSAQ LTFM WALDFW+G
Sbjct  855   VYNHRIVTSFSSIEKVLQIFDKAQEAPRNEAVKKSWFAGIGMGSAQCLTFMSWALDFWFG  914

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             G LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMT+DLAKGSAAVAS+F ILDR S+I+ 
Sbjct  915   GTLVQKGEISAGDVFKTFFILVSTGKVIAEAGSMTTDLAKGSAAVASVFEILDRKSLISD  974

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
             P     D  G+ +EK++G IE+KKV+F YPSRP   +LR+F LEVKAG S+GLVGKSG G
Sbjct  975   PSK---DGRGSKMEKITGNIEMKKVDFWYPSRPNNMVLRQFSLEVKAGRSVGLVGKSGCG  1031

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KST++ LI RFYDV  G+++VDGVD+R  D+ WYR+ +ALVSQ+PVI+SG+IRDNILFGK
Sbjct  1032  KSTVIGLILRFYDVVKGTVKVDGVDIREMDLQWYRKHVALVSQDPVIFSGSIRDNILFGK  1091

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
             LDASENE+++AA+AANAH+FISSLK GY TECGERGVQLSGGQKQRIAIARAIIRNPTIL
Sbjct  1092  LDASENELVDAARAANAHEFISSLKDGYGTECGERGVQLSGGQKQRIAIARAIIRNPTIL  1151

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALDV+SEQVVQ+ALD IM+GRTT+VVAHRLNTIK LDSIA V++GKVVE G+Y
Sbjct  1152  LLDEATSALDVQSEQVVQQALDRIMVGRTTLVVAHRLNTIKKLDSIAFVADGKVVEQGSY  1211

Query  223   SQLKNKRG  200
             +QLKN+RG
Sbjct  1212  AQLKNQRG  1219


 Score =   313 bits (801),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 196/527 (37%), Positives = 305/527 (58%), Gaps = 5/527 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   S+ F  L L  +++  ++ Y ++   E    +IR + LE IL  E  +FD ++ +
Sbjct  705   RIRTYSMIFCSLSLVSIILNLVQHYNFAYMGEHLTKRIRLRTLEKILTFETAWFDKEQNS  764

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + SL++ +++++V + +  TS     +      +W+L++V      + I+
Sbjct  765   SGALCSRLSNEASLVKSLVADRVSLLVQTTSGVTIAMILGLVVAWKLAIVMIAVQPLTIL  824

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  +S    K  +++  I  +A+ + + + SF++   +L+ +    +     
Sbjct  825   CFYTRKVLLSSISTNFTKAQNQSTQIAVEAVYNHRIVTSFSSIEKVLQIFDKAQEAPRNE  884

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
              +K     G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  + 
Sbjct  885   AVKKSWFAGIGMGSAQCLTFMSWALDFWFGGTLV-QKGEISAGDVFKTFFILVSTGKVIA  943

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKID--GEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              A        + S A + +F  +DR   I    +D  G  ++ I G +E K V F YPSR
Sbjct  944   EAGSMTTDLAKGSAAVASVFEILDRKSLISDPSKDGRGSKMEKITGNIEMKKVDFWYPSR  1003

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P ++VL+  +L+V+AG++V LVG SG GKST I L+ RFYD   G++ +DGV+I  + ++
Sbjct  1004  PNNMVLRQFSLEVKAGRSVGLVGKSGCGKSTVIGLILRFYDVVKGTVKVDGVDIREMDLQ  1063

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W R  + LVSQ+  +F  SIR+NI+ GKL  S  E+V AA  ANAH+FI  L  GY T+ 
Sbjct  1064  WYRKHVALVSQDPVIFSGSIRDNILFGKLDASENELVDAARAANAHEFISSLKDGYGTEC  1123

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ ALD+   GRTTLV
Sbjct  1124  GERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQQALDRIMVGRTTLV  1183

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             VAH+L+TI+  D IA V+ G ++EQGS+++L  + G +  +A LQ Q
Sbjct  1184  VAHRLNTIKKLDSIAFVADGKVVEQGSYAQLKNQRGAFFNLANLQIQ  1230



>ref|XP_008450777.1| PREDICTED: putative ABC transporter B family member 8 [Cucumis 
melo]
Length=1234

 Score =  1644 bits (4256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 872/1208 (72%), Positives = 1031/1208 (85%), Gaps = 14/1208 (1%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             VIFRYADW+D+ LM LGT+GAIGDGMSTNCLL++ S L N+LG       +     N M 
Sbjct  28    VIFRYADWVDLLLMLLGTIGAIGDGMSTNCLLVFASSLMNSLG-------NGHIQQNFMD  80

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              V KCSLYFV LGL VMV+ FMEGYCWSKTSERQVLKIR+KYLEA+LRQEVGFFDSQEAT
Sbjct  81    NVNKCSLYFVYLGLVVMVLAFMEGYCWSKTSERQVLKIRHKYLEAVLRQEVGFFDSQEAT  140

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             TS++ NSISKDTSL+QEVLSEKVP+F+M++SVFLSGL FS YFSWRL+LVA+PT+++L+I
Sbjct  141   TSDVVNSISKDTSLLQEVLSEKVPLFIMNSSVFLSGLAFSAYFSWRLALVAFPTMLLLVI  200

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PG+ YGKYL++++ K  KEY KANGIV QALSSIKTIY+FTAE+ ++E Y  IL+RT ++
Sbjct  201   PGVTYGKYLVHVTNKRHKEYGKANGIVEQALSSIKTIYAFTAEKRVIENYKRILERTTRV  260

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K GIAKGLAVGS+GL+FAIW  +AWYGSRL+M+KGESGGRIYAAGIS++L GLSLG+A
Sbjct  261   GIKQGIAKGLAVGSSGLAFAIWGLIAWYGSRLVMYKGESGGRIYAAGISFILAGLSLGVA  320

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
             LP++K+ TEA +AASRIF  IDR P IDGED  G++L+ ++ ++EF ++ FAYPSR +S 
Sbjct  321   LPDLKHLTEAKIAASRIFKTIDRTPLIDGEDSKGIILNNLQPQIEFDHITFAYPSRADSF  380

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VLKD NLK++ GKT+ALVG SGSGKST I+LLQRFYD   G + IDGV+I ALQ+KW+R 
Sbjct  381   VLKDFNLKLDPGKTLALVGPSGSGKSTVISLLQRFYDPIDGVLKIDGVDIKALQLKWIRS  440

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
             +MGLVSQ+HALFGTSI+ENI+ GKL  SMEE++AAAM ANAH+FI QLP+GYETKVGERG
Sbjct  441   KMGLVSQDHALFGTSIKENILFGKLDASMEEIMAAAMAANAHNFITQLPEGYETKVGERG  500

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
             ALLSGGQKQRIAIARAI+KNP ILLLDEATSALDSESE LVQ+ALDQAS GRTTLVVAHK
Sbjct  501   ALLSGGQKQRIAIARAIVKNPAILLLDEATSALDSESEALVQNALDQASLGRTTLVVAHK  560

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQSFAPSSNA  2024
             LSTIRNAD+IAVV+GGCI+E GSH++L+  KNGHYA+++KLQR  S  D +Q+    +++
Sbjct  561   LSTIRNADVIAVVNGGCIVEIGSHNDLINRKNGHYAKLSKLQRLSSYDDVEQNIETRTSS  620

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
               +S+ KSSPA  A SPL ++    +P        PSF+RLL LN  EWKQ LIGS+SAI
Sbjct  621   VGRSSAKSSPAFFAKSPLPMDI---LPQSTSPPKPPSFTRLLSLNSPEWKQALIGSLSAI  677

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
             AFGAVQP YALT+GGMISAFF+ SH EMQARI+ + ++F  L L+SI LNL QHY FAYM
Sbjct  678   AFGAVQPVYALTVGGMISAFFAQSHYEMQARIRTYSMIFCSLSLVSIILNLVQHYNFAYM  737

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLT+RIRLR LEKILTFETAWFDEE NSSGALC+RLSNEA++VKSLVADR+SLLVQ  
Sbjct  738   GEHLTKRIRLRTLEKILTFETAWFDEEQNSSGALCSRLSNEASLVKSLVADRVSLLVQTT  797

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S VTIAM++GL VAWKLA+VMIAVQPLTILCFYTRKVLLS+I+T F KAQN STQIAVEA
Sbjct  798   SGVTIAMILGLAVAWKLAIVMIAVQPLTILCFYTRKVLLSSISTNFTKAQNQSTQIAVEA  857

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHRIVTSF SI KVL IFD AQ+ PR EA KKSW AGIG+GSAQ LTFM WALDFW+G
Sbjct  858   VYNHRIVTSFSSIGKVLQIFDKAQEAPRNEAIKKSWFAGIGMGSAQCLTFMSWALDFWFG  917

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             G LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMT+DLAKGSAAVAS+F ILDR S+I+ 
Sbjct  918   GTLVQKGEISAGDVFKTFFILVSTGKVIAEAGSMTTDLAKGSAAVASVFEILDRKSLISD  977

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
             P     D  G+ +EK++G IE+KKV+F YPSRP   +LR+F LEVKAG S+GLVGKSG G
Sbjct  978   PSK---DGRGSKMEKITGNIEMKKVDFWYPSRPNNMVLRQFSLEVKAGRSVGLVGKSGCG  1034

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KST++ LI RFYDV  GS++VDGVD+R  D+ WYR+ +ALVSQ+PVI+SG+IRDNILFGK
Sbjct  1035  KSTVIGLILRFYDVVKGSVKVDGVDIREMDLQWYRKHVALVSQDPVIFSGSIRDNILFGK  1094

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
             LDASENE+++AA+AANAH+FISSL+ GY TECGERGVQLSGGQKQRIAIARAIIRNPTIL
Sbjct  1095  LDASENELVDAARAANAHEFISSLRDGYGTECGERGVQLSGGQKQRIAIARAIIRNPTIL  1154

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALDV+SEQVVQ+ALD IM+GRTT+VVAHRLNTIK LD IA V++GKVVE G+Y
Sbjct  1155  LLDEATSALDVQSEQVVQQALDRIMVGRTTLVVAHRLNTIKKLDFIAFVADGKVVEQGSY  1214

Query  223   SQLKNKRG  200
             +QLK++RG
Sbjct  1215  AQLKSQRG  1222


 Score =   313 bits (802),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 197/527 (37%), Positives = 305/527 (58%), Gaps = 5/527 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   S+ F  L L  +++  ++ Y ++   E    +IR + LE IL  E  +FD ++ +
Sbjct  708   RIRTYSMIFCSLSLVSIILNLVQHYNFAYMGEHLTKRIRLRTLEKILTFETAWFDEEQNS  767

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + SL++ +++++V + +  TS     +      +W+L++V      + I+
Sbjct  768   SGALCSRLSNEASLVKSLVADRVSLLVQTTSGVTIAMILGLAVAWKLAIVMIAVQPLTIL  827

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  +S    K  +++  I  +A+ + + + SF++   +L+ +    +     
Sbjct  828   CFYTRKVLLSSISTNFTKAQNQSTQIAVEAVYNHRIVTSFSSIGKVLQIFDKAQEAPRNE  887

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
              +K     G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  + 
Sbjct  888   AIKKSWFAGIGMGSAQCLTFMSWALDFWFGGTLV-QKGEISAGDVFKTFFILVSTGKVIA  946

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKID--GEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              A        + S A + +F  +DR   I    +D  G  ++ I G +E K V F YPSR
Sbjct  947   EAGSMTTDLAKGSAAVASVFEILDRKSLISDPSKDGRGSKMEKITGNIEMKKVDFWYPSR  1006

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P ++VL+  +L+V+AG++V LVG SG GKST I L+ RFYD   GS+ +DGV+I  + ++
Sbjct  1007  PNNMVLRQFSLEVKAGRSVGLVGKSGCGKSTVIGLILRFYDVVKGSVKVDGVDIREMDLQ  1066

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W R  + LVSQ+  +F  SIR+NI+ GKL  S  E+V AA  ANAH+FI  L  GY T+ 
Sbjct  1067  WYRKHVALVSQDPVIFSGSIRDNILFGKLDASENELVDAARAANAHEFISSLRDGYGTEC  1126

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ ALD+   GRTTLV
Sbjct  1127  GERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQQALDRIMVGRTTLV  1186

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             VAH+L+TI+  D IA V+ G ++EQGS+++L  + G +  +A LQ Q
Sbjct  1187  VAHRLNTIKKLDFIAFVADGKVVEQGSYAQLKSQRGAFFNLANLQIQ  1233



>ref|XP_011007116.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X2 [Populus euphratica]
Length=1142

 Score =  1630 bits (4222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 867/1141 (76%), Positives = 1003/1141 (88%), Gaps = 19/1141 (2%)
 Frame = -2

Query  3592  MVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQ  3413
             MVM FMEGYCWSKTSERQVLKIRYKYLEAILRQEVGF+DSQEATTSEI NSISKDTSL+Q
Sbjct  1     MVMAFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFYDSQEATTSEIINSISKDTSLVQ  60

Query  3412  EVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskks  3233
             EVLSEKVPIFLMH SVF SGL F+TYFSWRLSLVA+PT+++LIIPG+IYGKYLLYLSKK+
Sbjct  61    EVLSEKVPIFLMHASVFFSGLAFATYFSWRLSLVAFPTLLLLIIPGMIYGKYLLYLSKKA  120

Query  3232  fkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVGSTG  3053
               EY KAN IV +ALSSIKTIYSFTAE+ I++RYS+ILDRT KLG+K GIAKGLAVGSTG
Sbjct  121   RTEYGKANSIVERALSSIKTIYSFTAEKRIIDRYSAILDRTTKLGIKQGIAKGLAVGSTG  180

Query  3052  LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASR  2873
             LSFAIWAFLAWYGS L+M+KGESGGRIYAAGIS++L GLSLG+ALP++KYFTEASVAA+R
Sbjct  181   LSFAIWAFLAWYGSHLVMYKGESGGRIYAAGISFILSGLSLGIALPDLKYFTEASVAATR  240

Query  2872  IFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVA  2693
             IF RIDRVP+ID ED  G VL+ I+G++ F++V F YP RP+++VLKD NL+VEAGKTVA
Sbjct  241   IFKRIDRVPEIDSEDTKGRVLEKIQGKIIFQHVSFTYPCRPDAVVLKDFNLEVEAGKTVA  300

Query  2692  LVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSI  2513
             LVGASGSGKSTAIALLQRFYD +SG + IDGV++  L +KW+RGQMGLVSQ+HALFGTSI
Sbjct  301   LVGASGSGKSTAIALLQRFYDVDSGIVKIDGVDLRTLNLKWIRGQMGLVSQDHALFGTSI  360

Query  2512  RENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiara  2333
             +ENIM GKL  +M+E++AAAM ANAH+FIRQLP+GYETKVGERGALLSGGQKQRIAIARA
Sbjct  361   KENIMFGKLDATMDEIMAAAMAANAHNFIRQLPEGYETKVGERGALLSGGQKQRIAIARA  420

Query  2332  iIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGG  2153
             IIKNPVILLLDEATSALDSESE LVQ+ALDQAS GRTT+VVAHKLST+RNADLIAVV  G
Sbjct  421   IIKNPVILLLDEATSALDSESETLVQNALDQASMGRTTMVVAHKLSTVRNADLIAVVDNG  480

Query  2152  CIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQS-----FAPSSNAGRQSTEKsspa  1991
              IIE GSH++L+  +NGHYA++AKLQRQFSC +Q+Q+      + +S+A RQST KSSPA
Sbjct  481   SIIEIGSHNDLINIQNGHYAKLAKLQRQFSCDEQEQNPEIRFSSVTSSAARQSTGKSSPA  540

Query  1990  vlassplLIETAQKVPTDHH----HQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQP  1823
             +          A  +P D +    H P+PSFSRLL LN  EWKQGL+GSISAIAFGAVQP
Sbjct  541   IF---------ASPLPVDDNPKPVHIPAPSFSRLLSLNAPEWKQGLMGSISAIAFGAVQP  591

Query  1822  TYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRR  1643
              YALT+GGMI+AFF+P+H+E++ RI+ + L+F  L L SI +NL QHY FAYMGE LT+R
Sbjct  592   VYALTVGGMIAAFFAPNHDEVRDRIRIYSLIFCSLSLFSIIINLVQHYNFAYMGERLTKR  651

Query  1642  IRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAM  1463
             IRLRMLEKIL FETAWFDEE NSSGAL  RLS EA+MVK+L+ADR+ LLVQ  S+VTIAM
Sbjct  652   IRLRMLEKILGFETAWFDEEENSSGALSLRLSTEASMVKTLIADRVCLLVQTTSAVTIAM  711

Query  1462  VMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIV  1283
             +MGLVVAWKLA+VMIAVQPLTILCFYT+K+LLS+I+T FVKAQN STQIAVEAVYNHRIV
Sbjct  712   IMGLVVAWKLAIVMIAVQPLTILCFYTKKILLSSISTNFVKAQNQSTQIAVEAVYNHRIV  771

Query  1282  TSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNG  1103
             TSF S+ KVL +FD AQ+EPRKE +KKSWLAGIG+GSAQ LTFM WALDFW+GG LV  G
Sbjct  772   TSFASVGKVLQLFDEAQEEPRKEGRKKSWLAGIGMGSAQCLTFMSWALDFWFGGTLVEKG  831

Query  1102  EISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVD  923
             EIS+GDVFKTFFILVSTGKVIA+AGSMTSDL+KGS AVAS+F ILDR S+I   Y+    
Sbjct  832   EISAGDVFKTFFILVSTGKVIAEAGSMTSDLSKGSTAVASVFKILDRQSLIPGSYHAGDG  891

Query  922   NGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVAL  743
             + GT LE L GKIE+KK++FAYPSRP+  ILR+FCLEVK G+S+GLVGKSG GKST++ L
Sbjct  892   SSGTKLETLCGKIEMKKIDFAYPSRPKILILRQFCLEVKPGTSVGLVGKSGCGKSTVIGL  951

Query  742   IERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDasene  563
             I+RFYDV+ GS+RVDGVD+R  DI W+R++ ALVSQEPV+YSG+IR+NI+ GKLDASENE
Sbjct  952   IQRFYDVEKGSVRVDGVDIRELDIQWFRKRTALVSQEPVLYSGSIRENIMLGKLDASENE  1011

Query  562   iieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATS  383
             ++EAA+AANAH FISSLK+GY+TECGERGVQLSGGQKQRIAIARAI+RNPTILLLDEATS
Sbjct  1012  VVEAARAANAHDFISSLKEGYETECGERGVQLSGGQKQRIAIARAILRNPTILLLDEATS  1071

Query  382   ALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNKR  203
             ALDV+SEQVVQEALD IM+ RTT+VVAHRLNTIKNLDSIA V++GKVVE GTY+QLKNKR
Sbjct  1072  ALDVQSEQVVQEALDRIMVRRTTIVVAHRLNTIKNLDSIAFVADGKVVERGTYAQLKNKR  1131

Query  202   G  200
             G
Sbjct  1132  G  1132


 Score =   334 bits (856),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 206/523 (39%), Positives = 311/523 (59%), Gaps = 8/523 (2%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F  L L  +++  ++ Y ++   ER   +IR + LE IL  E  +FD +E ++  ++
Sbjct  620   SLIFCSLSLFSIIINLVQHYNFAYMGERLTKRIRLRMLEKILGFETAWFDEEENSSGALS  679

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
               +S + S+++ +++++V + +  TS     +      +W+L++V      + I+     
Sbjct  680   LRLSTEASMVKTLIADRVCLLVQTTSAVTIAMIMGLVVAWKLAIVMIAVQPLTILCFYTK  739

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S    K  +++  I  +A+ + + + SF +   +L+ +    +   K G K  
Sbjct  740   KILLSSISTNFVKAQNQSTQIAVEAVYNHRIVTSFASVGKVLQLFDEAQEEPRKEGRKKS  799

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  +  A   
Sbjct  800   WLAGIGMGSAQCLTFMSWALDFWFGGTLV-EKGEISAGDVFKTFFILVSTGKVIAEAGSM  858

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDG-----EDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                 ++ S A + +F  +DR   I G     +  SG  L+T+ G++E K + FAYPSRP+
Sbjct  859   TSDLSKGSTAVASVFKILDRQSLIPGSYHAGDGSSGTKLETLCGKIEMKKIDFAYPSRPK  918

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+   L+V+ G +V LVG SG GKST I L+QRFYD   GS+ +DGV+I  L ++W 
Sbjct  919   ILILRQFCLEVKPGTSVGLVGKSGCGKSTVIGLIQRFYDVEKGSVRVDGVDIRELDIQWF  978

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +  LVSQE  L+  SIRENIMLGKL  S  EVV AA  ANAHDFI  L +GYET+ GE
Sbjct  979   RKRTALVSQEPVLYSGSIRENIMLGKLDASENEVVEAARAANAHDFISSLKEGYETECGE  1038

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE++VQ+ALD+    RTT+VVA
Sbjct  1039  RGVQLSGGQKQRIAIARAILRNPTILLLDEATSALDVQSEQVVQEALDRIMVRRTTIVVA  1098

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             H+L+TI+N D IA V+ G ++E+G++++L  K G +  +A L+
Sbjct  1099  HRLNTIKNLDSIAFVADGKVVERGTYAQLKNKRGAFFDLASLR  1141



>ref|XP_010915424.1| PREDICTED: putative ABC transporter B family member 8 [Elaeis 
guineensis]
Length=1235

 Score =  1604 bits (4153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 848/1210 (70%), Positives = 1023/1210 (85%), Gaps = 12/1210 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +FR+AD +D+ LM LGT+G+IGDG + NCLLL+ S++ N+LGYG             M E
Sbjct  24    MFRFADGVDVVLMLLGTIGSIGDGCAVNCLLLFASNVMNSLGYGKAQQGQVG----FMHE  79

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  LYFV LGLAV+V+ FMEGYCWS+TSERQVL+IRY YLEAILRQEVGFFDSQEATT
Sbjct  80    VEKYCLYFVYLGLAVLVVAFMEGYCWSRTSERQVLRIRYTYLEAILRQEVGFFDSQEATT  139

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI +SISKDT+LIQEVLSEKVPIFLM++S F+SGL FSTYFSWRLSLVA+P +++LIIP
Sbjct  140   SEIISSISKDTALIQEVLSEKVPIFLMNSSAFISGLIFSTYFSWRLSLVAFPLVLLLIIP  199

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLL LS+KS   Y+KAN IV QALSSIKTIYSFTAE+ I+ERY +ILDRT+KLG
Sbjct  200   GLIYGKYLLRLSRKSRGAYAKANAIVEQALSSIKTIYSFTAEKRIIERYGAILDRTVKLG  259

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVG TGLSF IWAFLAWYG+RL+M+ GESGGRIYA+GIS+V+GGLSLGMAL
Sbjct  260   IKQGIAKGLAVGCTGLSFTIWAFLAWYGTRLVMYHGESGGRIYASGISFVMGGLSLGMAL  319

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PE+K+FTEASVAASRI  RI+R+P+ID ED  G+ LD ++GE++F++V+FAYPSRP+SLV
Sbjct  320   PELKHFTEASVAASRIIKRINRMPQIDAEDPKGIKLDCVQGEIKFESVQFAYPSRPDSLV  379

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LK+ NL+V AG+TVALVG SGSGKSTAIAL+QRFYDAN G + IDGV+I  LQ+KW+R +
Sbjct  380   LKNFNLEVPAGQTVALVGTSGSGKSTAIALVQRFYDANEGVVKIDGVDIKRLQLKWIRQK  439

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTS++ENI+ GK   +M+E+ AAAMTANAH+FIRQLP+GY+TKVGERGA
Sbjct  440   MGLVSQDHALFGTSVKENILFGKPDATMDEIYAAAMTANAHNFIRQLPEGYDTKVGERGA  499

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESEKLVQ+ALDQAS GRTTLVVAHKL
Sbjct  500   LLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESEKLVQNALDQASMGRTTLVVAHKL  559

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKN-GHYAQMAKLQRQFSCADQD-QSFAPSSNA  2024
             STI+NAD IAVV GG I+E G+H EL+ +N  HY+++ KLQR  S  DQ+ +S+ PSS A
Sbjct  560   STIKNADQIAVVDGGMIVEIGTHDELISQNDSHYSRLVKLQRIASSIDQEPESYRPSSVA  619

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
                ++  S       S     + +  PT  H  PSPSF+RLL +N  EWKQ L+GS+SAI
Sbjct  620   RSSASRLSLTKASPMSFASAFSEEAPPTISH--PSPSFTRLLAMNAPEWKQALVGSLSAI  677

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              FG++QP YA++IGGMI+AFF   HEEMQA I+++ L+F+ L +LS+ +NL QH  FAYM
Sbjct  678   VFGSIQPIYAISIGGMIAAFFLHDHEEMQAVIRRYALIFSSLSVLSLVVNLLQHSNFAYM  737

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLTRRIRLR+LEKILTFE AWFDEE NSSGALC+RLSNEA+++K+LVADR+SLLVQ A
Sbjct  738   GEHLTRRIRLRVLEKILTFEAAWFDEESNSSGALCSRLSNEASLLKTLVADRISLLVQTA  797

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S V I+  MGL+VAWKLALVMIA+QP TILC Y +K++LS+++    KAQ+ STQ+A+EA
Sbjct  798   SGVAISFSMGLIVAWKLALVMIAIQPATILCHYAKKIVLSSVSLDLAKAQHRSTQLAIEA  857

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHR+VTSFGSI+KVL +F+ AQ EP + A+KKSW+AG  +G +  L+FM WALDFWYG
Sbjct  858   VYNHRMVTSFGSISKVLQLFEEAQKEPLRVARKKSWVAGFAMGCSPCLSFMSWALDFWYG  917

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             GKL  +G+IS+GDVFKTFFILVSTGKVIA+A SMTSDLAKG+ AVAS+F +LDR S+I  
Sbjct  918   GKLAQSGQISAGDVFKTFFILVSTGKVIAEACSMTSDLAKGATAVASVFEVLDRQSLI--  975

Query  943   PYNGKVD--NGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSG  770
             P +  VD  NGGT L+++ GKIE+KKV+FAYP+RP+  +LREF LEVKAGSSIGLVG+SG
Sbjct  976   PGSSHVDHRNGGTKLQRIQGKIELKKVDFAYPTRPQCLVLREFSLEVKAGSSIGLVGRSG  1035

Query  769   SGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILF  590
              GKSTI+ LI+RFYDVD G +R+DG+DVR  DI WYR   ALVSQEPVI+SG+IRDNI F
Sbjct  1036  CGKSTIIGLIQRFYDVDRGIVRIDGMDVRDLDIVWYRGFTALVSQEPVIFSGSIRDNIAF  1095

Query  589   GKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPT  410
             GK +A E+EI++AA+AANAH FISSLK+GY+T+CG+RGVQLSGGQKQRIAIARAIIRNPT
Sbjct  1096  GKPEAGEDEIVDAARAANAHDFISSLKEGYNTDCGDRGVQLSGGQKQRIAIARAIIRNPT  1155

Query  409   ILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHG  230
             ILLLDEATSALDV+SE+VVQ+ALD IM+GRTT+VVAHRLNTIK +DSIA + EGKVVEHG
Sbjct  1156  ILLLDEATSALDVQSERVVQQALDRIMVGRTTVVVAHRLNTIKKVDSIAFIGEGKVVEHG  1215

Query  229   TYSQLKNKRG  200
              Y+ L NK+G
Sbjct  1216  NYAHLMNKKG  1225


 Score =   305 bits (780),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 187/496 (38%), Positives = 279/496 (56%), Gaps = 6/496 (1%)
 Frame = -2

Query  3547  ERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTS  3368
             E    +IR + LE IL  E  +FD +  ++  + + +S + SL++ ++++++ + +   S
Sbjct  739   EHLTRRIRLRVLEKILTFEAAWFDEESNSSGALCSRLSNEASLLKTLVADRISLLVQTAS  798

Query  3367  VFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKANGIVGQAL  3188
                         +W+L+LV        I+        L  +S    K   ++  +  +A+
Sbjct  799   GVAISFSMGLIVAWKLALVMIAIQPATILCHYAKKIVLSSVSLDLAKAQHRSTQLAIEAV  858

Query  3187  SSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGS  3011
              + + + SF +   +L+ +       +++  K     G A+G S  LSF  WA   WYG 
Sbjct  859   YNHRMVTSFGSISKVLQLFEEAQKEPLRVARKKSWVAGFAMGCSPCLSFMSWALDFWYGG  918

Query  3010  RLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGE  2831
             +L      S G ++      V  G  +  A        + + A + +F  +DR   I G 
Sbjct  919   KLAQSGQISAGDVFKTFFILVSTGKVIAEACSMTSDLAKGATAVASVFEVLDRQSLIPGS  978

Query  2830  D-----KSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGK  2666
                     G  L  I+G++E K V FAYP+RP+ LVL++ +L+V+AG ++ LVG SG GK
Sbjct  979   SHVDHRNGGTKLQRIQGKIELKKVDFAYPTRPQCLVLREFSLEVKAGSSIGLVGRSGCGK  1038

Query  2665  STAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKL  2486
             ST I L+QRFYD + G + IDG+++  L + W RG   LVSQE  +F  SIR+NI  GK 
Sbjct  1039  STIIGLIQRFYDVDRGIVRIDGMDVRDLDIVWYRGFTALVSQEPVIFSGSIRDNIAFGKP  1098

Query  2485  GGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILL  2306
                 +E+V AA  ANAHDFI  L +GY T  G+RG  LSGGQKQRIAIARAII+NP ILL
Sbjct  1099  EAGEDEIVDAARAANAHDFISSLKEGYNTDCGDRGVQLSGGQKQRIAIARAIIRNPTILL  1158

Query  2305  LDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHS  2126
             LDEATSALD +SE++VQ ALD+   GRTT+VVAH+L+TI+  D IA +  G ++E G+++
Sbjct  1159  LDEATSALDVQSERVVQQALDRIMVGRTTVVVAHRLNTIKKVDSIAFIGEGKVVEHGNYA  1218

Query  2125  ELMEKNGHYAQMAKLQ  2078
              LM K G +  +A LQ
Sbjct  1219  HLMNKKGAFFNLATLQ  1234



>ref|XP_008809753.1| PREDICTED: putative ABC transporter B family member 8 [Phoenix 
dactylifera]
Length=1217

 Score =  1596 bits (4132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 846/1209 (70%), Positives = 1017/1209 (84%), Gaps = 8/1209 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +FR+AD +D+ LM LGT+G+IGDG + NCLLL+ S++ N+LGYG             M E
Sbjct  4     LFRFADGLDVVLMLLGTIGSIGDGCAVNCLLLFASNVMNSLGYGKTQQGRVD----FMHE  59

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  LYFV LGLAV+V+ FMEGYCWS+TSERQVL+IRY YLEAILRQEVGFFDSQEATT
Sbjct  60    VEKYCLYFVYLGLAVLVVAFMEGYCWSRTSERQVLRIRYTYLEAILRQEVGFFDSQEATT  119

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKDT+LIQEVLSEKVP+FLM++S F+SGL FSTYFSWRLSLVA+P +++LIIP
Sbjct  120   SEIINSISKDTALIQEVLSEKVPVFLMNSSAFISGLIFSTYFSWRLSLVAFPLVLLLIIP  179

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLL LS+KS + Y+KANGIV QALSSIKTIYSFTAE+ I+ERY++ILDRT+KLG
Sbjct  180   GLIYGKYLLRLSRKSREVYAKANGIVEQALSSIKTIYSFTAEKRIVERYAAILDRTVKLG  239

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVG TGLSFAIWAFLAWYGSRL+M++GESGGRIYAAGIS+V+GGLSLGMAL
Sbjct  240   IKQGIAKGLAVGCTGLSFAIWAFLAWYGSRLVMYRGESGGRIYAAGISFVMGGLSLGMAL  299

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PEVK+FT+ASVAASRI  RI+R+P+ID ED  G+ LD IRGE++F++V+FAYPSRP+SLV
Sbjct  300   PEVKHFTDASVAASRIIDRINRIPQIDAEDPKGIKLDCIRGEIKFESVQFAYPSRPDSLV  359

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LKD +L+V AG+TVALVG SGSGKSTAIAL+QRFYD N G + IDG++I  L +KW+R +
Sbjct  360   LKDFDLQVPAGQTVALVGTSGSGKSTAIALVQRFYDVNEGVVMIDGIDIKRLHLKWIRQK  419

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTS++ENI+ GK   +M+E+ AAAMTANAH+FI QLP+GY+TKVGERGA
Sbjct  420   MGLVSQDHALFGTSVKENILFGKPDATMDEIYAAAMTANAHNFIWQLPEGYDTKVGERGA  479

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESEKLVQ+ALDQAS GRTTLVVAHKL
Sbjct  480   LLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESEKLVQNALDQASMGRTTLVVAHKL  539

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKN-GHYAQMAKLQRQFSCADQD-QSFAPSSNA  2024
             STI+NAD IAVV GG I+E G+H +L+ +N   Y+++ KLQR  S  DQ+ +S+ PSS A
Sbjct  540   STIKNADQIAVVDGGMIVEIGTHDDLISQNDSRYSRLVKLQRMASSIDQEPESYRPSSVA  599

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
                ++  S       S     + +  PT   H PSPSF+RLL +N  EWKQ L GS+SAI
Sbjct  600   RSSASRLSLTKASPMSFASAFSEENPPTTISH-PSPSFTRLLAMNAPEWKQALAGSLSAI  658

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              FG++QP YA +IGGMI+AFF   HEEMQA I+++ L+F+ L  LS+ +NL QH  FAYM
Sbjct  659   VFGSIQPIYAFSIGGMIAAFFLHDHEEMQAVIRRYALIFSSLSALSLLVNLLQHSSFAYM  718

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLTRRIRLR+LEKILTFETAWFDEE NSSGALC+RLSNEA++VK+LVADR+SLLVQ A
Sbjct  719   GEHLTRRIRLRVLEKILTFETAWFDEESNSSGALCSRLSNEASLVKTLVADRISLLVQTA  778

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S V I+  MGL+VAWKLALVMIA+QP TILCFY +K++LS+++    KAQ+ STQ+A+EA
Sbjct  779   SGVVISFSMGLIVAWKLALVMIAIQPSTILCFYAKKIVLSSVSLDLAKAQHHSTQLAIEA  838

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHR+VTSFGSI+KVL +F+ AQ EP + A+KKSW+AG  +G +  ++FM WALDFWYG
Sbjct  839   VYNHRMVTSFGSISKVLQLFEEAQKEPLRVARKKSWVAGFAMGCSPCVSFMSWALDFWYG  898

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIIT-  947
             GKL   G+IS+GDVFKTFFILVSTGKVIA+A SMTSDLAKG+ AVAS+F +LDR S+I  
Sbjct  899   GKLAQTGQISAGDVFKTFFILVSTGKVIAEACSMTSDLAKGATAVASVFEVLDRQSLIPG  958

Query  946   SPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGS  767
             S  +    NGGT L+++ GKIE+KKV+FAYP+RP+  +L EF LEVKAGSSIGLVG+SG 
Sbjct  959   SSSHADHRNGGTKLQRIQGKIELKKVDFAYPTRPQCLVLGEFSLEVKAGSSIGLVGRSGC  1018

Query  766   GKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFG  587
             GKSTI+ LI+RFYDVD G +R+DG+DVR  DI WYR   ALVSQEPV++SG+IRDNI FG
Sbjct  1019  GKSTIIGLIQRFYDVDRGVVRIDGMDVRELDIVWYRGFTALVSQEPVLFSGSIRDNIAFG  1078

Query  586   KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTI  407
             K +A E+EI+EAA+AANAH FISSLK+GY+TECGERG+QLSGGQKQRIAIARAI+RNPTI
Sbjct  1079  KPEAGEDEIVEAARAANAHDFISSLKEGYNTECGERGIQLSGGQKQRIAIARAIMRNPTI  1138

Query  406   LLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGT  227
             LLLDEATSALDV+SE+ VQEALD IM+ RTT+VVAHRLNTIK +DSIA + EGKVVEHG 
Sbjct  1139  LLLDEATSALDVQSERAVQEALDRIMVRRTTVVVAHRLNTIKKVDSIAFIGEGKVVEHGN  1198

Query  226   YSQLKNKRG  200
             Y+ L NK+G
Sbjct  1199  YAHLMNKKG  1207


 Score =   304 bits (779),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 186/497 (37%), Positives = 278/497 (56%), Gaps = 7/497 (1%)
 Frame = -2

Query  3547  ERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTS  3368
             E    +IR + LE IL  E  +FD +  ++  + + +S + SL++ ++++++ + +   S
Sbjct  720   EHLTRRIRLRVLEKILTFETAWFDEESNSSGALCSRLSNEASLVKTLVADRISLLVQTAS  779

Query  3367  VFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKANGIVGQAL  3188
               +         +W+L+LV        I+        L  +S    K    +  +  +A+
Sbjct  780   GVVISFSMGLIVAWKLALVMIAIQPSTILCFYAKKIVLSSVSLDLAKAQHHSTQLAIEAV  839

Query  3187  SSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGS  3011
              + + + SF +   +L+ +       +++  K     G A+G S  +SF  WA   WYG 
Sbjct  840   YNHRMVTSFGSISKVLQLFEEAQKEPLRVARKKSWVAGFAMGCSPCVSFMSWALDFWYGG  899

Query  3010  RLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGE  2831
             +L      S G ++      V  G  +  A        + + A + +F  +DR   I G 
Sbjct  900   KLAQTGQISAGDVFKTFFILVSTGKVIAEACSMTSDLAKGATAVASVFEVLDRQSLIPGS  959

Query  2830  D------KSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSG  2669
                      G  L  I+G++E K V FAYP+RP+ LVL + +L+V+AG ++ LVG SG G
Sbjct  960   SSHADHRNGGTKLQRIQGKIELKKVDFAYPTRPQCLVLGEFSLEVKAGSSIGLVGRSGCG  1019

Query  2668  KSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGK  2489
             KST I L+QRFYD + G + IDG+++  L + W RG   LVSQE  LF  SIR+NI  GK
Sbjct  1020  KSTIIGLIQRFYDVDRGVVRIDGMDVRELDIVWYRGFTALVSQEPVLFSGSIRDNIAFGK  1079

Query  2488  LGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVIL  2309
                  +E+V AA  ANAHDFI  L +GY T+ GERG  LSGGQKQRIAIARAI++NP IL
Sbjct  1080  PEAGEDEIVEAARAANAHDFISSLKEGYNTECGERGIQLSGGQKQRIAIARAIMRNPTIL  1139

Query  2308  LLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSH  2129
             LLDEATSALD +SE+ VQ+ALD+    RTT+VVAH+L+TI+  D IA +  G ++E G++
Sbjct  1140  LLDEATSALDVQSERAVQEALDRIMVRRTTVVVAHRLNTIKKVDSIAFIGEGKVVEHGNY  1199

Query  2128  SELMEKNGHYAQMAKLQ  2078
             + LM K G +  +A LQ
Sbjct  1200  AHLMNKKGAFFNLATLQ  1216



>gb|KGN66172.1| hypothetical protein Csa_1G574890 [Cucumis sativus]
Length=1187

 Score =  1580 bits (4090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/1208 (69%), Positives = 989/1208 (82%), Gaps = 58/1208 (5%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             VIFRYADW+DI LM LGT+GAIGDGMSTNCLL++ S L N+LG       +     N M 
Sbjct  25    VIFRYADWVDILLMFLGTIGAIGDGMSTNCLLVFASSLMNSLG-------NGHIQQNFMD  77

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              V KCSLYFV LGL VMV+ FMEGYCWSKTSERQVLKIR+KYLEA+LRQEVGFFDSQEAT
Sbjct  78    NVNKCSLYFVYLGLVVMVLAFMEGYCWSKTSERQVLKIRHKYLEAVLRQEVGFFDSQEAT  137

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             T+++ NSISKDTSL+QEVLSEKVP+F+M++SVFLSGLGFS YFSWRL+LVA+PT+++L+I
Sbjct  138   TADVVNSISKDTSLLQEVLSEKVPLFIMNSSVFLSGLGFSAYFSWRLALVAFPTMLLLVI  197

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PG+ YGKYL++++ K  KEY KANGIV QALSSIKTIY+FTAE+ ++E Y  IL+RT ++
Sbjct  198   PGVTYGKYLVHVTNKRRKEYGKANGIVEQALSSIKTIYAFTAEKRVIENYKRILERTTRV  257

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K GIAKGLAVGS+GL+FAIW  +AWYGSRL+M+KGESGGRIYAAGIS++L GLSLG+A
Sbjct  258   GIKQGIAKGLAVGSSGLAFAIWGLIAWYGSRLVMYKGESGGRIYAAGISFILAGLSLGVA  317

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESL  2741
             LP++K+ TEA +AASRIF  IDR P IDGED  G++L+ ++  +EF ++ FAYPSRP+S 
Sbjct  318   LPDLKHLTEAKIAASRIFKTIDRSPLIDGEDSKGLILNNLQPHIEFDHITFAYPSRPDSF  377

Query  2740  VLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRG  2561
             VLKD NLK++ GKT+ALVG SGSGKST I+LLQRFYD   G + +DGV+I ALQ+KW+R 
Sbjct  378   VLKDFNLKLDPGKTLALVGPSGSGKSTVISLLQRFYDPIDGVLKVDGVDIKALQLKWIRS  437

Query  2560  QMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERG  2381
             +MGLVSQ+HALFGTSI+ENI+ GKL  SMEE++ AAM ANAH+FI QLP+GYETKVGERG
Sbjct  438   KMGLVSQDHALFGTSIKENILFGKLDASMEEIMVAAMAANAHNFITQLPEGYETKVGERG  497

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
             ALLSGGQKQR                                            +VVAHK
Sbjct  498   ALLSGGQKQR--------------------------------------------IVVAHK  513

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQSFAPSSNA  2024
             LSTIR AD+IAVV+GG I+E GSH++L+  KNGHYA++AKLQR  S  D +Q+    +++
Sbjct  514   LSTIRKADVIAVVNGGGIVEIGSHNDLINRKNGHYAKLAKLQRLSSYDDVEQNIEIRASS  573

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
               +S+ +SSP   A SPL +E    +P +      PSF+RLL LN  EWKQ L GS+SAI
Sbjct  574   VGRSSARSSPTFFAKSPLPMEI---LPQETSSPKPPSFTRLLSLNSPEWKQALTGSLSAI  630

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
             AFGAVQP YALT+GGMISAFF+ SH EMQARI+ + ++F  L L+SI LNL QHY FAYM
Sbjct  631   AFGAVQPIYALTVGGMISAFFAQSHYEMQARIRTYSMIFCSLSLVSIILNLVQHYNFAYM  690

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHLT+RIRLR LEKILTFETAWFD+E NSSGALC+RLSNEA++VKSLVADR+SLLVQ  
Sbjct  691   GEHLTKRIRLRTLEKILTFETAWFDKEQNSSGALCSRLSNEASLVKSLVADRVSLLVQTT  750

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S VTIAM++GLVVAWKLA+VMIAVQPLTILCFYTRKVLLS+I+T F KAQN STQIAVEA
Sbjct  751   SGVTIAMILGLVVAWKLAIVMIAVQPLTILCFYTRKVLLSSISTNFTKAQNQSTQIAVEA  810

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHRIVTSF SI KVL IFD AQ+ PR EA KKSW AGIG+GSAQ LTFM WALDFW+G
Sbjct  811   VYNHRIVTSFSSIEKVLQIFDKAQEAPRNEAVKKSWFAGIGMGSAQCLTFMSWALDFWFG  870

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             G LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMT+DLAKGSAAVAS+F ILDR S+I+ 
Sbjct  871   GTLVQKGEISAGDVFKTFFILVSTGKVIAEAGSMTTDLAKGSAAVASVFEILDRKSLISD  930

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
             P     D  G+ +EK++G IE+KKV+F YPSRP   +LR+F LEVKAG S+GLVGKSG G
Sbjct  931   PSK---DGRGSKMEKITGNIEMKKVDFWYPSRPNNMVLRQFSLEVKAGRSVGLVGKSGCG  987

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KST++ LI RFYDV  G+++VDGVD+R  D+ WYR+ +ALVSQ+PVI+SG+IRDNILFGK
Sbjct  988   KSTVIGLILRFYDVVKGTVKVDGVDIREMDLQWYRKHVALVSQDPVIFSGSIRDNILFGK  1047

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
             LDASENE+++AA+AANAH+FISSLK GY TECGERGVQLSGGQKQRIAIARAIIRNPTIL
Sbjct  1048  LDASENELVDAARAANAHEFISSLKDGYGTECGERGVQLSGGQKQRIAIARAIIRNPTIL  1107

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALDV+SEQVVQ+ALD IM+GRTT+VVAHRLNTIK LDSIA V++GKVVE G+Y
Sbjct  1108  LLDEATSALDVQSEQVVQQALDRIMVGRTTLVVAHRLNTIKKLDSIAFVADGKVVEQGSY  1167

Query  223   SQLKNKRG  200
             +QLKN+RG
Sbjct  1168  AQLKNQRG  1175


 Score =   313 bits (801),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 196/527 (37%), Positives = 305/527 (58%), Gaps = 5/527 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
              +   S+ F  L L  +++  ++ Y ++   E    +IR + LE IL  E  +FD ++ +
Sbjct  661   RIRTYSMIFCSLSLVSIILNLVQHYNFAYMGEHLTKRIRLRTLEKILTFETAWFDKEQNS  720

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             +  + + +S + SL++ +++++V + +  TS     +      +W+L++V      + I+
Sbjct  721   SGALCSRLSNEASLVKSLVADRVSLLVQTTSGVTIAMILGLVVAWKLAIVMIAVQPLTIL  780

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
                     L  +S    K  +++  I  +A+ + + + SF++   +L+ +    +     
Sbjct  781   CFYTRKVLLSSISTNFTKAQNQSTQIAVEAVYNHRIVTSFSSIEKVLQIFDKAQEAPRNE  840

Query  3100  GMKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLG  2927
              +K     G+ +GS   L+F  WA   W+G  L+  KGE S G ++      V  G  + 
Sbjct  841   AVKKSWFAGIGMGSAQCLTFMSWALDFWFGGTLV-QKGEISAGDVFKTFFILVSTGKVIA  899

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKID--GEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              A        + S A + +F  +DR   I    +D  G  ++ I G +E K V F YPSR
Sbjct  900   EAGSMTTDLAKGSAAVASVFEILDRKSLISDPSKDGRGSKMEKITGNIEMKKVDFWYPSR  959

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P ++VL+  +L+V+AG++V LVG SG GKST I L+ RFYD   G++ +DGV+I  + ++
Sbjct  960   PNNMVLRQFSLEVKAGRSVGLVGKSGCGKSTVIGLILRFYDVVKGTVKVDGVDIREMDLQ  1019

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W R  + LVSQ+  +F  SIR+NI+ GKL  S  E+V AA  ANAH+FI  L  GY T+ 
Sbjct  1020  WYRKHVALVSQDPVIFSGSIRDNILFGKLDASENELVDAARAANAHEFISSLKDGYGTEC  1079

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD +SE++VQ ALD+   GRTTLV
Sbjct  1080  GERGVQLSGGQKQRIAIARAIIRNPTILLLDEATSALDVQSEQVVQQALDRIMVGRTTLV  1139

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             VAH+L+TI+  D IA V+ G ++EQGS+++L  + G +  +A LQ Q
Sbjct  1140  VAHRLNTIKKLDSIAFVADGKVVEQGSYAQLKNQRGAFFNLANLQIQ  1186



>ref|XP_009406169.1| PREDICTED: putative ABC transporter B family member 8 [Musa acuminata 
subsp. malaccensis]
Length=1233

 Score =  1558 bits (4035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/1208 (69%), Positives = 1008/1208 (83%), Gaps = 8/1208 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F + DW+D+ LM LGT+GAIGDG S NCLLL+ S++ N+LGYG             M  
Sbjct  22    VFTFVDWVDVVLMLLGTIGAIGDGCSINCLLLFASNVMNSLGYGKAQDNHPD----FMHN  77

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  LYFV LG AV+V+ FMEGYCWS+TSERQVL+IRYKYLEAILRQEV FFDSQEATT
Sbjct  78    VEKYCLYFVYLGSAVLVVAFMEGYCWSRTSERQVLRIRYKYLEAILRQEVAFFDSQEATT  137

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKDT LIQEVLSEKVP+F+MH+SVF+SGL FS YFSWRLSLVA P +++LIIP
Sbjct  138   SEIINSISKDTCLIQEVLSEKVPLFIMHSSVFVSGLAFSAYFSWRLSLVALPLVLLLIIP  197

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLLYLS KS + Y+KANGI  QAL SIKTIYSFTAE+SI+ERY++ILD+T+KLG
Sbjct  198   GLIYGKYLLYLSHKSREAYAKANGITEQALGSIKTIYSFTAEKSIVERYAAILDKTVKLG  257

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVGSTGLSFAIW FLAWYG RL+M+ GESGGRIYAAGIS+VLGGLSLGMAL
Sbjct  258   IKQGIAKGLAVGSTGLSFAIWGFLAWYGGRLVMYHGESGGRIYAAGISFVLGGLSLGMAL  317

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PEVK+FTEASVAA RI  RI+R+P+ID ED +G+ LD I GE+EF +V+F YPSRP+++V
Sbjct  318   PEVKHFTEASVAAKRILERINRLPRIDAEDPTGIKLDGIHGEVEFDSVQFTYPSRPDTVV  377

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LKD NL+V AG+T+ALVG SGSGKSTA+ALLQRFYD + G++ IDGV+I  LQ+KWLR +
Sbjct  378   LKDFNLRVPAGETIALVGTSGSGKSTAVALLQRFYDVDVGTVRIDGVDIKKLQLKWLREK  437

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTSI+ENI+ GK   +M E+ AAAMTANAH+FIRQLP+GY+TK+GERGA
Sbjct  438   MGLVSQDHALFGTSIKENILFGKPDATMGEIYAAAMTANAHNFIRQLPEGYDTKIGERGA  497

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESEKLVQ+ALDQAS GRTTLVVAHKL
Sbjct  498   LLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESEKLVQNALDQASMGRTTLVVAHKL  557

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQD-QSFAPSSNA  2024
             STI+NAD IAVV  G I+E G+H +L+ ++N HY+++ KLQR  S  DQ+ +SF PSS  
Sbjct  558   STIKNADQIAVVDCGRIVEMGTHDDLINDRNSHYSRLVKLQRISSNIDQEPESFRPSS-V  616

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
              R S  + S    + +   + +  +  T     P+PSFSRLL +N  EWKQ ++GSISAI
Sbjct  617   TRSSASRLSLTRASPASFSVFSEDQPST-TSSSPAPSFSRLLAMNSPEWKQAIVGSISAI  675

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              +G++QP YA +IGGMI+AFF   H +MQA I+++ L+F+ L ++SI +NL QHY FAYM
Sbjct  676   IYGSIQPIYAFSIGGMIAAFFLQDHAKMQAIIRRYSLIFSSLSVVSIIVNLSQHYNFAYM  735

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GE LT+R+RLR+LEKILTFE AWFDEE +SSGALC+RLSNEA++VK+LVADR+SLLVQ A
Sbjct  736   GERLTKRVRLRVLEKILTFEAAWFDEESHSSGALCSRLSNEASLVKTLVADRISLLVQTA  795

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S V IAM MGL+VAWKLALVMIA+QP T++C+Y +KV+LS ++    KAQ+ STQIA+EA
Sbjct  796   SGVVIAMTMGLIVAWKLALVMIAIQPSTMICYYAKKVVLSRVSVGMAKAQHISTQIAIEA  855

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNH++VTSFG  +KVL +F  AQ+EP + ++KKSW+AGI  GS+  L+F+ WALDFWYG
Sbjct  856   VYNHKMVTSFGCADKVLGLFKQAQEEPLRASRKKSWVAGIATGSSPCLSFLSWALDFWYG  915

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             GKL  +GEIS+GDVFKTFFILVSTGKVIA+AGSMTSDLAKG+ AVAS+F +LDR S+I  
Sbjct  916   GKLAQSGEISAGDVFKTFFILVSTGKVIAEAGSMTSDLAKGATAVASVFEVLDRQSLIPG  975

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
               N    +    L+K+ GKI+I+KV+FAYP+RP+ P+LREF LEVKAG+S+GLVG+SG G
Sbjct  976   STNMDRQSDERKLKKIQGKIDIRKVDFAYPTRPQCPVLREFNLEVKAGASVGLVGRSGCG  1035

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KST+++LI+RFYDVD G +R+D  DVR  DI W+R   ALVSQ+PVI+SG+IRDNI FGK
Sbjct  1036  KSTVISLIQRFYDVDRGVVRIDNTDVRELDIIWFRGFTALVSQDPVIFSGSIRDNIAFGK  1095

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
              +++E+EI+EAA+AANAH FISSLK GYDT+CGERGVQLSGGQKQRIAIARAI+RNPTIL
Sbjct  1096  PESTEDEIVEAARAANAHDFISSLKDGYDTDCGERGVQLSGGQKQRIAIARAIVRNPTIL  1155

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALDV+SE+ VQEALD IM+ RTT+VVAHRLNTIK LDSIA V EG+VVE GTY
Sbjct  1156  LLDEATSALDVQSERAVQEALDRIMVNRTTVVVAHRLNTIKKLDSIAFVGEGRVVERGTY  1215

Query  223   SQLKNKRG  200
             +QL +K+G
Sbjct  1216  AQLMSKKG  1223


 Score =   308 bits (790),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 189/525 (36%), Positives = 294/525 (56%), Gaps = 6/525 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + SL F  L +  +++   + Y ++   ER   ++R + LE IL  E  +FD +  ++
Sbjct  707   IRRYSLIFSSLSVVSIIVNLSQHYNFAYMGERLTKRVRLRVLEKILTFEAAWFDEESHSS  766

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + +   S  +  +      +W+L+LV        +I 
Sbjct  767   GALCSRLSNEASLVKTLVADRISLLVQTASGVVIAMTMGLIVAWKLALVMIAIQPSTMIC  826

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S    K    +  I  +A+ + K + SF     +L  +    +  ++  
Sbjct  827   YYAKKVVLSRVSVGMAKAQHISTQIAIEAVYNHKMVTSFGCADKVLGLFKQAQEEPLRAS  886

Query  3097  MKIGIAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+A GS+  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  887   RKKSWVAGIATGSSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFILVSTGKVIAEA  946

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSG--MVLDTIRGELEFKNVKFAYPS  2756
                     + + A + +F  +DR   +P     D+      L  I+G+++ + V FAYP+
Sbjct  947   GSMTSDLAKGATAVASVFEVLDRQSLIPGSTNMDRQSDERKLKKIQGKIDIRKVDFAYPT  1006

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+  VL++ NL+V+AG +V LVG SG GKST I+L+QRFYD + G + ID  ++  L +
Sbjct  1007  RPQCPVLREFNLEVKAGASVGLVGRSGCGKSTVISLIQRFYDVDRGVVRIDNTDVRELDI  1066

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
              W RG   LVSQ+  +F  SIR+NI  GK   + +E+V AA  ANAHDFI  L  GY+T 
Sbjct  1067  IWFRGFTALVSQDPVIFSGSIRDNIAFGKPESTEDEIVEAARAANAHDFISSLKDGYDTD  1126

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
              GERG  LSGGQKQRIAIARAI++NP ILLLDEATSALD +SE+ VQ+ALD+    RTT+
Sbjct  1127  CGERGVQLSGGQKQRIAIARAIVRNPTILLLDEATSALDVQSERAVQEALDRIMVNRTTV  1186

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKL  2081
             VVAH+L+TI+  D IA V  G ++E+G++++LM K G +  +A L
Sbjct  1187  VVAHRLNTIKKLDSIAFVGEGRVVERGTYAQLMSKKGAFFDLAAL  1231



>ref|XP_010095343.1| Putative ABC transporter B family member 8 [Morus notabilis]
 gb|EXB59762.1| Putative ABC transporter B family member 8 [Morus notabilis]
Length=1146

 Score =  1557 bits (4032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/1125 (73%), Positives = 972/1125 (86%), Gaps = 24/1125 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             S++  + RYADW+D+ LM LGT+GA+GDGMSTN LL++ SH+ N+LGYG   +Q    + 
Sbjct  26    SNLATVLRYADWVDVVLMILGTIGALGDGMSTNILLVFASHIMNSLGYGQTQTQQNRGH-  84

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEKCSL FV LGLAVMVM FMEGYCWSKTSERQVL++RYKYLEA+LRQEVGFFDS
Sbjct  85    -FMDEVEKCSLNFVYLGLAVMVMAFMEGYCWSKTSERQVLRMRYKYLEAVLRQEVGFFDS  143

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTS++ NSISKDT LIQEVLSEKVPIFLMH+SVF+SGL F+T+FSWRLSLVA+PT++
Sbjct  144   QEATTSDVINSISKDTFLIQEVLSEKVPIFLMHSSVFISGLAFATFFSWRLSLVAFPTLL  203

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYG+YLLYLS+KS KEY KAN I+ QALSSI+T+YSFTAE+ I+ERYS+ILD+
Sbjct  204   LLIIPGMIYGRYLLYLSRKSHKEYGKANSIIEQALSSIRTVYSFTAEKRIVERYSAILDQ  263

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T KLG+K G+AKGLAVGSTGLSF IWAFLAWYGSRL+M+KGESGGRIYAAGIS+VL GLS
Sbjct  264   TTKLGIKQGLAKGLAVGSTGLSFTIWAFLAWYGSRLVMYKGESGGRIYAAGISFVLSGLS  323

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ALP+VKYFTEASVAA RIF RIDR+P IDGED  G+VLD IRGELEF++VKF YPSR
Sbjct  324   LGIALPDVKYFTEASVAAQRIFDRIDRIPLIDGEDTKGLVLDEIRGELEFEHVKFTYPSR  383

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+++VLKD NLKVEAG+TVALVGASGSGKSTAI+L+QRFYD + G + IDGV++  L +K
Sbjct  384   PDTIVLKDFNLKVEAGQTVALVGASGSGKSTAISLVQRFYDVDDGVVKIDGVDVRTLHLK  443

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE----VVAAAMTANAHDFIRQLPQGY  2405
             W+RG MGLVSQ+HALFGTSI+ENIM GKL  +MEE    +  AAM ANAH+FIRQLP+GY
Sbjct  444   WIRGNMGLVSQDHALFGTSIKENIMFGKLDATMEEKRKELAGAAMAANAHNFIRQLPEGY  503

Query  2404  ETKV-------GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDAL  2246
             ETKV       GERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESE LVQ+AL
Sbjct  504   ETKVISSYEEIGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQNAL  563

Query  2245  DQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQF  2069
             DQAS GRTTLVVAHKLST+RNADLIAVVSGGCIIE GSH++L+ + NGHYA++AK+QRQF
Sbjct  564   DQASMGRTTLVVAHKLSTVRNADLIAVVSGGCIIELGSHNDLINRDNGHYAKLAKMQRQF  623

Query  2068  SCA--DQDQS------FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPS  1913
             S A  + DQS       + + ++GRQST +SSP V + SP   ++ +  P      P+PS
Sbjct  624   SFAVDNNDQSDTSGLVSSVTRSSGRQSTARSSPLVFSKSPN--QSIETTPQHKISHPAPS  681

Query  1912  FSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCL  1733
             F+RLL LN  EWKQGLIGS+SA+AFG+VQPTYALTIGGMISAFF+PSH+EM+ RI+ + L
Sbjct  682   FTRLLSLNAPEWKQGLIGSLSAVAFGSVQPTYALTIGGMISAFFAPSHDEMRDRIRTYSL  741

Query  1732  VFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCAR  1553
             +F  L  +SI LNL QHY FAYMG  LT+RIR+RMLEKILTFETAWFDEE NSSGALC+R
Sbjct  742   IFCSLSAISIILNLLQHYNFAYMGARLTKRIRIRMLEKILTFETAWFDEEENSSGALCSR  801

Query  1552  LSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKV  1373
             LSNEA+MVKSLVADR+SLLVQ  S+VTIAM+MGLVVAWKLALVMIAVQPLTILCFYTRKV
Sbjct  802   LSNEASMVKSLVADRVSLLVQTTSAVTIAMIMGLVVAWKLALVMIAVQPLTILCFYTRKV  861

Query  1372  LLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWL  1193
             LLS++++  V+AQ+ STQIAVEAVYNHRIVTSFG + KVL++F+ AQ+ PRKEA+K++W+
Sbjct  862   LLSSMSSNIVRAQHQSTQIAVEAVYNHRIVTSFGIVGKVLELFEEAQEAPRKEARKRAWM  921

Query  1192  AGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSD  1013
             AG+G+GSAQ LTF+ WALDFWYGG+LV  GEIS+GDVFKTFFILVSTGKVIA+AGSMTSD
Sbjct  922   AGMGMGSAQCLTFVSWALDFWYGGRLVMKGEISAGDVFKTFFILVSTGKVIAEAGSMTSD  981

Query  1012  LAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPI  833
             +AKGSAAV ++F ILDR S I+   NG   N GT LEK++G++E+KKV+FAYPSRPET +
Sbjct  982   IAKGSAAVTAVFRILDRKSHISGSDNGTDGNSGTKLEKITGRLEMKKVDFAYPSRPETLV  1041

Query  832   LREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQ  653
             LR+F LEVKAG+SIGLVGKSG GKST++ LI+RFYDV  GS++VDGVD+R  DI WYRR 
Sbjct  1042  LRQFSLEVKAGTSIGLVGKSGCGKSTVIGLIQRFYDVGKGSVKVDGVDIRELDIQWYRRH  1101

Query  652   MALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFIS  518
              ALVSQEPVIYSG+IRDNILFGKLD+SE+E++EAAKAANAH+FIS
Sbjct  1102  TALVSQEPVIYSGSIRDNILFGKLDSSEHEVVEAAKAANAHEFIS  1146


 Score =   309 bits (792),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 200/528 (38%), Positives = 311/528 (59%), Gaps = 21/528 (4%)
 Frame = -2

Query  1750  IQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSS  1571
             ++K  L F  L L  + +   + YC++   E    R+R + LE +L  E  +FD +  ++
Sbjct  89    VEKCSLNFVYLGLAVMVMAFMEGYCWSKTSERQVLRMRYKYLEAVLRQEVGFFDSQEATT  148

Query  1570  GALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTIL-  1394
               +   +S +  +++ ++++++ + +  +S     +      +W+L+LV      L I+ 
Sbjct  149   SDVINSISKDTFLIQEVLSEKVPIFLMHSSVFISGLAFATFFSWRLSLVAFPTLLLLIIP  208

Query  1393  -CFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRK  1217
                Y R +L   ++ K  K    +  I  +A+ + R V SF +  ++++ +    D+  K
Sbjct  209   GMIYGRYLLY--LSRKSHKEYGKANSIIEQALSSIRTVYSFTAEKRIVERYSAILDQTTK  266

Query  1216  EAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIA  1037
                K+    G+ +GS  GL+F  WA   WYG +LV     S G ++      V +G  + 
Sbjct  267   LGIKQGLAKGLAVGST-GLSFTIWAFLAWYGSRLVMYKGESGGRIYAAGISFVLSGLSLG  325

Query  1036  DAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAY  857
              A        + S A   IF  +DR  +I    +G+ D  G  L+++ G++E + V F Y
Sbjct  326   IALPDVKYFTEASVAAQRIFDRIDRIPLI----DGE-DTKGLVLDEIRGELEFEHVKFTY  380

Query  856   PSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSF  677
             PSRP+T +L++F L+V+AG ++ LVG SGSGKST ++L++RFYDVD G +++DGVDVR+ 
Sbjct  381   PSRPDTIVLKDFNLKVEAGQTVALVGASGSGKSTAISLVQRFYDVDDGVVKIDGVDVRTL  440

Query  676   DIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDaseneiiea----akaanAHQFISSLK  509
              + W R  M LVSQ+  ++  +I++NI+FGKLDA+  E  +     A AANAH FI  L 
Sbjct  441   HLKWIRGNMGLVSQDHALFGTSIKENIMFGKLDATMEEKRKELAGAAMAANAHNFIRQLP  500

Query  508   KGYDT-------ECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQ  350
             +GY+T       E GERG  LSGGQKQRIAIARAII+NP ILLLDEATSALD ESE +VQ
Sbjct  501   EGYETKVISSYEEIGERGALLSGGQKQRIAIARAIIKNPVILLLDEATSALDSESETLVQ  560

Query  349   EALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
              ALD   +GRTT+VVAH+L+T++N D IA+VS G ++E G+++ L N+
Sbjct  561   NALDQASMGRTTLVVAHKLSTVRNADLIAVVSGGCIIELGSHNDLINR  608



>ref|XP_004969800.1| PREDICTED: putative ABC transporter B family member 8-like [Setaria 
italica]
Length=1233

 Score =  1550 bits (4014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1210 (67%), Positives = 1003/1210 (83%), Gaps = 7/1210 (1%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +FR+AD +D+ LM LGTLGAIGDG STN LL++ S + N LGYG     + +    
Sbjct  21    SIRGMFRFADRVDVLLMVLGTLGAIGDGCSTNLLLIFASDVMNALGYGRGGGAATVD---  77

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEK  L FV L  AV+ + FMEGYCWS+TSERQVL+IRY YL+AILRQEVGFFDSQ
Sbjct  78    FMHEVEKSCLNFVYLAFAVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEVGFFDSQ  137

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL F+TYF WRL+L+++P +++
Sbjct  138   EATTSEIINSISKDASLIQEVLSEKVPLFLMHSTVFVSGLAFATYFCWRLALISFPLVLL  197

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGLIYGKYLLYLS++S  EY+ AN +V QAL SIKT+YSFTAE+ I+++Y++ILD+T
Sbjct  198   LIIPGLIYGKYLLYLSRQSRHEYANANSLVEQALGSIKTVYSFTAEKRIIQKYTAILDKT  257

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             I+LG+K GIAKGLAVG TGLSFAIWAFLAWYG RL+MH   SGGRIYAAGIS+VLGGLSL
Sbjct  258   IELGIKQGIAKGLAVGFTGLSFAIWAFLAWYGGRLVMHHQASGGRIYAAGISFVLGGLSL  317

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALPE+K+FTEASVAA+RI  RI+RVP+I+ +D  G+VLD IRGEL+F++V+F YPSRP
Sbjct  318   GMALPELKHFTEASVAATRILDRINRVPQINADDPKGLVLDQIRGELQFESVRFVYPSRP  377

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
                VLKD NL++ AG+T+ALVG+SGSGKSTAIAL+QRFYDA+ G++ IDG +I  LQ+KW
Sbjct  378   NMPVLKDFNLQIPAGQTIALVGSSGSGKSTAIALVQRFYDASEGTVKIDGFDIKELQLKW  437

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R +MGLVSQ+HALFGTSI+ENI+ GK   +M+EV AAAMTANAH+FIR LP+ YETK+G
Sbjct  438   IRSKMGLVSQDHALFGTSIKENILFGKPDATMDEVYAAAMTANAHNFIRGLPEEYETKIG  497

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVV
Sbjct  498   ERGALLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVV  557

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSS  2030
             AHKLST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+     +S
Sbjct  558   AHKLSTVKNADQIAVVDGGAIAEIGTHDELINKGGTYSRLVKLQKMVSYIDQENEQFRAS  617

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSIS  1850
             +  R ST + S +  +  PL     +++ +D    P+PSFSRLL +N  EW+Q +IGS+S
Sbjct  618   SVARTSTSRHSVSRASPMPLTPAVLKEISSD-VSPPAPSFSRLLAMNAPEWRQAVIGSLS  676

Query  1849  AIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFA  1670
             A+ +G++QP YA+TIGGMI+AFF   H EM A I+++ L+F  L ++SI +NL QHY FA
Sbjct  677   ALVYGSLQPIYAITIGGMIAAFFVQDHNEMNAIIRRYALIFCSLSMVSIVVNLLQHYNFA  736

Query  1669  YMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQ  1490
             YMGEHL RRIR+++LEKILTFE AWFDEE NSSGALC+RLSNEA++VK+LVADR+SLL+Q
Sbjct  737   YMGEHLVRRIRVQVLEKILTFEAAWFDEETNSSGALCSRLSNEASLVKTLVADRMSLLLQ  796

Query  1489  AASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAV  1310
              AS + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ  STQIA+
Sbjct  797   TASGIIIAVTMGLIVAWKLALVMIAVQPTTMICYYAKKIVLSNVSRDLAKAQYQSTQIAI  856

Query  1309  EAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFW  1130
             EAVYNHR+VTSFG  +KVL +F++AQ+EP K A+KKSW+AG+  G +  L+F+ WALDFW
Sbjct  857   EAVYNHRMVTSFGCSSKVLQLFEHAQEEPLKRARKKSWVAGLTTGLSPCLSFLSWALDFW  916

Query  1129  YGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSII  950
             YGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR SI 
Sbjct  917   YGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKSI-  975

Query  949   TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSG  770
              SP N +V+      +K+ G+IE KKV+F+YP+RPE  IL++F L+VKAG+S+GLVG+SG
Sbjct  976   -SPQNSQVEKEDQK-KKIQGRIEFKKVDFSYPTRPECLILQDFSLDVKAGTSVGLVGRSG  1033

Query  769   SGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILF  590
              GKSTI+ LI+RFYDVD G++R+DG+DVR  +I W+R   ALVSQEP ++SG++RDNI F
Sbjct  1034  CGKSTIIGLIQRFYDVDRGAVRIDGMDVREMNILWFRGFTALVSQEPAMFSGSVRDNIAF  1093

Query  589   GKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPT  410
             GK +A E+EI+EAAKAANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAIIRNP 
Sbjct  1094  GKPEADEDEIVEAAKAANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRNPA  1153

Query  409   ILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHG  230
             ILLLDEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGKVVE G
Sbjct  1154  ILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGKVVERG  1213

Query  229   TYSQLKNKRG  200
             +Y QL NK+G
Sbjct  1214  SYPQLMNKKG  1223


 Score =   322 bits (825),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 196/528 (37%), Positives = 304/528 (58%), Gaps = 11/528 (2%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L +  +V+  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  710   IRRYALIFCSLSMVSIVVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  769

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        +I 
Sbjct  770   GALCSRLSNEASLVKTLVADRMSLLLQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMIC  829

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  830   YYAKKIVLSNVSRDLAKAQYQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHAQEEPLKRA  889

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     GL  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  890   RKKSWVAGLTTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  949

Query  2920  LPEVKYFTEASVAASRIFSRIDRVP------KIDGEDKSGMVLDTIRGELEFKNVKFAYP  2759
                     + + A + +F  +DR        +++ ED+       I+G +EFK V F+YP
Sbjct  950   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKEDQK----KKIQGRIEFKKVDFSYP  1005

Query  2758  SRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQ  2579
             +RPE L+L+D +L V+AG +V LVG SG GKST I L+QRFYD + G++ IDG+++  + 
Sbjct  1006  TRPECLILQDFSLDVKAGTSVGLVGRSGCGKSTIIGLIQRFYDVDRGAVRIDGMDVREMN  1065

Query  2578  VKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYET  2399
             + W RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY+T
Sbjct  1066  ILWFRGFTALVSQEPAMFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYDT  1125

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               GE G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT
Sbjct  1126  DCGEHGIQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMSGRTT  1185

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             +VVAH+L+TI+N D IA +  G ++E+GS+ +LM K G +  +A LQ+
Sbjct  1186  IVVAHRLNTIKNVDSIAFLGEGKVVERGSYPQLMNKKGAFYNLATLQK  1233



>ref|XP_006644646.1| PREDICTED: putative ABC transporter B family member 8-like [Oryza 
brachyantha]
Length=1232

 Score =  1545 bits (4000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/1208 (67%), Positives = 1002/1208 (83%), Gaps = 9/1208 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF++AD +D+ LM LGTLGAIGDG STN LL++ S + N+LGY      +   +   MR 
Sbjct  22    IFKFADRLDVLLMALGTLGAIGDGCSTNLLLIFASDVMNSLGYARAGQAAHGVD--FMRA  79

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  L FV L  AV+ + FMEGYCWS+TSERQVL+IRY YL+AILRQEVGFFDSQEATT
Sbjct  80    VEKSCLNFVYLAFAVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEVGFFDSQEATT  139

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV++P +++LIIP
Sbjct  140   SEIINSISKDASLIQEVLSEKVPLFLMHSTVFISGLAFSTYFSWRLALVSFPLVLLLIIP  199

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLLYLS++S  EY+ AN +V QAL SIKT+YSFTAE+ I++RY+++LD+TIKLG
Sbjct  200   GLIYGKYLLYLSRQSRHEYANANSLVEQALGSIKTVYSFTAEKRIIQRYTAVLDKTIKLG  259

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSLGMAL
Sbjct  260   IRQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSLGMAL  319

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PE+K+FTEASVAA+RI  RI+RVP+I+ +D  G++LD +RGEL+F++V+F YPSRP   V
Sbjct  320   PELKHFTEASVAATRILDRINRVPEINADDPKGLILDQVRGELQFESVRFVYPSRPNMTV  379

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LKD NL++ AG+TVALVG+SGSGKSTAIAL+QRFYDA+ G++ +DGV I  LQ+KW+R +
Sbjct  380   LKDFNLQIPAGQTVALVGSSGSGKSTAIALVQRFYDASEGTVKVDGVNIKELQLKWIRSK  439

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTSI+ENI+ GK   +M+E+ AAAMTANAH+FIR LP+ YETK+GERGA
Sbjct  440   MGLVSQDHALFGTSIKENILFGKPDATMDELYAAAMTANAHNFIRGLPEEYETKIGERGA  499

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARA+IKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVAHKL
Sbjct  500   LLSGGQKQRIAIARAVIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVAHKL  559

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQD--QSFAPSSNA  2024
             ST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+    F  SS A
Sbjct  560   STVKNADQIAVVDGGTIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQEGGDQFRASSVA  619

Query  2023  GRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
              R ST + S +  +  PL    +++  +     P+PSFSRLL +N  EW+Q +IGS+SA+
Sbjct  620   -RTSTSRLSMSRASPMPLTPAISKETDSP-GSPPAPSFSRLLAMNAPEWRQAVIGSLSAL  677

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              +G++QP YA+TIGGMI+AFF  +  EM A I ++ L+F  L ++SI +NL QHY FAYM
Sbjct  678   VYGSLQPIYAITIGGMIAAFFVQNRNEMNAIISRYALIFCSLSVISIAVNLLQHYNFAYM  737

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GEHL RRIR+++LEKILTFE AWFDEE NSSG+LC+RLSNEA++VK+LVADR+SLL+Q A
Sbjct  738   GEHLVRRIRVQVLEKILTFEAAWFDEETNSSGSLCSRLSNEASLVKTLVADRISLLLQTA  797

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ+ STQIA+EA
Sbjct  798   SGIIIAVTMGLIVAWKLALVMIAVQPTTMICYYAKKIVLSNVSRDLAKAQHQSTQIAIEA  857

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             VYNHR+VTSFG  +KVL +F++ Q+EP K+A+KKSW+AGI  G +  L+F+ WALDFWYG
Sbjct  858   VYNHRMVTSFGCSSKVLQLFEHTQEEPLKKARKKSWVAGITTGLSPCLSFLSWALDFWYG  917

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             GKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR SI  S
Sbjct  918   GKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKSI--S  975

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
             P N +V+       K+ G+IE KKV+FAYP+RP+  IL++F L+VKAG+SIGLVG+SG G
Sbjct  976   PQNSQVEKDNQK-NKIQGRIEFKKVDFAYPTRPQCLILQDFSLDVKAGTSIGLVGRSGCG  1034

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KSTI+ LI+RFYDVD G++RVDG+DVR  +I WYR   ALVSQEP I+SG++RDNI FGK
Sbjct  1035  KSTIIGLIQRFYDVDRGAVRVDGMDVREMNILWYRGFTALVSQEPAIFSGSVRDNIAFGK  1094

Query  583   LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTIL  404
              +A E+EI+EAAKAANAH+FISSLK GY T+CGE G+QLSGGQKQRIAIARAIIRNP+IL
Sbjct  1095  PEADEDEIVEAAKAANAHEFISSLKDGYHTDCGEHGLQLSGGQKQRIAIARAIIRNPSIL  1154

Query  403   LLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTY  224
             LLDEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGKVVE GTY
Sbjct  1155  LLDEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGKVVERGTY  1214

Query  223   SQLKNKRG  200
               L +K+G
Sbjct  1215  PHLMSKKG  1222


 Score =   313 bits (801),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 191/525 (36%), Positives = 300/525 (57%), Gaps = 5/525 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L +  + +  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  709   ISRYALIFCSLSVISIAVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  768

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        +I 
Sbjct  769   GSLCSRLSNEASLVKTLVADRISLLLQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMIC  828

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  829   YYAKKIVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHTQEEPLKKA  888

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  889   RKKSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  948

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
                     + + A + +F  +DR    P+    +K     + I+G +EFK V FAYP+RP
Sbjct  949   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNQK-NKIQGRIEFKKVDFAYPTRP  1007

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             + L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ +DG+++  + + W
Sbjct  1008  QCLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVRVDGMDVREMNILW  1067

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
              RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY T  G
Sbjct  1068  YRGFTALVSQEPAIFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYHTDCG  1127

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             E G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT+VV
Sbjct  1128  EHGLQLSGGQKQRIAIARAIIRNPSILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVV  1187

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             AH+L+TI+N D IA +  G ++E+G++  LM K G +  +A LQ+
Sbjct  1188  AHRLNTIKNVDSIAFLGEGKVVERGTYPHLMSKKGAFYNLATLQK  1232



>tpg|DAA57811.1| TPA: hypothetical protein ZEAMMB73_975376 [Zea mays]
Length=1231

 Score =  1537 bits (3979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 813/1206 (67%), Positives = 1000/1206 (83%), Gaps = 4/1206 (0%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IFR+AD +D+ LM LGTLGAIGDG STN LL++ S + N LGYG   +     +   M E
Sbjct  20    IFRFADRVDVLLMALGTLGAIGDGCSTNLLLIFASDVMNALGYGGAQAGGGAKSAQFMHE  79

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  L FV LGL V+ + FMEGYCWS+TSERQVL+IRY YL+AILRQE GFFDSQEATT
Sbjct  80    VEKSCLNFVYLGLVVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEAGFFDSQEATT  139

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKD S IQEVLSEKVP+FLMH++VF+SGL F+TYF WRL+LV++P +++LIIP
Sbjct  140   SEIINSISKDASHIQEVLSEKVPLFLMHSTVFVSGLAFATYFCWRLALVSFPLVLLLIIP  199

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLLYLS++S  EY+KAN +V QAL SIKT+YSFTAE+ I++RY++ILD+TIKLG
Sbjct  200   GLIYGKYLLYLSRRSRHEYAKANSLVDQALGSIKTVYSFTAEKRIIQRYTAILDKTIKLG  259

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVG TGLSFAIWAFLAWYG RL++    +GGRIYAAGIS+VLGGLSLGMAL
Sbjct  260   IKQGIAKGLAVGFTGLSFAIWAFLAWYGGRLVVFHHVTGGRIYAAGISFVLGGLSLGMAL  319

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PE+K+F EASVAA+RI  RI+RVP+ID ED  G+VLD IRGELEF++V+F YPSRP   V
Sbjct  320   PELKHFAEASVAATRILDRINRVPQIDAEDPKGLVLDQIRGELEFESVRFEYPSRPNMPV  379

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LK+ +L++ AG+T+ALVG+SGSGKSTAIAL+QRFYDA+ G++ +DG +I  LQ+KW+R +
Sbjct  380   LKNFSLQIPAGQTIALVGSSGSGKSTAIALVQRFYDASEGTVKVDGFDIKELQLKWIRSK  439

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTSI+ENI+ GK   +M+EV AAAMTANAH+FIR LP+ YETK+GERGA
Sbjct  440   MGLVSQDHALFGTSIKENILFGKPDATMDEVYAAAMTANAHNFIRGLPEEYETKIGERGA  499

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARA+IKN  ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVAHKL
Sbjct  500   LLSGGQKQRIAIARAVIKNTAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVAHKL  559

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSSNAGR  2018
             ST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+     +S+  R
Sbjct  560   STVKNADQIAVVDGGTIAEIGTHDELISKGGPYSRLVKLQKMVSYIDQENDQFRASSVAR  619

Query  2017  QSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAF  1838
              ST + S +  +  PL     ++  +D  H P+PSFSRLL +N  EW+Q ++GS+SA+ +
Sbjct  620   TSTSRHSMSRASPMPLTPAALKENDSD-VHPPAPSFSRLLAMNAPEWRQAVVGSLSALVY  678

Query  1837  GAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGE  1658
             G++QP YA+TIGGMI+AFF     EM A I+++ L+F  L L+SI +NL QHY FAYMGE
Sbjct  679   GSLQPIYAITIGGMIAAFFVQDQNEMNAIIRRYALIFCSLSLVSIVVNLLQHYNFAYMGE  738

Query  1657  HLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASS  1478
             HL RRIR+++LEKILTFE AWFDEE NSSGALC+RLSNEA++VK+LVADR+SLL+Q AS 
Sbjct  739   HLVRRIRVQVLEKILTFEAAWFDEETNSSGALCSRLSNEASLVKTLVADRISLLLQTASG  798

Query  1477  VTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVY  1298
             + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ+ STQIA+EAVY
Sbjct  799   IIIAVTMGLMVAWKLALVMIAVQPSTMMCYYAKKMVLSNVSRDLAKAQHQSTQIAIEAVY  858

Query  1297  NHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGK  1118
             NHR+VTSFG  +KVL +F++AQ+EP K+A+KKSW+AGI  G +  L+F+ WALDFWYGGK
Sbjct  859   NHRMVTSFGCSSKVLQLFEHAQEEPLKKARKKSWVAGITTGLSPCLSFLSWALDFWYGGK  918

Query  1117  LVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPY  938
             L  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKGS AVAS+F +LDR SI  SP 
Sbjct  919   LAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGSNAVASVFEVLDRKSI--SPK  976

Query  937   NGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKS  758
             N +V+      +K+ G+IE KKV+FAYP+RPE  IL++F L+VKAG+S+GLVG+SG GKS
Sbjct  977   NSQVEKEDQK-KKIEGRIEFKKVDFAYPTRPECLILQDFSLDVKAGTSVGLVGRSGCGKS  1035

Query  757   TIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLD  578
             TI+ LI+RFYDVD G++R+DG+DVR  +I W+R   ALVSQEP ++SG++RDNI FGK +
Sbjct  1036  TIIGLIQRFYDVDRGAVRIDGMDVREMNILWFRGFTALVSQEPAMFSGSVRDNIAFGKPE  1095

Query  577   aseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLL  398
             A E+EI+EAAKAANAH+FIS+LK GYDT+CGE G+QLSGGQKQRIAIARAIIRNPTILLL
Sbjct  1096  ADEDEIVEAAKAANAHEFISTLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRNPTILLL  1155

Query  397   DEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQ  218
             DEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGKVVE G+Y Q
Sbjct  1156  DEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGKVVERGSYPQ  1215

Query  217   LKNKRG  200
             L NK+G
Sbjct  1216  LMNKKG  1221


 Score =   326 bits (835),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 199/528 (38%), Positives = 304/528 (58%), Gaps = 11/528 (2%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L L  +V+  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  708   IRRYALIFCSLSLVSIVVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  767

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        ++ 
Sbjct  768   GALCSRLSNEASLVKTLVADRISLLLQTASGIIIAVTMGLMVAWKLALVMIAVQPSTMMC  827

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  828   YYAKKMVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHAQEEPLKKA  887

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  888   RKKSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  947

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPK---IDGEDKSGMVLDTIRGELEFKNVKFAYP  2759
                     + S A + +F  +DR    PK   ++ ED+       I G +EFK V FAYP
Sbjct  948   GSMTSDLAKGSNAVASVFEVLDRKSISPKNSQVEKEDQK----KKIEGRIEFKKVDFAYP  1003

Query  2758  SRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQ  2579
             +RPE L+L+D +L V+AG +V LVG SG GKST I L+QRFYD + G++ IDG+++  + 
Sbjct  1004  TRPECLILQDFSLDVKAGTSVGLVGRSGCGKSTIIGLIQRFYDVDRGAVRIDGMDVREMN  1063

Query  2578  VKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYET  2399
             + W RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY+T
Sbjct  1064  ILWFRGFTALVSQEPAMFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISTLKDGYDT  1123

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               GE G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT
Sbjct  1124  DCGEHGIQLSGGQKQRIAIARAIIRNPTILLLDEATSALDAQSEQVVQEALDRIMSGRTT  1183

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             +VVAH+L+TI+N D IA +  G ++E+GS+ +LM K G +  +A LQ+
Sbjct  1184  IVVAHRLNTIKNVDSIAFLGEGKVVERGSYPQLMNKKGAFYNLATLQK  1231



>gb|EEC71408.1| hypothetical protein OsI_03576 [Oryza sativa Indica Group]
Length=1234

 Score =  1536 bits (3977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1212 (67%), Positives = 1000/1212 (83%), Gaps = 12/1212 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN---L  3647
             +F++AD +D+ LM LGTLGAIGDG STN LL++ S + N+LGY    +    +       
Sbjct  19    MFKFADRVDVLLMALGTLGAIGDGCSTNLLLIFASDVMNSLGYARAGAHGGAAAATGVDF  78

Query  3646  MREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQE  3467
             MREVEK  L FV L  AV+ + FMEGYCWS+TSERQVL+IRY YL+AILRQEVGFFDSQE
Sbjct  79    MREVEKSCLNFVYLAFAVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEVGFFDSQE  138

Query  3466  ATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVil  3287
             ATTSEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV++P +++L
Sbjct  139   ATTSEIINSISKDASLIQEVLSEKVPLFLMHSTVFISGLAFSTYFSWRLALVSFPLVLLL  198

Query  3286  iipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTI  3107
             IIPGLIYGKYLLYLS++S  EY+ AN +V QAL SIKT+YSFTAE+ I++RY+++LD+TI
Sbjct  199   IIPGLIYGKYLLYLSRQSRHEYTNANSLVEQALGSIKTVYSFTAEKRIIQRYTAVLDKTI  258

Query  3106  KLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
             KLG++ GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSLG
Sbjct  259   KLGIRQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSLG  318

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
             MALPE+K+FTEASVAA+RI  RI+RVP+I+ +D  G++LD +RGEL+F++V+F YPSRP 
Sbjct  319   MALPELKHFTEASVAATRILDRINRVPEINADDPKGLILDQVRGELQFESVRFVYPSRPN  378

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               VLKD NL++ AG+TVALVG+SGSGKSTAIAL+QRFYDA  G++ +DGV I  LQ+KW+
Sbjct  379   MTVLKDFNLQIPAGQTVALVGSSGSGKSTAIALVQRFYDATEGTVKVDGVNIKELQLKWI  438

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +MGLVSQ+HALFGTSI+ENI+ GK   +M+E+ AAAMTANAH+FIR LP+ YETK+GE
Sbjct  439   RSKMGLVSQDHALFGTSIKENILFGKPDATMDELYAAAMTANAHNFIRGLPEEYETKIGE  498

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RGALLSGGQKQRIAIARA+IKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVA
Sbjct  499   RGALLSGGQKQRIAIARAVIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVA  558

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQD--QSFAPS  2033
             HKLST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+    F  S
Sbjct  559   HKLSTVKNADQIAVVDGGTIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQEGGDQFRAS  618

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHH-HQPSPSFSRLLGLNLTEWKQGLIGS  1856
             S A R ST + S +  +  PL    +++  TD     P+PSFSRLL +N  EW+Q +IGS
Sbjct  619   SVA-RTSTSRLSMSRASPMPLTPGISKE--TDSSVSPPAPSFSRLLAMNAPEWRQAVIGS  675

Query  1855  ISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYC  1676
             +SA+ +G++QP YA+TIGGMI+AFF     EM A I ++ L+F  L ++SI +NL QHY 
Sbjct  676   LSALVYGSLQPIYAITIGGMIAAFFVQDLNEMNAIISRYALIFCSLSVISIVVNLLQHYN  735

Query  1675  FAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLL  1496
             FAYMGEHL RRIR+++LEKILTFE AWFDEE NSSG+LC+RLSNEA++VK+LVADR+SLL
Sbjct  736   FAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSSGSLCSRLSNEASLVKTLVADRISLL  795

Query  1495  VQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQI  1316
             +Q AS + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ+ STQI
Sbjct  796   LQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMICYYAKKIVLSNVSRDLAKAQHQSTQI  855

Query  1315  AVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALD  1136
             A+EAVYNHR+VTSFG  +KVL +F++ Q+EP K A+KKSW+AGI  G +  L+F+ WALD
Sbjct  856   AIEAVYNHRMVTSFGCSSKVLQLFEHTQEEPLKRARKKSWVAGITTGLSPCLSFLSWALD  915

Query  1135  FWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPS  956
             FWYGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR S
Sbjct  916   FWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKS  975

Query  955   IITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGK  776
             I  SP N +V+       K+ G+IE K+V+FAYP+RP+  IL++F L+VKAG+SIGLVG+
Sbjct  976   I--SPQNSQVEKDNQK-NKIQGRIEFKRVDFAYPTRPQCLILQDFSLDVKAGTSIGLVGR  1032

Query  775   SGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNI  596
             SG GKSTI+ LI+RFYDVD G+++VDG+DVR  DI WYR   ALVSQEP I+SG++RDNI
Sbjct  1033  SGCGKSTIIGLIQRFYDVDRGAVKVDGMDVREMDILWYRGFTALVSQEPAIFSGSVRDNI  1092

Query  595   LFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRN  416
              FGK +A E+EI+EAAKAANAH+FISSLK GY T+CGE G+QLSGGQKQRIAIARAIIRN
Sbjct  1093  AFGKPEADEDEIVEAAKAANAHEFISSLKDGYHTDCGEHGLQLSGGQKQRIAIARAIIRN  1152

Query  415   PTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVE  236
             P ILLLDEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGKVVE
Sbjct  1153  PAILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGKVVE  1212

Query  235   HGTYSQLKNKRG  200
              GTY  L +K+G
Sbjct  1213  RGTYPHLMSKKG  1224


 Score =   315 bits (808),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 192/525 (37%), Positives = 301/525 (57%), Gaps = 5/525 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L +  +V+  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  711   ISRYALIFCSLSVISIVVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  770

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        +I 
Sbjct  771   GSLCSRLSNEASLVKTLVADRISLLLQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMIC  830

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  831   YYAKKIVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHTQEEPLKRA  890

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  891   RKKSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  950

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
                     + + A + +F  +DR    P+    +K     + I+G +EFK V FAYP+RP
Sbjct  951   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNQK-NKIQGRIEFKRVDFAYPTRP  1009

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             + L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ +DG+++  + + W
Sbjct  1010  QCLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVKVDGMDVREMDILW  1069

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
              RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY T  G
Sbjct  1070  YRGFTALVSQEPAIFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYHTDCG  1129

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             E G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT+VV
Sbjct  1130  EHGLQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVV  1189

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             AH+L+TI+N D IA +  G ++E+G++  LM K G +  +A LQ+
Sbjct  1190  AHRLNTIKNVDSIAFLGEGKVVERGTYPHLMSKKGAFYNLAALQK  1234



>ref|NP_001044110.1| Os01g0723800 [Oryza sativa Japonica Group]
 emb|CAD59577.1| MDR-like ABC transporter [Oryza sativa Japonica Group]
 dbj|BAD87059.1| MDR-like p-glycoprotein-like [Oryza sativa Japonica Group]
 dbj|BAF06024.1| Os01g0723800 [Oryza sativa Japonica Group]
 gb|EEE55316.1| hypothetical protein OsJ_03309 [Oryza sativa Japonica Group]
Length=1234

 Score =  1536 bits (3976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/1212 (67%), Positives = 1001/1212 (83%), Gaps = 12/1212 (1%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN---L  3647
             +F++AD +D+ LM LGTLGAIGDG STN LL++ S + N+LGY    +    +       
Sbjct  19    MFKFADRVDVLLMALGTLGAIGDGCSTNLLLIFASDVMNSLGYARAGAHGGAAAATGVDF  78

Query  3646  MREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQE  3467
             MREVEK  L FV L  AV+ + FMEGYCWS+TSERQVL+IRY YL+AILRQEVGFFDSQE
Sbjct  79    MREVEKSCLNFVYLAFAVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEVGFFDSQE  138

Query  3466  ATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVil  3287
             ATTSEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV++P +++L
Sbjct  139   ATTSEIINSISKDASLIQEVLSEKVPLFLMHSTVFISGLAFSTYFSWRLALVSFPLVLLL  198

Query  3286  iipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTI  3107
             IIPGLIYGKYLLYLS++S  EY+ AN +V QAL SIKT+YSFTAE+ I++RY+++LD+TI
Sbjct  199   IIPGLIYGKYLLYLSRQSRHEYTNANSLVEQALGSIKTVYSFTAEKRIIQRYTAVLDKTI  258

Query  3106  KLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
             KLG++ GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSLG
Sbjct  259   KLGIRQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSLG  318

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
             MALPE+K+FTEASVAA+RI  RI+RVP+I+ +D  G++LD +RGEL+F++V+F YPSRP 
Sbjct  319   MALPELKHFTEASVAATRILDRINRVPEINADDPKGLILDQVRGELQFESVRFVYPSRPN  378

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               VLKD NL++ AG+TVALVG+SGSGKSTAIAL+QRFYDA  G++ +DGV I  LQ+KW+
Sbjct  379   MTVLKDFNLQIPAGQTVALVGSSGSGKSTAIALVQRFYDATEGTVKVDGVNIKELQLKWI  438

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R +MGLVSQ+HALFGTSI+ENI+ GK   +M+E+ AAAMTANAH+FIR LP+ YETK+GE
Sbjct  439   RSKMGLVSQDHALFGTSIKENILFGKPDATMDELYAAAMTANAHNFIRGLPEEYETKIGE  498

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RGALLSGGQKQRIAIARA+IKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVA
Sbjct  499   RGALLSGGQKQRIAIARAVIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVA  558

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQD--QSFAPS  2033
             HKLST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+    F  S
Sbjct  559   HKLSTVKNADQIAVVDGGTIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQEGGDQFRAS  618

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHH-HQPSPSFSRLLGLNLTEWKQGLIGS  1856
             S A R ST + S +  +  PL    +++  TD     P+PSFSRLL +N  EW+Q +IGS
Sbjct  619   SVA-RTSTSRLSMSRASPMPLTPGISKE--TDSSVSPPAPSFSRLLAMNAPEWRQAVIGS  675

Query  1855  ISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYC  1676
             +SA+ +G++QP YA+TIGGMI+AFF    +EM A I ++ L+F  L ++SI +NL QHY 
Sbjct  676   LSALVYGSLQPIYAITIGGMIAAFFVQDLKEMNAIISRYALIFCSLSVISIVVNLLQHYN  735

Query  1675  FAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLL  1496
             FAYMGEHL RRIR+++LEKILTFE AWFDEE NSSG+LC+RLSNEA++VK+LVADR+SLL
Sbjct  736   FAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSSGSLCSRLSNEASLVKTLVADRISLL  795

Query  1495  VQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQI  1316
             +Q AS + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ+ STQI
Sbjct  796   LQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMICYYAKKIVLSNVSRDLAKAQHQSTQI  855

Query  1315  AVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALD  1136
             A+EAVYNHR+VTSFG  +KVL +F++ Q+EP K A+KKSW+AGI  G +  L+F+ WALD
Sbjct  856   AIEAVYNHRMVTSFGCSSKVLQLFEHTQEEPLKRARKKSWVAGITTGLSPCLSFLSWALD  915

Query  1135  FWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPS  956
             FWYGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR S
Sbjct  916   FWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKS  975

Query  955   IITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGK  776
             I  SP N +V+       K+ G+IE K+V+FAYP+RP+  IL++F L+VKAG+SIGLVG+
Sbjct  976   I--SPQNSQVEKDNQK-NKIQGRIEFKRVDFAYPTRPQCLILQDFSLDVKAGTSIGLVGR  1032

Query  775   SGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNI  596
             SG GKSTI+ LI+RFYDVD G+++VDG+DVR  DI WYR   ALVSQEP I+SG++RDNI
Sbjct  1033  SGCGKSTIIGLIQRFYDVDRGAVKVDGMDVREMDILWYRGFTALVSQEPAIFSGSVRDNI  1092

Query  595   LFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRN  416
              FGK +A E+EI+EAAKAANAH+FISSLK GY T+CGE G+QLSGGQKQRIAIARAIIRN
Sbjct  1093  AFGKPEADEDEIVEAAKAANAHEFISSLKDGYHTDCGEHGLQLSGGQKQRIAIARAIIRN  1152

Query  415   PTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVE  236
             P ILLLDEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGKVVE
Sbjct  1153  PAILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGKVVE  1212

Query  235   HGTYSQLKNKRG  200
              GTY  L +K+G
Sbjct  1213  RGTYPHLMSKKG  1224


 Score =   315 bits (808),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 192/525 (37%), Positives = 301/525 (57%), Gaps = 5/525 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L +  +V+  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  711   ISRYALIFCSLSVISIVVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  770

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        +I 
Sbjct  771   GSLCSRLSNEASLVKTLVADRISLLLQTASGIIIAVTMGLIVAWKLALVMIAVQPTTMIC  830

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  831   YYAKKIVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHTQEEPLKRA  890

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  891   RKKSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  950

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
                     + + A + +F  +DR    P+    +K     + I+G +EFK V FAYP+RP
Sbjct  951   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNQK-NKIQGRIEFKRVDFAYPTRP  1009

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             + L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ +DG+++  + + W
Sbjct  1010  QCLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVKVDGMDVREMDILW  1069

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
              RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY T  G
Sbjct  1070  YRGFTALVSQEPAIFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYHTDCG  1129

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             E G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT+VV
Sbjct  1130  EHGLQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVV  1189

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             AH+L+TI+N D IA +  G ++E+G++  LM K G +  +A LQ+
Sbjct  1190  AHRLNTIKNVDSIAFLGEGKVVERGTYPHLMSKKGAFYNLAALQK  1234



>ref|XP_003569704.1| PREDICTED: putative ABC transporter B family member 8 [Brachypodium 
distachyon]
Length=1233

 Score =  1532 bits (3966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1206 (67%), Positives = 993/1206 (82%), Gaps = 4/1206 (0%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F++AD +DI LM LGTLGAIGDG STN LL++ S + N+LG G    Q+  +  + M +
Sbjct  22    LFKFADRVDILLMVLGTLGAIGDGCSTNLLLIFASDVMNSLGRGHAQQQASATTVHFMHD  81

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             VEK  L FV L  AV+ +  MEGYCWS+TSERQVL+IR+ YL+AILRQEV FFDSQEATT
Sbjct  82    VEKSCLNFVYLAFAVLAVASMEGYCWSRTSERQVLRIRHLYLQAILRQEVAFFDSQEATT  141

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV+YP +++LIIP
Sbjct  142   SEIINSISKDASLIQEVLSEKVPLFLMHSTVFVSGLAFSTYFSWRLALVSYPLVLLLIIP  201

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGKYLLYLS++S  EY+KAN +V QAL SIKT+YSFTAE+ I++RY+SILD+TI LG
Sbjct  202   GLIYGKYLLYLSRQSRHEYAKANSLVEQALGSIKTVYSFTAEKGIIQRYTSILDKTINLG  261

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSLGMAL
Sbjct  262   IKQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSLGMAL  321

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             PE+K+F EASVAA+RI  RI+RVP+I+ +D  G+VL+ +RGELEF++V+F YPSRP   V
Sbjct  322   PELKHFIEASVAATRILERINRVPQINDDDPKGLVLEQVRGELEFESVRFVYPSRPNMTV  381

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LKD NL++ AG+T+ALVG+SGSGKSTAIAL+QRFYDA+ G++ +DGV+I  L++KW+R +
Sbjct  382   LKDFNLQISAGQTIALVGSSGSGKSTAIALVQRFYDASEGTVKVDGVDIKKLKLKWIRSK  441

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQ+HALFGTSIRENI+ GK   +M+E+ AA+MTANAH+FIR LP+ YETK+GERGA
Sbjct  442   MGLVSQDHALFGTSIRENILFGKPDATMDELYAASMTANAHNFIRGLPEEYETKIGERGA  501

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
             LLSGGQKQRIAIARA+IKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVAHKL
Sbjct  502   LLSGGQKQRIAIARAVIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVAHKL  561

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSSNAGR  2018
             ST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+     +S+A R
Sbjct  562   STVKNADQIAVVDGGTIAEIGTHDELISKGGPYSRLVKLQKMVSYIDQESDQFRASSAAR  621

Query  2017  QSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAF  1838
              ST   S +  +  PL    +++  +     P+PSFSRLL +N  EWKQ LIGS+SA+ +
Sbjct  622   TSTSHLSMSRASPMPLTPGVSKETESS-VSPPAPSFSRLLAMNAPEWKQALIGSLSALVY  680

Query  1837  GAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGE  1658
             G++QP YAL+IGGMI+AFF     EM A I ++ L+F  L ++SI +NL QHY FAYMGE
Sbjct  681   GSLQPIYALSIGGMIAAFFVQDQNEMNAIISRYALIFCSLSMISIAVNLLQHYNFAYMGE  740

Query  1657  HLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASS  1478
             HL RRIR+++LEKILTFE AWFDEE NSS +LC+RLS+EA++VK+LVADR+SLL+Q A  
Sbjct  741   HLVRRIRVQVLEKILTFEAAWFDEETNSSASLCSRLSDEASLVKTLVADRISLLLQTACG  800

Query  1477  VTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVY  1298
             + IA+ MGLVVAWKLALVMIA+QP T++C+Y +K++LS ++    KAQ+ STQIA+EAVY
Sbjct  801   IVIAVTMGLVVAWKLALVMIAIQPSTMICYYAKKIVLSNVSRDLAKAQHQSTQIAIEAVY  860

Query  1297  NHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGK  1118
             NHR+VTSFG  +K+L +F+  Q+EP ++A+K SW+AGI  G +  L+F+ WALDFWYGGK
Sbjct  861   NHRMVTSFGCSSKILQLFEQTQEEPLRKARKMSWVAGITTGLSPCLSFLSWALDFWYGGK  920

Query  1117  LVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPY  938
             L  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR SI  SP 
Sbjct  921   LAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKSI--SPQ  978

Query  937   NGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKS  758
             N +V+       K+ G+IE K+V+FAYP+RP+  IL++F L++KAG+SIGLVG+SG GKS
Sbjct  979   NSQVEKDNPK-SKIQGRIEFKRVDFAYPTRPQCLILQDFSLDIKAGTSIGLVGRSGCGKS  1037

Query  757   TIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLD  578
             TI+ L +RFYDVD G+++VDG+DVR  +I WYR   ALVSQEP I+SG++RDNI FGK +
Sbjct  1038  TIIGLTQRFYDVDRGAVKVDGMDVREMNILWYRGFTALVSQEPAIFSGSVRDNIAFGKPE  1097

Query  577   aseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLL  398
             A E EI EAAKAANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAIIR+P ILLL
Sbjct  1098  ADEEEIFEAAKAANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRDPAILLL  1157

Query  397   DEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQ  218
             DEATSALD ESEQVVQEALD IM GRTT+VVAHRLNTIKN DSIA + EGKVVE GTY Q
Sbjct  1158  DEATSALDAESEQVVQEALDRIMSGRTTIVVAHRLNTIKNADSIAFLGEGKVVERGTYPQ  1217

Query  217   LKNKRG  200
             L NK+G
Sbjct  1218  LMNKKG  1223


 Score =   314 bits (804),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 188/524 (36%), Positives = 301/524 (57%), Gaps = 3/524 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L +  + +  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  710   ISRYALIFCSLSMISIAVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  769

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             + + + +S + SL++ ++++++ + L      +  +      +W+L+LV        +I 
Sbjct  770   ASLCSRLSDEASLVKTLVADRISLLLQTACGIVIAVTMGLVVAWKLALVMIAIQPSTMIC  829

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     IL+ +    +  ++  
Sbjct  830   YYAKKIVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKILQLFEQTQEEPLRKA  889

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K+    G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  890   RKMSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  949

Query  2920  LPEVKYFTEASVAASRIFSRIDR--VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                     + + A + +F  +DR  +   + + +       I+G +EFK V FAYP+RP+
Sbjct  950   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNPKSKIQGRIEFKRVDFAYPTRPQ  1009

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+D +L ++AG ++ LVG SG GKST I L QRFYD + G++ +DG+++  + + W 
Sbjct  1010  CLILQDFSLDIKAGTSIGLVGRSGCGKSTIIGLTQRFYDVDRGAVKVDGMDVREMNILWY  1069

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             RG   LVSQE A+F  S+R+NI  GK     EE+  AA  ANAH+FI  L  GY+T  GE
Sbjct  1070  RGFTALVSQEPAIFSGSVRDNIAFGKPEADEEEIFEAAKAANAHEFISSLKDGYDTDCGE  1129

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
              G  LSGGQKQRIAIARAII++P ILLLDEATSALD+ESE++VQ+ALD+  +GRTT+VVA
Sbjct  1130  HGIQLSGGQKQRIAIARAIIRDPAILLLDEATSALDAESEQVVQEALDRIMSGRTTIVVA  1189

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             H+L+TI+NAD IA +  G ++E+G++ +LM K G +  +A LQ+
Sbjct  1190  HRLNTIKNADSIAFLGEGKVVERGTYPQLMNKKGAFYNLATLQK  1233



>ref|XP_002458424.1| hypothetical protein SORBIDRAFT_03g033290 [Sorghum bicolor]
 gb|EES03544.1| hypothetical protein SORBIDRAFT_03g033290 [Sorghum bicolor]
Length=1235

 Score =  1528 bits (3957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/1215 (67%), Positives = 998/1215 (82%), Gaps = 13/1215 (1%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqi-sng  3653
             SI  +F++AD +D+ LM LGTLGAIGDG STN LL++ S + N LGYG   +      + 
Sbjct  19    SIRGMFQFADRVDVLLMALGTLGAIGDGCSTNLLLIFASDVMNALGYGGARASGGGAKSA  78

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M EVEK  L FV L   V+ + FMEGYCWS+TSERQVL+IRY YL+AILRQE GFFDS
Sbjct  79    QFMHEVEKSCLNFVYLAFVVLAVAFMEGYCWSRTSERQVLRIRYLYLQAILRQEAGFFDS  138

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QEATTSEI NSISKD S IQEVLSEKVP+FLMH++VF+SGL F+TYF WRL+LV++P ++
Sbjct  139   QEATTSEIINSISKDASHIQEVLSEKVPLFLMHSTVFVSGLVFATYFCWRLALVSFPLVL  198

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLLYLS++S  EYSKAN +V QAL SIKT+YSFTAE+ I++RY++ILD+
Sbjct  199   LLIIPGLIYGKYLLYLSRQSRHEYSKANSLVEQALGSIKTVYSFTAEKRIIQRYTAILDK  258

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             TIKLG+K GIAKGLAVG TGLSFAIWAFLAWYG RL+M    SGGRIYAAGIS+VLGGLS
Sbjct  259   TIKLGIKQGIAKGLAVGFTGLSFAIWAFLAWYGGRLVMFHHVSGGRIYAAGISFVLGGLS  318

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LGMALPE+K+FTEASVAA+RI  RI+RVP+I+ +D  G++LD IRGELEF++V F YPSR
Sbjct  319   LGMALPELKHFTEASVAATRILDRINRVPQINADDPKGLILDQIRGELEFESVHFVYPSR  378

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P   VLK+ NL++ AG+T+ALVG+SGSGKSTAIAL+QRFYDAN G++ IDG +I  LQ+K
Sbjct  379   PNMPVLKNFNLQIPAGQTIALVGSSGSGKSTAIALVQRFYDANEGTVKIDGFDIKELQLK  438

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R +MGLVSQ+HALFGTSI+ENI+ GK   +M+EV AAAMTANAH+FIR LP+ YETK+
Sbjct  439   WIRSKMGLVSQDHALFGTSIKENILFGKPDATMDEVYAAAMTANAHNFIRGLPEEYETKI  498

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGALLSGGQKQRIAIARAIIKNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLV
Sbjct  499   GERGALLSGGQKQRIAIARAIIKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLV  558

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             VAHKLST++NAD IAVV GG I E G+H EL+ + G Y+++ KLQ+  S  DQ+     +
Sbjct  559   VAHKLSTVKNADQIAVVDGGTIAEIGTHDELISRGGPYSRLVKLQKMVSYIDQENEQFRA  618

Query  2032  SNAGRQSTEKsspavlassplLI----ETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGL  1865
             S+  R ST + S +  +  PL      E    VP      P+PSFSRLL +N  EW+Q +
Sbjct  619   SSVARTSTSRHSMSRASPMPLTPAILKENNSDVPP-----PAPSFSRLLAMNSPEWRQAV  673

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
             +GS+SA+ +G++QP YA+TIGGMI+AFF     EM A I+++ L+F  L L+SI +NL Q
Sbjct  674   VGSLSALVYGSLQPIYAITIGGMIAAFFVQDQNEMNAIIRRYALIFCSLSLVSIVVNLLQ  733

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FAYMGEHL RRIR+++LEKILTFE AWFDEE NSSGALC+RLSNEA++VK+LVADR+
Sbjct  734   HYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSSGALCSRLSNEASLVKTLVADRI  793

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SLL+Q AS + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ+ S
Sbjct  794   SLLLQTASGIIIAVTMGLMVAWKLALVMIAVQPSTMICYYAKKMVLSNVSRDLAKAQHQS  853

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             TQIA+EAVYNHR+VTSFG  +KVL +F++AQ+EP K+A+KKSW+AGI  G +  L+F+ W
Sbjct  854   TQIAIEAVYNHRMVTSFGCSSKVLQLFEHAQEEPLKKARKKSWVAGITTGLSPCLSFLSW  913

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             ALDFWYGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LD
Sbjct  914   ALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLD  973

Query  964   RPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
             R SI  SP N +V+      +K+ G+IE KKV+FAYP+RPE  IL++F L+VKAG+S+GL
Sbjct  974   RKSI--SPKNSQVEKEDQK-KKIEGRIEFKKVDFAYPTRPECLILQDFSLDVKAGTSVGL  1030

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG+SG GKSTI+ LI+RFYDVD GS+R+DG+DVR  +I W+R   ALVSQEP ++SG++R
Sbjct  1031  VGRSGCGKSTIIGLIQRFYDVDRGSVRIDGMDVREMNILWFRGFTALVSQEPAMFSGSVR  1090

Query  604   DNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiarai  425
             DNI FGK +A E+EI+EAAKAANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAI
Sbjct  1091  DNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAI  1150

Query  424   iRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGK  245
             IRNP ILLLDEATSALD +SEQVVQEALD IM GRTT+VVAHRLNTIKN+DSIA + EGK
Sbjct  1151  IRNPAILLLDEATSALDAQSEQVVQEALDRIMSGRTTIVVAHRLNTIKNVDSIAFLGEGK  1210

Query  244   VVEHGTYSQLKNKRG  200
             VVE G+Y QL NK+G
Sbjct  1211  VVERGSYPQLMNKKG  1225


 Score =   326 bits (835),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 200/528 (38%), Positives = 304/528 (58%), Gaps = 11/528 (2%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L L  +V+  ++ Y ++   E  V +IR + LE IL  E  +FD +  ++
Sbjct  712   IRRYALIFCSLSLVSIVVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEETNSS  771

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S + SL++ ++++++ + L   S  +  +      +W+L+LV        +I 
Sbjct  772   GALCSRLSNEASLVKTLVADRISLLLQTASGIIIAVTMGLMVAWKLALVMIAVQPSTMIC  831

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     +L+ +    +  +K  
Sbjct  832   YYAKKMVLSNVSRDLAKAQHQSTQIAIEAVYNHRMVTSFGCSSKVLQLFEHAQEEPLKKA  891

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  LSF  WA   WYG +L      S G ++      V  G  +  A
Sbjct  892   RKKSWVAGITTGLSPCLSFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  951

Query  2920  LPEVKYFTEASVAASRIFSRIDR---VPK---IDGEDKSGMVLDTIRGELEFKNVKFAYP  2759
                     + + A + +F  +DR    PK   ++ ED+       I G +EFK V FAYP
Sbjct  952   GSMTSDLAKGANAVASVFEVLDRKSISPKNSQVEKEDQK----KKIEGRIEFKKVDFAYP  1007

Query  2758  SRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQ  2579
             +RPE L+L+D +L V+AG +V LVG SG GKST I L+QRFYD + GS+ IDG+++  + 
Sbjct  1008  TRPECLILQDFSLDVKAGTSVGLVGRSGCGKSTIIGLIQRFYDVDRGSVRIDGMDVREMN  1067

Query  2578  VKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYET  2399
             + W RG   LVSQE A+F  S+R+NI  GK     +E+V AA  ANAH+FI  L  GY+T
Sbjct  1068  ILWFRGFTALVSQEPAMFSGSVRDNIAFGKPEADEDEIVEAAKAANAHEFISSLKDGYDT  1127

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               GE G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+  +GRTT
Sbjct  1128  DCGEHGIQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMSGRTT  1187

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             +VVAH+L+TI+N D IA +  G ++E+GS+ +LM K G +  +A LQ+
Sbjct  1188  IVVAHRLNTIKNVDSIAFLGEGKVVERGSYPQLMNKKGAFYNLATLQK  1235



>ref|XP_010535953.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535954.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535955.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010535956.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X1 [Tarenaya hassleriana]
Length=1238

 Score =  1528 bits (3956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 821/1216 (68%), Positives = 1002/1216 (82%), Gaps = 15/1216 (1%)
 Frame = -2

Query  3826  IIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNL  3647
             I +IFR+AD +DI LM LGT+GAIGDGMSTN LL++ S + N+LGYG +N          
Sbjct  18    ISLIFRFADRVDIVLMFLGTIGAIGDGMSTNVLLVFASRIMNSLGYGQHNPHEIN----F  73

Query  3646  MREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQE  3467
             M EVEKCSLYFV LGLAV+ + FMEGYCWSKTSERQV+KIR  YLEA+LRQEV FFDSQE
Sbjct  74    MNEVEKCSLYFVYLGLAVLAVAFMEGYCWSKTSERQVMKIRRTYLEAVLRQEVSFFDSQE  133

Query  3466  ATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVil  3287
             A+ SEI +SIS DTSLIQ+VLSEKVP F MH SVF +GL FS YFSWRL+LVA P++++L
Sbjct  134   ASISEIISSISNDTSLIQQVLSEKVPTFCMHASVFFTGLAFSAYFSWRLTLVAIPSLLLL  193

Query  3286  iipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTI  3107
             IIPG+ YGKYL+YLSKKSFKEY+KAN +V QALSSIKTIYSFTAE+ +++ YS +L++T 
Sbjct  194   IIPGMTYGKYLVYLSKKSFKEYAKANSVVEQALSSIKTIYSFTAEKRVIKNYSDMLEKTT  253

Query  3106  KLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
             KLG+K G AKGLAVGSTGLSFAIWAFLAWYGSRL+M+   SGGR+YAAGIS+VL GLSLG
Sbjct  254   KLGIKQGQAKGLAVGSTGLSFAIWAFLAWYGSRLVMYHEASGGRVYAAGISFVLSGLSLG  313

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLD-TIRGELEFKNVKFAYPSR  2753
             M LPEVKYFTEASVA +RIF RIDR P+IDGED + G +++  ++G +EF++V F YPSR
Sbjct  314   MTLPEVKYFTEASVAVARIFERIDRKPEIDGEDTTKGFIINKNMKGVIEFEHVTFWYPSR  373

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S++LKD +L++EAGKTVALVGASGSGKSTA+AL+QRFYD   GS+ IDG +I  LQ+K
Sbjct  374   PDSIILKDFSLRIEAGKTVALVGASGSGKSTAVALVQRFYDPIQGSVRIDGFDIKTLQLK  433

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             W+R QM LVSQEHALFGTSIRENI  GK   +M+EV++AA  ANAH FI QLP+GYETK+
Sbjct  434   WMRHQMALVSQEHALFGTSIRENITFGKHDATMDEVISAAKAANAHGFITQLPEGYETKI  493

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERGA LSGGQKQRIAIARAII+NPVILLLDEATSALD ESE LVQ+ALDQAS GRTTLV
Sbjct  494   GERGAFLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLVQNALDQASMGRTTLV  553

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFS-CADQDQSFAP  2036
             +AHKLST+  AD IAV+  G I+E G+H ELM +NG YA++A+ QRQFS C  QD +  P
Sbjct  554   IAHKLSTVHGADHIAVLEDGSILEMGNHEELMIQNGKYAKLARFQRQFSVCEHQDMARTP  613

Query  2035  SSNAGRQSTEKsspavlassplLIETA--QKVPTDHHHQPSPSFSRLLGLNLTEWKQGLI  1862
             + N+  + + +SSP    S  + +E+   + + +   H+PSPSFSRLL L   +WK  + 
Sbjct  614   ARNSFSRLSVRSSPGWFDSPLIPLESTNVEILASPSLHRPSPSFSRLLPLISPDWKPAIT  673

Query  1861  GSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQH  1682
             G +SA  FGAVQP YALTIGGMISAFF+ + +EMQ RI+ +CL+F+ L ++SI LNL QH
Sbjct  674   GCLSAATFGAVQPVYALTIGGMISAFFAKNPQEMQDRIRTYCLIFSSLTVVSIVLNLLQH  733

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             Y FA +GE LT+R+RLRMLEKIL+FE AWFD E NSSGALC+RLS EA+ VKSL++DR+S
Sbjct  734   YSFAKVGERLTQRLRLRMLEKILSFEPAWFDSEENSSGALCSRLSGEASSVKSLLSDRVS  793

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
             LLVQ  S VTIAM++GL+VAWKLALVMIAVQP+TILCFYT+KVLLS I+  F  AQN S+
Sbjct  794   LLVQTISGVTIAMIIGLIVAWKLALVMIAVQPITILCFYTKKVLLSNISHNFTSAQNRSS  853

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
             QIA EA+YNH+IVTSFGS  K++ IFD AQ+E +++ +K +WLAGIG+GSAQ LTFM WA
Sbjct  854   QIASEAIYNHKIVTSFGSTRKIVQIFDKAQEEAKRKGEKATWLAGIGMGSAQCLTFMTWA  913

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
             LDFWYGG LV  G IS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAAVAS+F ILDR
Sbjct  914   LDFWYGGVLVQKGHISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAVASVFQILDR  973

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
             PS        + +N GT LE ++G+IE K+V+F+YP+RP+ P+LR+F L+VK G+S+GLV
Sbjct  974   PSSQVK----EDENSGTKLETITGRIEFKQVDFSYPTRPQIPVLRQFSLDVKPGTSMGLV  1029

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             GKSG GKST++ LI+RFYD + GS+R+DGVD+R  ++ WYR+  A+VSQEPV+YSG+IR+
Sbjct  1030  GKSGCGKSTVIGLIQRFYDAEKGSVRIDGVDLREMNVHWYRKHTAVVSQEPVVYSGSIRE  1089

Query  601   NILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraii  422
             NIL G+ +ASE+E+ EAAKAANAH+FIS LKKGYDTECGERGVQLSGGQKQR+AIARA++
Sbjct  1090  NILLGRPEASEDEVAEAAKAANAHKFISELKKGYDTECGERGVQLSGGQKQRVAIARAVL  1149

Query  421   RNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLDSIALVSEG  248
             R+P ILLLDEATSALDVESE+ VQEALD IM  R  T + VAHRLNT+KNLD IA+V++G
Sbjct  1150  RDPKILLLDEATSALDVESERAVQEALDRIMARRSITVVAVAHRLNTLKNLDRIAVVADG  1209

Query  247   KVVEHGTYSQLKNKRG  200
             KVVE G+Y++LKN  G
Sbjct  1210  KVVETGSYARLKNTGG  1225


 Score =   308 bits (789),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 301/519 (58%), Gaps = 4/519 (1%)
 Frame = -2

Query  3622  LYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITN  3443
             L F  L +  +V+  ++ Y ++K  ER   ++R + LE IL  E  +FDS+E ++  + +
Sbjct  716   LIFSSLTVVSIVLNLLQHYSFAKVGERLTQRLRLRMLEKILSFEPAWFDSEENSSGALCS  775

Query  3442  SISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliyg  3263
              +S + S ++ +LS++V + +   S     +      +W+L+LV      I I+      
Sbjct  776   RLSGEASSVKSLLSDRVSLLVQTISGVTIAMIIGLIVAWKLALVMIAVQPITILCFYTKK  835

Query  3262  kyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGI  3083
               L  +S       ++++ I  +A+ + K + SF + R I++ +    +   + G K   
Sbjct  836   VLLSNISHNFTSAQNRSSQIASEAIYNHKIVTSFGSTRKIVQIFDKAQEEAKRKGEKATW  895

Query  3082  AKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVK  2906
               G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  +  A     
Sbjct  896   LAGIGMGSAQCLTFMTWALDFWYGGVLVQKGHISAGDVFKTFFVLVSTGKVIAEAGSMTS  955

Query  2905  YFTEASVAASRIFSRIDRVP-KIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKD  2729
                + S A + +F  +DR   ++  ++ SG  L+TI G +EFK V F+YP+RP+  VL+ 
Sbjct  956   DLAKGSAAVASVFQILDRPSSQVKEDENSGTKLETITGRIEFKQVDFSYPTRPQIPVLRQ  1015

Query  2728  LNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGL  2549
              +L V+ G ++ LVG SG GKST I L+QRFYDA  GS+ IDGV++  + V W R    +
Sbjct  1016  FSLDVKPGTSMGLVGKSGCGKSTVIGLIQRFYDAEKGSVRIDGVDLREMNVHWYRKHTAV  1075

Query  2548  VSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLS  2369
             VSQE  ++  SIRENI+LG+   S +EV  AA  ANAH FI +L +GY+T+ GERG  LS
Sbjct  1076  VSQEPVVYSGSIRENILLGRPEASEDEVAEAAKAANAHKFISELKKGYDTECGERGVQLS  1135

Query  2368  GGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKLS  2195
             GGQKQR+AIARA++++P ILLLDEATSALD ESE+ VQ+ALD+  A R  T + VAH+L+
Sbjct  1136  GGQKQRVAIARAVLRDPKILLLDEATSALDVESERAVQEALDRIMARRSITVVAVAHRLN  1195

Query  2194  TIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             T++N D IAVV+ G ++E GS++ L    G ++++   Q
Sbjct  1196  TLKNLDRIAVVADGKVVETGSYARLKNTGGEFSRLVHAQ  1234



>dbj|BAJ97242.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1232

 Score =  1526 bits (3950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/1210 (67%), Positives = 1002/1210 (83%), Gaps = 4/1210 (0%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +F++AD +D+ LM LGTLGAIGDG STN LL++ S + N+LG G    Q   ++ +
Sbjct  17    SIRGLFKFADRVDVVLMALGTLGAIGDGCSTNLLLIFASDVMNSLGRGHAQQQGSATSAH  76

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M ++EK  L FV L  A++V+  MEGYCWS+TSERQVL+IR+ YLEAILRQEV FFDSQ
Sbjct  77    FMHDIEKSCLNFVYLAFAILVVASMEGYCWSRTSERQVLRIRHLYLEAILRQEVAFFDSQ  136

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV+YP +++
Sbjct  137   EATTSEIINSISKDASLIQEVLSEKVPLFLMHSTVFVSGLAFSTYFSWRLALVSYPLVLL  196

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGLIYGKYLLYLS++S +EY+KAN +V QAL SIKT+YSFTAE+ I++RY++ILD+T
Sbjct  197   LIIPGLIYGKYLLYLSRESRREYAKANSLVEQALGSIKTVYSFTAEKGIIQRYTAILDKT  256

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             I LG+K GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSL
Sbjct  257   INLGIKQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSL  316

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALPE+K+F EASVAA+RI  RI+RVP+I+ +D  G+VLD +RGE+EF++++F YPSRP
Sbjct  317   GMALPELKHFIEASVAATRILERINRVPQINDDDPKGLVLDQVRGEIEFESIRFVYPSRP  376

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
                VLKD NL++ AG+T+ALVG+SGSGKSTAIAL+QRFYDA+ G++ +DG++I  L +K 
Sbjct  377   NMTVLKDFNLQIPAGQTIALVGSSGSGKSTAIALVQRFYDASEGTVKVDGIDIKKLNLKS  436

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R +MGLVSQ+HALFGTSI+ENI+ GK   +M+E+ AAAMTANAH+FI  LP+GYETK+G
Sbjct  437   IRSKMGLVSQDHALFGTSIKENILFGKPDATMDELYAAAMTANAHNFIMGLPEGYETKIG  496

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARA++KNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVV
Sbjct  497   ERGALLSGGQKQRIAIARAVLKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVV  556

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSS  2030
             AHKLST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+     +S
Sbjct  557   AHKLSTVKNADQIAVVDGGRIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQETDQFRAS  616

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSIS  1850
             +A R S  + S +  +  PL    +++  + +   P+PSFSRLL +N  EWKQ LIGSIS
Sbjct  617   SAARTSASRLSMSRASPMPLTPGFSKETES-YVSPPAPSFSRLLAMNAPEWKQALIGSIS  675

Query  1849  AIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFA  1670
             A+ +G++QPTYALTIGGMI+AFF   H EM A I ++ L+F  L L+SI +NL QHY FA
Sbjct  676   ALVYGSLQPTYALTIGGMIAAFFVQDHNEMNAIISRYALIFCSLSLVSIAVNLLQHYNFA  735

Query  1669  YMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQ  1490
             YMGEHL RRIR+++LEKILTFE AWFDE+ NSSG+LC+RLS+E+++VK+LVADR+SLL+Q
Sbjct  736   YMGEHLVRRIRVQVLEKILTFEAAWFDEDTNSSGSLCSRLSDESSLVKTLVADRISLLLQ  795

Query  1489  AASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAV  1310
              A  + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ  STQIA+
Sbjct  796   TACGIVIAVTMGLIVAWKLALVMIAVQPCTMICYYAKKIVLSNVSRDLAKAQYESTQIAI  855

Query  1309  EAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFW  1130
             EAVYNHR+VTSFG  +K+L +F++ Q+EP ++A+KKSW+AGI  G +  LTF+ WALDFW
Sbjct  856   EAVYNHRMVTSFGCSSKILQLFEHTQEEPLRKARKKSWVAGITTGLSPCLTFLSWALDFW  915

Query  1129  YGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSII  950
             YGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR SI 
Sbjct  916   YGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKSI-  974

Query  949   TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSG  770
              SP N +V+       K+ G+IE KKV+F+YP+RP+  IL++F L+VKAG+SIGLVG+SG
Sbjct  975   -SPQNSQVEKDNPK-SKIQGRIEFKKVDFSYPTRPQCLILQDFSLDVKAGTSIGLVGRSG  1032

Query  769   SGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILF  590
              GKSTI+ LI+RFYDVD G++R+DGVDVR  ++ WYR   ALVSQEP ++SG++RDNI F
Sbjct  1033  CGKSTIIGLIQRFYDVDRGAVRIDGVDVREMNVLWYRGFTALVSQEPAMFSGSVRDNIAF  1092

Query  589   GKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPT  410
             GK +A E EI+EAAKAANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAIIRNP 
Sbjct  1093  GKPEADEEEIVEAAKAANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRNPA  1152

Query  409   ILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHG  230
             ILLLDEATSALD +SEQVVQEALD IM GRTT++VAHRLNTIKN DSIA + EGKV+E G
Sbjct  1153  ILLLDEATSALDAQSEQVVQEALDRIMTGRTTIIVAHRLNTIKNADSIAFLGEGKVIERG  1212

Query  229   TYSQLKNKRG  200
             TY QL NK+G
Sbjct  1213  TYPQLMNKKG  1222


 Score =   317 bits (811),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 192/524 (37%), Positives = 300/524 (57%), Gaps = 3/524 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L L  + +  ++ Y ++   E  V +IR + LE IL  E  +FD    ++
Sbjct  709   ISRYALIFCSLSLVSIAVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEDTNSS  768

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S ++SL++ ++++++ + L      +  +      +W+L+LV        +I 
Sbjct  769   GSLCSRLSDESSLVKTLVADRISLLLQTACGIVIAVTMGLIVAWKLALVMIAVQPCTMIC  828

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     IL+ +    +  ++  
Sbjct  829   YYAKKIVLSNVSRDLAKAQYESTQIAIEAVYNHRMVTSFGCSSKILQLFEHTQEEPLRKA  888

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  L+F  WA   WYG +L      S G ++      V  G  +  A
Sbjct  889   RKKSWVAGITTGLSPCLTFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  948

Query  2920  LPEVKYFTEASVAASRIFSRIDR--VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                     + + A + +F  +DR  +   + + +       I+G +EFK V F+YP+RP+
Sbjct  949   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNPKSKIQGRIEFKKVDFSYPTRPQ  1008

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ IDGV++  + V W 
Sbjct  1009  CLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVRIDGVDVREMNVLWY  1068

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             RG   LVSQE A+F  S+R+NI  GK     EE+V AA  ANAH+FI  L  GY+T  GE
Sbjct  1069  RGFTALVSQEPAMFSGSVRDNIAFGKPEADEEEIVEAAKAANAHEFISSLKDGYDTDCGE  1128

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
              G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+   GRTT++VA
Sbjct  1129  HGIQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMTGRTTIIVA  1188

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             H+L+TI+NAD IA +  G +IE+G++ +LM K G +  +A LQ+
Sbjct  1189  HRLNTIKNADSIAFLGEGKVIERGTYPQLMNKKGAFFNLATLQK  1232



>emb|CAA71179.1| P-glycoprotein homologue [Hordeum vulgare subsp. vulgare]
Length=1232

 Score =  1521 bits (3937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/1210 (66%), Positives = 1001/1210 (83%), Gaps = 4/1210 (0%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +F++AD +D+ LM LGTLGAIGDG STN LL++ S + N+LG G    Q   ++ +
Sbjct  17    SIRGLFKFADRVDVVLMALGTLGAIGDGCSTNLLLIFASDVMNSLGRGHAQQQGSATSAH  76

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M ++EK  L FV L  A++V+  MEGYCWS+TSERQVL+IR+ YLEAILRQEV FFDSQ
Sbjct  77    FMHDIEKSCLNFVYLAFAILVVASMEGYCWSRTSERQVLRIRHLYLEAILRQEVAFFDSQ  136

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EATTSEI NSISKD SLIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV+YP +++
Sbjct  137   EATTSEIINSISKDASLIQEVLSEKVPLFLMHSTVFVSGLAFSTYFSWRLALVSYPLVLL  196

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGLIYGKYLLYLS++S +EY+KAN +V QAL SIKT+YSFTAE+ I++RY++ILD+T
Sbjct  197   LIIPGLIYGKYLLYLSRESRREYAKANSLVEQALGSIKTVYSFTAEKGIIQRYTAILDKT  256

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             I LG+K GIAKGLAVG TGLSFAIWAFLAWYGSRL+M+  ESGGRIYAAGIS+VLGGLSL
Sbjct  257   INLGIKQGIAKGLAVGFTGLSFAIWAFLAWYGSRLVMYHHESGGRIYAAGISFVLGGLSL  316

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             GMALPE+K+F EASVAA+RI  RI+RVP+I+ +D  G+VLD +RGE+EF++++F YPSRP
Sbjct  317   GMALPELKHFIEASVAATRILERINRVPQINDDDPKGLVLDQVRGEIEFESIRFVYPSRP  376

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
                VLKD NL++ AG+T+ALVG+SGSGKSTAIAL+QRFYDA+ G++ +DG++I  L +K 
Sbjct  377   NMTVLKDFNLQIPAGQTIALVGSSGSGKSTAIALVQRFYDASEGTVKVDGIDIKKLNLKS  436

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R ++GLVSQ+HALFGTSI+ENI+ GK   +M+ + AAAMTANAH+FI  LP+GYETK+G
Sbjct  437   IRSKIGLVSQDHALFGTSIKENILFGKPDATMDLLYAAAMTANAHNFIMGLPEGYETKIG  496

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERGALLSGGQKQRIAIARA++KNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVV
Sbjct  497   ERGALLSGGQKQRIAIARAVLKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVV  556

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSS  2030
             AHKLST++NAD IAVV GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+     +S
Sbjct  557   AHKLSTVKNADQIAVVDGGRIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQETDQFRAS  616

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSIS  1850
             +A R S  + S +  +  PL    +++  + +   P+PSFSRLL +N  EWKQ LIGSIS
Sbjct  617   SAARTSASRLSMSRASPMPLTPGFSKETES-YVSPPAPSFSRLLAMNAPEWKQALIGSIS  675

Query  1849  AIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFA  1670
             A+ +G++QPTYALTIGGMI+AFF   H EM A I ++ L+F  L L+SI +NL QHY FA
Sbjct  676   ALVYGSLQPTYALTIGGMIAAFFVQDHNEMNAIISRYALIFCSLSLVSIAVNLLQHYNFA  735

Query  1669  YMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQ  1490
             YMGEHL RRIR+++LEKILTFE AWFDE+ NSSG+LC+RLS+E+++VK+LVADR+SLL+Q
Sbjct  736   YMGEHLVRRIRVQVLEKILTFEAAWFDEDTNSSGSLCSRLSDESSLVKTLVADRISLLLQ  795

Query  1489  AASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAV  1310
              A  + IA+ MGL+VAWKLALVMIAVQP T++C+Y +K++LS ++    KAQ  STQIA+
Sbjct  796   TACGIVIAVTMGLIVAWKLALVMIAVQPCTMICYYAKKIVLSNVSRDLAKAQYESTQIAI  855

Query  1309  EAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFW  1130
             EAVYNHR+VTSFG  +K+L +F++ Q+EP ++A+KKSW+AGI  G +  LTF+ WALDFW
Sbjct  856   EAVYNHRMVTSFGCSSKILQLFEHTQEEPLRKARKKSWVAGITTGLSPCLTFLSWALDFW  915

Query  1129  YGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSII  950
             YGGKL  +GEIS+GDVFKTFF+LVSTGK+IADAGSMTSDLAKG+ AVAS+F +LDR SI 
Sbjct  916   YGGKLAQSGEISAGDVFKTFFVLVSTGKLIADAGSMTSDLAKGANAVASVFEVLDRKSI-  974

Query  949   TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSG  770
              SP N +V+       K+ G+IE KKV+F+YP+RP+  IL++F L+VKAG+SIGLVG+SG
Sbjct  975   -SPQNSQVEKDNPK-SKIQGRIEFKKVDFSYPTRPQCLILQDFSLDVKAGTSIGLVGRSG  1032

Query  769   SGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILF  590
              GKSTI+ LI+RFYDVD G++R+DGVDVR  ++ WYR   ALVSQEP ++SG++RDNI F
Sbjct  1033  CGKSTIIGLIQRFYDVDRGAVRIDGVDVREMNVLWYRGFTALVSQEPAMFSGSVRDNIAF  1092

Query  589   GKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPT  410
             GK +A E EI+EAAKAANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAIIRNP 
Sbjct  1093  GKPEADEEEIVEAAKAANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRNPA  1152

Query  409   ILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHG  230
             ILLLDEATSALD +SEQVVQEALD IM GRTT++VAHRLNTIKN DSIA + EGKV+E G
Sbjct  1153  ILLLDEATSALDAQSEQVVQEALDRIMTGRTTIIVAHRLNTIKNADSIAFLGEGKVIERG  1212

Query  229   TYSQLKNKRG  200
             TY QL NK+G
Sbjct  1213  TYPQLMNKKG  1222


 Score =   317 bits (811),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 192/524 (37%), Positives = 300/524 (57%), Gaps = 3/524 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L L  + +  ++ Y ++   E  V +IR + LE IL  E  +FD    ++
Sbjct  709   ISRYALIFCSLSLVSIAVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEDTNSS  768

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S ++SL++ ++++++ + L      +  +      +W+L+LV        +I 
Sbjct  769   GSLCSRLSDESSLVKTLVADRISLLLQTACGIVIAVTMGLIVAWKLALVMIAVQPCTMIC  828

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     IL+ +    +  ++  
Sbjct  829   YYAKKIVLSNVSRDLAKAQYESTQIAIEAVYNHRMVTSFGCSSKILQLFEHTQEEPLRKA  888

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  L+F  WA   WYG +L      S G ++      V  G  +  A
Sbjct  889   RKKSWVAGITTGLSPCLTFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  948

Query  2920  LPEVKYFTEASVAASRIFSRIDR--VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                     + + A + +F  +DR  +   + + +       I+G +EFK V F+YP+RP+
Sbjct  949   GSMTSDLAKGANAVASVFEVLDRKSISPQNSQVEKDNPKSKIQGRIEFKKVDFSYPTRPQ  1008

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ IDGV++  + V W 
Sbjct  1009  CLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVRIDGVDVREMNVLWY  1068

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             RG   LVSQE A+F  S+R+NI  GK     EE+V AA  ANAH+FI  L  GY+T  GE
Sbjct  1069  RGFTALVSQEPAMFSGSVRDNIAFGKPEADEEEIVEAAKAANAHEFISSLKDGYDTDCGE  1128

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
              G  LSGGQKQRIAIARAII+NP ILLLDEATSALD++SE++VQ+ALD+   GRTT++VA
Sbjct  1129  HGIQLSGGQKQRIAIARAIIRNPAILLLDEATSALDAQSEQVVQEALDRIMTGRTTIIVA  1188

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             H+L+TI+NAD IA +  G +IE+G++ +LM K G +  +A LQ+
Sbjct  1189  HRLNTIKNADSIAFLGEGKVIERGTYPQLMNKKGAFFNLATLQK  1232



>ref|XP_010535957.1| PREDICTED: putative ABC transporter B family member 8 isoform 
X2 [Tarenaya hassleriana]
Length=1181

 Score =  1474 bits (3815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/1157 (68%), Positives = 961/1157 (83%), Gaps = 11/1157 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M EVEKCSLYFV LGLAV+ + FMEGYCWSKTSERQV+KIR  YLEA+LRQEV FFDSQ
Sbjct  16    FMNEVEKCSLYFVYLGLAVLAVAFMEGYCWSKTSERQVMKIRRTYLEAVLRQEVSFFDSQ  75

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             EA+ SEI +SIS DTSLIQ+VLSEKVP F MH SVF +GL FS YFSWRL+LVA P++++
Sbjct  76    EASISEIISSISNDTSLIQQVLSEKVPTFCMHASVFFTGLAFSAYFSWRLTLVAIPSLLL  135

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG+ YGKYL+YLSKKSFKEY+KAN +V QALSSIKTIYSFTAE+ +++ YS +L++T
Sbjct  136   LIIPGMTYGKYLVYLSKKSFKEYAKANSVVEQALSSIKTIYSFTAEKRVIKNYSDMLEKT  195

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K G AKGLAVGSTGLSFAIWAFLAWYGSRL+M+   SGGR+YAAGIS+VL GLSL
Sbjct  196   TKLGIKQGQAKGLAVGSTGLSFAIWAFLAWYGSRLVMYHEASGGRVYAAGISFVLSGLSL  255

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLD-TIRGELEFKNVKFAYPS  2756
             GM LPEVKYFTEASVA +RIF RIDR P+IDGED + G +++  ++G +EF++V F YPS
Sbjct  256   GMTLPEVKYFTEASVAVARIFERIDRKPEIDGEDTTKGFIINKNMKGVIEFEHVTFWYPS  315

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S++LKD +L++EAGKTVALVGASGSGKSTA+AL+QRFYD   GS+ IDG +I  LQ+
Sbjct  316   RPDSIILKDFSLRIEAGKTVALVGASGSGKSTAVALVQRFYDPIQGSVRIDGFDIKTLQL  375

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R QM LVSQEHALFGTSIRENI  GK   +M+EV++AA  ANAH FI QLP+GYETK
Sbjct  376   KWMRHQMALVSQEHALFGTSIRENITFGKHDATMDEVISAAKAANAHGFITQLPEGYETK  435

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             +GERGA LSGGQKQRIAIARAII+NPVILLLDEATSALD ESE LVQ+ALDQAS GRTTL
Sbjct  436   IGERGAFLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLVQNALDQASMGRTTL  495

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFS-CADQDQSFA  2039
             V+AHKLST+  AD IAV+  G I+E G+H ELM +NG YA++A+ QRQFS C  QD +  
Sbjct  496   VIAHKLSTVHGADHIAVLEDGSILEMGNHEELMIQNGKYAKLARFQRQFSVCEHQDMART  555

Query  2038  PSSNAGRQSTEKsspavlassplLIETA--QKVPTDHHHQPSPSFSRLLGLNLTEWKQGL  1865
             P+ N+  + + +SSP    S  + +E+   + + +   H+PSPSFSRLL L   +WK  +
Sbjct  556   PARNSFSRLSVRSSPGWFDSPLIPLESTNVEILASPSLHRPSPSFSRLLPLISPDWKPAI  615

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
              G +SA  FGAVQP YALTIGGMISAFF+ + +EMQ RI+ +CL+F+ L ++SI LNL Q
Sbjct  616   TGCLSAATFGAVQPVYALTIGGMISAFFAKNPQEMQDRIRTYCLIFSSLTVVSIVLNLLQ  675

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FA +GE LT+R+RLRMLEKIL+FE AWFD E NSSGALC+RLS EA+ VKSL++DR+
Sbjct  676   HYSFAKVGERLTQRLRLRMLEKILSFEPAWFDSEENSSGALCSRLSGEASSVKSLLSDRV  735

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SLLVQ  S VTIAM++GL+VAWKLALVMIAVQP+TILCFYT+KVLLS I+  F  AQN S
Sbjct  736   SLLVQTISGVTIAMIIGLIVAWKLALVMIAVQPITILCFYTKKVLLSNISHNFTSAQNRS  795

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             +QIA EA+YNH+IVTSFGS  K++ IFD AQ+E +++ +K +WLAGIG+GSAQ LTFM W
Sbjct  796   SQIASEAIYNHKIVTSFGSTRKIVQIFDKAQEEAKRKGEKATWLAGIGMGSAQCLTFMTW  855

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             ALDFWYGG LV  G IS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAAVAS+F ILD
Sbjct  856   ALDFWYGGVLVQKGHISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAVASVFQILD  915

Query  964   RPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
             RPS        + +N GT LE ++G+IE K+V+F+YP+RP+ P+LR+F L+VK G+S+GL
Sbjct  916   RPSSQVK----EDENSGTKLETITGRIEFKQVDFSYPTRPQIPVLRQFSLDVKPGTSMGL  971

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VGKSG GKST++ LI+RFYD + GS+R+DGVD+R  ++ WYR+  A+VSQEPV+YSG+IR
Sbjct  972   VGKSGCGKSTVIGLIQRFYDAEKGSVRIDGVDLREMNVHWYRKHTAVVSQEPVVYSGSIR  1031

Query  604   DNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiarai  425
             +NIL G+ +ASE+E+ EAAKAANAH+FIS LKKGYDTECGERGVQLSGGQKQR+AIARA+
Sbjct  1032  ENILLGRPEASEDEVAEAAKAANAHKFISELKKGYDTECGERGVQLSGGQKQRVAIARAV  1091

Query  424   iRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLDSIALVSE  251
             +R+P ILLLDEATSALDVESE+ VQEALD IM  R  T + VAHRLNT+KNLD IA+V++
Sbjct  1092  LRDPKILLLDEATSALDVESERAVQEALDRIMARRSITVVAVAHRLNTLKNLDRIAVVAD  1151

Query  250   GKVVEHGTYSQLKNKRG  200
             GKVVE G+Y++LKN  G
Sbjct  1152  GKVVETGSYARLKNTGG  1168


 Score =   311 bits (796),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 205/529 (39%), Positives = 309/529 (58%), Gaps = 8/529 (2%)
 Frame = -2

Query  1780  SPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFET  1601
             +P        ++K  L F  L L  + +   + YC++   E    +IR   LE +L  E 
Sbjct  10    NPHEINFMNEVEKCSLYFVYLGLAVLAVAFMEGYCWSKTSERQVMKIRRTYLEAVLRQEV  69

Query  1600  AWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVM  1421
             ++FD +  S   + + +SN+ ++++ ++++++      AS     +      +W+L LV 
Sbjct  70    SFFDSQEASISEIISSISNDTSLIQQVLSEKVPTFCMHASVFFTGLAFSAYFSWRLTLVA  129

Query  1420  IAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFD  1241
             I    L I+   T    L  ++ K  K    +  +  +A+ + + + SF +  +V+  + 
Sbjct  130   IPSLLLLIIPGMTYGKYLVYLSKKSFKEYAKANSVVEQALSSIKTIYSFTAEKRVIKNYS  189

Query  1240  NAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFIL  1061
             +  ++  K   K+    G+ +GS  GL+F  WA   WYG +LV   E S G V+      
Sbjct  190   DMLEKTTKLGIKQGQAKGLAVGST-GLSFAIWAFLAWYGSRLVMYHEASGGRVYAAGISF  248

Query  1060  VSTGKVIADAGSMTSDLAKGSAAVASIFAILDR-PSIITSPYNGKVDNGGTNLEK-LSGK  887
             V +G  +           + S AVA IF  +DR P I     +G+    G  + K + G 
Sbjct  249   VLSGLSLGMTLPEVKYFTEASVAVARIFERIDRKPEI-----DGEDTTKGFIINKNMKGV  303

Query  886   IEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSI  707
             IE + V F YPSRP++ IL++F L ++AG ++ LVG SGSGKST VAL++RFYD   GS+
Sbjct  304   IEFEHVTFWYPSRPDSIILKDFSLRIEAGKTVALVGASGSGKSTAVALVQRFYDPIQGSV  363

Query  706   RVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQ  527
             R+DG D+++  + W R QMALVSQE  ++  +IR+NI FGK DA+ +E+I AAKAANAH 
Sbjct  364   RIDGFDIKTLQLKWMRHQMALVSQEHALFGTSIRENITFGKHDATMDEVISAAKAANAHG  423

Query  526   FISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQE  347
             FI+ L +GY+T+ GERG  LSGGQKQRIAIARAIIRNP ILLLDEATSALD ESE +VQ 
Sbjct  424   FITQLPEGYETKIGERGAFLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLVQN  483

Query  346   ALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNKRG  200
             ALD   +GRTT+V+AH+L+T+   D IA++ +G ++E G + +L  + G
Sbjct  484   ALDQASMGRTTLVIAHKLSTVHGADHIAVLEDGSILEMGNHEELMIQNG  532


 Score =   308 bits (790),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 194/519 (37%), Positives = 301/519 (58%), Gaps = 4/519 (1%)
 Frame = -2

Query  3622  LYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITN  3443
             L F  L +  +V+  ++ Y ++K  ER   ++R + LE IL  E  +FDS+E ++  + +
Sbjct  659   LIFSSLTVVSIVLNLLQHYSFAKVGERLTQRLRLRMLEKILSFEPAWFDSEENSSGALCS  718

Query  3442  SISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliyg  3263
              +S + S ++ +LS++V + +   S     +      +W+L+LV      I I+      
Sbjct  719   RLSGEASSVKSLLSDRVSLLVQTISGVTIAMIIGLIVAWKLALVMIAVQPITILCFYTKK  778

Query  3262  kyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGI  3083
               L  +S       ++++ I  +A+ + K + SF + R I++ +    +   + G K   
Sbjct  779   VLLSNISHNFTSAQNRSSQIASEAIYNHKIVTSFGSTRKIVQIFDKAQEEAKRKGEKATW  838

Query  3082  AKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVK  2906
               G+ +GS   L+F  WA   WYG  L+     S G ++      V  G  +  A     
Sbjct  839   LAGIGMGSAQCLTFMTWALDFWYGGVLVQKGHISAGDVFKTFFVLVSTGKVIAEAGSMTS  898

Query  2905  YFTEASVAASRIFSRIDRVP-KIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKD  2729
                + S A + +F  +DR   ++  ++ SG  L+TI G +EFK V F+YP+RP+  VL+ 
Sbjct  899   DLAKGSAAVASVFQILDRPSSQVKEDENSGTKLETITGRIEFKQVDFSYPTRPQIPVLRQ  958

Query  2728  LNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGL  2549
              +L V+ G ++ LVG SG GKST I L+QRFYDA  GS+ IDGV++  + V W R    +
Sbjct  959   FSLDVKPGTSMGLVGKSGCGKSTVIGLIQRFYDAEKGSVRIDGVDLREMNVHWYRKHTAV  1018

Query  2548  VSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLS  2369
             VSQE  ++  SIRENI+LG+   S +EV  AA  ANAH FI +L +GY+T+ GERG  LS
Sbjct  1019  VSQEPVVYSGSIRENILLGRPEASEDEVAEAAKAANAHKFISELKKGYDTECGERGVQLS  1078

Query  2368  GGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKLS  2195
             GGQKQR+AIARA++++P ILLLDEATSALD ESE+ VQ+ALD+  A R  T + VAH+L+
Sbjct  1079  GGQKQRVAIARAVLRDPKILLLDEATSALDVESERAVQEALDRIMARRSITVVAVAHRLN  1138

Query  2194  TIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQ  2078
             T++N D IAVV+ G ++E GS++ L    G ++++   Q
Sbjct  1139  TLKNLDRIAVVADGKVVETGSYARLKNTGGEFSRLVHAQ  1177



>ref|XP_009151738.1| PREDICTED: putative ABC transporter B family member 8 [Brassica 
rapa]
Length=1241

 Score =  1472 bits (3810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/1226 (65%), Positives = 982/1226 (80%), Gaps = 30/1226 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             +I VIFR+ADWIDI LM LGT+GAIGDGMSTN  L++ S + N+LGYG NN  +      
Sbjct  17    NIHVIFRFADWIDIVLMVLGTVGAIGDGMSTNVALVFASKIMNSLGYGQNNHHT------  70

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                EV+KCSLYFV LGLA++ + FMEGYCWSKTSERQV KIR  YL+A+LRQEV FF+S+
Sbjct  71    FKDEVQKCSLYFVYLGLAILGVAFMEGYCWSKTSERQVEKIRRTYLKAVLRQEVSFFESE  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             +A+ SEI ++IS DTSLIQ++LSEKVPIFLMHTSVF++GL F+ YFSWRL+LVA P++V+
Sbjct  131   DASISEIIHTISTDTSLIQQLLSEKVPIFLMHTSVFITGLVFAAYFSWRLTLVAIPSLVL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGLIYGKYL+YLSKKS+KEY+KAN IV QALSSIKTI SFTAE  I++ YS IL+R 
Sbjct  191   LLIPGLIYGKYLVYLSKKSYKEYAKANSIVEQALSSIKTILSFTAETQIIKSYSEILERH  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K G+AKGLAVGSTG+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS++L GLSL
Sbjct  251   KKLGLKQGLAKGLAVGSTGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFILSGLSL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLDT-IRGELEFKNVKFAYPS  2756
             G AL E++YF+EASVAA+RI SRIDRVP IDGED + G + +  I G +EF++V F YPS
Sbjct  311   GTALTEIRYFSEASVAAARICSRIDRVPDIDGEDTTKGFIPNAKIEGRVEFEHVTFTYPS  370

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             R +S++L+D NL+ +AGKTVAL+GASGSGKST IALLQRFYD   G + IDG +I  LQ+
Sbjct  371   RQKSIILRDFNLRADAGKTVALMGASGSGKSTVIALLQRFYDPAEGFVRIDGFDIKTLQL  430

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R Q+G+VSQ+HALFGTSI+ENIM GK   SM+EV++AA  ANA +FI QLP GY+T+
Sbjct  431   KWMREQIGVVSQDHALFGTSIKENIMFGKDNASMDEVISAAKAANADEFITQLPDGYDTQ  490

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             +G+RG LLSGGQKQRIAIARAII+NPVILLLDEATSALD+ESE L+Q +LDQ +AGRTTL
Sbjct  491   IGDRGGLLSGGQKQRIAIARAIIRNPVILLLDEATSALDAESETLIQVSLDQVAAGRTTL  550

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAP  2036
             VVAHKLST+R ADLIAV+  G + E GSH +LM KN HYA++  +QRQFS  +  Q    
Sbjct  551   VVAHKLSTVRGADLIAVLENGSVKEMGSHEDLMTKNNHYAKLINIQRQFSSQEHRQDLQD  610

Query  2035  SSNA--GRQS-TEKsspavlassplLIETAQKVPTDHHHQ-------PSPSFSRLLGLNL  1886
              S    GRQ  + ++S + L+        A  +P +  H        PS SF+RLL L  
Sbjct  611   GSKTPEGRQYWSARNSFSRLSIRSTPDLIASPIPFESIHSAEPDDNLPSTSFTRLLPLVS  670

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWK  L+G ISA  FGA+QP YAL IGGMISAFF+ S ++MQ RI+ + L+F  L  +S
Sbjct  671   PEWKSSLLGCISAATFGAIQPIYALNIGGMISAFFATSSKQMQDRIRIYSLIFISLTFIS  730

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
             +TLNL QHY FA MGE L +R+RLRMLEKI TFE AWFD E NSSG LC+RLSNEA+ VK
Sbjct  731   MTLNLIQHYSFAKMGERLMQRLRLRMLEKIFTFEPAWFDVEENSSGELCSRLSNEASTVK  790

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             S+V+DR+SLLVQ  S V IAMV+GL+VAWKLALVMIAVQPL++ CFYT+KVLL++I+  +
Sbjct  791   SIVSDRISLLVQTISGVLIAMVIGLLVAWKLALVMIAVQPLSVFCFYTKKVLLTSISHNY  850

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
               AQN S+ IA EAVYNH+IVTS GS  K+++IFD AQDE R++ +K +WLAG G+GSAQ
Sbjct  851   AYAQNRSSNIASEAVYNHKIVTSLGSTKKIIEIFDKAQDEARRKGKKAAWLAGFGMGSAQ  910

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LTFM WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAA++
Sbjct  911   CLTFMTWALDFWYGGVLVEKGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAIS  970

Query  985   SIFAILDRPSIITSPYNGKVDNG--GTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLE  812
             S+F ILDRPS          DN   G  ++ ++G+IE+KKV+F+YP+RP  P+L++F L+
Sbjct  971   SVFKILDRPS--------SQDNTTHGAKIDAITGRIELKKVDFSYPNRPSIPVLQQFSLD  1022

Query  811   VKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQE  632
             +K G+SIGLVG SG GKST++ALI+RFYDV+ G +++DGVD+R  DI WYR+  ALVSQE
Sbjct  1023  IKPGTSIGLVGTSGCGKSTVIALIQRFYDVEKGCVKIDGVDLREIDIKWYRKHTALVSQE  1082

Query  631   PVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
             PV+YSG+IR+NIL G+ +A+E+E++EAAKAANAH FIS++++GY+TECGERGVQLSGGQK
Sbjct  1083  PVVYSGSIRENILLGRPEAAEDEVMEAAKAANAHDFISAMEEGYETECGERGVQLSGGQK  1142

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKN  278
             QR+AIARA +RNP ILLLDE TS+LD +SEQ VQEAL  IM  R  TT+VVAHRLNT+K 
Sbjct  1143  QRLAIARAFLRNPVILLLDEVTSSLDSDSEQAVQEALARIMASRKMTTVVVAHRLNTLKK  1202

Query  277   LDSIALVSEGKVVEHGTYSQLKNKRG  200
             LD IA++++G VVE G+Y +LKN  G
Sbjct  1203  LDRIAVIADGTVVETGSYDRLKNMGG  1228


 Score =   318 bits (816),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 190/516 (37%), Positives = 294/516 (57%), Gaps = 6/516 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F+ L    M +  ++ Y ++K  ER + ++R + LE I   E  +FD +E ++ E+ 
Sbjct  720   SLIFISLTFISMTLNLIQHYSFAKMGERLMQRLRLRMLEKIFTFEPAWFDVEENSSGELC  779

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +S + S ++ ++S+++ + +   S  L  +      +W+L+LV      + +      
Sbjct  780   SRLSNEASTVKSIVSDRISLLVQTISGVLIAMVIGLLVAWKLALVMIAVQPLSVFCFYTK  839

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S       ++++ I  +A+ + K + S  + + I+E +    D   + G K  
Sbjct  840   KVLLTSISHNYAYAQNRSSNIASEAVYNHKIVTSLGSTKKIIEIFDKAQDEARRKGKKAA  899

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G  +GS   L+F  WA   WYG  L+  KGE S G ++      V  G  +  A   
Sbjct  900   WLAGFGMGSAQCLTFMTWALDFWYGGVLV-EKGEISAGDVFKTFFVLVSTGKVIAEAGSM  958

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
                  + S A S +F  +DR P        G  +D I G +E K V F+YP+RP   VL+
Sbjct  959   TSDLAKGSAAISSVFKILDR-PSSQDNTTHGAKIDAITGRIELKKVDFSYPNRPSIPVLQ  1017

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
               +L ++ G ++ LVG SG GKST IAL+QRFYD   G + IDGV++  + +KW R    
Sbjct  1018  QFSLDIKPGTSIGLVGTSGCGKSTVIALIQRFYDVEKGCVKIDGVDLREIDIKWYRKHTA  1077

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LVSQE  ++  SIRENI+LG+   + +EV+ AA  ANAHDFI  + +GYET+ GERG  L
Sbjct  1078  LVSQEPVVYSGSIRENILLGRPEAAEDEVMEAAKAANAHDFISAMEEGYETECGERGVQL  1137

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKL  2198
             SGGQKQR+AIARA ++NPVILLLDE TS+LDS+SE+ VQ+AL +  A R  TT+VVAH+L
Sbjct  1138  SGGQKQRLAIARAFLRNPVILLLDEVTSSLDSDSEQAVQEALARIMASRKMTTVVVAHRL  1197

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQM  2090
             +T++  D IAV++ G ++E GS+  L    G ++++
Sbjct  1198  NTLKKLDRIAVIADGTVVETGSYDRLKNMGGQFSRL  1233



>emb|CDX85304.1| BnaC07g26150D [Brassica napus]
Length=1241

 Score =  1453 bits (3761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/1224 (64%), Positives = 980/1224 (80%), Gaps = 26/1224 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             +I VIFR+AD IDI LM LGT+GAIGDGMSTN  L++ S + N+LGYG +N  +      
Sbjct  17    NIHVIFRFADCIDIVLMVLGTVGAIGDGMSTNVALVFASKIMNSLGYGQHNPHT------  70

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                EV+KCSLYF+ LGLA++ + FMEGYCWSKTSERQV KIR  YL+A+LRQEV FF+S+
Sbjct  71    FKDEVQKCSLYFLYLGLAILGVAFMEGYCWSKTSERQVEKIRRTYLKAVLRQEVSFFESE  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             +A+ SEI ++IS DTSLIQ++LSEKVPIFLMHTSVF++GL F+ YFSWRL+LVA P++++
Sbjct  131   DASISEIIHTISTDTSLIQQLLSEKVPIFLMHTSVFITGLVFAAYFSWRLTLVALPSLLL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGLIYGKYL+YLS KS+ EY+KAN IV QALSSIKTI SFTAE  I++ YS IL+R 
Sbjct  191   LLIPGLIYGKYLVYLSNKSYNEYAKANSIVEQALSSIKTILSFTAETQIIKSYSEILERH  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K G+AKGLAVGSTG+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS++L GLSL
Sbjct  251   KKLGLKQGLAKGLAVGSTGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFILSGLSL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLDT-IRGELEFKNVKFAYPS  2756
             G AL E++YF+EASVAA+RI SRIDRVP+IDGED + G + +  I G +EF++V F YPS
Sbjct  311   GTALTEIRYFSEASVAAARICSRIDRVPEIDGEDTTKGFIPNAKIEGRVEFEHVTFTYPS  370

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S++L+D  L+ +AG+TVAL+GASG GKST IALLQRFYD   G + IDG +I  L++
Sbjct  371   RPKSIILRDFTLRADAGRTVALMGASGCGKSTVIALLQRFYDPTEGFVRIDGFDIKTLRL  430

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R Q+G+VSQ+HALFGTSI+ENIM GK   SM+EV++AA  ANA DFI QLP GYET+
Sbjct  431   KWMREQIGVVSQDHALFGTSIKENIMFGKDNASMDEVISAAKAANADDFITQLPDGYETQ  490

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             +G+RGALLSGGQKQRIAIARAII+NPVILLLDEATSALD+ESE L+Q +LDQ +AGRTTL
Sbjct  491   IGDRGALLSGGQKQRIAIARAIIRNPVILLLDEATSALDAESETLIQVSLDQVAAGRTTL  550

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCAD--QDQSF  2042
             VVAHKLST+R AD IAV+  G + E GSH +LM KN HYA++  +QRQFS  +  QD   
Sbjct  551   VVAHKLSTVRGADHIAVLENGSVKEMGSHEDLMTKNNHYAKLINIQRQFSSQEHRQDLQD  610

Query  2041  APSSNAGRQS-TEKsspavlassplLIETAQKVPTDHHHQ-------PSPSFSRLLGLNL  1886
                +  GRQ  + ++S + L+        A  +P +  H        PS SF+RLL L  
Sbjct  611   GVKTPEGRQYWSARNSFSRLSIRSTPDLIASPIPFESIHAAEPDDNLPSTSFTRLLPLVS  670

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWK  L G ISA  FGA+QP YAL IGGMISAFF+ S ++MQ RI+ + L+F  L  +S
Sbjct  671   PEWKSSLFGCISAATFGAIQPIYALNIGGMISAFFATSSKQMQDRIRIYSLIFISLTFIS  730

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
             +TLNL QHY FA MGE L +R+RLRMLEKI TFE AWFD E NSSG LCARLSNEA+ VK
Sbjct  731   MTLNLIQHYSFAKMGERLMQRLRLRMLEKIFTFEPAWFDVEENSSGELCARLSNEASTVK  790

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             S+V+DR+SLLVQ  S V IAMV+GL+VAWKLALVMIAVQPL++LCFYT+KVLL++I+  +
Sbjct  791   SIVSDRISLLVQTISGVLIAMVIGLLVAWKLALVMIAVQPLSVLCFYTKKVLLTSISRNY  850

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
               AQN S+ IA EAVYNH+IVTS GS  K+++IFD AQDE R++ +K +WLAG G+GSAQ
Sbjct  851   AYAQNRSSNIASEAVYNHKIVTSLGSTKKIIEIFDKAQDEARRKGKKAAWLAGFGMGSAQ  910

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LTFM WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGK IA+AGSMTSDLAKGSAA++
Sbjct  911   CLTFMTWALDFWYGGVLVQKGEISAGDVFKTFFVLVSTGKFIAEAGSMTSDLAKGSAAIS  970

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+F ILDRP    SP +    N G  +E ++G+IE+KKV+F+YP+RP  P+L++F L++K
Sbjct  971   SVFKILDRP----SPQDNT--NHGAKIEAITGRIELKKVDFSYPNRPSIPVLQQFSLDIK  1024

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
              G+SIGLVG SG GKST++ALI+RFYDV+ G +++DGVD+R  DI WYR+  ALVSQEPV
Sbjct  1025  PGTSIGLVGTSGCGKSTVIALIQRFYDVEKGCVKIDGVDLRELDIKWYRKYTALVSQEPV  1084

Query  625   IYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             +YSG+IR+NIL G+ +A+E+E++EAAKAANAH FIS++++GY+TECGERGVQLSGGQKQR
Sbjct  1085  VYSGSIRENILLGRPEAAEDEVMEAAKAANAHDFISAMEEGYETECGERGVQLSGGQKQR  1144

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLD  272
             +AIARA +RNP ILLLDE TS+LD +SEQ VQEAL  IM  R  TT+VVAHRLNT+K LD
Sbjct  1145  LAIARAFLRNPVILLLDEVTSSLDSDSEQAVQEALARIMASRKMTTVVVAHRLNTLKKLD  1204

Query  271   SIALVSEGKVVEHGTYSQLKNKRG  200
              IA++++G VVE G+Y +LKN  G
Sbjct  1205  RIAVIADGTVVETGSYDRLKNMGG  1228


 Score =   317 bits (811),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 190/516 (37%), Positives = 295/516 (57%), Gaps = 6/516 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F+ L    M +  ++ Y ++K  ER + ++R + LE I   E  +FD +E ++ E+ 
Sbjct  720   SLIFISLTFISMTLNLIQHYSFAKMGERLMQRLRLRMLEKIFTFEPAWFDVEENSSGELC  779

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
               +S + S ++ ++S+++ + +   S  L  +      +W+L+LV      + ++     
Sbjct  780   ARLSNEASTVKSIVSDRISLLVQTISGVLIAMVIGLLVAWKLALVMIAVQPLSVLCFYTK  839

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S+      ++++ I  +A+ + K + S  + + I+E +    D   + G K  
Sbjct  840   KVLLTSISRNYAYAQNRSSNIASEAVYNHKIVTSLGSTKKIIEIFDKAQDEARRKGKKAA  899

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G  +GS   L+F  WA   WYG  L+  KGE S G ++      V  G  +  A   
Sbjct  900   WLAGFGMGSAQCLTFMTWALDFWYGGVLV-QKGEISAGDVFKTFFVLVSTGKFIAEAGSM  958

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
                  + S A S +F  +DR P        G  ++ I G +E K V F+YP+RP   VL+
Sbjct  959   TSDLAKGSAAISSVFKILDR-PSPQDNTNHGAKIEAITGRIELKKVDFSYPNRPSIPVLQ  1017

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
               +L ++ G ++ LVG SG GKST IAL+QRFYD   G + IDGV++  L +KW R    
Sbjct  1018  QFSLDIKPGTSIGLVGTSGCGKSTVIALIQRFYDVEKGCVKIDGVDLRELDIKWYRKYTA  1077

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LVSQE  ++  SIRENI+LG+   + +EV+ AA  ANAHDFI  + +GYET+ GERG  L
Sbjct  1078  LVSQEPVVYSGSIRENILLGRPEAAEDEVMEAAKAANAHDFISAMEEGYETECGERGVQL  1137

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKL  2198
             SGGQKQR+AIARA ++NPVILLLDE TS+LDS+SE+ VQ+AL +  A R  TT+VVAH+L
Sbjct  1138  SGGQKQRLAIARAFLRNPVILLLDEVTSSLDSDSEQAVQEALARIMASRKMTTVVVAHRL  1197

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQM  2090
             +T++  D IAV++ G ++E GS+  L    G ++++
Sbjct  1198  NTLKKLDRIAVIADGTVVETGSYDRLKNMGGQFSRL  1233



>ref|XP_006853687.1| hypothetical protein AMTR_s00056p00132920 [Amborella trichopoda]
 gb|ERN15154.1| hypothetical protein AMTR_s00056p00132920 [Amborella trichopoda]
Length=1266

 Score =  1449 bits (3751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/1226 (64%), Positives = 971/1226 (79%), Gaps = 30/1226 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SSI  +FRYA+W+DI LM LGT GAIGDGMSTNCLL++ S + N+LG       S+ S+G
Sbjct  42    SSIAGLFRYAEWVDIVLMVLGTAGAIGDGMSTNCLLIFASQIMNSLG----RGDSEQSHG  97

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
               M  VE+CS+YFV LGLAV V+ FMEGYCWS+TSERQV++IRYKYLEAILRQEVG+FDS
Sbjct  98    GFMDRVEECSVYFVYLGLAVWVVAFMEGYCWSRTSERQVMRIRYKYLEAILRQEVGYFDS  157

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             QE T SEI +S+SKDTSLIQEVLSEKVP FLMHTSVF+SG+GF TYFSWRL+++A+P + 
Sbjct  158   QETTASEIIDSLSKDTSLIQEVLSEKVPTFLMHTSVFISGIGFCTYFSWRLAILAFPFLP  217

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPGLIYGKYLLY+S KS++EY+KA+ IV QAL SI+TIY+FTAER+I+++YS+IL+R
Sbjct  218   LLIIPGLIYGKYLLYMSNKSYEEYNKASSIVEQALGSIRTIYAFTAERTIIDKYSTILER  277

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             T+KLGMK G+AKGLAVGSTG+SFAIWAFLAWYGSRL MH+GESGGRI+AAGI+++LGGLS
Sbjct  278   TVKLGMKQGLAKGLAVGSTGISFAIWAFLAWYGSRLAMHRGESGGRIWAAGITFILGGLS  337

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG+ALPEVK+FTEAS+AA+RIF RIDRVP+ID E++ G++ + I+G +EF+ + FAYPSR
Sbjct  338   LGIALPEVKHFTEASIAAARIFKRIDRVPEIDTEEEKGIMPEKIQGNIEFRKITFAYPSR  397

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S+ LK+ +L V+AG+ +ALVG SG GKST I++LQRFYD   G + IDGV I  LQ+K
Sbjct  398   PDSICLKNFDLSVQAGQNLALVGRSGCGKSTLISILQRFYDVLEGEVRIDGVCIRDLQLK  457

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLRG MGLVSQ+HALFGTSIRENIM GK   +MEEV+AAAMTANAH FI QLP+GYETKV
Sbjct  458   WLRGNMGLVSQDHALFGTSIRENIMFGKADATMEEVIAAAMTANAHGFIIQLPEGYETKV  517

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             G RG+ LSGGQKQRIAIARAIIKNP ILLLDEATSALDSESE++VQ+ALDQAS GRTTL 
Sbjct  518   GHRGSQLSGGQKQRIAIARAIIKNPPILLLDEATSALDSESEQIVQNALDQASMGRTTLT  577

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR-QFSCADQD----  2051
             +AH+LSTIRNA  IAV+  G IIE+GSH EL+ K N  Y+    LQ+ QF+   QD    
Sbjct  578   IAHRLSTIRNAHQIAVMENGHIIEKGSHKELINKENSLYSHFLSLQQAQFNPDAQDPNES  637

Query  2050  QSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLG-LNLTEWK  1874
              SF    ++GR+ + + S           +T+  +P       +PSF RL   LN  E  
Sbjct  638   SSFPARKSSGRRQSFQKSSPYTFHKTPSFKTSADLPP----MKTPSFYRLASMLNKYELI  693

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             + L+G +SA  FGA+QP YALTIG MISAFF+ SHEEM+ RI+ +C +F  L + S  +N
Sbjct  694   KSLMGIVSATIFGAIQPVYALTIGAMISAFFTQSHEEMEGRIKTYCFIFLSLSIASFVVN  753

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY F  MGE LTRRIRLRML+KIL+FE AWFDE+ NS  A+CARL +EA+++K+L+A
Sbjct  754   LSQHYNFGCMGESLTRRIRLRMLDKILSFEVAWFDEDRNSGPAICARLGSEASVMKTLIA  813

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  S+VTI+MVMGLV+AW+LALV+IAVQPLTI CFYTRKVLLS +++  +KAQ
Sbjct  814   DRVSLLVQTVSAVTISMVMGLVIAWRLALVIIAVQPLTISCFYTRKVLLSRLSSNSIKAQ  873

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + S+ IA EAV NHRI+TSF     V+ +F    ++P K + +KSW+AGIG+G+AQ LTF
Sbjct  874   SESSNIASEAVSNHRIITSFSCNKMVMRVFKETLEKPMKASVRKSWMAGIGMGTAQCLTF  933

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             M WALDFWYGGKLV  G IS+GDVFKTFFILVSTGKVIA+AGSMTSDLA+G+ ++ S+F 
Sbjct  934   MSWALDFWYGGKLVERGSISAGDVFKTFFILVSTGKVIAEAGSMTSDLARGATSLTSVFQ  993

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             IL+R ++I         +GG  L + +G+IE++ V FAYPSRP   +L  F + VK G+ 
Sbjct  994   ILERETLIKG-------DGGLKLNRFNGEIEMRDVEFAYPSRPRVLVLNGFSVRVKGGTW  1046

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             +GLVG+SG GKST+V L++RFYDV  G IRVDGVDVR  D+ W+R ++ +V QE VI+SG
Sbjct  1047  LGLVGRSGCGKSTVVGLVQRFYDVQRGVIRVDGVDVREMDLRWFRERVGMVGQEAVIFSG  1106

Query  613   TIRDNILFGK--------LDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             +I+DNI FGK          ASE+E++EAAKAA AH+FISSLK GY TECGERG+QLSGG
Sbjct  1107  SIKDNIQFGKAGAGAGAGASASESEVVEAAKAARAHEFISSLKDGYLTECGERGIQLSGG  1166

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRI IARAI+RNP ILLLDEATSALD +SE  V  AL+ +M G+T +VV HRLNTI  
Sbjct  1167  QKQRIGIARAILRNPRILLLDEATSALDAQSEHTVNIALETVMKGKTCLVVTHRLNTIDK  1226

Query  277   LDSIALVSEGKVVEHGTYSQLKNKRG  200
             +D+IA V++GKVVE GT + LK K+G
Sbjct  1227  VDTIAFVADGKVVEQGTPAYLKAKKG  1252


 Score =   285 bits (730),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 182/518 (35%), Positives = 284/518 (55%), Gaps = 11/518 (2%)
 Frame = -2

Query  3616  FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSI  3437
             F+ L +A  V+   + Y +    E    +IR + L+ IL  EV +FD    +   I   +
Sbjct  742   FLSLSIASFVVNLSQHYNFGCMGESLTRRIRLRMLDKILSFEVAWFDEDRNSGPAICARL  801

Query  3436  SKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygky  3257
               + S+++ +++++V + +   S     +      +WRL+LV      + I         
Sbjct  802   GSEASVMKTLIADRVSLLVQTVSAVTISMVMGLVIAWRLALVIIAVQPLTISCFYTRKVL  861

Query  3256  llylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAK  3077
             L  LS  S K  S+++ I  +A+S+ + I SF+  + ++  +   L++ +K  ++     
Sbjct  862   LSRLSSNSIKAQSESSNIASEAVSNHRIITSFSCNKMVMRVFKETLEKPMKASVRKSWMA  921

Query  3076  GLAVGSTG-LSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYF  2900
             G+ +G+   L+F  WA   WYG +L+     S G ++      V  G  +  A       
Sbjct  922   GIGMGTAQCLTFMSWALDFWYGGKLVERGSISAGDVFKTFFILVSTGKVIAEAGSMTSDL  981

Query  2899  TEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNL  2720
                + + + +F  ++R   I G+   G+ L+   GE+E ++V+FAYPSRP  LVL   ++
Sbjct  982   ARGATSLTSVFQILERETLIKGD--GGLKLNRFNGEIEMRDVEFAYPSRPRVLVLNGFSV  1039

Query  2719  KVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQ  2540
             +V+ G  + LVG SG GKST + L+QRFYD   G I +DGV++  + ++W R ++G+V Q
Sbjct  1040  RVKGGTWLGLVGRSGCGKSTVVGLVQRFYDVQRGVIRVDGVDVREMDLRWFRERVGMVGQ  1099

Query  2539  EHALFGTSIRENIMLGKLGGSMEE--------VVAAAMTANAHDFIRQLPQGYETKVGER  2384
             E  +F  SI++NI  GK G             VV AA  A AH+FI  L  GY T+ GER
Sbjct  1100  EAVIFSGSIKDNIQFGKAGAGAGAGASASESEVVEAAKAARAHEFISSLKDGYLTECGER  1159

Query  2383  GALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAH  2204
             G  LSGGQKQRI IARAI++NP ILLLDEATSALD++SE  V  AL+    G+T LVV H
Sbjct  1160  GIQLSGGQKQRIGIARAILRNPRILLLDEATSALDAQSEHTVNIALETVMKGKTCLVVTH  1219

Query  2203  KLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQM  2090
             +L+TI   D IA V+ G ++EQG+ + L  K GH++Q+
Sbjct  1220  RLNTIDKVDTIAFVADGKVVEQGTPAYLKAKKGHFSQL  1257



>gb|EMS65074.1| Putative ABC transporter B family member 8 [Triticum urartu]
Length=1167

 Score =  1438 bits (3722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 769/1194 (64%), Positives = 952/1194 (80%), Gaps = 37/1194 (3%)
 Frame = -2

Query  3781  MCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMREVEKCSLYFVLLG  3602
             M LGTLGAIGDG ST+ LL++ S + N+LG G    Q   ++ + M ++EK  L FV L 
Sbjct  1     MALGTLGAIGDGCSTHLLLIFASDVMNSLGRGHAQQQGSATSVHFMHDIEKSCLNFVYLA  60

Query  3601  LAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTS  3422
              A++V+  MEGYCWS+TSERQVL+IR+ YLEAILRQEV FFDSQEATTSEI NSISKD S
Sbjct  61    FAILVVASMEGYCWSRTSERQVLRIRHLYLEAILRQEVAFFDSQEATTSEIINSISKDAS  120

Query  3421  LIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllyls  3242
             LIQEVLSEKVP+FLMH++VF+SGL FSTYFSWRL+LV+YP +++LIIPGLIYGKYLLYLS
Sbjct  121   LIQEVLSEKVPLFLMHSTVFVSGLAFSTYFSWRLALVSYPLVLLLIIPGLIYGKYLLYLS  180

Query  3241  kksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVG  3062
             ++S +EY+KAN +V QAL SIKT+YSFTAE+ I++RY++ILD+TI LG+K GIAKGLAVG
Sbjct  181   RESRREYAKANSLVEQALGSIKTVYSFTAEKGIIQRYTAILDKTINLGIKQGIAKGLAVG  240

Query  3061  STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVA  2882
              TGLSFAIWAFLAWYGSRL+M+  ESGGRIYA+GIS+VLGGLSLGMALPE+K+F EASVA
Sbjct  241   FTGLSFAIWAFLAWYGSRLVMYHHESGGRIYASGISFVLGGLSLGMALPELKHFIEASVA  300

Query  2881  ASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGK  2702
             A+RI  RI+RVP+I+ +D  G+VLD +RGE+EF+++ FAYPSRP                
Sbjct  301   ATRILERINRVPQINDDDPKGLVLDQVRGEIEFESIHFAYPSRPN---------------  345

Query  2701  TVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFG  2522
                               + RFYD++ G++ IDG +I  L +K +R +MGLVSQ+HALFG
Sbjct  346   ------------------MTRFYDSSEGTVKIDGFDIKKLNLKSIRSKMGLVSQDHALFG  387

Query  2521  TSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriai  2342
             TSI+ENI+ GK   +M+E+ AAAMTANAH+F+  LP+GYETK+GERGALLSGGQKQRIAI
Sbjct  388   TSIKENILFGKPDATMDELYAAAMTANAHNFVMGLPEGYETKIGERGALLSGGQKQRIAI  447

Query  2341  araiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVV  2162
             ARA++KNP ILLLDEATSALDSESEKLVQ ALDQAS GRTTLVVAHKLST++NAD IAVV
Sbjct  448   ARAVLKNPAILLLDEATSALDSESEKLVQHALDQASMGRTTLVVAHKLSTVKNADQIAVV  507

Query  2161  SGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSSNAGRQSTEKsspavla  1982
              GG I E G+H EL+ K G Y+++ KLQ+  S  DQ+      +++  +++        A
Sbjct  508   DGGSIAEIGTHDELINKGGPYSRLVKLQKMVSYIDQETD-QFRASSAARTSASRLSMSRA  566

Query  1981  ssplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIG  1802
             S   L     K    +   P+PSFSRLL +N  EWKQ LIGSISA+ +G++QP YALTIG
Sbjct  567   SPMPLTPGVSKETGSYVSPPAPSFSRLLAMNAPEWKQALIGSISALVYGSLQPIYALTIG  626

Query  1801  GMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLE  1622
             GMI+AFF   H EM A I ++ L+F  L L+SI +NL QHY FAYMGEHL RRIR+++LE
Sbjct  627   GMIAAFFVQDHNEMNAIISRYALIFCSLSLVSIAVNLLQHYNFAYMGEHLVRRIRVQVLE  686

Query  1621  KILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVA  1442
             KILTFE AWFDE+ NSSG+LC+RLS+E+++VK+LVADR+SLL+Q A  + IA+ MGL+VA
Sbjct  687   KILTFEAAWFDEDTNSSGSLCSRLSDESSLVKTLVADRISLLLQTACGIVIAVTMGLIVA  746

Query  1441  WKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSIN  1262
             WKLALVMIAVQP T++C+Y +K++LS ++    KAQ  STQIA+EAVYNHR+VTSFG  +
Sbjct  747   WKLALVMIAVQPCTMICYYAKKIVLSNVSRDLAKAQYESTQIAIEAVYNHRMVTSFGCSS  806

Query  1261  KVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDV  1082
             K+L +F++ Q+EP ++A+KKSW+AGI  G +  LTF+ WALDFWYGGKL  +GEIS+GDV
Sbjct  807   KILQLFEHTQEEPLRKARKKSWVAGITTGLSPCLTFLSWALDFWYGGKLAQSGEISAGDV  866

Query  1081  FKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLE  902
             FKTFF+LVSTGK+IADAGSMTSDLAKGS AVAS+F +LDR SI  SP N +V+       
Sbjct  867   FKTFFVLVSTGKLIADAGSMTSDLAKGSNAVASVFEVLDRKSI--SPQNSQVEKDNPK-S  923

Query  901   KLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDV  722
             K+ G+IE KKV+FAYP+RP+  IL++F L+VKAG+SIGLVG+SG GKSTI+ LI+RFYDV
Sbjct  924   KIQGRIEFKKVDFAYPTRPQCLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDV  983

Query  721   DGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDaseneiieaaka  542
             D G++R+DG+DVR  ++ WYR   ALVSQEP ++SG++RDNI FGK +A E EI+EAAKA
Sbjct  984   DRGAVRIDGMDVREMNVLWYRGFTALVSQEPAMFSGSVRDNIAFGKPEADEEEIVEAAKA  1043

Query  541   anAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESE  362
             ANAH+FISSLK GYDT+CGE G+QLSGGQKQRIAIARAIIR+P ILLLDEATSALD +SE
Sbjct  1044  ANAHEFISSLKDGYDTDCGEHGIQLSGGQKQRIAIARAIIRDPAILLLDEATSALDAQSE  1103

Query  361   QVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNKRG  200
             QVVQEALD IM GRTT+VVAHRLNTIKN DSIA + EGKV+E GTY QL NK+G
Sbjct  1104  QVVQEALDRIMTGRTTIVVAHRLNTIKNADSIAFLGEGKVIERGTYPQLMNKKG  1157


 Score =   316 bits (809),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 193/524 (37%), Positives = 300/524 (57%), Gaps = 3/524 (1%)
 Frame = -2

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L F  L L  + +  ++ Y ++   E  V +IR + LE IL  E  +FD    ++
Sbjct  644   ISRYALIFCSLSLVSIAVNLLQHYNFAYMGEHLVRRIRVQVLEKILTFEAAWFDEDTNSS  703

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
               + + +S ++SL++ ++++++ + L      +  +      +W+L+LV        +I 
Sbjct  704   GSLCSRLSDESSLVKTLVADRISLLLQTACGIVIAVTMGLIVAWKLALVMIAVQPCTMIC  763

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
                    L  +S+   K   ++  I  +A+ + + + SF     IL+ +    +  ++  
Sbjct  764   YYAKKIVLSNVSRDLAKAQYESTQIAIEAVYNHRMVTSFGCSSKILQLFEHTQEEPLRKA  823

Query  3097  MKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
              K     G+  G S  L+F  WA   WYG +L      S G ++      V  G  +  A
Sbjct  824   RKKSWVAGITTGLSPCLTFLSWALDFWYGGKLAQSGEISAGDVFKTFFVLVSTGKLIADA  883

Query  2920  LPEVKYFTEASVAASRIFSRIDR--VPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
                     + S A + +F  +DR  +   + + +       I+G +EFK V FAYP+RP+
Sbjct  884   GSMTSDLAKGSNAVASVFEVLDRKSISPQNSQVEKDNPKSKIQGRIEFKKVDFAYPTRPQ  943

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              L+L+D +L V+AG ++ LVG SG GKST I L+QRFYD + G++ IDG+++  + V W 
Sbjct  944   CLILQDFSLDVKAGTSIGLVGRSGCGKSTIIGLIQRFYDVDRGAVRIDGMDVREMNVLWY  1003

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             RG   LVSQE A+F  S+R+NI  GK     EE+V AA  ANAH+FI  L  GY+T  GE
Sbjct  1004  RGFTALVSQEPAMFSGSVRDNIAFGKPEADEEEIVEAAKAANAHEFISSLKDGYDTDCGE  1063

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
              G  LSGGQKQRIAIARAII++P ILLLDEATSALD++SE++VQ+ALD+   GRTT+VVA
Sbjct  1064  HGIQLSGGQKQRIAIARAIIRDPAILLLDEATSALDAQSEQVVQEALDRIMTGRTTIVVA  1123

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQR  2075
             H+L+TI+NAD IA +  G +IE+G++ +LM K G +  +A LQ+
Sbjct  1124  HRLNTIKNADSIAFLGEGKVIERGTYPQLMNKKGAFFNLATLQK  1167



>sp|Q9LHK4.1|AB8B_ARATH RecName: Full=Putative ABC transporter B family member 8; Short=ABC 
transporter ABCB.8; Short=AtABCB8; AltName: Full=P-glycoprotein 
8; AltName: Full=Putative multidrug resistance protein 
22 [Arabidopsis thaliana]
 dbj|BAB02613.1| P-glycoprotein; multi-drug resistance related; ABC transporter-like 
protein [Arabidopsis thaliana]
Length=1241

 Score =  1427 bits (3694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 772/1220 (63%), Positives = 965/1220 (79%), Gaps = 24/1220 (2%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             VIFR+ADWIDI LM LG++GAIGDGMSTN  L++VS + NTLGY  +N  S         
Sbjct  20    VIFRFADWIDIVLMVLGSVGAIGDGMSTNVSLVFVSRIMNTLGYSQHNPSSTN----FKE  75

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
             E++KCSLYFV LGLA++ + FMEGYCWSKTSERQV+KIR  YLEA+LRQEV FFDS + +
Sbjct  76    EIQKCSLYFVYLGLAILGVAFMEGYCWSKTSERQVMKIRRTYLEAVLRQEVSFFDS-DIS  134

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             TSEI ++IS DTSLIQ++LSEKVPIFLMH SVF++GL FS YFSWRL++VA PT+V+L+I
Sbjct  135   TSEIIHTISTDTSLIQQLLSEKVPIFLMHISVFITGLVFSAYFSWRLTVVAIPTLVLLLI  194

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PGLIYGKYL++LSKKSFKEY+KAN IV QALSSIKTI SFTAE  I+++YS +L+R  KL
Sbjct  195   PGLIYGKYLVHLSKKSFKEYTKANSIVEQALSSIKTILSFTAETQIIKKYSEVLERHKKL  254

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K G+AKGLAVGS+G+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS+VLGG+SLG A
Sbjct  255   GLKQGLAKGLAVGSSGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFVLGGISLGTA  314

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGED-KSGMVL-DTIRGELEFKNVKFAYPSRPE  2747
             L E++YF+EASVAA+RI SRIDR+ +IDGED K G +  + ++G +EF+ V   Y SRPE
Sbjct  315   LTEIRYFSEASVAAARICSRIDRISEIDGEDTKKGFIPGEKMKGRVEFERVTLVYLSRPE  374

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             +++LKD  L V+ G++VAL+GASGSGKST IALLQRFYD   G + IDG +I  LQ+KW+
Sbjct  375   TIILKDFTLTVDVGQSVALMGASGSGKSTVIALLQRFYDPCEGFVRIDGFDIKTLQLKWM  434

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R  +G+VSQ+HALFGTSI EN+M GK   SM+EV++AA  ANAH FI QLP GY+T +G 
Sbjct  435   RQHIGVVSQDHALFGTSIMENLMFGKNKASMDEVISAAKAANAHGFITQLPNGYDTHIGN  494

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RGALLSGGQKQRIAIARAII+NPVILLLDEATSALD ESE L+Q+ALDQ +AGRTTLVVA
Sbjct  495   RGALLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLIQNALDQVAAGRTTLVVA  554

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQ----DQSFA  2039
             HKLST+R A++IA++  G + E GSH +LM KN HYA++ KLQRQF    Q    D+  +
Sbjct  555   HKLSTVRGANIIAMLENGSVRELGSHEDLMTKNNHYAKLVKLQRQFGHEHQQDLQDRVNS  614

Query  2038  PSSNAGRQSTEKsspavlassplLIETAQKVPTDH-----HHQPSPSFSRLLGLNLTEWK  1874
             P       +          SSP LI +   + ++H      + PS SF+RLL     EWK
Sbjct  615   PEIQQRWSTMNSVIRLSNRSSPDLIVSPITLESNHTTKINENIPSTSFTRLLPFVSPEWK  674

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
               L+G ISA  FGA+QP YAL+IGGMISAFF+ S +EMQ +I  + L+F  L  LSITLN
Sbjct  675   SSLVGCISATTFGAIQPVYALSIGGMISAFFAKSSQEMQDKIHIYSLIFISLTFLSITLN  734

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             L QHY FA MGE L +R+RL+MLEKI TFE AWFD E N +  +C+RL+NE ++VKSLVA
Sbjct  735   LLQHYSFAKMGERLMQRLRLKMLEKIFTFEPAWFDVEENFTSEICSRLNNEVSIVKSLVA  794

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  S VTIAM++GL+++WKLALVMIAVQPL+ILCFYT+KVLLS I+  +  AQ
Sbjct  795   DRISLLVQTISGVTIAMIIGLLISWKLALVMIAVQPLSILCFYTKKVLLSKISNNYAYAQ  854

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             N S+QIA EA+YNH+IVTS GS  K+++IFDNAQ E +++ +K +WLAG G+GSAQ LTF
Sbjct  855   NRSSQIASEAIYNHKIVTSLGSTKKIIEIFDNAQYEAKRKGRKAAWLAGFGMGSAQCLTF  914

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             + WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKG+AA++S+F 
Sbjct  915   LTWALDFWYGGVLVQKGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGTAAISSVFN  974

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDRPS      + +  N G  +  + G+IE+K ++F+YP+RP   +LR+F L++K G+S
Sbjct  975   ILDRPS------SHENTNHGEKMGTIQGRIELKNIDFSYPNRPSILVLRDFSLDIKPGTS  1028

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             IGLVG SG GKST++ALI+RFYDV+ G +++D  ++R  +I WYR+  ALVSQEPV+YSG
Sbjct  1029  IGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDSENLRDINIKWYRKHTALVSQEPVVYSG  1088

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +I+DNI+ G+ +A+E+E++EAAKAANAH FIS+++KGY TECGERGVQLSGGQKQRIAIA
Sbjct  1089  SIQDNIILGRPEATEDEVVEAAKAANAHDFISAMEKGYKTECGERGVQLSGGQKQRIAIA  1148

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLDSIAL  260
             RA +R+P ILLLDE TS+LD  SEQ VQ+AL  IM  R  TT+VVAHRLNT+KNLD IAL
Sbjct  1149  RAFLRSPIILLLDEVTSSLDSNSEQEVQDALARIMASRNMTTVVVAHRLNTLKNLDCIAL  1208

Query  259   VSEGKVVEHGTYSQLKNKRG  200
             + +G V+E G+Y  LKN  G
Sbjct  1209  IVDGTVIETGSYDHLKNIGG  1228


 Score =   310 bits (794),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 190/517 (37%), Positives = 297/517 (57%), Gaps = 6/517 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F+ L    + +  ++ Y ++K  ER + ++R K LE I   E  +FD +E  TSEI 
Sbjct  720   SLIFISLTFLSITLNLLQHYSFAKMGERLMQRLRLKMLEKIFTFEPAWFDVEENFTSEIC  779

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + ++ + S+++ ++++++ + +   S     +      SW+L+LV      + I+     
Sbjct  780   SRLNNEVSIVKSLVADRISLLVQTISGVTIAMIIGLLISWKLALVMIAVQPLSILCFYTK  839

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S       ++++ I  +A+ + K + S  + + I+E + +      + G K  
Sbjct  840   KVLLSKISNNYAYAQNRSSQIASEAIYNHKIVTSLGSTKKIIEIFDNAQYEAKRKGRKAA  899

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G  +GS   L+F  WA   WYG  L+  KGE S G ++      V  G  +  A   
Sbjct  900   WLAGFGMGSAQCLTFLTWALDFWYGGVLV-QKGEISAGDVFKTFFVLVSTGKVIAEAGSM  958

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
                  + + A S +F+ +DR P        G  + TI+G +E KN+ F+YP+RP  LVL+
Sbjct  959   TSDLAKGTAAISSVFNILDR-PSSHENTNHGEKMGTIQGRIELKNIDFSYPNRPSILVLR  1017

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
             D +L ++ G ++ LVG SG GKST IAL+QRFYD   G + ID   +  + +KW R    
Sbjct  1018  DFSLDIKPGTSIGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDSENLRDINIKWYRKHTA  1077

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LVSQE  ++  SI++NI+LG+   + +EVV AA  ANAHDFI  + +GY+T+ GERG  L
Sbjct  1078  LVSQEPVVYSGSIQDNIILGRPEATEDEVVEAAKAANAHDFISAMEKGYKTECGERGVQL  1137

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKL  2198
             SGGQKQRIAIARA +++P+ILLLDE TS+LDS SE+ VQDAL +  A R  TT+VVAH+L
Sbjct  1138  SGGQKQRIAIARAFLRSPIILLLDEVTSSLDSNSEQEVQDALARIMASRNMTTVVVAHRL  1197

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMA  2087
             +T++N D IA++  G +IE GS+  L    G ++++A
Sbjct  1198  NTLKNLDCIALIVDGTVIETGSYDHLKNIGGQFSRLA  1234



>ref|XP_010430925.1| PREDICTED: putative ABC transporter B family member 8 [Camelina 
sativa]
Length=1242

 Score =  1424 bits (3685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 773/1222 (63%), Positives = 976/1222 (80%), Gaps = 28/1222 (2%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             ++FR+ADWIDI LM LGTLGAIGDGMSTN  L++ S + NTLGYG +N  S         
Sbjct  21    IMFRFADWIDIVLMVLGTLGAIGDGMSTNVSLVFASRIMNTLGYGQHNPNSTT----FKD  76

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
             E++KCSLYFV LGLA++ + FMEGYCWSKTSERQV+KIR  YLEA+LRQEV FFDS +A+
Sbjct  77    EIQKCSLYFVYLGLAILGVAFMEGYCWSKTSERQVVKIRRTYLEAVLRQEVSFFDS-DAS  135

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             TSEI ++IS DTSLIQ++LSEKVPIFLMHTSVF++GL FS YFSWRL++VA PT+ +L+I
Sbjct  136   TSEIIHTISTDTSLIQQLLSEKVPIFLMHTSVFITGLVFSAYFSWRLTIVAMPTLALLLI  195

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PGLIYGKYL+ LSKKSFKE++KAN I+ QALSSIKTI SFTAE  I+++YS +L+R  KL
Sbjct  196   PGLIYGKYLVNLSKKSFKEHTKANSIIEQALSSIKTILSFTAETQIIKKYSKVLERHKKL  255

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K G+AKGLAVGS+G+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS+VL G+SLG A
Sbjct  256   GLKQGLAKGLAVGSSGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFVLSGISLGTA  315

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGEDKS-GMVLDT-IRGELEFKNVKFAYPSRPE  2747
             L E++YF+EASVAA+RI SRIDR+ +IDGED + G + +  ++G LEF++V F YPSRP+
Sbjct  316   LTEIRYFSEASVAAARICSRIDRISEIDGEDTTKGFIPEVKMKGRLEFEHVTFIYPSRPK  375

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             S+VLK+  +  + G+++AL+GASGSGKST IAL+QRFYD   G + IDG +I  LQ+KWL
Sbjct  376   SVVLKNFTITADVGESIALMGASGSGKSTVIALMQRFYDPCEGFVRIDGFDIKTLQLKWL  435

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             RG +G+VSQ+HALFGTSIRENIM GK   SM+EV++AA TANAH FI  LP GY+T VG+
Sbjct  436   RGHIGVVSQDHALFGTSIRENIMFGKDNASMDEVISAAKTANAHGFITHLPNGYDTHVGD  495

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RGALLSGGQKQRIAIARAII+NPVILLLDEATSALD ESE L+Q+ALDQ + GRTTLVVA
Sbjct  496   RGALLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLIQNALDQVAMGRTTLVVA  555

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFA---P  2036
             HKLSTIR A++IA++  G + E GSH +LM KN HYA++ KLQ Q S  +Q Q  +    
Sbjct  556   HKLSTIRGANIIAMLENGSVKELGSHEDLMMKNNHYAKLVKLQMQLS-HEQRQDLSDGNK  614

Query  2035  SSNAGRQSTEKsspavla--------ssplLIETAQKVPTDHHHQPSPSFSRLLGLNLTE  1880
             +   G+  T K+S + L+         SP+ +E+   +  D +  PS SF+RL+ +   E
Sbjct  615   NPEIGQYWTTKNSISRLSIRSSPDLIVSPISLESIHTIKVDDN-IPSTSFTRLIPMVSPE  673

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WK  L+G ISA  FGA+QP YALTIGGMISAFF+ + +EM+ +I+ + ++F  L  LSI+
Sbjct  674   WKSSLVGCISAATFGAIQPVYALTIGGMISAFFANNSQEMEDKIRIYSIIFTSLTFLSIS  733

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             LNL QHY F+ MGE L +R+RL+MLEKI TFE AWFD E N SGAL +RLSNEA++VKSL
Sbjct  734   LNLLQHYSFSKMGERLMQRLRLKMLEKIFTFEPAWFDMEENFSGALSSRLSNEASIVKSL  793

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             VADR+SLLVQ  S VTIAM++GL+++WKLALVMIAVQPL+ILCFYTRKVLLS I+  +  
Sbjct  794   VADRISLLVQTISGVTIAMIIGLLLSWKLALVMIAVQPLSILCFYTRKVLLSNISYNYDY  853

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQN S+QIA EA+YNH+IVTS GS  K+++IFD AQ + +++ +K +WLAG G+GSAQ L
Sbjct  854   AQNRSSQIASEAIYNHKIVTSLGSTKKIIEIFDKAQYDAKRKGKKATWLAGFGMGSAQCL  913

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
             TF  WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAA++S+
Sbjct  914   TFFTWALDFWYGGVLVQKGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAISSV  973

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             F ILDR S      + +  N G N+E + G IE+K ++FAYP+RP+  +L++F L++K G
Sbjct  974   FRILDRRS------SQENINHGANIETIIGGIEMKNIDFAYPNRPKITVLQKFSLDIKPG  1027

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
             +SIGLVG SG GKST++ALI+RFYDV+ G +++D VD++  DI WYR+  ALV+QEPVIY
Sbjct  1028  TSIGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDSVDLKDIDIKWYRKHTALVTQEPVIY  1087

Query  619   SGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             SG+IR+NI+ G+ +A+E+E++ AA+AANAH FIS+++KGY+TECGERG+QLSGGQKQRIA
Sbjct  1088  SGSIRENIILGRPEATEDEVVGAAQAANAHDFISAMEKGYETECGERGIQLSGGQKQRIA  1147

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLDSI  266
             IARA +RNP ILLLDE TS+LD  SE  VQ+AL  IM  R  TT+VVAHRLNT+KNLD I
Sbjct  1148  IARAFLRNPIILLLDEVTSSLDSNSEHEVQDALAKIMASRKMTTVVVAHRLNTLKNLDCI  1207

Query  265   ALVSEGKVVEHGTYSQLKNKRG  200
              ++++G VVE G+Y  LKN  G
Sbjct  1208  TVIADGTVVETGSYDLLKNIGG  1229


 Score =   300 bits (768),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 188/516 (36%), Positives = 293/516 (57%), Gaps = 6/516 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             S+ F  L    + +  ++ Y +SK  ER + ++R K LE I   E  +FD +E  +  ++
Sbjct  721   SIIFTSLTFLSISLNLLQHYSFSKMGERLMQRLRLKMLEKIFTFEPAWFDMEENFSGALS  780

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +S + S+++ ++++++ + +   S     +      SW+L+LV      + I+     
Sbjct  781   SRLSNEASIVKSLVADRISLLVQTISGVTIAMIIGLLLSWKLALVMIAVQPLSILCFYTR  840

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S       ++++ I  +A+ + K + S  + + I+E +        + G K  
Sbjct  841   KVLLSNISYNYDYAQNRSSQIASEAIYNHKIVTSLGSTKKIIEIFDKAQYDAKRKGKKAT  900

Query  3085  IAKGLAVGSTG-LSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G  +GS   L+F  WA   WYG  L+  KGE S G ++      V  G  +  A   
Sbjct  901   WLAGFGMGSAQCLTFFTWALDFWYGGVLV-QKGEISAGDVFKTFFVLVSTGKVIAEAGSM  959

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
                  + S A S +F  +DR    +  +  G  ++TI G +E KN+ FAYP+RP+  VL+
Sbjct  960   TSDLAKGSAAISSVFRILDRRSSQENINH-GANIETIIGGIEMKNIDFAYPNRPKITVLQ  1018

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
               +L ++ G ++ LVG SG GKST IAL+QRFYD   G + ID V++  + +KW R    
Sbjct  1019  KFSLDIKPGTSIGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDSVDLKDIDIKWYRKHTA  1078

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LV+QE  ++  SIRENI+LG+   + +EVV AA  ANAHDFI  + +GYET+ GERG  L
Sbjct  1079  LVTQEPVIYSGSIRENIILGRPEATEDEVVGAAQAANAHDFISAMEKGYETECGERGIQL  1138

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKL  2198
             SGGQKQRIAIARA ++NP+ILLLDE TS+LDS SE  VQDAL +  A R  TT+VVAH+L
Sbjct  1139  SGGQKQRIAIARAFLRNPIILLLDEVTSSLDSNSEHEVQDALAKIMASRKMTTVVVAHRL  1198

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQM  2090
             +T++N D I V++ G ++E GS+  L    G ++++
Sbjct  1199  NTLKNLDCITVIADGTVVETGSYDLLKNIGGQFSKL  1234



>ref|XP_006293275.1| hypothetical protein CARUB_v10019611mg [Capsella rubella]
 gb|EOA26173.1| hypothetical protein CARUB_v10019611mg [Capsella rubella]
Length=1195

 Score =  1357 bits (3513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 742/1223 (61%), Positives = 931/1223 (76%), Gaps = 76/1223 (6%)
 Frame = -2

Query  3820  VIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMR  3641
             V+FR+ADWIDI LM                                              
Sbjct  20    VMFRFADWIDIVLM----------------------------------------------  33

Query  3640  EVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEAT  3461
                 CSLYFV LGLAV+ + FMEGYCWSKTSERQV+KIR  YLEA+LRQEV FFDS +A+
Sbjct  34    ----CSLYFVYLGLAVLGVAFMEGYCWSKTSERQVVKIRRTYLEAVLRQEVSFFDS-DAS  88

Query  3460  TSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVilii  3281
             TSEI ++IS DTSLIQ++LSEKVPIFLMH SVF++GL FS YFSWRL++VA PT+V+L+I
Sbjct  89    TSEIIHTISTDTSLIQQLLSEKVPIFLMHISVFITGLVFSAYFSWRLTIVALPTLVLLLI  148

Query  3280  pgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKL  3101
             PGLIYG YL++L+KKSF+E   AN IV QALSSIKTI SFTAE  I+++YS +L+R  KL
Sbjct  149   PGLIYGNYLVHLTKKSFREDVIANSIVEQALSSIKTILSFTAETQIIKKYSKVLERHKKL  208

Query  3100  GMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMA  2921
             G+K G+AKGLAVGS+G+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS++L G+SLG A
Sbjct  209   GLKKGLAKGLAVGSSGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFILSGISLGTA  268

Query  2920  LPEVKYFTEASVAASRIFSRIDRVPKIDGED--KSGMVLDTIRGELEFKNVKFAYPSRPE  2747
             L E++YF+EASVAA+RI SRIDR+ +IDGED  K  +  D ++G +EF+ V F YPSRP+
Sbjct  269   LTEIRYFSEASVAAARICSRIDRISEIDGEDTTKGFIPKDKMKGRVEFECVTFIYPSRPK  328

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             S+VLK+  L  + G+TVAL+G SGSGKST I+LLQRFYD   G + IDG +I  LQ+KW+
Sbjct  329   SVVLKNFTLTADVGETVALMGTSGSGKSTVISLLQRFYDPCEGFVRIDGFDIKMLQLKWM  388

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R  +G+VSQ+HALFGTSIRENIM GK   SM+E++ AA  ANAH FI QLP GY+T VG+
Sbjct  389   REHIGVVSQDHALFGTSIRENIMFGKDNASMDEIILAAKAANAHGFITQLPNGYDTHVGD  448

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RGALLSGGQKQRIAIARAII+NPVILLLDEATSALD ESE L+Q+ALDQ +AGRTTLVVA
Sbjct  449   RGALLSGGQKQRIAIARAIIRNPVILLLDEATSALDGESETLIQNALDQVAAGRTTLVVA  508

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCAD-QD-------  2051
             HKLST+R A++IA++  G + E GSH +L+ KN HYA++ KLQ +FS    QD       
Sbjct  509   HKLSTVRGANIIAMLENGFVKELGSHEDLVMKNNHYAKLVKLQTEFSHEHRQDLSDGIKT  568

Query  2050  ----QSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLT  1883
                 Q +A  ++  RQS   S   V++     +E+      D +  P+ SF+RL+ L   
Sbjct  569   PEIRQYWATRNSINRQSIRSSPDLVVSPRS--LESIHTTKIDDN-SPNTSFTRLIPLVSL  625

Query  1882  EWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsi  1703
             EWK  L+G ISA  FGA+QP YALTIGGMISAFF+ + +EMQ +I+ + L+F  L +LSI
Sbjct  626   EWKSSLVGCISAATFGAIQPVYALTIGGMISAFFAKNSQEMQDKIRIYSLIFTSLTVLSI  685

Query  1702  tlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKS  1523
             +LNL QHY FA MGE L +R+R++MLEKI TFE AWFD E N SG L +RLSNEA++VKS
Sbjct  686   SLNLLQHYSFAKMGETLMQRLRVKMLEKIFTFEPAWFDVEENFSGELSSRLSNEASIVKS  745

Query  1522  LVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFV  1343
             +VADR+SLLVQ  S VTIAM++GL+V+WKLALVMIAVQPL+ILCFYT+KVLLS I+  + 
Sbjct  746   IVADRISLLVQTISGVTIAMIIGLLVSWKLALVMIAVQPLSILCFYTKKVLLSNISHNYA  805

Query  1342  KAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQG  1163
              AQN S+QIA EA+YNH+IVTS GS  K+++IFD AQ   +++ +  +WLAG G+G AQ 
Sbjct  806   YAQNRSSQIASEAIYNHKIVTSLGSTKKIIEIFDKAQYGAKRKGKNATWLAGFGMGLAQC  865

Query  1162  LTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVAS  983
             LTF+ WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAA++S
Sbjct  866   LTFLTWALDFWYGGVLVQKGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAISS  925

Query  982   IFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKA  803
             +F ILDR   I+S  N    N G   E + G IE+K + F+Y +RP  P+LR+F L +K 
Sbjct  926   VFKILDR---ISSQEN---TNPGEKFETILGGIELKDIEFSYSNRPTIPVLRQFSLNIKP  979

Query  802   GSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVI  623
             G+SIGLVG SG GKST++ALI+RFYDV+ G +++DGV++R+ DI WYR+  ALVSQEPV+
Sbjct  980   GTSIGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDGVELRNIDIKWYRQHTALVSQEPVV  1039

Query  622   YSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQri  443
             YSG+IR+NI+ G+ +A+ +E++ AAKAAN H FIS+++KGY+TECGERG+QLSGGQKQRI
Sbjct  1040  YSGSIRENIILGRPEATADEVVGAAKAANTHDFISAMEKGYETECGERGMQLSGGQKQRI  1099

Query  442   aiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR--TTMVVAHRLNTIKNLDS  269
             AIARA +RNP ILLLDE TS+LD +SE  VQ+AL  IM  R  TT+VVAHR+NT+ NLD 
Sbjct  1100  AIARAFLRNPIILLLDEVTSSLDSKSEHEVQDALARIMASRKMTTVVVAHRINTLNNLDC  1159

Query  268   IALVSEGKVVEHGTYSQLKNKRG  200
             IA++++G VVE G+Y +LKN RG
Sbjct  1160  IAVIADGTVVETGSYDRLKNSRG  1182


 Score =   298 bits (763),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 185/516 (36%), Positives = 293/516 (57%), Gaps = 6/516 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             SL F  L +  + +  ++ Y ++K  E  + ++R K LE I   E  +FD +E  + E++
Sbjct  674   SLIFTSLTVLSISLNLLQHYSFAKMGETLMQRLRVKMLEKIFTFEPAWFDVEENFSGELS  733

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +S + S+++ ++++++ + +   S     +      SW+L+LV      + I+     
Sbjct  734   SRLSNEASIVKSIVADRISLLVQTISGVTIAMIIGLLVSWKLALVMIAVQPLSILCFYTK  793

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S       ++++ I  +A+ + K + S  + + I+E +        + G    
Sbjct  794   KVLLSNISHNYAYAQNRSSQIASEAIYNHKIVTSLGSTKKIIEIFDKAQYGAKRKGKNAT  853

Query  3085  IAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGE-SGGRIYAAGISYVLGGLSLGMALPE  2912
                G  +G +  L+F  WA   WYG  L+  KGE S G ++      V  G  +  A   
Sbjct  854   WLAGFGMGLAQCLTFLTWALDFWYGGVLV-QKGEISAGDVFKTFFVLVSTGKVIAEAGSM  912

Query  2911  VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLK  2732
                  + S A S +F  +DR+   +  +  G   +TI G +E K+++F+Y +RP   VL+
Sbjct  913   TSDLAKGSAAISSVFKILDRISSQENTNP-GEKFETILGGIELKDIEFSYSNRPTIPVLR  971

Query  2731  DLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMG  2552
               +L ++ G ++ LVG SG GKST IAL+QRFYD   G + IDGVE+  + +KW R    
Sbjct  972   QFSLNIKPGTSIGLVGTSGCGKSTVIALIQRFYDVEIGCVKIDGVELRNIDIKWYRQHTA  1031

Query  2551  LVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             LVSQE  ++  SIRENI+LG+   + +EVV AA  AN HDFI  + +GYET+ GERG  L
Sbjct  1032  LVSQEPVVYSGSIRENIILGRPEATADEVVGAAKAANTHDFISAMEKGYETECGERGMQL  1091

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGR--TTLVVAHKL  2198
             SGGQKQRIAIARA ++NP+ILLLDE TS+LDS+SE  VQDAL +  A R  TT+VVAH++
Sbjct  1092  SGGQKQRIAIARAFLRNPIILLLDEVTSSLDSKSEHEVQDALARIMASRKMTTVVVAHRI  1151

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQM  2090
             +T+ N D IAV++ G ++E GS+  L    G ++++
Sbjct  1152  NTLNNLDCIAVIADGTVVETGSYDRLKNSRGQFSKL  1187



>ref|XP_006839128.1| hypothetical protein AMTR_s00090p00165440 [Amborella trichopoda]
 gb|ERN01697.1| hypothetical protein AMTR_s00090p00165440 [Amborella trichopoda]
Length=1245

 Score =  1224 bits (3168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/1216 (54%), Positives = 896/1216 (74%), Gaps = 19/1216 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D+ LM LG  GAIGDG ST  +LL  S + N LG     +    S   
Sbjct  22    SLWSIFMHADSVDVLLMVLGLFGAIGDGFSTPVMLLITSKIMNNLG-----NGPSASPLQ  76

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 V++ S+  + +   + V  F+EGYCW+KT ERQ  ++R +YL+A+LRQ+VG+FD Q
Sbjct  77    FTSNVDQNSVNLLYMACGLWVASFLEGYCWTKTGERQASRMRERYLKAVLRQDVGYFDLQ  136

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
              A+T+++   +S D+ +IQ+ LSEKVP F+M+T  FL     +    WRL+LVA P +++
Sbjct  137   VASTADVITGVSSDSLVIQDCLSEKVPNFIMNTMTFLGSYVVAFLLLWRLALVALPFVML  196

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGL+YG+ L+ L++K  +EY+KA  +V QA+SS++T+YSF AE  ++  +S  LD T
Sbjct  197   LIIPGLMYGRMLMGLARKMREEYTKAGVMVEQAISSVRTVYSFVAESKVMSDFSKSLDGT  256

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             ++LG+K G+AKGLA+GS G+SFAIWAF++WYGSRL+M+  E GG ++A G S  +GGL+L
Sbjct  257   VRLGLKQGLAKGLAIGSNGISFAIWAFMSWYGSRLVMYHAERGGTVFAVGASITVGGLAL  316

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EAS A  RI   I RVP ID ++  G++LDT+ GE+EF++++FAYPSRP
Sbjct  317   GAGLSNLKYFSEASAAGERIRQVIRRVPAIDSDNMEGLILDTVSGEVEFRDIEFAYPSRP  376

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+++ ++ +L+V AG+TVALVG+SGSGKSTAIALL+RFYD   G + +DGV I+ LQ+KW
Sbjct  377   ETVIFRNFSLRVPAGQTVALVGSSGSGKSTAIALLERFYDPLGGDVLLDGVSISKLQIKW  436

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   +M+EVVAAA  ANAH+FI QLPQGY+T+VG
Sbjct  437   LRSQMGLVSQEPALFATSIKENILFGKEDATMDEVVAAAKAANAHNFISQLPQGYDTQVG  496

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARA+IK P ILLLDEATSALDSESE++VQ+ALD A  GRTT+V+
Sbjct  497   ERGVQMSGGQKQRIAIARAVIKAPRILLLDEATSALDSESERIVQEALDLARVGRTTIVI  556

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD IAVV  G ++E GSH  L++ + G Y+ + KLQ Q +  D + S   S
Sbjct  557   AHRLSTIRNADAIAVVQQGEVVEIGSHDALIQDEKGFYSSLVKLQ-QANDKDDEASLEGS  615

Query  2032  -------SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
                    S+ G  +  + S +   +S     T   +       P PSF RLL LNL EW+
Sbjct  616   TCRLSRVSSMGSGTRGRISRSSSMNSGRSSITDYDIRVPPQDLPVPSFRRLLMLNLPEWR  675

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q L+G +SA+ FGA+QPTYA T+G MIS +F P H+E++ +++ +  +F  L +LS  +N
Sbjct  676   QALVGCLSAVIFGAIQPTYAFTMGSMISVYFLPDHDEIKQKVRLYAFIFVALAILSFAIN  735

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             +CQHY FA MGE+LT+R+R RML K+LTFE  WFDE+ N +GALC+RL  +A++V+SLV 
Sbjct  736   ICQHYYFAAMGEYLTKRVRERMLSKMLTFEVGWFDEDGNGTGALCSRLDKDASVVRSLVG  795

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++LLVQA S+V IA  MGL++AW+LA+VMIAVQPL I+CFY R+VLL +++ K ++AQ
Sbjct  796   DRMALLVQATSAVVIACTMGLIIAWRLAVVMIAVQPLIIVCFYARRVLLKSMSQKAIRAQ  855

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + S+++A EAV N R VT+F S  ++L +F+ AQ+ P++EA ++SW AG+G+G++Q L  
Sbjct  856   DESSKLAAEAVSNLRTVTAFSSQGRILRLFEQAQEGPKREAARQSWFAGLGLGTSQSLMS  915

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               WALDFWYGGKLV+ G IS+ ++F+TF ILVSTG+VIADAG+MTSDLAKGS AV S+FA
Sbjct  916   CTWALDFWYGGKLVAQGLISAKELFETFMILVSTGRVIADAGAMTSDLAKGSDAVGSVFA  975

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             +LDR ++I        D  G +  KL G +E+K V F+YP+RP+ PI + F L+++ G S
Sbjct  976   VLDRYTLIDPD-----DTDGFHPNKLEGHVELKNVYFSYPARPDIPIFQNFSLKIEPGLS  1030

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ LIERFYD   GS+ +DG DVR++ +   R  + +V QEP ++SG
Sbjct  1031  TALVGQSGSGKSTIIGLIERFYDPSKGSVYIDGRDVRTYHLRSLRMHIGMVGQEPTLFSG  1090

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TI +NI +G+  A+  EI  AA+AANAH FI++L  GY+T CG+RG+QLSGGQKQRIAIA
Sbjct  1091  TIHENIAYGRPGATLAEIEAAARAANAHGFITNLNDGYNTMCGDRGMQLSGGQKQRIAIA  1150

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP ILLLDEATSALD +SE+VVQEALD +M+GRT +VVAHRL+TI+  + IA++ 
Sbjct  1151  RAILKNPAILLLDEATSALDTQSEKVVQEALDRVMVGRTCVVVAHRLSTIQACNHIAVLD  1210

Query  253   EGKVVEHGTYSQLKNK  206
             +G VVE GT++ L  K
Sbjct  1211  KGAVVEQGTHATLFTK  1226


 Score =   296 bits (759),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 191/526 (36%), Positives = 303/526 (58%), Gaps = 6/526 (1%)
 Frame = -2

Query  3634  EKCSLY-FVLLGLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             +K  LY F+ + LA++   +   + Y ++   E    ++R + L  +L  EVG+FD    
Sbjct  715   QKVRLYAFIFVALAILSFAINICQHYYFAAMGEYLTKRVRERMLSKMLTFEVGWFDEDGN  774

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
              T  + + + KD S+++ ++ +++ + +  TS  +         +WRL++V      ++I
Sbjct  775   GTGALCSRLDKDASVVRSLVGDRMALLVQATSAVVIACTMGLIIAWRLAVVMIAVQPLII  834

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
             +        L  +S+K+ +   +++ +  +A+S+++T+ +F+++  IL  +    +   +
Sbjct  835   VCFYARRVLLKSMSQKAIRAQDESSKLAAEAVSNLRTVTAFSSQGRILRLFEQAQEGPKR  894

Query  3103  LGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
                +     GL +G S  L    WA   WYG +L+     S   ++   +  V  G  + 
Sbjct  895   EAARQSWFAGLGLGTSQSLMSCTWALDFWYGGKLVAQGLISAKELFETFMILVSTGRVIA  954

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + S A   +F+ +DR   ID +D  G   + + G +E KNV F+YP+RP+
Sbjct  955   DAGAMTSDLAKGSDAVGSVFAVLDRYTLIDPDDTDGFHPNKLEGHVELKNVYFSYPARPD  1014

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               + ++ +LK+E G + ALVG SGSGKST I L++RFYD + GS+ IDG ++    ++ L
Sbjct  1015  IPIFQNFSLKIEPGLSTALVGQSGSGKSTIIGLIERFYDPSKGSVYIDGRDVRTYHLRSL  1074

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R  +G+V QE  LF  +I ENI  G+ G ++ E+ AAA  ANAH FI  L  GY T  G+
Sbjct  1075  RMHIGMVGQEPTLFSGTIHENIAYGRPGATLAEIEAAARAANAHGFITNLNDGYNTMCGD  1134

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAI+KNP ILLLDEATSALD++SEK+VQ+ALD+   GRT +VVA
Sbjct  1135  RGMQLSGGQKQRIAIARAILKNPAILLLDEATSALDTQSEKVVQEALDRVMVGRTCVVVA  1194

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGH--YAQMAKLQR  2075
             H+LSTI+  + IAV+  G ++EQG+H+ L  K  H  Y  +  LQR
Sbjct  1195  HRLSTIQACNHIAVLDKGAVVEQGTHATLFTKGPHGAYYNLVSLQR  1240



>ref|XP_008779540.1| PREDICTED: putative multidrug resistance protein [Phoenix dactylifera]
Length=1252

 Score =  1224 bits (3166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/1216 (54%), Positives = 894/1216 (74%), Gaps = 21/1216 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D++LM LG LGA GDG+ST  +L   S +FN LG   +   S I +   +  
Sbjct  25    IFMHADTVDMWLMALGFLGATGDGLSTPVMLFITSKVFNNLG---SGFSSSIDSSQFVHH  81

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             ++  S+  + L     VM F+EGYCW++T ERQ  ++R +YL+A+LRQ+V +FD + A+T
Sbjct  82    IDTNSVDLLYLACGSWVMSFLEGYCWTRTGERQASRMRARYLKAVLRQDVEYFDLKVAST  141

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEKVP F+M+ + F        +  WR++LVA PT+V+LIIP
Sbjct  142   SEVITSVSSDSLVIQDVLSEKVPNFIMNGATFFGSYMVGFFLVWRMALVALPTVVLLIIP  201

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L  L+++  +EY+KA  I  QA+SS++T+YSF AE   + ++S+ LD ++KLG
Sbjct  202   GLMYGRILTSLAREIREEYNKAGTIAEQAISSVRTVYSFVAESRTMAKFSAALDDSVKLG  261

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS  ++FAIWAFL WYGSRL+M+ G  GG ++A G + V+GGL+LG  L
Sbjct  262   LRQGLAKGIAIGSNSVTFAIWAFLVWYGSRLVMYHGGKGGTVFAVGAAIVVGGLALGSGL  321

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EAS A  RI   I R+PKID +   G VL+ + G +EF+ VKFAYPSRPE+L+
Sbjct  322   SNLKYFSEASSAGERIMEVIKRIPKIDSDSMEGEVLENVSGNVEFRAVKFAYPSRPENLI  381

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              +D +LK  AG+TVALVG SGSGKSTAIALL+RFYD + G I +DGV+I  LQ+KWLR Q
Sbjct  382   FRDFSLKAPAGRTVALVGGSGSGKSTAIALLERFYDPSGGEILVDGVDIRRLQLKWLRSQ  441

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF  SI+EN++ GK   S EEVVAAA  +NAH+FI QLP GY+T+VGERG 
Sbjct  442   MGLVSQEPALFAASIKENVLFGKEDASTEEVVAAAKASNAHNFISQLPLGYDTQVGERGV  501

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD A+ GRTT+V+AH+L
Sbjct  502   QMSGGQKQRIAIARAIIKSPKILLLDEATSALDSESERIVQEALDLATVGRTTIVIAHRL  561

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPSSNAG  2021
             STIRNAD+IAVV  G ++E GSH EL+  ++G Y+   +LQ Q S A ++ + A SS   
Sbjct  562   STIRNADIIAVVQAGQVMEIGSHDELIRSEDGLYSSFVRLQ-QTSTAGEEGAAASSSMMN  620

Query  2020  RQSTEKsspavlassplLIETAQKV--------PTDHHHQ---PSPSFSRLLGLNLTEWK  1874
                +     +   S      +            P D       P PSF RLL LN+ EWK
Sbjct  621   LALSSHLGSSSSMSQRFSAASRSSSARSFGNAGPADESEPEALPVPSFRRLLMLNVPEWK  680

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q L+GS+SA  FGAVQP YA  +G MIS +F   H++++++ + + L+F  L + S  +N
Sbjct  681   QALLGSLSATVFGAVQPLYAFAMGSMISVYFLTDHDDIKSKTRTYSLIFVSLSVFSFLIN  740

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY F  MGE+LT+R+R RML KILTFE AWFD++ NS+GA+C+RL+ +A +V+SLV 
Sbjct  741   IGQHYNFGAMGEYLTKRVRERMLSKILTFEVAWFDQDENSTGAICSRLAKDANVVRSLVG  800

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++L++Q  S+VTIA  MGL++AW+LALVMIAVQP+ I+CFY R+VLL +++ K +K+Q
Sbjct  801   DRMALIIQTVSAVTIACTMGLIIAWRLALVMIAVQPVIIVCFYARRVLLKSMSGKAIKSQ  860

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + S+++A EAV N R VT+F S +++L +FD+AQ+ PR+E+ ++SW AG+G+ ++Q L  
Sbjct  861   SESSKLAAEAVSNLRTVTAFSSQDRILRLFDHAQEGPRRESIRQSWFAGLGLATSQSLMT  920

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               W+LDFWYGG+L+S+G I++  +F+TF +LVSTG+VIADAGSMT+DLAKG+ A  S+FA
Sbjct  921   CTWSLDFWYGGRLISHGYITAKALFQTFMVLVSTGRVIADAGSMTTDLAKGADAAGSVFA  980

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR + I        D+ G + EKL G ++I+ V FAYP+RP+  I R F L ++AG S
Sbjct  981   ILDRFTRIEPE-----DSEGHHPEKLIGDVDIRGVEFAYPARPDVIIFRGFTLSIQAGKS  1035

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SG GKSTI+ LIERFYD   G++R+DG D++S+ +   RR + LV QEP +++G
Sbjct  1036  TALVGQSGCGKSTIIGLIERFYDPLKGTVRIDGRDIKSYHLRSLRRHIGLVGQEPTLFAG  1095

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIR+NIL+G   A+E EI  AA+AANAH FIS+L++GYDT CG+RGVQLSGGQKQR+AIA
Sbjct  1096  TIRENILYGTEGATEAEIESAARAANAHDFISNLEEGYDTWCGDRGVQLSGGQKQRVAIA  1155

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP ILLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D IA++ 
Sbjct  1156  RAILKNPAILLLDEATSALDSQSEKVVQEALERVMVGRTSVVVAHRLSTIQNCDLIAVLE  1215

Query  253   EGKVVEHGTYSQLKNK  206
             +G VVE GT++ L  K
Sbjct  1216  KGVVVEKGTHASLLAK  1231



>ref|XP_010552465.1| PREDICTED: ABC transporter B family member 15-like [Tarenaya 
hassleriana]
Length=1253

 Score =  1219 bits (3153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 654/1222 (54%), Positives = 895/1222 (73%), Gaps = 30/1222 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD  D  LM LG +GA+GDG +T  +LL  S L N LG       S  S+   M  
Sbjct  22    IFMHADGADWTLMGLGLIGAVGDGFNTPLVLLISSKLMNNLG-----GSSGFSSDAFMHN  76

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + L  A  V  F+EGYCW++T ERQ  ++R +YL A+LRQEVG+FD    +T
Sbjct  77    ISKNAVALLYLACASWVACFLEGYCWTRTGERQAARMRERYLRAVLRQEVGYFDLHVTST  136

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S D+ +IQ+VLSEK+P FLM+ S F+          WRL++V  P IV+L+IP
Sbjct  137   SDVITSVSSDSLVIQDVLSEKIPNFLMNASTFIGSYVVGFILLWRLAIVGLPFIVLLVIP  196

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ +S+K  +EY+KA  +  QA+SSI+T+Y+F AE   +  +S+ L  ++KLG
Sbjct  197   GLLYGRALMSISRKIREEYNKAGSMAEQAVSSIRTVYAFVAESKTISEFSTALQGSVKLG  256

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKG+A+GS G++FA+WAF++WYGS ++M+ G  GG ++A   S  +GG+SLG  L
Sbjct  257   LKQGLAKGIAIGSNGITFAMWAFMSWYGSGMVMYHGSQGGTVFAVAASAAIGGVSLGAGL  316

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EAS +  RI   I+RVPKID ++ +G VL+ +RGE+E ++VKFAYPSRPES++
Sbjct  317   SNLKYFSEASASGERIMEVINRVPKIDSDNTAGDVLEKVRGEVELRHVKFAYPSRPESMI  376

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               D +L++ AGKTVALVG SGSGKST ++LLQRFYD  +G I +DGV I+ L++KWLR Q
Sbjct  377   FDDFSLRIPAGKTVALVGGSGSGKSTVVSLLQRFYDPVAGEILLDGVTIDKLKLKWLRSQ  436

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF T+I+ENI+ GK   SM+EV+ A+  +NAH+FI QLP GYET+VGERG 
Sbjct  437   MGLVSQEPALFATTIKENILFGKEDASMDEVIEASKASNAHNFISQLPHGYETQVGERGV  496

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD AS GRTT+V+AH+L
Sbjct  497   QMSGGQKQRIAIARAIIKSPRILLLDEATSALDSESERIVQEALDNASVGRTTIVIAHRL  556

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPSSNAG  2021
             STIRNAD+IAVV    I E GSH ELM+ +NG YA + +LQ Q    + + +   +++  
Sbjct  557   STIRNADIIAVVQNRNIEESGSHDELMQHENGLYASLVRLQ-QMEKEESNLNINSANSHV  615

Query  2020  RQSTE---------------KsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNL  1886
               ST+                S+ +  ASS    + +  +P D    P PSF RL+ +NL
Sbjct  616   ASSTDLKSLSSRRLSLVSRSSSANSASASSLGATDISDSIPEDKK-LPVPSFKRLIAMNL  674

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWKQ L G +SA  FGAVQP YA ++G MIS +F  SH+E++ + + +   F  L + S
Sbjct  675   PEWKQALYGCVSATLFGAVQPAYAYSLGSMISVYFLTSHDEIKEKTRIYAFCFTGLAVFS  734

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
               +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD + NSSGA+C+RL+ +A +V+
Sbjct  735   FLINISQHYNFAYMGEYLTKRIRERMLSKLLTFEVGWFDRDENSSGAVCSRLAKDANVVR  794

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLV DR++LLVQ  S+VTIA  MGLV+AW+LA+VMIAVQPL I+CFYTR+V+L +++ K 
Sbjct  795   SLVGDRMALLVQTISAVTIACTMGLVIAWRLAIVMIAVQPLIIVCFYTRRVMLKSMSRKA  854

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             +KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AGIG+G++Q
Sbjct  855   IKAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQEGPRRESIRQSWFAGIGLGTSQ  914

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LT   WALDFWYGG+L+++G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AVA
Sbjct  915   SLTSCTWALDFWYGGRLIADGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVA  974

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+FAILDR + I        D  G   E+++G++E   V FAYP+RP+  I REF +E++
Sbjct  975   SVFAILDRYTAIEPE-----DPDGYQPERITGRVEFVDVEFAYPTRPDVMIFREFSIEIE  1029

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             AG S  +VG SGSGKST++ALIERFYD   G +R+DG D+RS+ +   RR ++LVSQEP 
Sbjct  1030  AGKSTAIVGPSGSGKSTVIALIERFYDPLKGIVRIDGRDLRSYHLRSLRRHISLVSQEPT  1089

Query  625   IYSGTIRDNILFGKLDase--neiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
             +++GTIRDNIL+G  D +   +EI+EAAKAANAH FI+ L  GYDT  G+RGVQLSGGQK
Sbjct  1090  LFAGTIRDNILYGNSDKTTDESEIVEAAKAANAHDFITGLSDGYDTYVGDRGVQLSGGQK  1149

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARA+++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D
Sbjct  1150  QRIAIARAVLKNPAVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNSD  1209

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
              IA++ +GK+VE GT+S L  K
Sbjct  1210  VIAVLEKGKLVESGTHSFLLAK  1231



>ref|XP_004142341.1| PREDICTED: ABC transporter B family member 15-like [Cucumis sativus]
 gb|KGN52419.1| hypothetical protein Csa_5G633170 [Cucumis sativus]
Length=1251

 Score =  1218 bits (3152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/1219 (54%), Positives = 889/1219 (73%), Gaps = 22/1219 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D FLM LG +GA+GDG +T  +L+  SHL N +G+ S++S +       +  
Sbjct  29    IFMHADAVDKFLMTLGFIGAVGDGFTTPLVLVVSSHLMNNIGHTSSSSITDS----FVAN  84

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             ++K ++  + +     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  85    IDKNAVALLYVACGGFVSCFLEGYCWTRTGERQAARMRARYLKAVLRQDVGYFDLHVTST  144

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEK+P FLM+ ++F+     +    WRL++V +P +V+L+IP
Sbjct  145   SEVITSVSNDSLVIQDVLSEKIPNFLMNAAIFIGSYLAAVILFWRLAVVGFPFVVLLVIP  204

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YGK L+ L++KS + Y KA  +  QA+SSI+T+Y+F  E   +  YSS L+R++K G
Sbjct  205   GLLYGKTLMGLARKSMEGYQKAGTVAEQAISSIRTVYAFAGEDKTISEYSSALERSVKFG  264

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G +KGLA+GS G+SFAIW+F++WYGSR++M+ G  GG ++A G +  +GGLS+G  L
Sbjct  265   IKQGFSKGLAIGSNGVSFAIWSFMSWYGSRMVMYHGAQGGTVFAVGAAIAVGGLSIGSGL  324

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  A  RI   I+RVPKID  D  G +L  I G+++F NV FAYPSRP+++V
Sbjct  325   SNIKYFSEACAAGERIMEVINRVPKIDSADMEGQILRNISGQVQFTNVHFAYPSRPDTIV  384

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L DL L + AG+TVALVG SGSGKST I+LLQRFYD  SGSI +DG+ I  LQ+KWLR Q
Sbjct  385   LNDLTLTIPAGQTVALVGGSGSGKSTVISLLQRFYDPISGSISVDGIGIEKLQLKWLRSQ  444

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALFGTSI+ENI+ GK  GSM++VV A   +NAH FI   PQGY+T+VGERG 
Sbjct  445   MGLVSQEPALFGTSIKENILFGKEDGSMDDVVEAGKASNAHSFISLFPQGYDTQVGERGV  504

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  505   QMSGGQKQRIAIARAIIKRPRILLLDEATSALDSESERIVQEALDKAAVGRTTIIIAHRL  564

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQ------FSCADQDQSFA  2039
             ST+RNADLIAV+  G + E G H +L++ + G Y  +  LQ +       S     +   
Sbjct  565   STVRNADLIAVLQDGQVREIGPHDDLIKNQTGLYTSLVHLQHKSPPEPSLSTTSHIEKIT  624

Query  2038  PSSNAGRQSTEKsspavlassplLI-ETAQKVPTDHHHQ--PSPSFSRLLGLNLTEWKQG  1868
              ++++ R S    S +  + +  L+ ETA         Q  P PSF RLL LNL EWKQ 
Sbjct  625   TTTSSRRLSLLSHSNSANSGASDLVHETAPPSSNIEKEQELPIPSFRRLLALNLPEWKQA  684

Query  1867  LIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLC  1688
             L+G   A+ FGAVQP YA  +G MIS +F  SHEE++A+ + + L F  L LLS+ +N+ 
Sbjct  685   LMGCSGAVVFGAVQPLYAFAMGSMISVYFLKSHEEIKAKTRTYALCFVGLALLSLLVNII  744

Query  1687  QHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADR  1508
             QHY FAYMGE+LT+R+R  ML KILTFE  WFD++ +SSGALC+RLS +A +V+SLV DR
Sbjct  745   QHYNFAYMGEYLTKRVREMMLSKILTFEIGWFDQDEHSSGALCSRLSKDANVVRSLVGDR  804

Query  1507  LSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNS  1328
             L+L+VQ  S+VTIA  MGLV++WKLALVMIAVQPL I CFYTR+VLL  ++ K +KAQ  
Sbjct  805   LALIVQTISAVTIAFTMGLVISWKLALVMIAVQPLVICCFYTRRVLLKKMSNKAIKAQEQ  864

Query  1327  STQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMC  1148
             S+++A EAV N R +T+F S  ++L + + AQ+ P++E+ K+SW AGIG+G +Q LT   
Sbjct  865   SSKLAAEAVSNLRTITAFSSQERILKMLEKAQEGPKRESIKQSWYAGIGLGCSQSLTTCS  924

Query  1147  WALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAIL  968
             WALDFWYGGKLV+ G+ ++  +F+TF ILVSTG+VIADAGSMTSDLAKGS AV S+F +L
Sbjct  925   WALDFWYGGKLVAQGQTTAKALFETFMILVSTGRVIADAGSMTSDLAKGSEAVGSVFDVL  984

Query  967   DRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIG  788
             DR + I        D  G    KL G+IEI  V+F YPSRPE  I R F + ++AG S  
Sbjct  985   DRFTKIEPD-----DPEGYKPNKLIGQIEINNVDFNYPSRPEAMIFRGFSISIEAGKSTA  1039

Query  787   LVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTI  608
             LVG+SGSGKSTI+ LIERFYD   G+I +DG D++S+ +   R+ +ALVSQEP +++GTI
Sbjct  1040  LVGQSGSGKSTIIGLIERFYDPIKGTINIDGRDIKSYHLRTLRKHIALVSQEPTLFAGTI  1099

Query  607   RDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiar  431
             R+NI++G      E+EIIEAAKA+NAH FIS LK GY+T CG+RG+QLSGGQKQRIAIAR
Sbjct  1100  RENIIYGVSKTVDESEIIEAAKASNAHDFISGLKDGYETWCGDRGLQLSGGQKQRIAIAR  1159

Query  430   aiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSE  251
             AI++NP +LLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D IA++ +
Sbjct  1160  AILKNPGVLLLDEATSALDGQSEKVVQEALERVMVGRTSVVVAHRLSTIQNCDMIAVLDK  1219

Query  250   GKVVEHGTYSQL--KNKRG  200
             GKVVE GT+S L  K  RG
Sbjct  1220  GKVVERGTHSSLLGKGPRG  1238


 Score =   315 bits (808),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 195/522 (37%), Positives = 307/522 (59%), Gaps = 4/522 (1%)
 Frame = -2

Query  3625  SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEIT  3446
             +L FV L L  +++  ++ Y ++   E    ++R   L  IL  E+G+FD  E ++  + 
Sbjct  728   ALCFVGLALLSLLVNIIQHYNFAYMGEYLTKRVREMMLSKILTFEIGWFDQDEHSSGALC  787

Query  3445  NSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliy  3266
             + +SKD ++++ ++ +++ + +   S            SW+L+LV      ++I      
Sbjct  788   SRLSKDANVVRSLVGDRLALIVQTISAVTIAFTMGLVISWKLALVMIAVQPLVICCFYTR  847

Query  3265  gkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIG  3086
                L  +S K+ K   +++ +  +A+S+++TI +F+++  IL+      +   +  +K  
Sbjct  848   RVLLKKMSNKAIKAQEQSSKLAAEAVSNLRTITAFSSQERILKMLEKAQEGPKRESIKQS  907

Query  3085  IAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEV  2909
                G+ +G S  L+   WA   WYG +L+     +   ++   +  V  G  +  A    
Sbjct  908   WYAGIGLGCSQSLTTCSWALDFWYGGKLVAQGQTTAKALFETFMILVSTGRVIADAGSMT  967

Query  2908  KYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKD  2729
                 + S A   +F  +DR  KI+ +D  G   + + G++E  NV F YPSRPE+++ + 
Sbjct  968   SDLAKGSEAVGSVFDVLDRFTKIEPDDPEGYKPNKLIGQIEINNVDFNYPSRPEAMIFRG  1027

Query  2728  LNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGL  2549
              ++ +EAGK+ ALVG SGSGKST I L++RFYD   G+I IDG +I +  ++ LR  + L
Sbjct  1028  FSISIEAGKSTALVGQSGSGKSTIIGLIERFYDPIKGTINIDGRDIKSYHLRTLRKHIAL  1087

Query  2548  VSQEHALFGTSIRENIMLGKLGGSME-EVVAAAMTANAHDFIRQLPQGYETKVGERGALL  2372
             VSQE  LF  +IRENI+ G      E E++ AA  +NAHDFI  L  GYET  G+RG  L
Sbjct  1088  VSQEPTLFAGTIRENIIYGVSKTVDESEIIEAAKASNAHDFISGLKDGYETWCGDRGLQL  1147

Query  2371  SGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLST  2192
             SGGQKQRIAIARAI+KNP +LLLDEATSALD +SEK+VQ+AL++   GRT++VVAH+LST
Sbjct  1148  SGGQKQRIAIARAILKNPGVLLLDEATSALDGQSEKVVQEALERVMVGRTSVVVAHRLST  1207

Query  2191  IRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQRQ  2072
             I+N D+IAV+  G ++E+G+HS L+ K   G Y  +  LQR+
Sbjct  1208  IQNCDMIAVLDKGKVVERGTHSSLLGKGPRGAYYALVNLQRR  1249



>ref|XP_006395369.1| hypothetical protein EUTSA_v10003530mg [Eutrema salsugineum]
 gb|ESQ32655.1| hypothetical protein EUTSA_v10003530mg [Eutrema salsugineum]
Length=1244

 Score =  1216 bits (3145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 653/1224 (53%), Positives = 897/1224 (73%), Gaps = 31/1224 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG ST  +LL  S L N LG       S  +   
Sbjct  19    SIRSIFIHADGVDWVLMGLGLIGAVGDGFSTPLVLLITSKLMNNLG------GSPFNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S F+          WRL++V  P +V+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASTFVGSYIVGFILLWRLAIVGLPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S+K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISRKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++F +WAF++WYGSR++M+ G  GG ++A   S  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFVMWAFMSWYGSRMVMYHGAQGGTVFAVAASVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID ++  G  L+ IRGE+EFK+VKF YPSRP
Sbjct  313   GGGLCNLKYFFEAASVGERIMEVINRVPKIDSDNPKGQKLEKIRGEVEFKHVKFLYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+LV  D  L+V +GKTVALVGASGSGKST I+LLQRFY+  +G I IDGV I+ LQVKW
Sbjct  373   ETLVFDDFCLRVPSGKTVALVGASGSGKSTVISLLQRFYNPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   SM++VV AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDASMDDVVEAAKASNAHNFISQLPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFA--  2039
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G YA + +LQ Q    D D + +  
Sbjct  553   AHRLSTIRNADVISVVKNGHVVETGSHDELMENFDGQYASLVRLQ-QIEKEDSDVNMSVN  611

Query  2038  ----PSSNAGR--QSTEKsspavlassplLIETAQKVPTDHHHQ---PSPSFSRLLGLNL  1886
                 P S+  +  +ST + S    +SS   + T   +  +H      P PSF RLL +NL
Sbjct  612   VQMGPISDHNKDLRSTSRVSTLSRSSSANPV-TGSSIVKNHSEDKKPPLPSFKRLLAMNL  670

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWKQ L G ISA  FGA+QP YA ++G M+S +F  SHEE++ + + + L F  L +LS
Sbjct  671   PEWKQALYGCISAALFGAIQPAYAYSLGSMVSVYFLTSHEEIKEKTRLYALSFVGLAVLS  730

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
               +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD + NSSGA+C+RL+ +A +V+
Sbjct  731   FLINISQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDRDENSSGAVCSRLAKDANVVR  790

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQPL I+CFYTR+VLL  +  + 
Sbjct  791   SLVGDRMALLVQTISAVTIACTMGLVIAWRLALVMIAVQPLIIVCFYTRRVLLKNMLKQA  850

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             +KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AGIG+  +Q
Sbjct  851   IKAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQENPRRESIRQSWFAGIGLAMSQ  910

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV 
Sbjct  911   SLTSCTWALDFWYGGRLIGDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVG  970

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+FA+LDR + I        D+ G   E+++G++E   V+F+YP+RP+  I ++F +++ 
Sbjct  971   SVFAVLDRYTSIDPE-----DSDGYEAERITGRVEFLDVDFSYPTRPDVMIFKDFSIDIA  1025

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             A  S  +VG SGSGKSTI+ LIERFYD   G + +DG D+RS+++   R+ +ALVSQEP 
Sbjct  1026  AAKSTAIVGPSGSGKSTIIGLIERFYDPVKGVVLIDGRDLRSYNLRSLRQHIALVSQEPT  1085

Query  625   IYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             +++GTIR+NIL+G    K+D  E+EIIEAA+AANAH FI+SL  GYDT CG+RG+QLSGG
Sbjct  1086  LFAGTIRENILYGRASDKID--ESEIIEAARAANAHDFITSLSDGYDTYCGDRGIQLSGG  1143

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N
Sbjct  1144  QKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQN  1203

Query  277   LDSIALVSEGKVVEHGTYSQLKNK  206
              D+IA++ +GK+VE GT+S L  K
Sbjct  1204  CDAIAVLDKGKLVERGTHSSLLAK  1227



>ref|XP_004304964.1| PREDICTED: ABC transporter B family member 15-like [Fragaria 
vesca subsp. vesca]
Length=1280

 Score =  1216 bits (3145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/1224 (54%), Positives = 897/1224 (73%), Gaps = 25/1224 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SSI  +F +AD  D  LM LG  G+IGDG +T  +LL  S L N +G       S  +  
Sbjct  42    SSISSVFMHADGADKLLMALGLFGSIGDGCTTPLVLLITSRLMNNVG-----GSSSNAQD  96

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
                  + K ++  + L  A  V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD 
Sbjct  97    AFTHNINKNAVALLYLASASFVCCFLEGYCWTRTGERQAARMRVRYLKAVLRQDVGYFDL  156

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
                +TSE+  S+S D+ +IQ+VLSEKVP F+M+ S+FL     +    W+L++V +P ++
Sbjct  157   HVTSTSEVITSVSSDSLVIQDVLSEKVPNFVMNCSMFLGSYIAAFIMLWKLAIVGFPFLL  216

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +L+IPGLIYG+ L+ L++K   EY+KA  I  Q LSSI+T+Y+F  E   +  +S+ L+ 
Sbjct  217   LLVIPGLIYGRTLMGLARKLRDEYNKAGTIAEQTLSSIRTVYAFVGENKTITEFSAALEG  276

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG+  G+AKGLA+GS G+ FAIW+F+++YGSR++M+ G  GG ++A G +  +GGL+
Sbjct  277   SVKLGLSQGLAKGLAIGSNGVVFAIWSFMSFYGSRMVMYHGAKGGTVFAVGAAIAVGGLA  336

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG  L  +KYF+EA  AA RI   I RVPKID ++  G +L+ + GE+EFK+V+FAYPSR
Sbjct  337   LGAGLSNLKYFSEACSAAERIMEVIRRVPKIDSDNMEGEILENVLGEVEFKHVEFAYPSR  396

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PES++ +D NL V AGKT+ALVG+SGSGKST I++LQRFYD   G I IDGV IN  Q+K
Sbjct  397   PESIIFQDFNLTVPAGKTLALVGSSGSGKSTVISVLQRFYDPLGGEILIDGVAINKCQLK  456

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE ALF TSI+ENI+ GK   +MEEV+ A   +NAH+FI QLP GY+T+V
Sbjct  457   WLRSQMGLVSQEPALFATSIKENILFGKEDATMEEVIEAGKASNAHNFISQLPMGYDTQV  516

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT++
Sbjct  517   GERGVQMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTII  576

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR-QFSCADQDQSFA  2039
             +AH+LSTIRNAD+IAVV  G ++E GSH EL ++ NG Y  + +LQ+ +    +Q   +A
Sbjct  577   IAHRLSTIRNADIIAVVQNGQVMEMGSHDELFQRENGLYTSLIRLQQTEKQPEEQAGHYA  636

Query  2038  PS--SNAGRQSTEKsspavlassplLIETAQKVPT----------DHHHQPSPSFSRLLG  1895
              S  SN    +T     ++++ S      AQ   +          +    P PSF RL+ 
Sbjct  637   SSSISNMDIHNTSSRRLSMVSRSSSANSFAQGRASSVVAGEDEIVERKKLPVPSFKRLIA  696

Query  1894  LNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllc  1715
             LNL EWKQ L+G  SAI FGAVQP YA  +G M+S +F   H+E++ + + + L F  L 
Sbjct  697   LNLPEWKQALLGCFSAILFGAVQPAYAFAMGSMVSVYFLTDHDEIKEKTRIYSLCFLGLA  756

Query  1714  llsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAA  1535
             + S+ +N+CQHY FAYMGE+LT+R+R RML KILTFE  WFD++ NSSGA+C+RL+ +A 
Sbjct  757   IFSLLVNICQHYNFAYMGEYLTKRVRERMLSKILTFEVGWFDQDENSSGAICSRLAKDAN  816

Query  1534  MVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT  1355
             +V+SLV DR++LLVQ  S+VT+A  MGLV+AW+LA+VMIAVQP+ I+ FYTR+VLL T++
Sbjct  817   VVRSLVGDRMALLVQTFSAVTVACTMGLVIAWRLAIVMIAVQPIIIVSFYTRRVLLKTMS  876

Query  1354  TKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIG  1175
              K +KAQ+ S+++A EAV N R +T+F S +++L + + AQ+ PRKE+ ++SW AGIG+G
Sbjct  877   KKAIKAQDESSKLAAEAVSNLRTITAFSSQDRLLKMLEKAQEGPRKESIRQSWYAGIGLG  936

Query  1174  SAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
              +Q LT + WA DFWYGGKL++ G +++ ++F+TF ILVSTG+VIADAGSMTSDLAKGS 
Sbjct  937   CSQSLTSITWAFDFWYGGKLITQGYVTAKELFETFMILVSTGRVIADAGSMTSDLAKGSD  996

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
             AVAS+FA+LDR + I        D  G   ++++G IE++ V+FAYP+RP+  I + F +
Sbjct  997   AVASVFAVLDRYTNIEPE-----DPEGCQPKRITGDIELRNVHFAYPARPDVMIFKGFSI  1051

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
             +++AG S  LVG+SGSGKSTI+ LIERFYD   G + +DG DV+S+ +   R+ +ALVSQ
Sbjct  1052  KIEAGKSTALVGQSGSGKSTIIGLIERFYDPLKGEVIIDGRDVKSYHLRSLRKHIALVSQ  1111

Query  634   EPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             EP ++SGTIR+NI++G  D   E EIIEAAKAANAH+FISSLK+GYDT CG+RGVQLSGG
Sbjct  1112  EPTLFSGTIRENIIYGVSDKVDELEIIEAAKAANAHEFISSLKEGYDTSCGDRGVQLSGG  1171

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARAI+RNP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI++
Sbjct  1172  QKQRIAIARAILRNPVVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQH  1231

Query  277   LDSIALVSEGKVVEHGTYSQLKNK  206
              D I ++ +G+VVE GT+S L  K
Sbjct  1232  CDLITVLDKGRVVEKGTHSSLLAK  1255



>ref|XP_009335785.1| PREDICTED: ABC transporter B family member 15-like [Pyrus x bretschneideri]
Length=1256

 Score =  1215 bits (3144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/1218 (53%), Positives = 886/1218 (73%), Gaps = 24/1218 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D  LM LG  G++GDG ST  +LL  S L N +G          +    +  
Sbjct  24    IFMHADGVDRLLMILGLFGSLGDGFSTPLVLLITSKLMNNIG-----GSPTSAQDAFLHN  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + L     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  79    INKNAVALLYLACGGFVCCFLEGYCWTRTGERQAARMRVRYLKAVLRQDVGYFDLHVTST  138

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEK+P FLM++S+F      +    WRL++V +P +V+L+IP
Sbjct  139   SEVITSVSNDSLVIQDVLSEKLPNFLMNSSMFFGSYIAAFIMMWRLAIVGFPFVVLLVIP  198

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L+++  +EY+KA  I  QA+SSI+T+Y+F  E   +  +S  L  ++KLG
Sbjct  199   GLIYGRTLMGLARQIREEYNKAANIAEQAISSIRTVYAFVGENKTVSEFSVALQGSVKLG  258

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +  G+AKGLA+GS G+ FAIW+F+++YGSR++M+ G  GG ++A G +  +GGL+LG  L
Sbjct  259   LSQGLAKGLAIGSNGVVFAIWSFMSYYGSRMVMYHGARGGTVFAVGAAIAVGGLALGSGL  318

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  AA RI   I RVPKID ++  G  L+ + GE+EFK+V+FAYPSRPES++
Sbjct  319   SNLKYFSEACSAAERIMEVIRRVPKIDSDNMEGECLEDVSGEVEFKHVEFAYPSRPESII  378

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD NL + AGKTVALVG SGSGKST I+LLQRFYD   G + +DGV IN LQ+KWLR Q
Sbjct  379   FKDFNLTIPAGKTVALVGGSGSGKSTVISLLQRFYDPLGGEVLLDGVAINKLQLKWLRSQ  438

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ GK    +EEV+ A   ANAH+FI QLPQGY+T+VGERG 
Sbjct  439   MGLVSQEPALFATSIKENILFGKEDAEIEEVIEAGKAANAHNFISQLPQGYDTQVGERGV  498

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  499   QMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  558

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR-----------QFSCADQ  2054
             STIRNAD+IAVV  G ++E GSH EL ++ NGHY  + +LQR            +  +  
Sbjct  559   STIRNADVIAVVQNGQVMEIGSHDELSQRENGHYTSLVRLQRTEKENEPEELGHYGASSS  618

Query  2053  DQSFAPSSNAGRQS-TEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
               +   S+++ R S   +SS A   +    ++    V  +    P PSF RLL LNL EW
Sbjct  619   ISNDIHSTSSRRLSMVSRSSSANSFAQGRALDQESVVEYEQKKLPVPSFRRLLALNLPEW  678

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ ++G  SA  FGAVQP YA  +G MIS +F   H+E++A+ + + L F  L + S+ +
Sbjct  679   KQAVMGCTSATLFGAVQPLYAFAMGSMISVYFLKDHDEIKAKTRTYSLCFLGLAIFSLLI  738

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+N+A +V+SLV
Sbjct  739   NVSQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDQDENSSGAICSRLANDANVVRSLV  798

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L+VQ  S+VT+A  MGL++ W+LALVMIAVQPL I+CFYTR+VLL  ++ K +K+
Sbjct  799   GDRMALVVQTMSAVTVACTMGLIITWRLALVMIAVQPLIIVCFYTRRVLLKKMSQKAIKS  858

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A EAV N R VT+F S N++L + + AQ+ PR+E+ ++SW AGIG+  +Q LT
Sbjct  859   QEESSKLAAEAVSNLRTVTAFSSQNRLLKMLEKAQEGPRRESIRQSWYAGIGLACSQSLT  918

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
              + WA DFWYGGKLV+ G +++  +F+TF +LVSTG+VIADAGSMT+DLAKG+ AV S+F
Sbjct  919   TVTWAFDFWYGGKLVAKGYVNAKQLFQTFMVLVSTGRVIADAGSMTTDLAKGADAVGSVF  978

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LD+ + I        D  G + ++++G IE++ V+FAYP+RP+  I   F ++++AG 
Sbjct  979   AVLDKYTKIEPE-----DPEGLDPKRITGSIELRNVHFAYPARPDVMIFNGFSIKIEAGK  1033

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   G +++DG DV+S+ +   R+ +ALVSQEP +++
Sbjct  1034  STALVGQSGSGKSTIIGLIERFYDPIKGLVKIDGQDVKSYHLKSLRKHIALVSQEPTLFA  1093

Query  616   GTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             GTIR+NI++G  D   E EI+EAA+AANAH FI+ L+ GYDT CG+RGVQLSGGQKQRIA
Sbjct  1094  GTIRENIVYGVSDKVDELEIVEAARAANAHDFIAGLRDGYDTSCGDRGVQLSGGQKQRIA  1153

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNP ILLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D I +
Sbjct  1154  IARAILRNPVILLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIRNCDMITV  1213

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +GKVVE GT+S L  K
Sbjct  1214  LDKGKVVEKGTHSSLLAK  1231



>gb|KFK33731.1| hypothetical protein AALP_AA5G052500 [Arabis alpina]
Length=1244

 Score =  1213 bits (3139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1221 (53%), Positives = 893/1221 (73%), Gaps = 25/1221 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG          +   
Sbjct  19    SIRSIFMHADGVDWLLMGLGFIGAVGDGFTTPLVLLITSKLMNNLG------GPSFNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M  + K ++  + +     V+ F+EGYCW++T ERQ  ++R +YL A+LRQ+VG+FD  
Sbjct  73    FMHNISKNAVSLLYVACGSWVVCFLEGYCWTRTGERQTARMRERYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S F+          WRL++V  P +V+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASTFVGSYIVGFILLWRLTIVGLPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +SKK  +EY++A  +  QA+SS++T+Y+F+ ER IL ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISKKIREEYNEAGFVAEQAISSVRTVYAFSGERKILSKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKG+ +GS G++FA+W +++WYGSR++M+ G  GG ++A   S  +GG+SL
Sbjct  253   VKLGIKQGLAKGITIGSNGITFAMWGYMSWYGSRMVMYHGAEGGTVFAVAASVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EAS A  RI   I+RVPKID ++  G  L+ IRGE+EFKNVKF YPSRP
Sbjct  313   GGGLSNIKYFFEASAAGDRIMEVINRVPKIDSDNPDGHKLENIRGEVEFKNVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ + +D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFEDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPAAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI++NI+ GK   SME+VV AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKKNILFGKEDASMEDVVEAAKASNAHNFISQLPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASVGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFA--  2039
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G Y  + +LQ Q    D D   +  
Sbjct  553   AHRLSTIRNADVISVVQNGHVVETGSHDELMENLDGQYTSLVRLQ-QIEKEDPDVKISVN  611

Query  2038  ----PSSNAGR--QSTEKsspavlassplLIETAQKVP--TDHHHQPSPSFSRLLGLNLT  1883
                 P S+  +  +S+ + S    +SS   +  +  V   ++ +  P PSF RLL +NL 
Sbjct  612   VKMGPISDPSKDLRSSSRVSTLSRSSSANSVTGSSIVKNISEDNKPPVPSFKRLLAMNLP  671

Query  1882  EWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsi  1703
             EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH E++ + + + L F  L +LS 
Sbjct  672   EWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHNEIKEKTRIYALSFVGLAVLSF  731

Query  1702  tlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKS  1523
              +N+CQHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+ +A +V+S
Sbjct  732   LINVCQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDQDENSSGAICSRLAKDATVVRS  791

Query  1522  LVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFV  1343
             LV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQPL I+CFYTR VLL  ++ K +
Sbjct  792   LVGDRMALLVQTVSAVTIACTMGLVIAWRLALVMIAVQPLIIVCFYTRLVLLKNMSQKAI  851

Query  1342  KAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQG  1163
             KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AGIG+  +Q 
Sbjct  852   KAQDESSKLAAEAVSNIRTITAFSSQERIMKMLEKAQENPRRESIRQSWFAGIGLAMSQS  911

Query  1162  LTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVAS  983
             LT   WALDFWYGG+L+++G I++  +F+TF ILVSTG+VIAD GSMT+DLAKGS AV S
Sbjct  912   LTSCTWALDFWYGGRLIADGYITAKALFETFMILVSTGRVIADVGSMTTDLAKGSDAVRS  971

Query  982   IFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKA  803
             +FA+LDR + I        D  G   E+++G++E   V+F+YP+RP+  I R+F +++ A
Sbjct  972   VFAVLDRYTSIDPE-----DPDGYETERITGQVEFLNVDFSYPTRPDVVIFRDFSIDIDA  1026

Query  802   GSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVI  623
             G S  +VG SGSGKSTI+ LIERFYD   G +R+DG D+R +++   R+ +ALVSQEP +
Sbjct  1027  GKSTAIVGPSGSGKSTIIGLIERFYDPVKGVVRIDGRDLRLYNLRSLRQHIALVSQEPTL  1086

Query  622   YSGTIRDNILFGKLDas--eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQ  449
             ++GTIR+NI++GK      E EII+AAKAANAH FI+SL  GYDT CG+RGVQLSGGQKQ
Sbjct  1087  FAGTIRENIIYGKASDKIDETEIIQAAKAANAHDFITSLSDGYDTTCGDRGVQLSGGQKQ  1146

Query  448   riaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDS  269
             RIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D 
Sbjct  1147  RIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNCDE  1206

Query  268   IALVSEGKVVEHGTYSQLKNK  206
             IA++ +GK+VE GT+S L +K
Sbjct  1207  IAVLDKGKLVERGTHSSLLSK  1227



>ref|XP_008458712.1| PREDICTED: ABC transporter B family member 15-like [Cucumis melo]
Length=1251

 Score =  1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/1222 (54%), Positives = 884/1222 (72%), Gaps = 34/1222 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D FLM LG +GAIGDG++T  +L+  S L N +G+ S+ S    S    +  
Sbjct  29    IFMHADAVDKFLMTLGFIGAIGDGLTTPLVLVVSSRLMNNIGHTSSASSITDS---FVTN  85

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             ++K ++  + +     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  86    IDKNAVALLYVACGGFVACFLEGYCWTRTGERQAARMRARYLKAVLRQDVGYFDLHVTST  145

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEK+P FLM+ ++F+     +    WRL++V  P  V+L+IP
Sbjct  146   SEVITSVSNDSLIIQDVLSEKIPNFLMNAAIFVGSYLAAVMLFWRLAVVGLPFAVLLVIP  205

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YGK L+ L+++S + Y KA  +  QA+SSI+T+Y+F  E   +  YSS L+ ++KLG
Sbjct  206   GLLYGKTLMGLARESMEGYQKAGTVAEQAISSIRTVYAFVGEDKTISEYSSALEGSVKLG  265

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G +KGLA+GS G+SFAIW+F++WYGSR++M+ G  GG ++A G +  +GGLS+G  L
Sbjct  266   IKQGFSKGLAIGSNGISFAIWSFMSWYGSRMVMYHGAQGGTVFAVGAAIAVGGLSIGSGL  325

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  A  RI   I+RVPKID  D  G +L  I G+++F NV FAYPSRP+++V
Sbjct  326   SNIKYFSEACAAGERIMEVINRVPKIDSADMEGQILRDISGQVQFTNVHFAYPSRPDTVV  385

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L DL L + AG+TVALVG SGSGKST I+LLQRFYD  SGSI +DG+ I  LQ+KWLR Q
Sbjct  386   LNDLTLTIPAGRTVALVGGSGSGKSTVISLLQRFYDPISGSISVDGIGIEKLQLKWLRSQ  445

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALFGTSI+ENI+ GK  GS+++V+ AA  +NAH FI   PQGY+T+VGERG 
Sbjct  446   MGLVSQEPALFGTSIKENILFGKEDGSIDDVIEAAKASNAHSFISLFPQGYDTQVGERGV  505

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  506   QMSGGQKQRIAIARAIIKRPRILLLDEATSALDSESERIVQEALDKAAVGRTTIIIAHRL  565

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQ----------------F  2069
             ST+RNADLIAV+  G ++E G H +L++ + G Y  + +LQ +                 
Sbjct  566   STVRNADLIAVLQDGQVMEMGPHDDLIKNQTGLYTSLVQLQHKSPPEPSSTTSHIEKITT  625

Query  2068  SCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLN  1889
             + + +  S    SN+G  S               IE  Q++       P+PSF RLL LN
Sbjct  626   TTSSRRLSLLNHSNSG-NSGASDLVHETTPPSSSIEKEQEL-------PNPSFRRLLALN  677

Query  1888  LTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcll  1709
             L EWKQ L+G   A+ FGAVQP YA  +G MIS +F  SHEE++A+ + + L F  L +L
Sbjct  678   LPEWKQALMGCSGAVVFGAVQPLYAFAMGSMISVYFLKSHEEIKAKTRTYALCFVGLAIL  737

Query  1708  sitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMV  1529
             S+ +N+ QHY FAYMGE+LT+R+R  ML KILTFE  WFD++ +SSGALC+RLS +A +V
Sbjct  738   SLLVNIVQHYNFAYMGEYLTKRVREMMLSKILTFEIGWFDQDEHSSGALCSRLSKDANVV  797

Query  1528  KSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTK  1349
             +SLV DR++L+VQ  S+VTIA  MGLV++WKLALVMIAVQPL I CFYTR+VLL  ++ K
Sbjct  798   RSLVGDRMALIVQTISAVTIAFTMGLVISWKLALVMIAVQPLVICCFYTRRVLLKKMSNK  857

Query  1348  FVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSA  1169
              +KAQ  S+++A EAV N R +T+F S  ++L + + AQ+ P++E+ K+SW AGIG+G +
Sbjct  858   AIKAQEQSSKLAAEAVSNLRTITAFSSQERILKMLEKAQEGPKRESIKQSWYAGIGLGCS  917

Query  1168  QGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAV  989
             Q LT   WALDFWYGGKLV+ G+ ++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV
Sbjct  918   QSLTTCSWALDFWYGGKLVAQGQTTAKALFETFMILVSTGRVIADAGSMTTDLAKGSEAV  977

Query  988   ASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              S+F +LDR + I        D  G    KL G+IEIK V+F YPSRPE  I   F + +
Sbjct  978   GSVFDVLDRFTKIEPD-----DPEGYKPNKLIGQIEIKNVDFNYPSRPEAMIFHGFSINI  1032

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             +AG S  LVG+SGSGKSTI+ LIERFYD   G+I +DG DV+S+ +   R+ +ALVSQEP
Sbjct  1033  EAGKSTALVGQSGSGKSTIIGLIERFYDPIKGTINIDGRDVKSYHLRTLRKHIALVSQEP  1092

Query  628   VIYSGTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
              +++GTIR+NI++G      E+EIIEAAKA+NAH FIS LK GY+T CG+RG+QLSGGQK
Sbjct  1093  TLFAGTIRENIIYGVSKTVDESEIIEAAKASNAHDFISGLKDGYETWCGDRGLQLSGGQK  1152

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARAI++NP +LLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D
Sbjct  1153  QRIAIARAILKNPGVLLLDEATSALDGQSEKVVQEALERVMVGRTSVVVAHRLSTIQNCD  1212

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
              IA++ +GKVVE GT+S L  K
Sbjct  1213  MIAVLDKGKVVETGTHSSLLGK  1234



>ref|XP_007217654.1| hypothetical protein PRUPE_ppa000356mg [Prunus persica]
 gb|EMJ18853.1| hypothetical protein PRUPE_ppa000356mg [Prunus persica]
Length=1251

 Score =  1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1222 (53%), Positives = 888/1222 (73%), Gaps = 24/1222 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +F +AD +D   M LG  G++GDG ST  +LL  S L N +G       S  +   
Sbjct  18    SIRSVFMHADGVDKCFMILGLFGSLGDGFSTPLVLLITSRLMNNIG-----GSSTSAQDA  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              +  + K ++  + L     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  73    FLHNINKNAVALLYLACGSFVCCFLEGYCWTRTGERQAARMRVRYLKAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TSE+  S+S D+ +IQ+VLSEK+P FLM+ S+F      +    W+L++V +P +V+
Sbjct  133   VTSTSEVITSVSNDSLVIQDVLSEKLPNFLMNASMFSGSYVAAFIMLWKLAIVGFPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPGL+YG+ L+ L+++  +EY+KA  I  QA+SSI+T+Y+F  E   +  +S+ L  +
Sbjct  193   LIIPGLMYGRTLMGLARQIREEYNKAGSIAEQAISSIRTVYAFVGENKTISEFSAALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+  G+AKGLA+GS G+ FAIW+F+++YGSR++M+ G  GG ++A G S  +GGL+L
Sbjct  253   VKLGLNQGLAKGLAIGSNGVVFAIWSFMSYYGSRMVMYHGAQGGTVFAVGASIAVGGLAL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EAS AA RI   I R+PKID ++  G +L+ + GE+EFK+V+FAYPSRP
Sbjct  313   GAGLSNLKYFSEASSAAERIMEVIRRIPKIDSDNMEGEILEEVSGEVEFKHVEFAYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ KD NL V AGKTVALVG SGSGKST I+LLQRFYD   G I +DGV IN LQ+KW
Sbjct  373   ESIIFKDFNLTVPAGKTVALVGGSGSGKSTVISLLQRFYDPLGGEILLDGVAINKLQLKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK    +E+V+ A   ANAH+FI QLPQGY+T+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDAEIEQVIDAGKAANAHNFISQLPQGYDTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIII  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+IAVV  G ++E GSHSEL   ++GHY  + +LQ+       ++  + S
Sbjct  553   AHRLSTIRNADVIAVVQNGQVMETGSHSELSRIEDGHYTSLVRLQQTEKQKGPEELGSSS  612

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPT------------DHHHQPSPSFSRLLGLN  1889
              +    +T     ++++ S      AQ   +            D    P PSF RLL LN
Sbjct  613   ISNDIHNTSSRRLSLVSRSSSANSFAQGRASSLAGDQENMEEFDQQKLPVPSFRRLLALN  672

Query  1888  LTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcll  1709
             L EWKQ ++G +SA  FGAVQP YA  +G M+S +F   H+E++A+ + + L F  L + 
Sbjct  673   LPEWKQAILGCLSATLFGAVQPAYAFAMGSMVSVYFLTDHDEIKAKTRTYALCFLGLAIF  732

Query  1708  sitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMV  1529
             S+ +N+CQHY FAYMGE LT+R+R RML KILTFE  WFD++ NSSGA+C+RL+ +A +V
Sbjct  733   SLLVNVCQHYNFAYMGECLTKRVRERMLSKILTFEVGWFDQDENSSGAICSRLAKDANVV  792

Query  1528  KSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTK  1349
             +SLV DR++L+VQ  S+V +A  MGLV+AW+LALVMIAVQPL I+CFYTR+VLL +++ K
Sbjct  793   RSLVGDRMALVVQTISAVVVACTMGLVIAWRLALVMIAVQPLIIVCFYTRRVLLKSMSRK  852

Query  1348  FVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSA  1169
              +K+Q  S+++A EAV N R +T+F S +++L + + AQ+ PR+E+ ++SW AGIG+  +
Sbjct  853   AIKSQEESSKLAAEAVSNLRTITAFSSQDRLLKMLEKAQEGPRRESIRQSWFAGIGLACS  912

Query  1168  QGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAV  989
             Q LT + WA DFWYGGKLV+ G + +  +F+TF +LVSTG+VIADAGSMT+DLAKGS AV
Sbjct  913   QSLTTVTWAFDFWYGGKLVAKGYVHAKQLFETFMVLVSTGRVIADAGSMTTDLAKGSDAV  972

Query  988   ASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              S+FA+LDR + I        D  G   +++ G IE++ V+FAYP+RP+  I + F +++
Sbjct  973   GSVFAVLDRYTKIEPE-----DPEGLEPKRIVGHIELRDVHFAYPARPDVMIFKGFSIKI  1027

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             ++G S  LVG+SGSGKSTI+ LIERFYD   G +++DG DV+S+ +   R+ +ALVSQEP
Sbjct  1028  ESGKSTALVGQSGSGKSTIIGLIERFYDPIKGVVKIDGRDVKSYHLRSLRKHIALVSQEP  1087

Query  628   VIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
              +++GTIR+NI++G  D   E EI+EAA+AANAH FI+ LK GYDT CG+RGVQLSGGQK
Sbjct  1088  TLFAGTIRENIVYGVSDKVDELEIVEAARAANAHDFIAGLKDGYDTWCGDRGVQLSGGQK  1147

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARAI+RNP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D
Sbjct  1148  QRIAIARAILRNPVVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQNCD  1207

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
              I ++ +GKVVE GT+S L +K
Sbjct  1208  LITVLDKGKVVEKGTHSSLLSK  1229



>emb|CDP02174.1| unnamed protein product [Coffea canephora]
Length=1249

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/1217 (53%), Positives = 885/1217 (73%), Gaps = 23/1217 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD ID  LM LG LG++GDG+    +LL  S L N +G       +     +    
Sbjct  20    IFMHADNIDKLLMTLGFLGSVGDGVLMPMMLLVTSELMNNIG-----DAASSVTKDFRHS  74

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K +L    +     +  F+EGYCW++T+ERQ   +R +YL+A+LRQE+G+FD   A+T
Sbjct  75    INKNALILCYMAAGQWISCFIEGYCWTRTAERQASTLRARYLKAVLRQEIGYFDLHVAST  134

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +E+  S+S D+ +IQ+V+SEKVP+ LM+ S F+     +    WRL++V +P I+ L+IP
Sbjct  135   AEVIASVSSDSLVIQDVISEKVPVSLMNLSTFVGAYVAAFAMVWRLAIVGFPFIIFLVIP  194

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ ++++  +EY+KA  +V QA+SS++T+YSF  E   +  YSS L  T+KLG
Sbjct  195   GLMYGRSLMSIARRIREEYNKAGMVVEQAISSVRTVYSFVGESKTIAEYSSALQGTLKLG  254

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G AKGLA+GS G+ FAIW+F+++YGSRL+M+ G  GG ++A G +  +GGL+LG AL
Sbjct  255   LRQGFAKGLAIGSNGVVFAIWSFMSYYGSRLVMYHGAKGGNVFAVGAALAVGGLALGSAL  314

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               V+Y +EAS A  RI   I RVPKID ++  G +L+ + G++EFK+V+FAYPSRPES++
Sbjct  315   SNVRYLSEASAAGERIMEIIKRVPKIDSDNLEGQILENVSGKVEFKHVEFAYPSRPESII  374

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD NL+V AG+TVALVG SGSGKST IALLQRFYD   G I +DGV I+ LQ+KWLR Q
Sbjct  375   FKDFNLEVPAGRTVALVGGSGSGKSTVIALLQRFYDPLGGEILLDGVNIDKLQLKWLRSQ  434

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
              GLVSQE ALF TSI+ENI+ GK   SMEEV+ AA  +NAH+FI QLPQGY+T+VGERG 
Sbjct  435   TGLVSQEPALFATSIKENILFGKEDASMEEVIEAAKASNAHNFICQLPQGYDTQVGERGV  494

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P +LLLDEATSALD+ESE++VQ+ALD+A+ GRTT+ +AH+L
Sbjct  495   QMSGGQKQRIAIARAIIKTPKLLLLDEATSALDAESERVVQEALDKAAVGRTTITIAHRL  554

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQR--QFSCADQDQS-FAPSS  2030
             STIRNADLIAVV  G +IE GSH EL+E +NG Y  + +LQ+  + S  + + S  A  S
Sbjct  555   STIRNADLIAVVQNGQVIETGSHDELVEDENGFYTSLIRLQQTEKISQVESNASALASLS  614

Query  2029  NA--GRQSTEKsspavlassplLIETAQKVPTDHHHQPS------PSFSRLLGLNLTEWK  1874
             NA   R ST     ++L+ S     T      ++   P       PSF RLL +NL EW+
Sbjct  615   NAISDRHSTSSRRLSILSRSSSANSTTPSHRAENAAAPGDQVFSVPSFRRLLAMNLPEWR  674

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q   G ISA+ FGA+QPTYAL +G MIS +F P H E++ + + + L F  L + S+ +N
Sbjct  675   QATAGCISAVLFGAIQPTYALALGSMISVYFLPDHREIKKKTEIYALSFVGLAVASLVIN  734

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             +CQHY FA MGEHLT+RIR +ML K+LTFE  WFD++ N++GALC+RL+ +A +V+SLV 
Sbjct  735   ICQHYNFAAMGEHLTKRIREKMLSKMLTFEIGWFDQDENTTGALCSRLAKDANVVRSLVG  794

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++LLVQ  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY ++VLL+T+T K +KAQ
Sbjct  795   DRMALLVQTISAVIIACTMGLVIAWRLALVMIAVQPLIIICFYCKRVLLTTMTKKAIKAQ  854

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
               S+++A EAV N R VT+F S  ++L + + AQ  PR+++ ++SW AG+G+G++  L  
Sbjct  855   QESSKVAAEAVSNLRTVTAFSSQARILRMLEQAQRGPRRQSIRQSWFAGVGLGTSNSLMS  914

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
             + WALDFWYGGKL+  GE+ +  +F+TF ILVSTG+VIADA ++T+DLAKGS AV S+FA
Sbjct  915   LTWALDFWYGGKLIGEGELGAKALFQTFMILVSTGRVIADAATLTNDLAKGSEAVGSVFA  974

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             +LDR S I        D  G    K++G +E++ V+FAYPSRP+  I   F L+++AG S
Sbjct  975   VLDRYSSIEPE-----DPEGHKPNKVTGHVELRDVDFAYPSRPDVIIFSGFSLKIQAGKS  1029

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ LI+RFYD   G +++DG D++++ +   R+ +ALVSQEP +++G
Sbjct  1030  TALVGQSGSGKSTIIGLIQRFYDPLRGVVKIDGRDIKAYHLRSLRKHIALVSQEPTLFAG  1089

Query  613   TIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             TIR N+ +G   D  E EIIEAAKAANAH F++ LK GYDT CG+RG+QLSGGQKQRIAI
Sbjct  1090  TIRQNVAYGASEDVGEAEIIEAAKAANAHDFVAGLKDGYDTWCGDRGLQLSGGQKQRIAI  1149

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAI++NP ILLLDEATSALD  SE+VVQ+AL+ +M+GRT++VVAHRL+TI++ D+IA++
Sbjct  1150  ARAILKNPAILLLDEATSALDSRSEKVVQDALERVMVGRTSVVVAHRLSTIQSCDTIAVL  1209

Query  256   SEGKVVEHGTYSQLKNK  206
              +GKVVE GT+S L  K
Sbjct  1210  DKGKVVEKGTHSSLLAK  1226


 Score =   307 bits (787),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 202/540 (37%), Positives = 315/540 (58%), Gaps = 14/540 (3%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             + ++ E  +L FV L +A +V+   + Y ++   E    +IR K L  +L  E+G+FD  
Sbjct  712   IKKKTEIYALSFVGLAVASLVINICQHYNFAAMGEHLTKRIREKMLSKMLTFEIGWFDQD  771

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             E TT  + + ++KD ++++ ++ +++ + +   S  +         +WRL+LV      +
Sbjct  772   ENTTGALCSRLAKDANVVRSLVGDRMALLVQTISAVIIACTMGLVIAWRLALVMIAVQPL  831

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             +II        L  ++KK+ K   +++ +  +A+S+++T+ +F+++  IL          
Sbjct  832   IIICFYCKRVLLTTMTKKAIKAQQESSKVAAEAVSNLRTVTAFSSQARILRMLEQAQRGP  891

Query  3109  IKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGR-IYAAGISYVLGGL  2936
              +  ++     G+ +G S  L    WA   WYG +LI  +GE G + ++   +  V  G 
Sbjct  892   RRQSIRQSWFAGVGLGTSNSLMSLTWALDFWYGGKLI-GEGELGAKALFQTFMILVSTGR  950

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
              +  A        + S A   +F+ +DR   I+ ED  G   + + G +E ++V FAYPS
Sbjct  951   VIADAATLTNDLAKGSEAVGSVFAVLDRYSSIEPEDPEGHKPNKVTGHVELRDVDFAYPS  1010

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+ ++    +LK++AGK+ ALVG SGSGKST I L+QRFYD   G + IDG +I A  +
Sbjct  1011  RPDVIIFSGFSLKIQAGKSTALVGQSGSGKSTIIGLIQRFYDPLRGVVKIDGRDIKAYHL  1070

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEV-----VAAAMTANAHDFIRQLPQ  2411
             + LR  + LVSQE  LF  +IR+N+  G    + E+V     + AA  ANAHDF+  L  
Sbjct  1071  RSLRKHIALVSQEPTLFAGTIRQNVAYG----ASEDVGEAEIIEAAKAANAHDFVAGLKD  1126

Query  2410  GYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASA  2231
             GY+T  G+RG  LSGGQKQRIAIARAI+KNP ILLLDEATSALDS SEK+VQDAL++   
Sbjct  1127  GYDTWCGDRGLQLSGGQKQRIAIARAILKNPAILLLDEATSALDSRSEKVVQDALERVMV  1186

Query  2230  GRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQRQFSCAD  2057
             GRT++VVAH+LSTI++ D IAV+  G ++E+G+HS L+ K  +G Y  +  LQ   +  D
Sbjct  1187  GRTSVVVAHRLSTIQSCDTIAVLDKGKVVEKGTHSSLLAKGPSGAYYSLVSLQTTANSTD  1246



>ref|XP_003633838.1| PREDICTED: ABC transporter B family member 15-like isoform X1 
[Vitis vinifera]
Length=1242

 Score =  1208 bits (3126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1226 (53%), Positives = 887/1226 (72%), Gaps = 34/1226 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD  D++LM  G LGA+GDG S   +L   S + N +G     S S  +   
Sbjct  10    SVRSIFMHADAADLWLMAFGFLGALGDGFSMPVVLYVTSEIMNNIG-----SSSTSAADA  64

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              + ++ K ++  + +     V  F+EGYCWS+T+ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  65    FVDKINKNAVTLLYIACGSWVACFLEGYCWSRTAERQATRMRARYLKAVLRQDVGYFDLH  124

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+E+  S+S D+ +IQ+VLSEKVP FLM+ + FL     +    WRL++V +P +V+
Sbjct  125   VTSTAEVITSVSNDSLVIQDVLSEKVPNFLMNAATFLGSYIAAFAMLWRLAIVGFPFVVV  184

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ L++   +EY+KA  I  QA+SSI+T+YSF  E      +S+ L  +
Sbjct  185   LVIPGLMYGRTLMGLARTIREEYNKAGTIAEQAISSIRTVYSFVGESKTRSDFSAALQGS  244

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKGLA+GS G+ FAIW+F++WYGSR++M+ G  GG ++  G +  +GGLSL
Sbjct  245   VKLGLRQGLAKGLAIGSNGIVFAIWSFMSWYGSRMVMYHGARGGTVFVVGAAIAVGGLSL  304

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EA  A  RI   I RVPKID ++  G +L+ + GE+EF++V+FAYPSRP
Sbjct  305   GAGLSNLKYFSEACSAGERIMEMIKRVPKIDSDNMEGQILENVSGEVEFRHVEFAYPSRP  364

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ KD NLK+ AGKTVALVG SGSGKSTAI+LLQRFYD   G I +DGV I+ LQ+KW
Sbjct  365   ESIIFKDFNLKIPAGKTVALVGGSGSGKSTAISLLQRFYDPLGGEILLDGVAIDKLQLKW  424

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R QMGLVSQE ALF T+I+ENI+ GK    MEEVVAAA  +NAH+FI QLPQGY+T+VG
Sbjct  425   VRSQMGLVSQEPALFATTIKENILFGKEDAVMEEVVAAAKASNAHNFICQLPQGYDTQVG  484

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD A+ GRTT+++
Sbjct  485   ERGVQMSGGQKQRIAIARAIIKAPQILLLDEATSALDSESERVVQEALDNAAVGRTTIII  544

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAP-  2036
             AH+LSTIRNAD+I VV  G I+E GSH +L++  +G Y  + +LQ+       ++S AP 
Sbjct  545   AHRLSTIRNADIITVVQNGQIMETGSHDDLIQNDDGLYTSLVRLQQ------TEKSEAPS  598

Query  2035  ---------SSNAGRQSTEKsspavlassplLIETAQKVPTD------HHHQPSPSFSRL  1901
                      S++    ST     ++++ S      A   P            P PSF RL
Sbjct  599   LPISSTAAISTSMDLHSTSSRRLSLVSRSSSANSNAPSRPAGEVFTAAEQDFPVPSFRRL  658

Query  1900  LGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAl  1721
             L +NL EWKQ  +G +SA+ FGAVQP YA  +G MIS +F P H+E++ + + + L F  
Sbjct  659   LAMNLPEWKQASMGCLSAVLFGAVQPVYAFAMGSMISVYFFPEHDEIKKKTRTYALCFVG  718

Query  1720  lcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNE  1541
             L + S  +N+ QHY FA MGE+LT+R+R RM  KILTFE  WFD++ NS+GA+C+RL+ +
Sbjct  719   LAVFSFLVNISQHYNFAAMGEYLTKRVRERMFSKILTFEVGWFDQDQNSTGAICSRLAKD  778

Query  1540  AAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLST  1361
             A +V+SLV DR++LLVQ  S+V IA  MGLV+AW+LA+VMIAVQPL I+C+YTR+VLL +
Sbjct  779   ANVVRSLVGDRMALLVQTFSAVIIACTMGLVIAWRLAVVMIAVQPLIIVCYYTRRVLLKS  838

Query  1360  ITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIG  1181
             ++ K +KAQ  S+++A EAV N RI+T+F S  ++L + + AQ+ P +E+ ++SW AGIG
Sbjct  839   MSAKGIKAQEESSKLAAEAVSNLRIITAFSSQARILKMLEAAQEGPLRESIRQSWFAGIG  898

Query  1180  IGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKG  1001
             +G++Q L    WALDFWYGGKL+S G ISS  +F+TF ILVSTG+VIADAGSMTSDLAKG
Sbjct  899   LGTSQSLMTCTWALDFWYGGKLISQGYISSKALFETFMILVSTGRVIADAGSMTSDLAKG  958

Query  1000  SAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREF  821
             S AV S+FA+LDR + I        D  G   EK+ G++EI+ V+FAYP+RP+  + + F
Sbjct  959   SDAVGSVFAVLDRYTRIEPE-----DPDGHQPEKIIGRVEIRDVDFAYPARPDVLVFKSF  1013

Query  820   CLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALV  641
              + + AG S  LVG+SGSGKSTI+ LIERFYD   GS+++DG D+RS+ +   R+ +ALV
Sbjct  1014  SINIDAGKSTALVGQSGSGKSTIIGLIERFYDPLQGSVKIDGKDIRSYHLRVLRKHIALV  1073

Query  640   SQEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLS  464
             SQEP +++GTIR+NI +G  D   E+EIIEAA+AANAH FI+ LK GYDT CG+RGVQLS
Sbjct  1074  SQEPTLFAGTIRENIAYGASDKIDESEIIEAARAANAHDFIAGLKNGYDTWCGDRGVQLS  1133

Query  463   GGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTI  284
             GGQKQR+AIARAI++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI
Sbjct  1134  GGQKQRVAIARAILKNPAVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTI  1193

Query  283   KNLDSIALVSEGKVVEHGTYSQLKNK  206
             +N D IA++ +GKVVE GT+S L  K
Sbjct  1194  QNCDLIAVLDKGKVVEKGTHSSLLGK  1219



>gb|ADZ48235.1| multidrug/pheromone exporter protein [Hevea brasiliensis]
Length=1250

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/1223 (54%), Positives = 882/1223 (72%), Gaps = 26/1223 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D FLM LG +G++GDG ST  +L   S L N +G       +     +
Sbjct  11    SIRSIFMHADGVDWFLMVLGVIGSVGDGFSTPLVLFVTSKLMNNIG------GASSFQSD  64

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + K +L    L     V+ F+EGYCW++T ERQ  ++R +YL+A+LRQEVG+FD  
Sbjct  65    FSHNINKNALALCYLACGQWVVCFVEGYCWTRTGERQATRMRARYLKAVLRQEVGYFDLH  124

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+E+  S+S D+ +IQ+VLSEKVP  LM+ S+F           WRL++V +P IVI
Sbjct  125   VTSTAEVITSVSNDSFVIQDVLSEKVPNLLMNASMFFGCYLVGFLLLWRLAIVGFPFIVI  184

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ L++K  +EY+KA  I  QALSSI+T+Y+F  E   +  YS+ LD +
Sbjct  185   LVIPGLMYGRTLMGLARKIKEEYNKAGTIAEQALSSIRTVYAFVGESKTVTAYSAALDFS  244

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKGLA+GS G+ FAIW+F+++YGSRL+M+    GG ++A G S  +GGL+L
Sbjct  245   VKLGLKQGLAKGLAIGSNGVVFAIWSFMSYYGSRLVMYHNARGGTVFAVGASIAVGGLAL  304

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKY +EA  A  RI   I R+P+ID E+  G +L+ + GE+EFK+V+FAYPSRP
Sbjct  305   GAGLSNVKYLSEACTAGERIMEVIRRIPRIDLENLEGEILENVGGEVEFKHVEFAYPSRP  364

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ KD  LK+ AG+TVALVG SGSGKST IALLQRFYD   G I +DGV I+ LQ+KW
Sbjct  365   ESIIFKDFTLKIPAGRTVALVGGSGSGKSTVIALLQRFYDPLDGEILLDGVAIDKLQLKW  424

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   +MEEVV AA  +NAH+FI QLPQGY+T+VG
Sbjct  425   LRSQMGLVSQEPALFATSIKENILFGKEDATMEEVVEAAKASNAHNFICQLPQGYDTQVG  484

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ ALD+A+ GRTT+++
Sbjct  485   ERGVQMSGGQKQRIAIARAIIKAPRILLLDEATSALDSESERIVQQALDKAAIGRTTIII  544

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQR--QFSCADQDQSFA  2039
             AH+LSTIRN D+I VV  G ++E GSH ELME ++G Y  + +LQ+  +    + DQ   
Sbjct  545   AHRLSTIRNVDVITVVQNGQVMETGSHDELMEIEDGLYTTLIRLQQTEKEKSNEDDQYHI  604

Query  2038  PSS------NAGRQSTEKsspavlassplLIE------TAQKVPTDHHHQPSPSFSRLLG  1895
             PSS      +    S+ + S     SS   I        A+ +  +    P PSF RLL 
Sbjct  605   PSSSLISKMDMNNTSSRRLSMVSRTSSANSIAPSRASVNAENIQLEEQKFPVPSFRRLLA  664

Query  1894  LNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllc  1715
             LNL EWKQ   G + AI FG VQP YA  +G MIS +F   H+E++ RI+ + L F  L 
Sbjct  665   LNLPEWKQASFGCLGAILFGGVQPLYAFAMGSMISVYFYTDHDEIKKRIRIYSLCFLGLS  724

Query  1714  llsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAA  1535
             + +  +N+ QHY FAYMGE+LT+RIR +ML K+LTFE  WFD++ NSSGA+C+RL+ +A 
Sbjct  725   IFTFIVNIVQHYNFAYMGEYLTKRIREKMLSKMLTFEVGWFDQDENSSGAICSRLAKDAN  784

Query  1534  MVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT  1355
             +V+SLV DR++L+VQ  S+V IA  MGL +AW+LA+VMIAVQPL I+CFYTR+VLL +++
Sbjct  785   VVRSLVGDRMALVVQTVSAVVIACTMGLFIAWRLAIVMIAVQPLIIVCFYTRRVLLKSMS  844

Query  1354  TKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIG  1175
              K +KAQ+ S+++A EAV N R +T+F S +++L + + AQ+ P +E+ ++S  AGIG+G
Sbjct  845   HKAIKAQDESSKLAAEAVSNLRTITAFSSQDRILRMLEKAQEGPLRESIRQSLFAGIGLG  904

Query  1174  SAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
             ++Q L    WALDFWYGGKL+S G I++ D+F+TF ILVSTG+VIADAGSMT+DLAKGS 
Sbjct  905   TSQSLMSCTWALDFWYGGKLISKGYITAKDLFETFMILVSTGRVIADAGSMTTDLAKGSD  964

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
             AV S+FA+LDR + I  P        G   E + G +E++ VNFAYP+RP+  I   F +
Sbjct  965   AVGSVFAVLDRYTKI-EPEGAD----GLKPEMIMGHVELRDVNFAYPARPDVIIFEGFSI  1019

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
             +++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG D++S+ +   R+ +ALVSQ
Sbjct  1020  KIEAGKSTALVGQSGSGKSTIIGLIERFYDPIRGIVKIDGRDIKSYHLRSLRKHIALVSQ  1079

Query  634   EPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQ  455
             EP +++GTIR+NI +G     E+EIIEAAKAANAH FI+ LK GYDT CG+RGVQLSGGQ
Sbjct  1080  EPTLFAGTIRENIAYGTSKNDESEIIEAAKAANAHDFIAGLKDGYDTWCGDRGVQLSGGQ  1139

Query  454   KQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNL  275
             KQRIAIARAI++NPT+LLLDEATSALD +SE+VVQ+AL+ +MIGRT++VVAHRL+TI+N 
Sbjct  1140  KQRIAIARAILKNPTVLLLDEATSALDSQSEKVVQDALERVMIGRTSVVVAHRLSTIQNC  1199

Query  274   DSIALVSEGKVVEHGTYSQLKNK  206
             D IA++ +G+VVE GT+S L  K
Sbjct  1200  DLIAVLDKGQVVEQGTHSSLLAK  1222



>ref|XP_008230690.1| PREDICTED: ABC transporter B family member 15-like [Prunus mume]
Length=1251

 Score =  1206 bits (3119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1222 (53%), Positives = 887/1222 (73%), Gaps = 24/1222 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +F +AD +D   M LG  G++GDG ST  +LL  S L N +G       S  +  +
Sbjct  18    SIRSVFMHADGVDKCFMILGLFGSLGDGFSTPLVLLITSRLMNNIG-----GSSTSAQDD  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              +  + K ++  + L     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  73    FLHNINKNAVALLYLACGSFVCCFLEGYCWTRTGERQAARMRVRYLKAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TSE+  S+S D+ +IQ+VLSEK+P FLM+ S+F      +    W+L++V +P +V+
Sbjct  133   VTSTSEVITSVSNDSLVIQDVLSEKLPNFLMNASMFSGSYVAAFIMLWKLAIVGFPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ L+++  +EY+KA  I  QA+SSI+T+Y+F  E   +  +S+ L  +
Sbjct  193   LVIPGLMYGRTLMGLARQIREEYNKAGSIAEQAISSIRTVYAFVGENKTISEFSAALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+  G+AKGLA+GS G+ FAIW+F+++YGSR++M+ G  GG ++A G S  +GGL+L
Sbjct  253   VKLGLNQGLAKGLAIGSNGVVFAIWSFMSYYGSRMVMYHGAQGGTVFAVGASIAVGGLAL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EAS AA RI   I RVPKID ++  G +L  + GE+EFK+V+FAYPSRP
Sbjct  313   GAGLSNLKYFSEASSAAERIMEVIRRVPKIDSDNMEGEILGEVSGEVEFKHVEFAYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ KD NL V AGKTVALVG SGSGKST I+LLQRFYD   G I +DGV IN LQ+KW
Sbjct  373   ESIIFKDFNLTVPAGKTVALVGGSGSGKSTVISLLQRFYDPLGGEILLDGVAINKLQLKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK    +E+V+ A   ANAH+FI QLPQGY+T+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDAEIEQVIDAGKAANAHNFISQLPQGYDTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIII  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+IAVV  G ++E GSH EL   ++GHY  + +LQ+       ++  + S
Sbjct  553   AHRLSTIRNADVIAVVQNGQVMETGSHDELSRIEDGHYTSLVRLQQTEKQKGPEELGSSS  612

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPT------------DHHHQPSPSFSRLLGLN  1889
              +    +T     ++++ S      AQ   +            D    P PSF RLL LN
Sbjct  613   ISNDIHNTSSRRLSLVSRSSSANSFAQGRASSLAGDQENMEEFDQQKLPVPSFRRLLALN  672

Query  1888  LTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcll  1709
             L EWKQ ++G +SA  FGAVQP YA  +G M+S +F   H+E++A+ + + L F  L + 
Sbjct  673   LPEWKQAILGCLSATLFGAVQPAYAFAMGSMVSVYFLTDHDEIKAKTRTYALCFLGLAIF  732

Query  1708  sitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMV  1529
             S+ +N+CQHY FAYMGE LT+R+R RML KILTFE  WFD++ NSSGA+C+RL+ +A +V
Sbjct  733   SLLVNVCQHYNFAYMGECLTKRVRERMLSKILTFEVGWFDQDENSSGAICSRLAKDANVV  792

Query  1528  KSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTK  1349
             +SLV DR++L+VQ  S+V +A  MGLV+AW+LALVMIAVQPL I+CFYTR+VLL +++ K
Sbjct  793   RSLVGDRMALVVQTISAVVVACTMGLVIAWRLALVMIAVQPLIIVCFYTRRVLLKSMSRK  852

Query  1348  FVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSA  1169
              +K+Q  S+++A EAV N R +T+F S +++L + + AQ+ PR+E+ ++SW AGIG+  +
Sbjct  853   AIKSQEESSKLAAEAVSNLRTITAFSSQDRLLKMLEKAQEGPRRESIRQSWFAGIGLACS  912

Query  1168  QGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAV  989
             Q LT + WA DFWYGGKLV+ G + +  +F+TF +LVSTG+VIADAGSMT+DLAKGS AV
Sbjct  913   QSLTTVTWAFDFWYGGKLVAKGYVHAKQLFETFMVLVSTGRVIADAGSMTTDLAKGSDAV  972

Query  988   ASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              S+FA+LDR + I        D  G   +++ G IE++ V+FAYP+RP+  I + F +++
Sbjct  973   GSVFAVLDRYTKIEPE-----DPEGLEPKRIVGHIELRDVHFAYPARPDVMIFKGFSIKI  1027

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             ++G S  LVG+SGSGKSTI+ LIERFYD   G +++DG DV+S+ +   R+ +ALVSQEP
Sbjct  1028  ESGKSTALVGQSGSGKSTIIGLIERFYDPIKGVVKIDGRDVKSYHLRSLRKHIALVSQEP  1087

Query  628   VIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
              +++GTIR+NI++G  D   E EI+EAA+AANAH FI+ LK GYDT CG+RGVQLSGGQK
Sbjct  1088  TLFAGTIRENIVYGVSDKVDELEIVEAARAANAHDFIAGLKDGYDTWCGDRGVQLSGGQK  1147

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARAI+RNP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D
Sbjct  1148  QRIAIARAILRNPVVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQNCD  1207

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
              I ++ +GKVVE GT+S L +K
Sbjct  1208  LITVLDKGKVVEKGTHSSLLSK  1229



>ref|XP_007032373.1| ABC transporter family protein isoform 1 [Theobroma cacao]
 gb|EOY03299.1| ABC transporter family protein isoform 1 [Theobroma cacao]
Length=1255

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/1225 (53%), Positives = 886/1225 (72%), Gaps = 27/1225 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D++LM LG +GAIGDG ST  +LL  S L N LG       S  +   
Sbjct  17    SIRSIFMHADGVDMWLMTLGFIGAIGDGFSTPLVLLVTSKLMNNLG-----DASAFTADM  71

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + K S+  + L     +  F+EG+CWS+T ERQ  ++R +YL+AILRQ+VG+FD  
Sbjct  72    FTHNIHKNSVALLYLACGSWLACFLEGFCWSRTGERQATRMRARYLKAILRQDVGYFDLH  131

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+E+  S+S D+ +IQ+VLSEKVP FLM+ ++F+     +    WRL++V +P  V+
Sbjct  132   VTSTAEVITSVSNDSLVIQDVLSEKVPNFLMNVAIFVGCYMVAFIMLWRLAIVGFPFAVL  191

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +++K+ +EY+KA  I  QA+SSI+T+YSF  E   +  +S+ L  +
Sbjct  192   LVIPGLMYGRGLIGIARKTREEYNKAGTIAEQAISSIRTVYSFVGENKTIAEFSAALQGS  251

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKGLA+GS G+ FA W+F+++YGSR++M+ G  GG ++  G +  +GGLSL
Sbjct  252   LKLGLRQGLAKGLAIGSNGVVFATWSFMSYYGSRMVMYHGAPGGTVFIVGAAIAMGGLSL  311

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L  +KYF+EA  A  RI   I RVPKID  +  G +LD + G +EF++V+FAYPSRP
Sbjct  312   GASLSNLKYFSEACSAGERIIEVIKRVPKIDSYNLEGEILDKVSGAVEFRHVEFAYPSRP  371

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++  D  L + AGKTVALVG SGSGKST IALLQRFYD   G I +DG+ I+ LQ+ W
Sbjct  372   ESMIFTDFCLDIPAGKTVALVGGSGSGKSTVIALLQRFYDPLGGEILLDGIAIDKLQLNW  431

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SMEEVV AA  +NAH+FI QLPQGY+T+VG
Sbjct  432   LRSQMGLVSQEPALFATTIKENILFGKEDASMEEVVEAAKASNAHNFICQLPQGYDTQVG  491

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALD+ESE++VQ+A+DQA+ GRT++++
Sbjct  492   ERGVQMSGGQKQRIAIARAIIKAPQILLLDEATSALDAESERVVQEAIDQAAIGRTSIII  551

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQR----QF--SCADQD  2051
             AH+LSTIRNADLIAVV  G ++E GSH  L+E +NGHY  +  LQ+    +F        
Sbjct  552   AHRLSTIRNADLIAVVQNGQVLETGSHDALIENENGHYTSLVHLQQTEKERFPEEVNSNS  611

Query  2050  QSFAPS--SNAGRQSTEKsspa-------vlassplLIETAQKVPTDHHHQPSPSFSRLL  1898
              ++A S  SN    ST     +         +     +  A++   ++   P PSF RLL
Sbjct  612   STYASSLISNVDTNSTSSRRLSLVSRSSSANSFIQNRVSLARESAVENQKLPMPSFRRLL  671

Query  1897  GLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAll  1718
              LNL EW+Q ++G +SAI FGAVQP YA ++G M+S +F   H+E++ + + + L F  L
Sbjct  672   ALNLPEWRQAILGCLSAILFGAVQPVYAFSLGSMVSVYFLTDHDEIKEKTKIYALCFLGL  731

Query  1717  cllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEA  1538
              + S+ +N+ QHY FAYMGE+LT+RIR RML KILTFE  W+D++ NSSGA+C+RL+ +A
Sbjct  732   SVFSLLINVGQHYNFAYMGEYLTKRIRERMLSKILTFEVGWYDQDENSSGAICSRLAKDA  791

Query  1537  AMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTI  1358
              +V+SLV DR++L+VQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL ++
Sbjct  792   NVVRSLVGDRMALIVQTISAVTIACTMGLVIAWRLALVMIAVQPIIIVCFYTRRVLLKSM  851

Query  1357  TTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGI  1178
             + K +KAQ+ S+++A EAV N R +T+F S +++L + D AQ+ PR+E+ ++SW AGIG+
Sbjct  852   SQKAIKAQDESSKLAAEAVSNLRTITAFSSQHRILKMLDKAQEGPRRESIRQSWFAGIGL  911

Query  1177  GSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGS  998
             G++Q LT   WALDFWYGGKL+S+G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS
Sbjct  912   GTSQSLTTCTWALDFWYGGKLISHGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGS  971

Query  997   AAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFC  818
              AV S+F +LDR + I        D      EK+ G +E++ ++FAYP+RP+  I R F 
Sbjct  972   DAVGSVFTVLDRYTNIEPE-----DPESYKPEKIIGHVELRDIDFAYPARPDVVIFRGFS  1026

Query  817   LEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVS  638
             L ++A  S  LVG+SGSGKSTI+ LIERFYD   G ++VDG D+RS+ +   R+ +ALVS
Sbjct  1027  LNIEASKSTALVGQSGSGKSTIIGLIERFYDPLEGIVKVDGRDIRSYHLKSLRKHIALVS  1086

Query  637   QEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSG  461
             QEP ++ GTIR+NI +G  D   E+EI+EAAKAANAH FIS LK GY+T CG++GVQLSG
Sbjct  1087  QEPTLFGGTIRENIAYGASDKMDESEIVEAAKAANAHDFISGLKDGYETWCGDKGVQLSG  1146

Query  460   GQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIK  281
             GQKQRIAIARAI++NP ILLLDEAT+ALD  SE+ VQ+AL+ +M+GRT++VVAHRL+TI+
Sbjct  1147  GQKQRIAIARAILKNPAILLLDEATNALDSRSEKAVQDALERVMVGRTSVVVAHRLSTIQ  1206

Query  280   NLDSIALVSEGKVVEHGTYSQLKNK  206
             N D IA++  GKVVE GT+  L  K
Sbjct  1207  NCDQIAVLDRGKVVEKGTHQSLLAK  1231



>gb|KDP45428.1| hypothetical protein JCGZ_09677 [Jatropha curcas]
Length=1248

 Score =  1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 654/1224 (53%), Positives = 891/1224 (73%), Gaps = 27/1224 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +G+IGDG ST  +LL  S L N +G       +  S  N
Sbjct  13    SIKSIFMHADRVDSLLMILGFIGSIGDGFSTPLVLLVTSKLMNNIG------GASPSANN  66

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
               + + K ++    + +   V+ F+EGYCW++T ERQ  ++R +YL+A+LRQEVG+FD  
Sbjct  67    FSQNINKNAVALCYVAVGQWVVCFLEGYCWTRTGERQATRMRARYLKAVLRQEVGYFDLH  126

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+E+  S+S D+ +IQ+VLSEKVP FLM+ S+F           WRL++V +P I++
Sbjct  127   VTSTAEVITSVSNDSLVIQDVLSEKVPNFLMNASMFFGCYIAGFVMLWRLAIVGFPFIIL  186

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGLIYG+ L+ L++K  +EY+KA  I  QA+SSI+T+Y+F  E   +  YS+ L+ +
Sbjct  187   LVIPGLIYGRTLMELARKIREEYNKAGTIAEQAISSIRTVYAFVGESKTISAYSAALEFS  246

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKGLA+GS G+ FAIWAF+++YGSRL+M+    GG ++A G S  +GGL+L
Sbjct  247   VKLGLKQGLAKGLAIGSNGVVFAIWAFMSYYGSRLVMYHDARGGTVFAVGASIAVGGLAL  306

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EA  A  RI   I RVPKID E+  G +L+ +RGE+EFK+V+FAYPSRP
Sbjct  307   GAGLSNVKYFSEACSAGERIMEVIRRVPKIDLENMEGEILENVRGEVEFKHVEFAYPSRP  366

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES+ LKD +L + AG+TVALVG SGSGKST IALLQRFYD   G I +DGV I+ LQ+KW
Sbjct  367   ESITLKDFSLNIPAGRTVALVGGSGSGKSTVIALLQRFYDPLGGEILVDGVSIDKLQLKW  426

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   ++E+V+ AA  +NAH+FI QLP GY+T+VG
Sbjct  427   LRSQMGLVSQEPALFATSIKENILFGKEDATIEQVIEAAKASNAHNFICQLPNGYDTQVG  486

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+V+
Sbjct  487   ERGIQMSGGQKQRIAIARAIIKAPRILLLDEATSALDSESERIVQEALDKAAVGRTTIVI  546

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQR--QFSCADQDQSFA  2039
             AH+LSTIRNAD+IAVV  G I+E GSH EL+E ++G Y  + +LQ+  +    + D   A
Sbjct  547   AHRLSTIRNADVIAVVQNGQIMETGSHDELIENEDGLYTSLVRLQQTEKDKTTEDDHLTA  606

Query  2038  PSSNAGRQSTEKsspavlassplLIETAQKVPT------------DHHHQPSPSFSRLLG  1895
              SS   +     +S   L+            P+            +    P PSF RLL 
Sbjct  607   SSSLISKMDMNNTSSRRLSLVSRSSSNNSMAPSGASFAGENVQVEEEQKFPVPSFRRLLA  666

Query  1894  LNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllc  1715
             LNL EWKQ   G + AI FG VQP YA ++G MIS +F   H E++ +I+ + L+F  L 
Sbjct  667   LNLPEWKQASFGCLGAILFGGVQPVYAFSMGSMISIYFLKDHNEIKEQIRMYALIFLGLA  726

Query  1714  llsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAA  1535
             + S+ +N+ QHY FAYMGE+LT+RIR RML KILTFE  WFD++ NSSGA+C+RL+ +A 
Sbjct  727   IFSLIVNIVQHYNFAYMGEYLTKRIRERMLSKILTFEVGWFDQDENSSGAICSRLAKDAN  786

Query  1534  MVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT  1355
             +V+SLV DR++L+VQ  S+V +A  MGLV+AW+LA+VMIAVQPL I+CFYTR+VLL +++
Sbjct  787   VVRSLVGDRVALVVQTVSAVILACTMGLVIAWRLAVVMIAVQPLIIVCFYTRRVLLKSMS  846

Query  1354  TKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIG  1175
              + +KAQ+ S++IA EAV N R +T+F S +++L + + AQ+ P++E+ ++S  AGIG+G
Sbjct  847   QRAIKAQDESSKIAGEAVSNLRTITAFSSQDRILKMLEKAQEGPQRESIRQSLFAGIGLG  906

Query  1174  SAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
             ++Q L    WALDFWYGGKL+S G I++ D+F+TF +LVSTG+VIADAGSMT+DLAKG+ 
Sbjct  907   TSQSLMSCTWALDFWYGGKLISQGYITAKDLFETFMVLVSTGRVIADAGSMTTDLAKGAD  966

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
             AV S+FA+LDR + I        D  G   E + G +E++ V+FAYP+RP   I + F +
Sbjct  967   AVGSVFAVLDRYTKIEPQ-----DPDGFEPETIMGNVELRDVDFAYPARPNVIIFKSFSI  1021

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
             +++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG D+RS+ +   R+ +ALVSQ
Sbjct  1022  KIEAGKSTALVGQSGSGKSTIIGLIERFYDPLKGVVKIDGRDIRSYQLRSLRKYIALVSQ  1081

Query  634   EPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             EP +++GTI++NI++G  D   E+EIIEAAKAANAH FI+ L+ GYDT CG+RGVQLSGG
Sbjct  1082  EPTLFAGTIKENIVYGTSDKIDESEIIEAAKAANAHDFIAGLRDGYDTWCGDRGVQLSGG  1141

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARAI++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI++
Sbjct  1142  QKQRIAIARAILKNPSVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQS  1201

Query  277   LDSIALVSEGKVVEHGTYSQLKNK  206
              D IA++ +G+VVE GT+S L  K
Sbjct  1202  CDLIAVLDKGQVVEQGTHSSLLGK  1225



>ref|XP_004951620.1| PREDICTED: putative multidrug resistance protein-like [Setaria 
italica]
Length=1244

 Score =  1200 bits (3105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/1212 (54%), Positives = 884/1212 (73%), Gaps = 19/1212 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F +AD  D+ LM LG +GA+GDG+ST  +LL  S +FN LG                 +
Sbjct  25    VFMHADAADVALMVLGLVGAMGDGLSTPVMLLITSRIFNDLG------NGPDLLQEFSSK  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +++ +   + L LA  VM F+EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD +  +T
Sbjct  79    IDENARNLLFLALANWVMAFLEGYCWARTAERQASRMRERYLRAVLRQDVEYFDLKVGST  138

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ ++Q+VLSEKVP F+M+ S+FL          W L+LVA P++++LIIP
Sbjct  139   SEVITSVSNDSLVVQDVLSEKVPNFVMNCSMFLGSYAVGFALLWHLTLVALPSVLLLIIP  198

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G +YG+ L+ L+++  ++Y++   I  QA+SS++T+YSF AERS + R+S+ L+ + +LG
Sbjct  199   GFMYGRILIGLARRIREQYTRPGAIAEQAVSSVRTVYSFVAERSTMARFSAALEESARLG  258

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKG+A+GS G++F IWAF  WYGSRL+M+ G  GG ++A   + V+GGL+LG  L
Sbjct  259   VKQGLAKGVAIGSNGITFTIWAFNVWYGSRLVMYHGYKGGTVFAVSAAIVVGGLALGSGL  318

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               VKYF+EAS AA R+   I RVPKID E  +G  L  + GE+EFKNV+F YPSRPE+ +
Sbjct  319   SNVKYFSEASSAAERVQEVIRRVPKIDSESNAGEELANVAGEVEFKNVEFCYPSRPETPI  378

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
                 NL+V AG+TVALVG SGSGKST IALL+RFYD ++G + +DGV+I  L++KWLR Q
Sbjct  379   FVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPSAGEVSLDGVDIRRLRLKWLRAQ  438

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSIRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+VGERG 
Sbjct  439   MGLVSQEPALFATSIRENILFGKEDATEEEVVAAAKAANAHNFISQLPQGYDTQVGERGI  498

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V+AH+L
Sbjct  499   QMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIVIAHRL  558

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQ--RQFSCADQDQSFAPSSN  2027
             STIRNAD+IAV+  G + E GSH EL+  +NG Y  +  LQ  R    A++      +S 
Sbjct  559   STIRNADMIAVMQYGEVKELGSHDELIANENGLYTSLVHLQQTRDSREANEVGGTGSTSA  618

Query  2026  AGRQSTEKsspavlassplLI-----ETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLI  1862
             AG+ S+   S    A+S         +      TD    P PSF RLL LN  EWKQ L+
Sbjct  619   AGQSSSHSMSRRFSAASRSSSGRSMGDEENDNSTDKPKLPLPSFRRLLMLNAPEWKQALM  678

Query  1861  GSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQH  1682
             GS SAI FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  +N+ QH
Sbjct  679   GSFSAIVFGGIQPAYAYAMGSMISIYFLTDHNEIKDKTRTYALIFVGLAVLSFLINIGQH  738

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             Y F  MGE+LT+R+R +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV DR++
Sbjct  739   YNFGAMGEYLTKRVREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLVGDRMA  798

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
             L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K ++AQ+ S+
Sbjct  799   LVIQTVSAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIQAQSESS  858

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
             ++A EAV N R +T+F S  ++L +FD AQD PRKE+ ++SW AG+G+G++  L    WA
Sbjct  859   KLAAEAVSNLRTITAFSSQERILRLFDQAQDGPRKESIRQSWFAGLGLGTSMSLMTCTWA  918

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
             LDFWYGGKL++   I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+FA+LDR
Sbjct  919   LDFWYGGKLMAEHHITAKALFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVFAVLDR  978

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
              + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G S  LV
Sbjct  979   ETEI-DPDNPE----GHKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFSLSIQPGKSTALV  1033

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             G+SGSGKSTI+ LIERFYD   G +++DG D++++++   RR + LVSQEP +++GTIR+
Sbjct  1034  GQSGSGKSTIIGLIERFYDPLRGVVKIDGRDIKTYNLRALRRHIGLVSQEPTLFAGTIRE  1093

Query  601   NILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraii  422
             NI++G   A+E EI  AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAIARAI+
Sbjct  1094  NIVYGTETATEAEIENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAIARAIL  1153

Query  421   RNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKV  242
             +NP ILLLDEATSALD +SE+VVQEALD +M+GRT++VVAHRL+TI+N D I ++ +G +
Sbjct  1154  KNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSIVVAHRLSTIQNCDQITVLEKGII  1213

Query  241   VEHGTYSQLKNK  206
             VE GT++ L  K
Sbjct  1214  VEKGTHASLMAK  1225



>ref|XP_006290512.1| hypothetical protein CARUB_v10016590mg [Capsella rubella]
 gb|EOA23410.1| hypothetical protein CARUB_v10016590mg [Capsella rubella]
Length=1245

 Score =  1197 bits (3097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1226 (53%), Positives = 894/1226 (73%), Gaps = 35/1226 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF++AD +D  LM LG +GAIGDG +T  +LL  S L N LG       S  +   
Sbjct  20    SVRSIFKHADRVDWLLMGLGFIGAIGDGFTTPLVLLITSKLMNNLG------GSSFNAET  73

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  74    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  133

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ LIQ+VLSEK+P FLM  S+F+          WRL++V  P IV+
Sbjct  134   VTSTSDVITSVSSDSFLIQDVLSEKLPNFLMSASMFVGSYIVGFVLLWRLAIVGLPFIVL  193

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  194   LVIPGLMYGRALISISTKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  253

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  254   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAIAIGGVSL  313

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EAS A  RI   I+RVPKID ++  G  LD IRGE+EFKNVKF YPSR 
Sbjct  314   GGGLSNLKYFFEASSAGERIMEVINRVPKIDSDNLDGHKLDNIRGEVEFKNVKFVYPSRL  373

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L + +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  374   ETSIFDDFCLTIPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEILIDGVSIDKLQVKW  433

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SM +VV AA  +NAH+FI QLP GYET+VG
Sbjct  434   LRSQMGLVSQEPALFATTIKENILFGKEDASMNDVVEAAKASNAHNFISQLPHGYETQVG  493

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  494   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  553

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  NG YA + +LQ Q    D D +   +
Sbjct  554   AHRLSTIRNADVISVVQNGQVVETGSHDELMENVNGQYASLVRLQ-QIEKQDSDININVN  612

Query  2032  SNAG-------------RQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGL  1892
             +  G             R ST   S +  + +   I  A+ +  D+  Q  PSF RLL +
Sbjct  613   AQTGPISDPNKDLRSSSRISTLSRSSSANSFTGPSI--AKNLSEDNKPQL-PSFKRLLAM  669

Query  1891  NLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcl  1712
             NL EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L +
Sbjct  670   NLPEWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLAV  729

Query  1711  lsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAM  1532
             +S  +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+ +A +
Sbjct  730   ISFLINISQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDKDENSSGAICSRLAKDANV  789

Query  1531  VKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITT  1352
             V+SLV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL +++ 
Sbjct  790   VRSLVGDRMALLVQTVSAVTIAFTMGLVIAWRLALVMIAVQPVIIVCFYTRRVLLKSMSK  849

Query  1351  KFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGS  1172
             K +KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AG+G+  
Sbjct  850   KAIKAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQESPRRESIRQSWFAGLGLAM  909

Query  1171  AQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAA  992
             +Q LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS A
Sbjct  910   SQSLTSCTWALDFWYGGRLIQDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDA  969

Query  991   VASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLE  812
             V S+FA+LDR + I        D  G   E+L+G++E   V+F+YP+RP+  I + F +E
Sbjct  970   VGSVFAVLDRYTSIDPE-----DPDGYEPERLTGRVEFLNVDFSYPTRPDVTIFKNFSIE  1024

Query  811   VKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQE  632
             +  G S  +VG SGSGKSTI+ LIERFYD   G +++DG D+RS+ +   R+ +ALVSQE
Sbjct  1025  IYEGKSTAIVGPSGSGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRQHIALVSQE  1084

Query  631   PVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLS  464
             P +++GTIR+NI++G    K+D  E+EIIEAAKAANAH FI+SL  GYDT CG+RGVQLS
Sbjct  1085  PTLFAGTIRENIIYGRASDKID--ESEIIEAAKAANAHDFITSLTDGYDTSCGDRGVQLS  1142

Query  463   GGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTI  284
             GGQKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI
Sbjct  1143  GGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTI  1202

Query  283   KNLDSIALVSEGKVVEHGTYSQLKNK  206
             +N D+IA++ +GK+VE GT+S L +K
Sbjct  1203  QNCDAIAVLDKGKLVERGTHSSLLSK  1228



>ref|XP_006338500.1| PREDICTED: ABC transporter B family member 15-like [Solanum tuberosum]
Length=1263

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1230 (52%), Positives = 884/1230 (72%), Gaps = 36/1230 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F +AD +DI LM LG LGAI DG+S   +L+  S L N LG     +    S  +    
Sbjct  20    VFMHADSVDILLMILGFLGAICDGVSMPVMLIVTSKLMNNLG-----NNDSSSTDSFTHH  74

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L  V L     V  F+EG+CW++T+ERQ  ++R  YL+A+LRQ+VG+FD   A+T
Sbjct  75    INENALALVYLACGQWVACFLEGFCWTRTAERQASRLRISYLKAVLRQDVGYFDLHVAST  134

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +++  S+S D+ +IQE +SEKVP+FLM+ + F+          W+L+LV +P I+ L+IP
Sbjct  135   ADVIASVSSDSLVIQECISEKVPVFLMNVATFIGSYVVGFLMIWKLALVGFPFIIFLVIP  194

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ +++K   EY KA  IV QA+SS++T+YSF  E   +  YS+ L  T+ LG
Sbjct  195   GLMYGRALMGIARKIRDEYGKAGIIVEQAISSVRTVYSFVGENKTIAEYSNALQGTVDLG  254

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G+ FAIW+F+++YGSR++M+ GE GG ++A G +  +GGL+LG  L
Sbjct  255   LKQGLAKGLAIGSNGIVFAIWSFMSYYGSRMVMYNGEHGGTVFAVGAAIAIGGLALGSGL  314

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA+ A  R+   I RVPKID ++  G  LD + GE+EFK+V+FAYPSRPES++
Sbjct  315   SNLKYFSEANAAGERVVQVIKRVPKIDSDNMEGQTLDNVTGEVEFKHVEFAYPSRPESII  374

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L D +LKV  GKTVALVG SGSGKST +ALLQRFYD   G I +DG+ I+ LQ+KWLR Q
Sbjct  375   LNDFSLKVPTGKTVALVGGSGSGKSTVVALLQRFYDPLGGEILLDGIAIDKLQLKWLRSQ  434

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF T+I+ENI+ GK   SME+V+ AA  +NAH+FI QLPQGY+T+VGERG 
Sbjct  435   MGLVSQEPALFATTIKENILFGKEDASMEQVIEAAKASNAHNFICQLPQGYDTQVGERGV  494

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  495   QMSGGQKQRIAIARAIIKSPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  554

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQ--------DQS  2045
             STIRNADLIAVV  G + E GSH EL+E  +G Y  + +LQ+  + +D+        +  
Sbjct  555   STIRNADLIAVVQNGQVKEIGSHDELIEDVDGLYTSLVRLQQTENPSDEISIAPTNRNTV  614

Query  2044  FAPSS-NAGRQSTEKsspavlassplLI---------------ETAQKVPTDHHHQPSPS  1913
             FAPS+ N+G  S  +          ++                + A    T     P PS
Sbjct  615   FAPSNLNSGFTSDHEVQNTSSRRLSIVSRSSSANSAAQSRRFDQNATISNTPEQVFPVPS  674

Query  1912  FSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCL  1733
             F RLL +NL EWK+  +G I AI FG VQP YA  +G MIS +F PSH+E++ + + + L
Sbjct  675   FKRLLAMNLPEWKEATLGCIGAILFGGVQPVYAFAMGSMISVYFLPSHDEIKEKTKIYAL  734

Query  1732  VFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCAR  1553
              F  L   S+ +N+ QHY FA MGE LT+RIR RML K+LTFE  W+D+E NS+GA+C+R
Sbjct  735   CFLGLAFFSLFVNVLQHYNFAAMGEKLTKRIRERMLSKMLTFEIGWYDKEENSTGAVCSR  794

Query  1552  LSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKV  1373
             L+ +A +V+SL+ DR++LL+Q  S+VTIA  MGLV+AW+LA VMIAVQPL I+C+Y ++V
Sbjct  795   LAKDANVVRSLIGDRMALLIQTVSAVTIACTMGLVIAWRLAWVMIAVQPLIIVCYYCKRV  854

Query  1372  LLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWL  1193
             LL  ++ K +KAQ  S+++A EAV N R VT+F S +++L +   AQ+ P +E+ ++SW 
Sbjct  855   LLKNMSKKSIKAQEESSKLAAEAVSNLRTVTAFSSQSRILQMLKKAQEGPLRESIRQSWF  914

Query  1192  AGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSD  1013
             AGIG+G++  L    WALDFWYGGKL++ G I +  +F+TF ILVSTG+VIADAG+MT+D
Sbjct  915   AGIGLGTSNSLMTCTWALDFWYGGKLMAEGLIGAQALFQTFMILVSTGRVIADAGTMTND  974

Query  1012  LAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPI  833
             LAKG+ AV S+FA+LDR S+I        D+ G   +K++G +E+  V+FAYP+RP   I
Sbjct  975   LAKGADAVGSVFAVLDRYSLIEPE-----DSDGYKPKKITGNVELYDVDFAYPARPNVII  1029

Query  832   LREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQ  653
              + F ++++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG DVRS+ +   R+ 
Sbjct  1030  FKGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPLSGVVKIDGRDVRSYHLRSLRKH  1089

Query  652   MALVSQEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERG  476
             +ALVSQEP +++GTIR NI +G  +   E+EIIEAAKAANAH FIS+LK GY+T CG+RG
Sbjct  1090  IALVSQEPTLFAGTIRQNIGYGASEEVDESEIIEAAKAANAHDFISALKDGYETWCGDRG  1149

Query  475   VQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHR  296
             +QLSGGQKQRIAIARAI++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHR
Sbjct  1150  LQLSGGQKQRIAIARAILKNPAVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHR  1209

Query  295   LNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             L+TI+N D+IA++ +GK+VE GT+S L  K
Sbjct  1210  LSTIQNCDTIAVLDKGKIVEKGTHSSLLAK  1239



>emb|CDY64952.1| BnaA06g39710D [Brassica napus]
Length=985

 Score =  1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/970 (66%), Positives = 777/970 (80%), Gaps = 18/970 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             +I VIFR+ADWIDI LM LGT+GAIGDGMSTN  L++ S + N+LGYG NN  +      
Sbjct  17    NIHVIFRFADWIDIVLMVLGTVGAIGDGMSTNVALVFASKIMNSLGYGQNNHHT------  70

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                EV+KCSLYFV LGLA++ + FMEGYCWSKTSERQV KIR  YL+A+LRQEV FF+S+
Sbjct  71    FKDEVQKCSLYFVYLGLAILGVAFMEGYCWSKTSERQVEKIRRTYLKAVLRQEVSFFESE  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             +A+ SEI ++IS DTSLIQ++LSEKVPIFLMHTSVF++GL F+ YFSWRL+LVA P++V+
Sbjct  131   DASISEIIHTISTDTSLIQQLLSEKVPIFLMHTSVFITGLVFAAYFSWRLTLVAIPSLVL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGLIYGKYL+YLSKKS+KEY+KAN IV QALSSIKTI SFTAE  I++ YS IL+R 
Sbjct  191   LLIPGLIYGKYLVYLSKKSYKEYAKANSIVEQALSSIKTILSFTAETQIIKSYSEILERH  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              KLG+K G+AKGLAVGSTG+SF IWAFLAWYGSRL+MHK E+GGRIYAAGIS++L GLSL
Sbjct  251   KKLGLKQGLAKGLAVGSTGISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFILSGLSL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDT--IRGELEFKNVKFAYPS  2756
             G AL E++YF+EASVAA+RI SRIDRVP+IDGED +  ++    I G +EF++V F YPS
Sbjct  311   GTALTEIRYFSEASVAAARICSRIDRVPEIDGEDTTKGIIPNAKIEGRVEFEHVTFTYPS  370

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+S++LKD  L+ +AG+TVAL+GASGSGKST IALLQRFYD   G + IDG +I  LQ+
Sbjct  371   RPKSIILKDFTLRADAGRTVALMGASGSGKSTVIALLQRFYDPAEGFVRIDGFDIKTLQL  430

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KW+R Q+G+VSQ+HALFGTSI+ENIM GK   SM+EVV+AA  ANA +FI QLP GYET+
Sbjct  431   KWMREQIGVVSQDHALFGTSIKENIMFGKDNASMDEVVSAAKAANADEFITQLPDGYETQ  490

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             +G+RG LLSGGQKQRIAIARAII+NPVILLLDEATSALD+ESE L+Q +LDQ +AGRTTL
Sbjct  491   IGDRGGLLSGGQKQRIAIARAIIRNPVILLLDEATSALDAESETLIQVSLDQVAAGRTTL  550

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAP  2036
             VVAHKLST+R ADLIAV+  G + E GSH +LM KN HYA++  +QRQFS  +  Q    
Sbjct  551   VVAHKLSTVRGADLIAVLENGSVKEMGSHEDLMTKNNHYAKLINIQRQFSSQEHRQDLQD  610

Query  2035  SSNA--GRQS-TEKsspavlassplLIETAQKVPTDHHHQ-------PSPSFSRLLGLNL  1886
              S    GRQ  + ++S + L+        A  +P +  H        PS SF+RLL L  
Sbjct  611   GSKTPEGRQYWSARNSFSRLSIRSTPDLIASPIPFESIHAAEPDDNLPSTSFTRLLPLVS  670

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWK  L+G ISA  FGA+QP YAL IGGMISAFF+ S ++MQ RI+ + L+F  L  +S
Sbjct  671   PEWKSSLLGCISAATFGAIQPIYALNIGGMISAFFATSSKQMQDRIRIYSLIFISLTFIS  730

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
             +TLNL QHY FA MGE L +R+RLRMLEKI TFE AWFD E NSSG LC+RLSNEA+ VK
Sbjct  731   MTLNLIQHYSFAKMGERLMQRLRLRMLEKIFTFEPAWFDVEENSSGELCSRLSNEASTVK  790

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             S+V+DR+SLLVQ  S V IAMV+GL+VAWKLALVMIAVQPL++LCFYT+KVLL++I+  +
Sbjct  791   SIVSDRISLLVQTISGVLIAMVIGLLVAWKLALVMIAVQPLSVLCFYTKKVLLTSISRNY  850

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
               AQN S+ IA EAVYNH+IVTS GS  K+++IFD AQDE R++ +K +WLAG G+GSAQ
Sbjct  851   AYAQNRSSNIASEAVYNHKIVTSLGSTKKIIEIFDKAQDEARRKGKKAAWLAGFGMGSAQ  910

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LTFM WALDFWYGG LV  GEIS+GDVFKTFF+LVSTGKVIA+AGSMTSDLAKGSAA++
Sbjct  911   CLTFMTWALDFWYGGVLVEKGEISAGDVFKTFFVLVSTGKVIAEAGSMTSDLAKGSAAIS  970

Query  985   SIFAILDRPS  956
             S+F ILDRPS
Sbjct  971   SVFKILDRPS  980


 Score =   293 bits (749),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 185/525 (35%), Positives = 305/525 (58%), Gaps = 8/525 (2%)
 Frame = -2

Query  1774  SHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAW  1595
             +H   +  +QK  L F  L L  + +   + YC++   E    +IR   L+ +L  E ++
Sbjct  67    NHHTFKDEVQKCSLYFVYLGLAILGVAFMEGYCWSKTSERQVEKIRRTYLKAVLRQEVSF  126

Query  1594  FDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIA  1415
             F+ E  S   +   +S + ++++ L+++++ + +   S     +V     +W+L LV I 
Sbjct  127   FESEDASISEIIHTISTDTSLIQQLLSEKVPIFLMHTSVFITGLVFAAYFSWRLTLVAIP  186

Query  1414  VQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNA  1235
                L ++        L  ++ K  K    +  I  +A+ + + + SF +  +++  +   
Sbjct  187   SLVLLLIPGLIYGKYLVYLSKKSYKEYAKANSIVEQALSSIKTILSFTAETQIIKSYSEI  246

Query  1234  QDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVS  1055
              +  +K   K+    G+ +GS  G++F  WA   WYG +LV + + + G ++      + 
Sbjct  247   LERHKKLGLKQGLAKGLAVGST-GISFTIWAFLAWYGSRLVMHKQETGGRIYAAGISFIL  305

Query  1054  TGKVIADAGSMTSDLAKGSAAVASIFAILDR-PSII-TSPYNGKVDNGGTNLEKLSGKIE  881
             +G  +  A +     ++ S A A I + +DR P I       G + N      K+ G++E
Sbjct  306   SGLSLGTALTEIRYFSEASVAAARICSRIDRVPEIDGEDTTKGIIPNA-----KIEGRVE  360

Query  880   IKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRV  701
              + V F YPSRP++ IL++F L   AG ++ L+G SGSGKST++AL++RFYD   G +R+
Sbjct  361   FEHVTFTYPSRPKSIILKDFTLRADAGRTVALMGASGSGKSTVIALLQRFYDPAEGFVRI  420

Query  700   DGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFI  521
             DG D+++  + W R Q+ +VSQ+  ++  +I++NI+FGK +AS +E++ AAKAANA +FI
Sbjct  421   DGFDIKTLQLKWMREQIGVVSQDHALFGTSIKENIMFGKDNASMDEVVSAAKAANADEFI  480

Query  520   SSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEAL  341
             + L  GY+T+ G+RG  LSGGQKQRIAIARAIIRNP ILLLDEATSALD ESE ++Q +L
Sbjct  481   TQLPDGYETQIGDRGGLLSGGQKQRIAIARAIIRNPVILLLDEATSALDAESETLIQVSL  540

Query  340   DGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             D +  GRTT+VVAH+L+T++  D IA++  G V E G++  L  K
Sbjct  541   DQVAAGRTTLVVAHKLSTVRGADLIAVLENGSVKEMGSHEDLMTK  585



>ref|XP_002453447.1| hypothetical protein SORBIDRAFT_04g006100 [Sorghum bicolor]
 gb|EES06423.1| hypothetical protein SORBIDRAFT_04g006100 [Sorghum bicolor]
Length=1236

 Score =  1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1212 (53%), Positives = 881/1212 (73%), Gaps = 19/1212 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F +AD  D+ LM LG +G +GDG ST  +L   S +FN LG                 +
Sbjct  17    VFMHADATDVVLMVLGLVGTMGDGFSTPVMLFITSRIFNDLG------NGPDVLQEFSSK  70

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +   V L L  +VM F+EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD +  +T
Sbjct  71    INENARNLVFLALGCLVMAFLEGYCWARTAERQASRMRERYLRAVLRQDVEYFDLKVGST  130

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ ++Q+VLSEK+P F+M+ ++FL          W L+LVA P++++LIIP
Sbjct  131   SEVITSVSNDSLVVQDVLSEKLPNFVMNCAMFLGSYAVGFALLWHLTLVALPSVLLLIIP  190

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G +YG+ L+ L+++  ++Y++   I  QA+SS++T+YSF AER+ +  +S+ L+ + +LG
Sbjct  191   GFMYGRILIGLARRIREQYTRPGAIAEQAVSSVRTVYSFVAERTTMAHFSAALEESARLG  250

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKG+A+GS G++FAIWAF  WYGSRL+M+ G  GG ++A   + V+GGL+LG  L
Sbjct  251   IKQGLAKGVAIGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGLALGSGL  310

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               VKYF+EAS AA R+   I RVPKID E  +G  +  + G++EFKNV+F YPSRPE+ +
Sbjct  311   SNVKYFSEASSAAERVQEVILRVPKIDSESSAGDEVANVAGDVEFKNVEFCYPSRPETPI  370

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
                 NL+V AG+TVALVG SGSGKST IALL+RFYD  +G + +DGV+I  L++KWLR Q
Sbjct  371   FVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPAAGEVTLDGVDIRRLRLKWLRAQ  430

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSIRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+VGERG 
Sbjct  431   MGLVSQEPALFATSIRENILFGKEDATEEEVVAAAKAANAHNFISQLPQGYDTQVGERGV  490

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+VVAH+L
Sbjct  491   QMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIVVAHRL  550

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQ--RQFSCADQDQSFAPSSN  2027
             STIRNAD+IAV+  G + E GSH EL+  +NG Y  + +LQ  R    A+Q      +S 
Sbjct  551   STIRNADMIAVMQYGEVKELGSHDELIANENGLYTSLVRLQQTRDSREANQVGGTGSTSA  610

Query  2026  AGRQSTEKsspavlassplLI-----ETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLI  1862
             AG+ S+   S    A+S         +      T+    P PSF RLL LN  EWKQ L+
Sbjct  611   AGQSSSHSMSRRFSAASRSSSGRSMGDAENDNITEKPKLPVPSFRRLLMLNAPEWKQALM  670

Query  1861  GSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQH  1682
             GS SAI FG +QP Y+  +G MIS +F   H E++ + + + L+F  L +LS  +N+ QH
Sbjct  671   GSFSAIVFGGIQPAYSYAMGSMISIYFLADHNEIKDKTRTYTLIFVALAVLSFLINIGQH  730

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             Y F  MGE+LT+R+R +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV DR++
Sbjct  731   YNFGAMGEYLTKRVREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLVGDRMA  790

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
             L++Q  S+V  A  MGLV+AW+LALVMIAVQPL ILCFYTR+VLL +++TK ++AQ+ S+
Sbjct  791   LVIQTVSAVLTACTMGLVIAWRLALVMIAVQPLIILCFYTRRVLLKSMSTKSIQAQSESS  850

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
             ++A EAV N R +T+F S  ++L +FD AQD PRKE+ ++SW AG+G+G++  L    WA
Sbjct  851   RLAAEAVSNLRTITAFSSQERILRLFDQAQDGPRKESIRQSWFAGLGLGTSMSLMTCTWA  910

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
             LDFWYGGKLV+   I+S  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+FA+LDR
Sbjct  911   LDFWYGGKLVAEHHITSKALFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVFAVLDR  970

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
              + I  P N +    G   E+L G+++I+ V+FAYPSRP+  I + F L ++ G S  LV
Sbjct  971   ETEI-DPDNPE----GYKPERLKGEVDIRGVDFAYPSRPDVIIFKGFSLSIQPGKSTALV  1025

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             G+SGSGKSTI+ LIERFYD   G +++DG D++++++   RR + LVSQEP +++GTIR+
Sbjct  1026  GQSGSGKSTIIGLIERFYDPLRGVVKIDGKDIKTYNLRGLRRHIGLVSQEPTLFAGTIRE  1085

Query  601   NILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraii  422
             NI++G   A+E EI  AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAIARAI+
Sbjct  1086  NIVYGTETATEAEIENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAIARAIL  1145

Query  421   RNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKV  242
             +NP ILLLDEATSALD +SE+VVQEALD +M+GRT++VVAHRL+TI+N D I ++ +G V
Sbjct  1146  KNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSIVVAHRLSTIQNCDQITVLEKGIV  1205

Query  241   VEHGTYSQLKNK  206
             VE GT++ L  K
Sbjct  1206  VEKGTHASLMAK  1217



>ref|XP_008679898.1| PREDICTED: putative multidrug resistance protein [Zea mays]
Length=1243

 Score =  1196 bits (3093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/1216 (53%), Positives = 885/1216 (73%), Gaps = 19/1216 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  +F +AD  D+ LM LG +GA+GDGMST  +L   S +FN LG              
Sbjct  20    SLASVFMHADVADVVLMVLGLVGAMGDGMSTPVMLFITSRIFNDLG------SGPGLLQE  73

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                ++ + +   V L L   +M F+EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD +
Sbjct  74    FSSKINENARNLVFLALGNWLMAFLEGYCWARTAERQASRMRERYLRAVLRQDVEYFDLK  133

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TSE+  S+S D+ ++Q+VLSEKVP F+M+ S+FL          W L+LVA P++++
Sbjct  134   VGSTSEVITSVSNDSLVVQDVLSEKVPNFVMNCSMFLGSYAVGFALLWHLTLVALPSVLL  193

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIPG +YG+ L+ L+++  ++Y++   I  QA+SS++T+YSF AERS + ++S+ L  +
Sbjct  194   LIIPGFMYGRILIGLARRIREQYTRPGAIAEQAVSSVRTVYSFVAERSTMAQFSAALQES  253

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
              +LG+K G+AKG+A+GS G++FAIWAF  WYGSRL+M+ G  GG ++A   + V+GGL+L
Sbjct  254   ARLGVKQGLAKGVAIGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGLAL  313

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EAS AA R+   I RVPKID E  +G  L  + GE+EFKNV+F YPSRP
Sbjct  314   GSGLSNVKYFSEASSAAERVQEVILRVPKIDSESSAGDELANVAGEVEFKNVEFCYPSRP  373

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +    NL+V AG+TVALVG SGSGKST IALL+RFYD ++G + +DGV+I  L++KW
Sbjct  374   ETPIFVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPSAGEVTLDGVDIRRLRLKW  433

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSIRENI+ GK   + EE+VAAA  ANAH+FI QLPQGY+T+VG
Sbjct  434   LRAQMGLVSQEPALFATSIRENILFGKEDATGEEIVAAAKAANAHNFISQLPQGYDTQVG  493

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V+
Sbjct  494   ERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIVI  553

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQ--RQFSCADQDQSFA  2039
             AH+LSTIRNAD+IAV+  G + E GSH +L++ +NG Y  + +LQ  R    A+Q     
Sbjct  554   AHRLSTIRNADMIAVMQYGEVKELGSHDDLIDNENGLYTSLVRLQQTRDSREANQVGGTV  613

Query  2038  PSSNAGRQSTEKsspavlassplLI-----ETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
              +S  G+ S+   S    A+S         +       +    P PSF RLL LN  EWK
Sbjct  614   STSAVGQSSSHSMSRRFSAASRSSSGRSMGDAENDNIAEKPKPPIPSFRRLLMLNAPEWK  673

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q L+GS SAI FG +QP YA  +G MIS +F   H+E++ + + + L+F  L +LS  +N
Sbjct  674   QALMGSFSAIVFGGIQPAYAYAMGSMISIYFLADHDEIKDKTRTYALIFVALAVLSFLIN  733

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY F  MGE+LT+R+R +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV 
Sbjct  734   IGQHYNFGAMGEYLTKRVREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLVG  793

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K ++AQ
Sbjct  794   DRMALVIQTVSAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIQAQ  853

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + S+++A EAV N R +T+F S +++L +FD AQD PRKE+ ++SW AG+G+G++  L  
Sbjct  854   SESSKLAAEAVSNLRTITAFSSQDRILRLFDQAQDGPRKESIRQSWFAGLGLGTSMSLMT  913

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               WALDFWYGGKL++   I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+FA
Sbjct  914   CTWALDFWYGGKLMAERHITAKALFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVFA  973

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             +LDR + I  P N +    G   EKL G+++IK V+FAYPSRP+  I + F L ++ G S
Sbjct  974   VLDRETEI-DPDNPE----GYKPEKLKGEVDIKGVDFAYPSRPDVIIFKGFSLSIQPGKS  1028

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ LIERFYD   G +++DG D++++++   RR + LVSQEP +++G
Sbjct  1029  TALVGQSGSGKSTIIGLIERFYDPLRGVVKIDGKDIKTYNLRALRRHIGLVSQEPTLFAG  1088

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIR+NI++G   A+E EI  AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAIA
Sbjct  1089  TIRENIVYGTETATEAEIENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAIA  1148

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP ILLLDEATSALD +SE+VVQEALD +M+GRT++VVAHRL+TI+N D I ++ 
Sbjct  1149  RAILKNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSIVVAHRLSTIQNCDQITVLE  1208

Query  253   EGKVVEHGTYSQLKNK  206
             +G VVE GT++ L  K
Sbjct  1209  KGIVVEKGTHASLMAK  1224



>sp|Q6YUU5.1|MDR_ORYSJ RecName: Full=Putative multidrug resistance protein; AltName: 
Full=P-glycoprotein [Oryza sativa Japonica Group]
 dbj|BAD16475.1| putative multidrug resistance p-glycoprotein [Oryza sativa Japonica 
Group]
Length=1245

 Score =  1195 bits (3091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/1217 (53%), Positives = 886/1217 (73%), Gaps = 19/1217 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS + +F +AD  D+ LM LG LGA+GDG+ST  +LL  S +FN LG             
Sbjct  18    SSFMTVFMHADAADVALMVLGLLGAMGDGISTPVMLLITSRIFNDLG------SGADIVK  71

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
                 +V   +   V L  A  VM F+EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  72    EFSSKVNVNARNLVFLAAASWVMAFLEGYCWARTAERQASRMRARYLRAVLRQDVEYFDL  131

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             ++ +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++F           WRL+LVA P++V
Sbjct  132   KKGSTAEVITSVSNDSLVVQDVLSEKVPNFVMNAAMFAGSYAVGFALLWRLTLVALPSVV  191

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG +YG+ L+ L+++  ++Y++   I  QA+SS +T+YSF AER+ + ++S+ L+ 
Sbjct  192   LLIIPGFMYGRILVGLARRIREQYTRPGAIAEQAVSSARTVYSFVAERTTMAQFSAALEE  251

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             + +LG+K G+AKG+AVGS G++FAIWAF  WYGSRL+M+ G  GG ++A   + V+GGL+
Sbjct  252   SARLGLKQGLAKGIAVGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGLA  311

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG  L  VKYF+EAS AA RI   I RVPKID E  +G  L  + GE+EF+NV+F YPSR
Sbjct  312   LGSGLSNVKYFSEASSAAERILEVIRRVPKIDSESDTGEELANVTGEVEFRNVEFCYPSR  371

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PES +    NL+V AG+TVALVG SGSGKST IALL+RFYD ++G + +DGV+I  L++K
Sbjct  372   PESPIFVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPSAGEVMVDGVDIRRLRLK  431

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE ALF TSIRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+V
Sbjct  432   WLRAQMGLVSQEPALFATSIRENILFGKEEATAEEVVAAAKAANAHNFISQLPQGYDTQV  491

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V
Sbjct  492   GERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASMGRTTIV  551

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-SFA  2039
             +AH+LSTIRNAD+IAV+  G + E G H EL+   NG Y+ + +LQ+     + D+    
Sbjct  552   IAHRLSTIRNADIIAVMQSGEVKELGPHDELIANDNGLYSSLVRLQQTRDSNEIDEIGVT  611

Query  2038  PSSNAGRQSTEKsspavlassplLI------ETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              S++A  QS+  S     +++          +      T+    P PSF RLL LN  EW
Sbjct  612   GSTSAVGQSSSHSMSRRFSAASRSSSARSLGDARDDDNTEKPKLPVPSFRRLLMLNAPEW  671

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ L+GS SA+ FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  +
Sbjct  672   KQALMGSFSAVVFGGIQPAYAYAMGSMISVYFLTDHAEIKDKTRTYALIFVGLAVLSFLI  731

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV
Sbjct  732   NIGQHYNFGAMGEYLTKRIREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLV  791

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K + A
Sbjct  792   GDRMALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIHA  851

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A EAV N R +T+F S  ++L +F+ +QD PRKE+ ++SW AG+G+G++  L 
Sbjct  852   QAESSKLAAEAVSNLRTITAFSSQERILRLFEQSQDGPRKESIRQSWFAGLGLGTSMSLM  911

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WALDFWYGG+L++   IS+ ++F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+F
Sbjct  912   TCTWALDFWYGGRLMAEHHISAKELFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVF  971

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LDR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G 
Sbjct  972   AVLDRETEI-DPDNPQ----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFTLSIQPGK  1026

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   GS+++DG D++++++   RR + LVSQEP +++
Sbjct  1027  STALVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKAYNLRALRRHIGLVSQEPTLFA  1086

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             GTIR+NI++G   ASE EI +AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAI
Sbjct  1087  GTIRENIVYGTETASEAEIEDAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAI  1146

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAI++NP ILLLDEATSALD +SE+VVQEALD +MIGRT++VVAHRL+TI+N D I ++
Sbjct  1147  ARAILKNPAILLLDEATSALDSQSEKVVQEALDRVMIGRTSVVVAHRLSTIQNCDLITVL  1206

Query  256   SEGKVVEHGTYSQLKNK  206
              +G VVE GT++ L  K
Sbjct  1207  EKGTVVEKGTHASLMAK  1223



>ref|XP_008368430.1| PREDICTED: ABC transporter B family member 15-like [Malus domestica]
Length=1260

 Score =  1194 bits (3088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1225 (52%), Positives = 875/1225 (71%), Gaps = 31/1225 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D  LM LG  G++GDG ST  + L  S L N +G          +    +  
Sbjct  25    IFMHADGVDRLLMILGLFGSLGDGFSTPLVXLITSKLMNNIG-----GSPTSAQVAFLHN  79

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + L     V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  80    INKNAVALLYLACGSFVCCFLEGYCWTRTGERQAARMRVRYLKAVLRQDVGYFDLHVTST  139

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEK+P FLM+ S+F      +    WRL++V +P +V+L+IP
Sbjct  140   SEVITSVSNDSLVIQDVLSEKLPNFLMNFSMFSGSYVAAFIMMWRLAIVGFPFVVLLVIP  199

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L+++  +EY+KA  I  QA+SSI+T+Y+F  E   +  +S+ L  ++ LG
Sbjct  200   GLIYGRTLMGLARQIREEYNKAGNIAEQAISSIRTVYAFVGENKTISEFSAALQGSVXLG  259

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +  G+AKGLA+GS G+ FAIW+F+++YGSR++M+ G  GG ++A G +  +GGL+LG  L
Sbjct  260   LSQGLAKGLAIGSNGVVFAIWSFMSFYGSRMVMYHGAQGGTVFAVGAAIAVGGLALGSGL  319

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  AA RI   I RVPKID ++  G +L+ + GE+EFK+V+FAYPSRPES++
Sbjct  320   SNLKYFSEACSAAERIMEVIRRVPKIDSDNMEGEILEDVSGEVEFKHVEFAYPSRPESII  379

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD NL V AGKTVALVG SGSGKST IALLQRFYD   G I +DGV IN LQ+KWLR Q
Sbjct  380   FKDFNLTVPAGKTVALVGGSGSGKSTVIALLQRFYDPLGGEILLDGVAINKLQLKWLRSQ  439

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ GK    +EE   A   ANAH+FI QLPQGY+T+VGERG 
Sbjct  440   MGLVSQEPALFATSIKENILFGKEDAGIEEXTEAGKAANAHNFISQLPQGYDTQVGERGV  499

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  500   QMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  559

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ--SFAPSSN  2027
             STIRNAD+IAVV  G ++E GSH EL ++ NGHY  + +LQ+     + ++   +  SS+
Sbjct  560   STIRNADVIAVVQNGQVMETGSHDELSQRENGHYTSLVRLQQTEKEKEPEELGHYGASSS  619

Query  2026  AGRQ-----------------STEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLL  1898
               +                     +SS A   +     +    V  +H   P PSF RLL
Sbjct  620   ISKDIHSTSSRRHSTSSRRLSMLSRSSSANSFAQGRAPDQESVVGYEHKKLPVPSFRRLL  679

Query  1897  GLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAll  1718
              LNL EWKQ ++G  SA  FGAVQP YA  +G M+S +F   H++++A+ + + L F  L
Sbjct  680   ALNLPEWKQAVMGCTSATLFGAVQPLYAFAMGSMVSVYFLTDHDKIKAKTRTYSLCFLGL  739

Query  1717  cllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEA  1538
              + S+ +N+ QHY FAYMGE+LT+R+R RML K+LTFE  WFD++ NSSGA+C+RL+ +A
Sbjct  740   AIFSLXINVSQHYNFAYMGEYLTKRVRERMLSKVLTFEVGWFDQDENSSGAICSRLAKDA  799

Query  1537  AMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTI  1358
              +V+SLV DR++L+VQ  S+VT+A  MGL++ W+LA+VMIAVQPL I+CFYTR+VLL ++
Sbjct  800   NVVRSLVGDRMALVVQTISAVTVACTMGLIITWRLAIVMIAVQPLIIVCFYTRRVLLKSM  859

Query  1357  TTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGI  1178
             + K +K+Q  S+++A EAV N R VT+F S  ++L + + AQ+ PR+E+ ++SW AGIG+
Sbjct  860   SRKAIKSQEESSKLAAEAVSNLRTVTAFSSQXRLLKMLEKAQEGPRRESIRQSWYAGIGL  919

Query  1177  GSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGS  998
               +Q LT + WA DFWYGGKLV+ G + +  +F+TF ILVSTG+VIADAGSMT+DLAKG+
Sbjct  920   ACSQSLTTVTWAFDFWYGGKLVAKGYVKAXQLFQTFMILVSTGRVIADAGSMTTDLAKGA  979

Query  997   AAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFC  818
              AV S+FA+LDR + I        D  G   E ++G IE+  ++FAYP+RP+  I + F 
Sbjct  980   DAVGSVFAVLDRYTKIEPE-----DPEGLEPEAITGHIELHDIHFAYPARPDVMIFKGFS  1034

Query  817   LEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVS  638
             +++ AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG DV+S+ +   R+ +ALVS
Sbjct  1035  IKIXAGKSTALVGQSGSGKSTIIGLIERFYDPIKGEVKIDGRDVKSYHLKSLRKHIALVS  1094

Query  637   QEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSG  461
             QEP +++GTIR+NI++G  D   E E++ AA+AANAH FI+ LK GYDT CG+RGVQLSG
Sbjct  1095  QEPTLFAGTIRENIVYGVSDKVDELEVVXAARAANAHDFIAGLKDGYDTSCGDRGVQLSG  1154

Query  460   GQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIK  281
             GQKQRIAIARAI+RNP +LLLDEATSALD  SE+VVQ+AL+ +M+GRT++VVAHRL+TI+
Sbjct  1155  GQKQRIAIARAILRNPVVLLLDEATSALDSRSEKVVQDALERVMVGRTSVVVAHRLSTIQ  1214

Query  280   NLDSIALVSEGKVVEHGTYSQLKNK  206
             N D IA++ +G VVE GT+S L  K
Sbjct  1215  NCDMIAVLDKGWVVEKGTHSSLLAK  1239



>ref|XP_002324019.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEF04152.2| ABC transporter family protein [Populus trichocarpa]
Length=1259

 Score =  1194 bits (3088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/1226 (53%), Positives = 893/1226 (73%), Gaps = 28/1226 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +G+IGDG ST  +L   S L N LG       +  S   
Sbjct  16    SIRSIFMHADRVDWLLMVLGFIGSIGDGFSTPLVLFVTSKLMNNLG------GASSSAEA  69

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + K +L    L     V+ F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  70    FTHSINKNALALCYLACGQWVVSFLEGYCWTRTGERQATRMRARYLKAVLRQDVGYFDLH  129

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+E+  S+S D+ +IQ+VLSEKVP FLM+ ++F           WRL++V  P +VI
Sbjct  130   VTSTAEVITSVSNDSLVIQDVLSEKVPNFLMNVAMFFGCYIIGFVLLWRLAIVGLPFVVI  189

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +++K+ +EY+K+  I  QA+SSI+T+++F +E   +  YS+ L+ +
Sbjct  190   LVIPGLVYGRTLMGIARKTREEYNKSGTIAEQAISSIRTVFAFVSEAKTIAAYSAALEFS  249

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKGLA+GS G+ F IW+F+++YGSR++M+ G +GG ++A G +  +GGL+L
Sbjct  250   VKLGLRQGLAKGLAIGSNGVVFGIWSFMSYYGSRMVMYHGSAGGTVFAVGAAIAVGGLAL  309

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EAS A  RI   I+RVPKID E+  G  L+ + GE+EF++V+FAYPSRP
Sbjct  310   GAGLSNVKYFSEASSAGERIVEMINRVPKIDLENMEGETLENVTGEVEFRHVEFAYPSRP  369

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ KD  L++ AGKTVALVG SGSGKST IALLQRFYD   G I +DG+ ++ LQ+KW
Sbjct  370   ESMIFKDFCLRIPAGKTVALVGGSGSGKSTVIALLQRFYDPLGGEILVDGIAVDKLQLKW  429

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   ++ EVV AA  +NAH+FI  LPQ Y+T+VG
Sbjct  430   LRSQMGLVSQEPALFATTIKENILFGKEDATINEVVEAAKASNAHNFISHLPQEYDTQVG  489

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++
Sbjct  490   ERGVQMSGGQKQRIAIARAIIKAPRILLLDEATSALDSESERVVQEALDKAAVGRTTIII  549

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQR-QFSCADQDQSF--  2042
             AH+LSTIRNAD+IAVV  G I+E GSH EL+E +NG Y  +  LQ+ +    ++D S   
Sbjct  550   AHRLSTIRNADVIAVVQDGQILESGSHGELIENENGLYTSLVLLQQTEKEKTNEDASTDI  609

Query  2041  -APS-------SNAGRQS----TEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLL  1898
              +PS       +NA  +     +  SS   +  S   +   +    +    P PSF RLL
Sbjct  610   SSPSLVSNMDVNNASSRRLSIVSRSSSQNSVTPSRASLTAGENALVEEQQLPVPSFRRLL  669

Query  1897  GLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAll  1718
              LNL EWKQ  IG + AI FG VQP YA T+G MIS +F   H E++ +I+ + L F  L
Sbjct  670   ALNLPEWKQASIGCLGAIIFGGVQPLYAFTMGSMISIYFLADHNEIKEKIRIYSLCFLGL  729

Query  1717  cllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEA  1538
               LS+ +N+ QHY FAYMGEHLT+RIR RML KILTFE  WFD++ NSSGA+C+RL+ +A
Sbjct  730   AFLSLIVNVLQHYNFAYMGEHLTKRIRERMLSKILTFEVGWFDQDKNSSGAICSRLATDA  789

Query  1537  AMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTI  1358
              +V+SLV DR++L+VQ  S+VTIA  MGL++AW+LA+VMIAVQP+ I+CFY R+VLL+++
Sbjct  790   NVVRSLVGDRMALIVQTISAVTIACTMGLIIAWRLAVVMIAVQPIIIVCFYVRRVLLTSM  849

Query  1357  TTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGI  1178
             + K +KAQ+ ST++A +AV N R +T+F S +++L +   AQ+ PRKE  ++SW AGIG+
Sbjct  850   SQKAIKAQDESTKLAADAVSNLRTITAFSSQDRILKMLGKAQEGPRKENIRQSWYAGIGL  909

Query  1177  GSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGS  998
             G++Q L    WALDFWYGG+L+S G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS
Sbjct  910   GTSQSLMSCTWALDFWYGGRLISQGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGS  969

Query  997   AAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFC  818
              ++ S+FA+LDR + I        D  G    ++ G +E+  V+FAYP+RP+  I + F 
Sbjct  970   DSIRSVFAVLDRYTRIEPE-----DPEGYQPGEIKGHVELCDVDFAYPARPDVRIFKGFS  1024

Query  817   LEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVS  638
             + ++AG S  LVG+SGSGKSTI+ LIERFYD   G++++DG D+RS+ +   R+ +ALVS
Sbjct  1025  ISIEAGKSTALVGQSGSGKSTIIGLIERFYDPLRGTVKIDGRDIRSYHLRSLRKYIALVS  1084

Query  637   QEPVIYSGTIRDNILFGKL-DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSG  461
             QEP +++GT+++NI++G   + SE+E++EAAKAANAH FI+ LK GYDT CG++GVQLSG
Sbjct  1085  QEPTLFAGTVKENIIYGAANEVSESEVMEAAKAANAHDFIAGLKDGYDTWCGDKGVQLSG  1144

Query  460   GQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIK  281
             GQKQRIAIARAI++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+
Sbjct  1145  GQKQRIAIARAILKNPVVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQ  1204

Query  280   NLDSIALVSEGKVVEHGTYSQLKNKR  203
             N D IA++ +GKVVE GT+S L +KR
Sbjct  1205  NCDLIAVLDKGKVVEKGTHSSLFSKR  1230



>ref|XP_010091939.1| ABC transporter B family member 15 [Morus notabilis]
 gb|EXB47719.1| ABC transporter B family member 15 [Morus notabilis]
Length=1253

 Score =  1191 bits (3082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1222 (52%), Positives = 886/1222 (73%), Gaps = 23/1222 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  +F +AD +D+ LM  G LGA+GDG ST  +LL  S L N +G     + S  +   
Sbjct  17    SIRSVFVHADGVDLILMVFGFLGALGDGFSTPLVLLITSRLMNNIG----GASSDSAQDV  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              ++ + K ++  + L     V  F+EGYCW++T ERQ  ++R +YL+A+LRQEVG+FD  
Sbjct  73    FLKNINKNAVALLYLACGSFVACFLEGYCWTRTGERQAARMRARYLKAVLRQEVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TSE+  S+S D+ +IQ+VLSEK+P FLM+ S+F+     +    W+L++V +P + +
Sbjct  133   VTSTSEVITSVSNDSLVIQDVLSEKLPNFLMNASMFIGSYIAAFIMLWKLAIVGFPFVAL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ L++K  +EY+ A  I  QA+SSI+T+Y+F  E   +  +SS L  +
Sbjct  193   LVIPGLMYGRTLMSLARKIREEYNTAGNIAEQAISSIRTVYAFVGESKTITEFSSALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +K G+K G+AKGLA+GS G+ FAIW+F+A+YGSR++M+ G  GG ++A G S  +GGL+L
Sbjct  253   VKFGLKQGLAKGLAIGSNGVVFAIWSFMAYYGSRMVMYHGAKGGTVFAVGASIAVGGLAL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EA  A  RI   I+RVPKID ++  G VL+ + GE+EF++V+FAYPSRP
Sbjct  313   GAGLSNLKYFSEACSAGERILEVINRVPKIDSDNMEGQVLENVFGEVEFEHVEFAYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ +D  LK+ +G+TVALVG SGSGKST I+LLQRFYD   G I +DGV I+ LQ+KW
Sbjct  373   ESIIFRDFCLKIPSGRTVALVGGSGSGKSTVISLLQRFYDPLGGEIRLDGVAIDKLQLKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK    +E+VV AA  +NAHDFI +LPQGY+T+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDADLEQVVEAAKASNAHDFISKLPQGYDTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARA IK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARATIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIII  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+IAVV  G ++E GSH EL+++ +G Y  + +LQ+       ++  +  
Sbjct  553   AHRLSTIRNADIIAVVQNGHVMETGSHDELIQRDDGLYTSLVRLQQTEKQKSPEEYSSSH  612

Query  2032  -----------SNAGRQSTEKsspavlassplLIETA-QKVPTDHHHQPSPSFSRLLGLN  1889
                        +N   +     S +  A+S     TA   V  +    P PSF RLL LN
Sbjct  613   ATSSSISSIDMNNTSSRRLSILSRSSSANSARAYSTAGDDVVQEEMKLPVPSFRRLLALN  672

Query  1888  LTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcll  1709
             L EWK+ L+G  SA  FG+VQP YA  +G MIS +F   H+E++ + + + L F  L + 
Sbjct  673   LPEWKEALLGGSSATLFGSVQPVYAFAMGSMISVYFLTDHDEIKEKTRIYALCFLGLAIF  732

Query  1708  sitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMV  1529
             S+ +N+CQHY FAYMGE LT+R+R RML KILTFE  WFD++ NS+GA+C+RL+ +A +V
Sbjct  733   SLLINVCQHYNFAYMGECLTKRVRERMLSKILTFEVGWFDQDENSTGAVCSRLAKDANVV  792

Query  1528  KSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTK  1349
             +SLV DR++LLVQ  S+VT+A  MGLV+AW+LA+VMIAVQPL I+CFYTR+VLL +++++
Sbjct  793   RSLVGDRMALLVQTFSAVTVAFTMGLVIAWRLAIVMIAVQPLIIICFYTRRVLLRSMSSQ  852

Query  1348  FVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSA  1169
               KAQ+ S+++A EAV N R +T+F S +++L + + AQ+ PR+E+ ++SW AGIG+  +
Sbjct  853   ASKAQDESSKLAAEAVSNLRTITAFSSQDRILKMLEKAQEGPRRESIRQSWYAGIGLACS  912

Query  1168  QGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAV  989
             Q LT   WA DFWYGG+L+++  I+S  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AV
Sbjct  913   QSLTTCTWAFDFWYGGRLIADAYITSKALFETFMILVSTGRVIADAGSMTTDLAKGADAV  972

Query  988   ASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEV  809
              ++FA+LDR + I        D  G+  E ++G +E++ V+FAYP+RP+  I + F +++
Sbjct  973   GTVFAVLDRYTRIEPE-----DPEGSQPETITGYVELRDVHFAYPARPDVMIFQGFSIKI  1027

Query  808   KAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEP  629
             +AG S  LVG+SGSGKSTI+ LIERFYD   G++++DG D+R + +   R+ +ALVSQEP
Sbjct  1028  EAGKSTALVGQSGSGKSTIIGLIERFYDPLKGAVKIDGRDIRLYHLRSLRKHIALVSQEP  1087

Query  628   VIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
              +++GTI+ NI +G  D   E EIIEAAKAANAH FI+ LK GYDT CG+RGVQLSGGQK
Sbjct  1088  TLFAGTIKGNIAYGASDKIGETEIIEAAKAANAHDFIAGLKDGYDTWCGDRGVQLSGGQK  1147

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARAI+RNP ILLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+  D
Sbjct  1148  QRIAIARAILRNPAILLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQKCD  1207

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
              IA++ +GKVVE G +S L  K
Sbjct  1208  VIAVLDKGKVVEKGAHSNLLAK  1229



>ref|XP_003571049.1| PREDICTED: putative multidrug resistance protein [Brachypodium 
distachyon]
Length=1242

 Score =  1191 bits (3082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/1218 (53%), Positives = 889/1218 (73%), Gaps = 20/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS+  +F +AD  D+ LM LG LGA+GDGMST  +L   S +FN LG             
Sbjct  17    SSLASVFMHADAADVALMALGLLGAVGDGMSTPVMLFITSRIFNDLG------GGPDVLN  70

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
                 ++ + +   V L LA  VM F+EGYCWS+T+ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  71    EFSSKINENARNLVFLALACWVMAFLEGYCWSRTAERQASRMRARYLRAVLRQDVEYFDL  130

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             +  +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++FL          WRL+LVA P+I+
Sbjct  131   KVGSTAEVIASVSNDSLVVQDVLSEKVPNFVMNVAMFLGSYAVGFALLWRLTLVALPSIL  190

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG +YG+ L+ L+++  ++Y+    +  QA+SS +T+YSF AERS + R+S+ L+ 
Sbjct  191   LLIIPGFMYGRILVGLARRIREQYAVPGALAEQAVSSARTVYSFAAERSTMARFSAALEE  250

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             + +LG+K G+AKG+AVGS G++FAIWAF  WYGSRL+M+ G  GG ++A   S V+GGL+
Sbjct  251   SARLGVKQGLAKGVAVGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSASIVVGGLA  310

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG  L  +KYF+EAS A  RI + I RVPKID     G  L  + GE+EF+ V+F+YPSR
Sbjct  311   LGSGLSNLKYFSEASAAGERIMAVIRRVPKIDSASDVGEELANVAGEVEFRGVEFSYPSR  370

Query  2752  PESLVLKD-LNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             PES +     +L+V AG+T ALVG+SGSGKST +ALL+RFYD ++G + +DGV+I  L++
Sbjct  371   PESPIFSGGFSLRVPAGRTAALVGSSGSGKSTVVALLERFYDPSAGEVTLDGVDIRRLKI  430

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KWLR Q+GLVSQE ALF TSIRENI+LGK   + EEV AAA  ANAH+FI QLPQGYET+
Sbjct  431   KWLRAQIGLVSQEPALFATSIRENILLGKEAATPEEVTAAAKAANAHNFISQLPQGYETQ  490

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             VGERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+
Sbjct  491   VGERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTI  550

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQ--RQFSCADQDQS  2045
             VVAH+LSTIRNAD+IAV+  G + E GSH EL+  +NG Y+ + +LQ  ++ + AD+   
Sbjct  551   VVAHRLSTIRNADMIAVMQYGEVKELGSHDELIANENGPYSSLVRLQQTKESNEADEVSG  610

Query  2044  FAPSSNAGRQSTEKsspavlassplLI-----ETAQKVPTDHHHQPSPSFSRLLGLNLTE  1880
                +S  G+ S+   S  +  +S         +      T+    P PSF RLL LN  E
Sbjct  611   TGSTSAMGQSSSHSMSRRLSVASRSSSARSLGDAGNVDNTEQPKLPVPSFRRLLMLNAPE  670

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             W+Q L+GS+SAI FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  
Sbjct  671   WRQALMGSLSAIVFGGIQPAYAYAMGSMISVYFLTDHAEIRDKTRTYALIFVALAVLSFL  730

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             +N+ QHY F  MGE+LT+R+R +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SL
Sbjct  731   INIGQHYNFGAMGEYLTKRVREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSL  790

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             V DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K ++
Sbjct  791   VGDRMALVIQTVSAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIQ  850

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQ+ S+++A EAV N R +T+F S +++L +F+ AQ+ PRKE+ ++SW+AG+G+G++  L
Sbjct  851   AQSESSKLAAEAVSNLRTITAFSSQDRILGLFNQAQNGPRKESIRQSWIAGLGLGTSMSL  910

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
                 WALDFW+GG+L++   I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ A+AS+
Sbjct  911   MTCTWALDFWFGGRLIAEHHITAKALFQTFMILVSTGRVIADAGSMTTDLAKGADAIASV  970

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             FA+LDR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G
Sbjct  971   FAVLDRVTEI-DPDNPE----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFSLSIQPG  1025

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
              S  LVG+SGSGKSTI+ LIERFYD   G +++DG D+R++++   R+ + LVSQEP ++
Sbjct  1026  KSTALVGQSGSGKSTIIGLIERFYDPLRGLVKIDGRDIRTYNLRALRQHIGLVSQEPTLF  1085

Query  619   SGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             +GTIR+NI++G   ASE E   AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIA
Sbjct  1086  AGTIRENIVYGTETASEAETENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIA  1145

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI++NP ILLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+T++N D I +
Sbjct  1146  IARAILKNPAILLLDEATSALDSQSEKVVQEALERVMVGRTSVVVAHRLSTVQNCDLITV  1205

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +G VVE GT+S L +K
Sbjct  1206  LDKGIVVEKGTHSSLMSK  1223



>ref|XP_010272126.1| PREDICTED: ABC transporter B family member 15-like isoform X1 
[Nelumbo nucifera]
Length=1248

 Score =  1191 bits (3080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/1223 (52%), Positives = 884/1223 (72%), Gaps = 36/1223 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD  DI LM LG +GA+GDG+    +L+  S + N LG       S       +  
Sbjct  24    IFMHADHTDILLMILGFIGAVGDGVGMPVMLIITSKIMNNLG-----GGSTADPHLFLHN  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             V + ++  + +     ++ F+EGYCW++T ERQ  ++R +YL+A++RQ++G+FD Q  +T
Sbjct  79    VTENAVNLLYMACGYWIVCFLEGYCWTRTGERQATRMRARYLKAVMRQDIGYFDVQVTST  138

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +E+  S+S D  +IQ+V+SEK+P FLM+ S F+     +    WRL+LV +P ++ILIIP
Sbjct  139   AEVVTSVSNDCLVIQDVISEKLPNFLMNASTFIGSYIAAFLLMWRLALVGFPFVLILIIP  198

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L++K  +EY+KA  IV Q++SSI+T+YSF  E   +  +S+ L+ ++KLG
Sbjct  199   GLIYGRILMGLARKIREEYNKAGNIVEQSVSSIRTVYSFVGESKTMAEFSAALEGSVKLG  258

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G+ FAIW+F++WYGSRL+M+ G  GG ++A G S  +GGLSLG  +
Sbjct  259   LKQGLAKGLAIGSNGVVFAIWSFMSWYGSRLVMYHGAEGGTVFAVGASISVGGLSLGSGI  318

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  A  RI   I RVPKID ++  G +L  + G +EF+NV FAYPSRPE+++
Sbjct  319   SNLKYFSEAFSAGERIMEVIKRVPKIDSDNMEGQILQDVSGAIEFRNVGFAYPSRPENVI  378

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              +D  LK+ AGKT+ALVG SGSGKST I+LL+RFY+  SG I +DG+ I+ LQ+KWLR Q
Sbjct  379   FEDFCLKIPAGKTIALVGGSGSGKSTVISLLERFYNPLSGEILLDGIPIDKLQLKWLRSQ  438

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFI-RQLPQGYETKVGERG  2381
             MGLVSQE ALF TSI+ENI+ GK   +MEEVVAAA  AN H+FI  QLPQGY+T+VGERG
Sbjct  439   MGLVSQEPALFATSIKENILFGKESATMEEVVAAAKIANVHNFIVSQLPQGYDTQVGERG  498

Query  2380  ALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHK  2201
               +SGGQKQRIAIARA+I+ P ILLLDEATSALDSESE++VQ+ALD AS GRTT+V+AH+
Sbjct  499   VQMSGGQKQRIAIARAVIRAPRILLLDEATSALDSESERVVQEALDNASVGRTTIVIAHR  558

Query  2200  LSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQ----------  2054
             LSTIR+AD+IAV+  G ++E GSH EL + ++G Y  + +LQ+    A +          
Sbjct  559   LSTIRSADVIAVMKNGQVVETGSHEELFQDEDGLYTSLVRLQQTDESAREIEISSTSSSL  618

Query  2053  -DQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTD---HHHQPSPSFSRLLGLNL  1886
               Q+    +N+ R ST        +SS   +  A + P        Q  PSF RLL LN 
Sbjct  619   PSQTVNQDNNSKRFST-----LSRSSSTNSVVVASRAPVGGKGEATQLVPSFRRLLLLNT  673

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWKQ  +G +SAI FG VQP YA  +G M+S +F   H+EM+++ + +CL+F  L L S
Sbjct  674   PEWKQASLGCVSAILFGGVQPAYAYVLGSMVSVYFLTDHDEMKSKTRMYCLLFVGLALFS  733

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
               +N+ QHY FA MGE+LT+RIR RML KILTFE  WFD+  NS+GA+C+RL+ +A +V+
Sbjct  734   FVINMSQHYSFAAMGEYLTKRIRERMLSKILTFEVGWFDQHENSTGAVCSRLAKDANVVR  793

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLV DR++L+VQ  S+V+IA  MGL++AW+LA+V+IAVQPL ILC+Y R+VLL T++ K 
Sbjct  794   SLVGDRMALVVQTFSAVSIAFTMGLIIAWRLAIVIIAVQPLIILCYYARRVLLKTMSKKA  853

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             +KAQ+ S+++A EAV N R +T+F S +++L + D A + PR+E+ ++SW AGIG+G++Q
Sbjct  854   IKAQDQSSKLAAEAVSNLRTITAFSSQDRILCMLDRANEGPRRESIRQSWFAGIGLGTSQ  913

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              L    W LDFWYGGKL+S G I++  +F+TF +L+STG+VIADAGSMTSDLAKG+ AV 
Sbjct  914   SLMSCTWVLDFWYGGKLISQGYITAKALFETFMVLMSTGRVIADAGSMTSDLAKGADAVG  973

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+FA+LDR + I        D  G   EK++G +E++ ++FAYP+RP+  I R F L ++
Sbjct  974   SVFAVLDRYTRIEPE-----DLEGHRPEKITGYVELRDIDFAYPARPDVMIFRGFSLSIE  1028

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             AG S  LVG+SGSGKSTI+ LIERFYD   G++ +DG D+R++ +  +R+ +ALVSQEP 
Sbjct  1029  AGKSTALVGQSGSGKSTIIGLIERFYDPLKGTVSIDGRDIRTYHLRCFRKHIALVSQEPT  1088

Query  625   IYSGTIRDNILFG---KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQ  455
             + SGTIR+NI +G   K+D  E EIIEAA+ ANAH FI+ LK GY+T CG+RG QLSGGQ
Sbjct  1089  LLSGTIRENITYGVANKVD--EAEIIEAARTANAHDFIAGLKDGYETWCGDRGAQLSGGQ  1146

Query  454   KQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNL  275
             KQRIAIARAI++ P +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N 
Sbjct  1147  KQRIAIARAILKKPAVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHRLSTIQNC  1206

Query  274   DSIALVSEGKVVEHGTYSQLKNK  206
             D IA++ +GKVVE GT+S L NK
Sbjct  1207  DLIAVLDKGKVVEKGTHSSLLNK  1229



>ref|XP_006392796.1| hypothetical protein EUTSA_v10011187mg [Eutrema salsugineum]
 gb|ESQ30082.1| hypothetical protein EUTSA_v10011187mg [Eutrema salsugineum]
Length=1245

 Score =  1191 bits (3080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/1219 (52%), Positives = 875/1219 (72%), Gaps = 26/1219 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  I  +AD +D  LM LG +GA+GDG +T  +L   S L N LG       S  +   
Sbjct  19    SIRSILVHADGVDWLLMGLGLIGAVGDGFTTPLILFITSKLMNNLG------GSSSNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ ++K S+  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSIDKYSVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               + S++  S+S D+  IQ+VLSEK+P FL   S F+     S    WRL+LV  P IV+
Sbjct  133   VTSISDVITSVSSDSLAIQDVLSEKLPNFLTSASTFVGSYIVSFVLLWRLALVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S+K  +EY++A  I  QA+SS++T+Y+F+ ER  + R+S+ L  +
Sbjct  193   LVIPGLMYGRALMSISRKIRQEYNEAGSIAEQAISSVRTVYAFSGERKTISRFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FAIW F++WYGSR++M+ G  GG +Y    S  +GGL+L
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAIWGFMSWYGSRMVMYHGAQGGTVYTVATSLAIGGLAL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L   KYF EAS A  R+   I+RVPKID ++  G  L+ IRGE+EFKNVKF YPSRP
Sbjct  313   GSSLSNFKYFFEASSAGERMMEVINRVPKIDSDNPEGQKLEKIRGEVEFKNVKFLYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+L+  D  ++V  GKT+ALVG SGSGKST I+LLQR+YD  +G I IDGV I+ LQVKW
Sbjct  373   ETLIFHDFCMRVPCGKTLALVGGSGSGKSTVISLLQRYYDPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   SM++VV AA  +NAH FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDASMDDVVEAAKASNAHTFISQLPHGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P+ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPIILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS----  2045
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G Y  + +LQ Q    D+D      
Sbjct  553   AHRLSTIRNADVISVVQNGHVVETGSHDELMENLDGQYTSLVRLQ-QIEKEDEDSDVNIN  611

Query  2044  ----FAPSSNAGRQSTEKsspavlassplLIETAQ-----KVPTDHHHQPSPSFSRLLGL  1892
                   P +N   +  + SS           + A      K+ +  + QP PSF RLL +
Sbjct  612   VNVHMGPITNHPNKDLKSSSRVSSLGKSSSAKLATSPNTVKILSKENKQPLPSFKRLLAM  671

Query  1891  NLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcl  1712
             NL E KQ L G ISA  +GA+ P YA ++G M+S +F  SH E++ + + + L F  L L
Sbjct  672   NLPERKQALYGCISATLYGAIMPIYAYSLGSMVSVYFLTSHNEIKEKTRIYALSFVGLFL  731

Query  1711  lsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAM  1532
             LS  L++ QHY FAYMGE LT+RIR +ML K+LTFE  WFD + NSSGA+C+RL+ +A +
Sbjct  732   LSFLLSIIQHYNFAYMGECLTKRIREKMLSKLLTFEVGWFDRDDNSSGAICSRLAQDANV  791

Query  1531  VKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITT  1352
             V+SLV DR++L+VQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL  ++ 
Sbjct  792   VRSLVGDRMALMVQTISAVTIACTMGLVIAWRLALVMIAVQPVMIVCFYTRQVLLKNMSR  851

Query  1351  KFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGS  1172
             K  KAQ+ S+++A EAV N R +TSF S  +++ + + AQ+ PR+E+ ++SW AG G+  
Sbjct  852   KASKAQDESSKLAAEAVSNVRTITSFSSQERIMKMLEKAQEGPRRESIRQSWFAGFGLAM  911

Query  1171  AQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAA  992
             +Q LT   WALDFW+GGKL++ G I++   F+TF ILVSTG+VIA+ GSM ++LA+GS  
Sbjct  912   SQSLTACTWALDFWFGGKLIAGGYITAKAFFETFMILVSTGRVIAEVGSMNTELARGSDT  971

Query  991   VASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLE  812
             V S+F++LDR + I        D  G   ++++G++E   V+F+YP+RP+  I R+F + 
Sbjct  972   VGSVFSVLDRYTSINPE-----DPDGYEPKRITGRVEFLDVDFSYPTRPDVMIFRDFSVV  1026

Query  811   VKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQE  632
             + A  S  +VG SGSGKST++ LIERFYD   G++R+DG D+RS+++   RR +ALVSQE
Sbjct  1027  IDARKSTAIVGPSGSGKSTVIGLIERFYDPVKGAVRIDGRDLRSYNLRSLRRHVALVSQE  1086

Query  631   PVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
             P +++GTIR+NI++G     E+E+IEAAKAANAH FI+SL  GYDT CG+RGVQLSGGQK
Sbjct  1087  PTLFAGTIRENIVYGGGVDDESEVIEAAKAANAHDFITSLSDGYDTYCGDRGVQLSGGQK  1146

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D
Sbjct  1147  QRIAIARAVLKNPSLLLLDEATSALDSQSERVVQDALERVMVGRTSVVVAHRLSTIQNCD  1206

Query  271   SIALVSEGKVVEHGTYSQL  215
             +IA++ +GK+VEHGT+S L
Sbjct  1207  AIAVLDKGKLVEHGTHSSL  1225


 Score =   299 bits (765),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 191/511 (37%), Positives = 298/511 (58%), Gaps = 21/511 (4%)
 Frame = -2

Query  3571  GYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKV  3392
             G C +K       +IR K L  +L  EVG+FD  + ++  I + +++D ++++ ++ +++
Sbjct  748   GECLTK-------RIREKMLSKLLTFEVGWFDRDDNSSGAICSRLAQDANVVRSLVGDRM  800

Query  3391  PIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKA  3212
              + +   S            +WRL+LV      ++I+        L  +S+K+ K   ++
Sbjct  801   ALMVQTISAVTIACTMGLVIAWRLALVMIAVQPVMIVCFYTRQVLLKNMSRKASKAQDES  860

Query  3211  NGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVG-STGLSFAIW  3035
             + +  +A+S+++TI SF+++  I++      +   +  ++     G  +  S  L+   W
Sbjct  861   SKLAAEAVSNVRTITSFSSQERIMKMLEKAQEGPRRESIRQSWFAGFGLAMSQSLTACTW  920

Query  3034  AFLAWYGSRLIMHKGESGGRIYA-AGISYVLGGLSLGMALPEV----KYFTEASVAASRI  2870
             A   W+G +LI     +GG I A A     +  +S G  + EV          S     +
Sbjct  921   ALDFWFGGKLI-----AGGYITAKAFFETFMILVSTGRVIAEVGSMNTELARGSDTVGSV  975

Query  2869  FSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVAL  2690
             FS +DR   I+ ED  G     I G +EF +V F+YP+RP+ ++ +D ++ ++A K+ A+
Sbjct  976   FSVLDRYTSINPEDPDGYEPKRITGRVEFLDVDFSYPTRPDVMIFRDFSVVIDARKSTAI  1035

Query  2689  VGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIR  2510
             VG SGSGKST I L++RFYD   G++ IDG ++ +  ++ LR  + LVSQE  LF  +IR
Sbjct  1036  VGPSGSGKSTVIGLIERFYDPVKGAVRIDGRDLRSYNLRSLRRHVALVSQEPTLFAGTIR  1095

Query  2509  ENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiarai  2330
             ENI+ G       EV+ AA  ANAHDFI  L  GY+T  G+RG  LSGGQKQRIAIARA+
Sbjct  1096  ENIVYGGGVDDESEVIEAAKAANAHDFITSLSDGYDTYCGDRGVQLSGGQKQRIAIARAV  1155

Query  2329  IKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGC  2150
             +KNP +LLLDEATSALDS+SE++VQDAL++   GRT++VVAH+LSTI+N D IAV+  G 
Sbjct  1156  LKNPSLLLLDEATSALDSQSERVVQDALERVMVGRTSVVVAHRLSTIQNCDAIAVLDKGK  1215

Query  2149  IIEQGSHSELMEK--NGHYAQMAKLQRQFSC  2063
             ++E G+HS L+ +   G Y  +  LQR  SC
Sbjct  1216  LVEHGTHSSLLARGHTGVYFSLVNLQRT-SC  1245



>ref|XP_010425612.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
15 [Camelina sativa]
Length=1244

 Score =  1190 bits (3078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/1223 (53%), Positives = 891/1223 (73%), Gaps = 29/1223 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S  +   
Sbjct  19    SVRSIFMHADRVDWVLMGLGFIGAVGDGFTTPLVLLITSKLMNNLG------GSSFNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ LIQ+VLSEK+P FLM  S+F+           +L++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFLIQDVLSEKLPNFLMSASMFVGSYIVGFVLLXKLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISTKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAEGGTVFAVAAAIAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EAS A  RI   I+RVPKID ++  G  L+ IRGE+EFKNVKF YPSR 
Sbjct  313   GGGLSNLKYFFEASSAGERIMQVINRVPKIDSDNPDGHKLENIRGEVEFKNVKFVYPSRL  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SME+VV AA  +NAH+FI QLP GY+T+VG
Sbjct  433   LRSQMGLVSQEPALFATTIKENILFGKEDASMEDVVEAAKASNAHNFISQLPHGYDTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P+ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPIILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSF---  2042
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G YA + +LQ Q    D D +    
Sbjct  553   AHRLSTIRNADVISVVQNGQVVETGSHDELMENVDGQYASLVRLQ-QIEKQDSDMNINVN  611

Query  2041  -----APSSNAGRQSTEKsspavlassplLIETAQKVPT-DHHHQPS-PSFSRLLGLNLT  1883
                   P  N   +S+ + S    +SS         V      ++P  PSF RLL +NL 
Sbjct  612   VQMGPVPDPNKDLRSSSRVSTLSRSSSANSFTGPSIVKNLSEDNKPKLPSFKRLLAMNLP  671

Query  1882  EWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsi  1703
             EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L +LS 
Sbjct  672   EWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLAILSF  731

Query  1702  tlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKS  1523
              +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+ +A +V+S
Sbjct  732   LINVSQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDKDENSSGAICSRLAKDANVVRS  791

Query  1522  LVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFV  1343
             LV DR++L+VQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL +++ K +
Sbjct  792   LVGDRMALVVQTVSAVTIAFTMGLVIAWRLALVMIAVQPVIIVCFYTRRVLLKSMSKKAI  851

Query  1342  KAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQG  1163
             KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AG G+  +Q 
Sbjct  852   KAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQESPRRESIRQSWFAGFGLAMSQS  911

Query  1162  LTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVAS  983
             LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV S
Sbjct  912   LTSCTWALDFWYGGRLIQDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVGS  971

Query  982   IFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKA  803
             +FA+LDR + I        D  G   E+L+G++E   V+F+YP+RP+  I + F +E+  
Sbjct  972   VFAVLDRYTSIDPE-----DQDGYEPERLTGRVEFLNVDFSYPTRPDVTIFKNFSIEIDE  1026

Query  802   GSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVI  623
             G S  +VG SGSGKSTI+ LIERFYD   G +++DG D+RS+ +   R+ +ALVSQEP +
Sbjct  1027  GKSTAIVGPSGSGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRQHIALVSQEPTL  1086

Query  622   YSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQ  455
             ++GTIR+NI++G    K+D  E+E+IEAAKAANAH FI+SL  GYDT CG+RGVQLSGGQ
Sbjct  1087  FAGTIRENIIYGRASDKID--ESEVIEAAKAANAHDFITSLTDGYDTYCGDRGVQLSGGQ  1144

Query  454   KQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNL  275
             KQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N 
Sbjct  1145  KQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNC  1204

Query  274   DSIALVSEGKVVEHGTYSQLKNK  206
             D+IA++ +GK+VE GT+S L +K
Sbjct  1205  DAIAVLDKGKLVERGTHSSLLSK  1227



>ref|XP_002877101.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53360.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=1239

 Score =  1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/1216 (53%), Positives = 888/1216 (73%), Gaps = 20/1216 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S  +   
Sbjct  19    SVRSIFMHADGVDWLLMSLGLIGAVGDGFTTPLVLLITSKLMNNLG------GSSFNTDT  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K S+  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNSVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S F+          WRL++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASTFVGSYIVGFILLWRLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S+K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISRKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIKQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVTAAIAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID ++  G  L+ IRGE+EFKNVKF YPSR 
Sbjct  313   GGGLSNLKYFFEAASVGERIMEVINRVPKIDSDNPDGHKLEKIRGEVEFKNVKFVYPSRL  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SM++VV AA  +NAH+FI QLP GYET+V 
Sbjct  433   LRSQMGLVSQEPALFATTIKENILFGKEDASMDDVVEAAKASNAHNFISQLPNGYETQVR  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQS--FA  2039
             AH+LSTIRNAD+I+VV  G I+E GSH ELME  +G YA +  LQ Q    D + S    
Sbjct  553   AHRLSTIRNADVISVVKNGHIVETGSHDELMENLDGQYATLVHLQ-QIEKQDINVSVQMG  611

Query  2038  PSSNAGR--QSTEKsspavlassplLIETAQKVPT-DHHHQPS-PSFSRLLGLNLTEWKQ  1871
             P S+  +  +S+ + S    +SS   +     V      ++P  PSF RLL +NL EWKQ
Sbjct  612   PISDPSKDIRSSSRVSTLSRSSSANSVTGPSIVKNLSEDNKPQLPSFKRLLAMNLPEWKQ  671

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
              L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L +LS  +N+
Sbjct  672   ALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLAVLSFLINI  731

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGE+LT+RIR RML K+LTFE  WFD + NSSGA+C+RL+ +A +V+SLV D
Sbjct  732   SQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDRDENSSGAICSRLAKDANVVRSLVGD  791

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL +++ K +KAQ+
Sbjct  792   RMALLVQTVSAVTIAFTMGLVIAWRLALVMIAVQPVIIVCFYTRRVLLKSMSKKAIKAQD  851

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AG G+  +Q LT  
Sbjct  852   ESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQESPRRESIRQSWFAGFGLAMSQSLTSC  911

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV S+FA+
Sbjct  912   TWALDFWYGGRLIQDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVGSVFAV  971

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             LDR + I        D  G   E+++G++E   V+F+YP+RP+  I + F ++++ G S 
Sbjct  972   LDRYTSIDPE-----DPDGYETERITGQVEFVDVHFSYPTRPDVIIFKNFSIKIEEGKST  1026

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
              +VG SGSGKSTI+ LIERFYD   G +++DG D+RS+ +   R+ +ALVSQEP +++GT
Sbjct  1027  AIVGPSGSGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRQHIALVSQEPTLFAGT  1086

Query  610   IRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             IR+NI++G  D   E EIIEAAKAANAH FI+SL  GYDT CG+RGVQLSGGQKQRIAIA
Sbjct  1087  IRENIIYGASDKIDEAEIIEAAKAANAHDFITSLTDGYDTYCGDRGVQLSGGQKQRIAIA  1146

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D+IA++ 
Sbjct  1147  RAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNCDAIAVLD  1206

Query  253   EGKVVEHGTYSQLKNK  206
             +GK+VE GT+S L +K
Sbjct  1207  KGKLVERGTHSSLLSK  1222



>ref|XP_006482504.1| PREDICTED: ABC transporter B family member 15-like [Citrus sinensis]
Length=1256

 Score =  1187 bits (3072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 640/1213 (53%), Positives = 867/1213 (71%), Gaps = 22/1213 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+F M LG +GAIGDG ST  +L   S   N +G       S +        
Sbjct  24    IFMHADGVDMFFMVLGYIGAIGDGFSTPLVLFLTSKFMNNIG-----DVSNVPIDVFTHN  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K +++ + L L   V  F+EGYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  79    INKNTVHLLYLALGSWVACFLEGYCWTRTGERQATRMRARYLKAVLRQDVGYFDLHVTST  138

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +E+  S+S D+ +IQ+V+SEK+P F+M+ S+F      +    WRL++V +P +V+L+IP
Sbjct  139   AEVITSVSNDSLVIQDVISEKLPNFVMNASLFFGCYLVAFLMLWRLAIVGFPFVVLLVIP  198

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G +YG+ L+ L++K   EY+KA  I  QA+SSI+T+Y+F  E      +SS L  +++LG
Sbjct  199   GFMYGRTLMSLARKMRDEYNKAGTIAEQAISSIRTVYAFVGESKTSIEFSSALQGSVQLG  258

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G++F IW+FL +YGSR++M+ G  GG ++A G S  +GGL+LG  L
Sbjct  259   LKQGLAKGLAIGSNGVTFGIWSFLCYYGSRMVMYHGAQGGTVFAVGASIAVGGLALGAGL  318

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             P +KYF+EA  A  RI   I RVPKID +   G +L+ + GE+EFK V+FAYPSRPES++
Sbjct  319   PNLKYFSEAMAAGERIMEMIKRVPKIDSDSMEGEILENVLGEVEFKCVQFAYPSRPESII  378

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD  L + AGKTVALVG SGSGKST IALLQRFY    G I +DGV I+ LQ+KWLR Q
Sbjct  379   FKDFCLTIPAGKTVALVGGSGSGKSTVIALLQRFYAPLGGEIILDGVSIDKLQLKWLRSQ  438

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ GK   SMEEV+ AA T+NAH+FIRQLPQ Y+T+VGERG 
Sbjct  439   MGLVSQEPALFATSIKENILFGKEDASMEEVIEAAKTSNAHNFIRQLPQQYDTQVGERGV  498

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A  GRTT+++AH+L
Sbjct  499   QMSGGQKQRIAIARAIIKAPRILLLDEATSALDSESERVVQEALDKAVVGRTTIIIAHRL  558

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSF----APS  2033
             STIRNAD+IAVV  G ++E GSH EL++ ++G Y  + +LQ      + + +     + S
Sbjct  559   STIRNADVIAVVQDGQVMETGSHDELIQAESGLYTSLVRLQTTTPDDNNNATMHSLASKS  618

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQ------PSPSFSRLLGLNLTEWKQ  1871
             SN    ST     ++++ S      AQ       ++      P PSF RL+ LN  EWKQ
Sbjct  619   SNMDMNSTSSRRLSIVSLSSSANSFAQGRGASQSNEEDIKKLPVPSFRRLVALNAPEWKQ  678

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
               +G + A  FGAVQP YA  +G MIS +F   H+E++ +   +   F  L + ++ +N+
Sbjct  679   ATLGCVGATLFGAVQPIYAFAMGSMISVYFLTDHDEIKKKTSIYAFCFLGLAVFTLVINI  738

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGEHLT+RIR RML KI TFE  WFD++ NSSGA+C+RL+ +A +V+SLV D
Sbjct  739   IQHYNFAYMGEHLTKRIRERMLSKIFTFEVGWFDQDENSSGAICSRLAKDANVVRSLVGD  798

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R +LLVQ  S+V IA  MGL +AW+LALVMIAVQPL I+CFY R+VLL +++ K +KAQ 
Sbjct  799   RTALLVQTISAVIIAFTMGLFIAWRLALVMIAVQPLVIICFYARRVLLRSMSNKAIKAQA  858

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              S+++A EAV N R +T+F S +++L + + AQ  PR+E+ ++SW AGIG+  +Q L   
Sbjct  859   ESSKLAAEAVSNLRTITAFSSQHRILKMLEKAQQGPRRESIRQSWYAGIGLAFSQSLASC  918

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WALDFWYGG+LV++G ISS  +F+TF ILVSTG+VIADAGSMT+D AKGS AV S+FA+
Sbjct  919   TWALDFWYGGRLVADGYISSKALFETFMILVSTGRVIADAGSMTTDFAKGSDAVGSVFAV  978

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             +DR + I        D  G   E+++G IE++ V+FAYP+RP+  I   F ++++AG S 
Sbjct  979   MDRYTKIEPE-----DPEGHQPERITGNIELQNVHFAYPARPDVMIFEGFSIKIEAGKST  1033

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
              LVG+SGSGKSTI+ LIERFYD   G +++D  D+RS+ +   RR +ALVSQEP +++GT
Sbjct  1034  ALVGQSGSGKSTIIGLIERFYDPLKGDVKIDDRDIRSYHLRSLRRHIALVSQEPTLFAGT  1093

Query  610   IRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             IR+NI +G  D   E+EI+EAAKAANAH FI+ L +GYDT CG+RG+QLSGGQKQRIAIA
Sbjct  1094  IRENIAYGASDEIDESEIVEAAKAANAHDFIAGLNEGYDTWCGDRGLQLSGGQKQRIAIA  1153

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP +LLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D IA++ 
Sbjct  1154  RAILKNPAVLLLDEATSALDSQSEKVVQEALERLMVGRTSVVVAHRLSTIQNCDIIAVLD  1213

Query  253   EGKVVEHGTYSQL  215
             +G V E GT+  L
Sbjct  1214  KGHVAEKGTHQSL  1226


 Score =   321 bits (823),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 209/530 (39%), Positives = 313/530 (59%), Gaps = 13/530 (2%)
 Frame = -2

Query  3634  EKCSLY-FVLLGLAV--MVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             +K S+Y F  LGLAV  +V+  ++ Y ++   E    +IR + L  I   EVG+FD  E 
Sbjct  717   KKTSIYAFCFLGLAVFTLVINIIQHYNFAYMGEHLTKRIRERMLSKIFTFEVGWFDQDEN  776

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++KD ++++ ++ ++  + +   S  +       + +WRL+LV      ++I
Sbjct  777   SSGAICSRLAKDANVVRSLVGDRTALLVQTISAVIIAFTMGLFIAWRLALVMIAVQPLVI  836

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD----  3116
             I        L  +S K+ K  ++++ +  +A+S+++TI +F+++  IL+           
Sbjct  837   ICFYARRVLLRSMSNKAIKAQAESSKLAAEAVSNLRTITAFSSQHRILKMLEKAQQGPRR  896

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              +I+     GI  GLA  S  L+   WA   WYG RL+     S   ++   +  V  G 
Sbjct  897   ESIRQSWYAGI--GLAF-SQSLASCTWALDFWYGGRLVADGYISSKALFETFMILVSTGR  953

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
              +  A      F + S A   +F+ +DR  KI+ ED  G   + I G +E +NV FAYP+
Sbjct  954   VIADAGSMTTDFAKGSDAVGSVFAVMDRYTKIEPEDPEGHQPERITGNIELQNVHFAYPA  1013

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+ ++ +  ++K+EAGK+ ALVG SGSGKST I L++RFYD   G + ID  +I +  +
Sbjct  1014  RPDVMIFEGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPLKGDVKIDDRDIRSYHL  1073

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSME-EVVAAAMTANAHDFIRQLPQGYET  2399
             + LR  + LVSQE  LF  +IRENI  G      E E+V AA  ANAHDFI  L +GY+T
Sbjct  1074  RSLRRHIALVSQEPTLFAGTIRENIAYGASDEIDESEIVEAAKAANAHDFIAGLNEGYDT  1133

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               G+RG  LSGGQKQRIAIARAI+KNP +LLLDEATSALDS+SEK+VQ+AL++   GRT+
Sbjct  1134  WCGDRGLQLSGGQKQRIAIARAILKNPAVLLLDEATSALDSQSEKVVQEALERLMVGRTS  1193

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSEL--MEKNGHYAQMAKLQR  2075
             +VVAH+LSTI+N D+IAV+  G + E+G+H  L  M   G Y  +  LQR
Sbjct  1194  VVVAHRLSTIQNCDIIAVLDKGHVAEKGTHQSLLAMGPTGAYYSLVSLQR  1243



>ref|XP_009765310.1| PREDICTED: ABC transporter B family member 15-like [Nicotiana 
sylvestris]
Length=1265

 Score =  1187 bits (3071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/1234 (53%), Positives = 890/1234 (72%), Gaps = 36/1234 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S + IF +AD  DI LM LG  GA+ DG S   +L+  S L N LG          ++ N
Sbjct  18    SFVSIFMHADRADILLMFLGFFGAVCDGFSMPIMLIVTSKLMNNLG-----DADTSNSDN  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + + +L  V L     V  F+EG+CW++T ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  73    FTHHINENALVLVFLACGQWVACFLEGFCWTRTGERQASRLRIRYLKAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
              A+T+++  S+S D+ +IQ+ +SEKVP+FLM+ + F+          WRL+LV +P ++ 
Sbjct  133   VASTADVITSVSSDSLVIQDCISEKVPVFLMNVAAFIGSYVVGFLMLWRLALVGFPFVIF  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +++K   EY KA  +V QA+SS++T+YSF  E   +  YS  L  T
Sbjct  193   LVIPGLMYGRALMGIARKIRDEYGKAGTVVEQAISSVRTVYSFVGENKTIAEYSVALQGT  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             ++LG+K G+AKGLA+GS G+ FAIW+F+++YGSRL+M+ G  GG ++A G +  +GGLSL
Sbjct  253   VELGLKQGLAKGLAIGSNGIVFAIWSFMSYYGSRLVMYNGAHGGTVFAVGAAIAIGGLSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EAS A  R+   I RVPKID ++  G +L+++ GE+EF++V+FAYPSRP
Sbjct  313   GSGLSNVKYFSEASAAGERVMEVIKRVPKIDSDNMEGQILESVTGEVEFRHVEFAYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++LKD NLKV  GKTVALVG SGSGKST +ALLQRFY+  +G I +DGV I+ LQ+KW
Sbjct  373   ESIILKDFNLKVPTGKTVALVGGSGSGKSTVVALLQRFYEPLAGEIFVDGVAIDKLQLKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SME+V+ AA  +NAH+FI QLPQGY+T+VG
Sbjct  433   LRSQMGLVSQEPALFATTIKENILFGKEDASMEQVIEAAKASNAHNFICQLPQGYDTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARA IK+P ILLLDEATSALDSESE++VQ+ALD A+ GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARATIKSPRILLLDEATSALDSESERVVQEALDMAAVGRTTIII  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQR------QFSCADQD  2051
             AH+LSTIRNADLIAVV  G I E GSH +L+ E+NG Y  + +LQ+      +F  A  +
Sbjct  553   AHRLSTIRNADLIAVVQDGQIKEIGSHDDLIEEENGLYTSLVRLQQTEKPSEEFYVAPTN  612

Query  2050  QS--FAPS-------SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQ---------  1925
             +S  FAPS       S+   Q+T     +++  S      AQ    D +           
Sbjct  613   KSIVFAPSNLNLELASDYDIQNTSSRRLSIVNRSSSANSAAQSRRVDQNATISSTTEQVF  672

Query  1924  PSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQ  1745
             P PSF RLL +NL EWK+  +G I AI FG VQP YA  +G MIS +F PSH+ ++ + +
Sbjct  673   PVPSFKRLLAMNLPEWKEATLGCIGAILFGGVQPVYAFAMGSMISVYFLPSHDVIKEKTK  732

Query  1744  KFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGA  1565
              + L F  L   S+ +N+ QHY FA MGE LT+R+R RML K+LTFE  W+D++ NS+GA
Sbjct  733   IYALCFLGLAFFSLIVNVLQHYNFAAMGEQLTKRVRERMLSKMLTFEIGWYDKDENSTGA  792

Query  1564  LCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFY  1385
             +C+RL+ +A +V+SLV DR++LL+Q  S+VTIA  MGLV+AWKLALVMIAVQPL I+C+Y
Sbjct  793   VCSRLAKDANVVRSLVGDRMALLIQTISAVTIACTMGLVIAWKLALVMIAVQPLIIVCYY  852

Query  1384  TRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQK  1205
              ++VLL +++ K +KAQ  S+++A EAV N R VT+F S  ++L +   AQ+ P++E+ +
Sbjct  853   CKRVLLKSMSKKSIKAQEESSKLAAEAVSNLRTVTAFSSQARILQMLKKAQEGPQRESIR  912

Query  1204  KSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGS  1025
             +SW AGIG+G++  L    WALDFWYGGKL++ GEI +  +F+TF ILVSTG+VIADAG+
Sbjct  913   QSWFAGIGLGTSNSLMTCTWALDFWYGGKLMAAGEIGAKALFQTFMILVSTGRVIADAGT  972

Query  1024  MTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRP  845
             MT+DLAKG+ AV S+F++LDR S+I        D+ G   +KL G +E+  V+FAYP+RP
Sbjct  973   MTNDLAKGADAVGSVFSVLDRYSLIEPE-----DSEGYKPKKLIGNVELCDVDFAYPARP  1027

Query  844   ETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGW  665
                I + F ++++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG D+RS+D+  
Sbjct  1028  NVIIFKGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPSSGLVKIDGRDIRSYDLRS  1087

Query  664   YRRQMALVSQEPVIYSGTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTEC  488
              R+ +ALVSQEP +++GTIR NI +G   +  E+E+IEAAKAANAH FIS+LK GY+T C
Sbjct  1088  LRKHIALVSQEPTLFAGTIRQNIAYGASEEVDESEVIEAAKAANAHDFISALKDGYETWC  1147

Query  487   GERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMV  308
             G+RG+QLSGGQKQRIAIARAI++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V
Sbjct  1148  GDRGLQLSGGQKQRIAIARAILKNPGVLLLDEATSALDSQSEKVVQDALERVMVGRTSVV  1207

Query  307   VAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             VAHRL+TI+N D+IA++ +GK+VE GT+S L  K
Sbjct  1208  VAHRLSTIQNCDTIAVLDKGKIVEKGTHSSLLAK  1241



>ref|XP_010514536.1| PREDICTED: ABC transporter B family member 15-like [Camelina 
sativa]
Length=1244

 Score =  1185 bits (3065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1223 (53%), Positives = 889/1223 (73%), Gaps = 29/1223 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GAIGDG +T  +LL  S L N LG       S  +   
Sbjct  19    SVRSIFMHADRVDWVLMGLGFIGAIGDGFTTPLVLLITSKLMNNLG------GSSFNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R +YL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMRERYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ LIQ+VLSEK+P FLM  S+F+          W+L++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFLIQDVLSEKLPNFLMSASMFVGSYIVGFVLLWKLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISTKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIKQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAEGGTVFAVAAAIAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EAS A  RI   I+RVPKID  +  G  L+ IRGE+EFKNVKF YPSR 
Sbjct  313   GGGLSNLKYFFEASSAGERIMQVINRVPKIDSNNPDGHKLENIRGEVEFKNVKFVYPSRL  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ + +D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFEDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SM++V+ AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATTIKENILFGKEDASMDDVMEAAKASNAHNFISQLPHGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P+ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPIILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFA--  2039
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G YA + +LQ Q    D D +    
Sbjct  553   AHRLSTIRNADVISVVQNGQVVETGSHDELMENVDGQYASLVRLQ-QIEKQDSDININVN  611

Query  2038  ------PSSNAGRQSTEKsspavlassplLIETAQKVPT-DHHHQPS-PSFSRLLGLNLT  1883
                   P  N   +S+ + S    +SS         V       +P  PSF RLL +NL 
Sbjct  612   VQMGPIPDPNKDLRSSSRVSTLSRSSSANSFTGPSIVKNLSEDTKPKLPSFKRLLAMNLP  671

Query  1882  EWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsi  1703
             EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L +LS 
Sbjct  672   EWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLAVLSF  731

Query  1702  tlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKS  1523
              +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+ +A +V+S
Sbjct  732   LINVSQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDKDENSSGAICSRLAKDANVVRS  791

Query  1522  LVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFV  1343
             LV DR++L+VQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL +++ K +
Sbjct  792   LVGDRMALVVQTVSAVTIAFTMGLVIAWRLALVMIAVQPVIIVCFYTRRVLLKSMSKKAI  851

Query  1342  KAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQG  1163
             KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AG G+  +Q 
Sbjct  852   KAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQESPRRESIRQSWFAGFGLAMSQS  911

Query  1162  LTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVAS  983
             LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV S
Sbjct  912   LTSCTWALDFWYGGRLIQDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVGS  971

Query  982   IFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKA  803
             +FA+LDR + I        D  G    +L+G++E   V+F+YP+RP+  I + F +E+  
Sbjct  972   VFAVLDRYTSIDPE-----DQDGYKPVRLTGRVEFLNVDFSYPTRPDVTIFKNFSIEIDE  1026

Query  802   GSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVI  623
             G S  +VG S SGKSTI+ LIERFYD   G +++DG D+RS+ +   R+ +ALVSQEP +
Sbjct  1027  GKSTAIVGPSASGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRQHIALVSQEPTL  1086

Query  622   YSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQ  455
             ++GTIR+NI++G    K+D  E+E+IEAAKAANAH FI+SL  GYDT CG+RGVQLSGGQ
Sbjct  1087  FAGTIRENIIYGRACDKID--ESEVIEAAKAANAHDFITSLIDGYDTYCGDRGVQLSGGQ  1144

Query  454   KQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNL  275
             KQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N 
Sbjct  1145  KQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNC  1204

Query  274   DSIALVSEGKVVEHGTYSQLKNK  206
             D+IA++ +GK+VE GT+S L +K
Sbjct  1205  DAIAVMDKGKLVERGTHSSLLSK  1227



>emb|CDX86445.1| BnaA06g31620D [Brassica napus]
Length=1244

 Score =  1185 bits (3065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1225 (52%), Positives = 886/1225 (72%), Gaps = 33/1225 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S      
Sbjct  19    SIRSIFMHADGVDWVLMGLGLIGAVGDGFTTPLVLLITSKLMNNLG------GSSFKTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S+F+          WRL++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASMFVGSYIVGFILLWRLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISSKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSAALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID  +  G+ L+ +RGE+EFK+VKF YPSRP
Sbjct  313   GGGLSNLKYFFEAASVGERIMEVINRVPKIDSNNPEGLKLEKVRGEVEFKHVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ + +D  L+V +GKTVALVG SGSGKST I+LLQRFY+  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFEDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYNPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   +M++VV AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDATMDDVVEAAKASNAHNFISQLPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+I VV  G ++E GSH ELM+  +G YA + +LQ+       D S   S
Sbjct  553   AHRLSTIRNADVITVVRNGHVVETGSHDELMDNIDGQYASLVRLQQ---IEKDDSSVNMS  609

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDH--------------HHQPSPSFSRLLG  1895
              N   Q++    P     S   + T  +  + +                 P PSF RLL 
Sbjct  610   VNV--QTSPTLDPTKDFRSCSRVSTLSRSSSTNSVTGSSIVKNLSKDDKPPLPSFKRLLA  667

Query  1894  LNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllc  1715
             +NL EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L 
Sbjct  668   MNLPEWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLA  727

Query  1714  llsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAA  1535
             +LS  +N+ QHY FAYMGE+LT+R+R RML K+LTFE  WFD + NSSGA+C+RL+ +A 
Sbjct  728   VLSFLINISQHYNFAYMGEYLTKRVRERMLSKVLTFEVGWFDRDENSSGAICSRLAKDAN  787

Query  1534  MVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT  1355
             +V+SLV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQPL I+CFYTR+VLL  ++
Sbjct  788   VVRSLVGDRMALLVQTISAVTIACTMGLVIAWRLALVMIAVQPLIIVCFYTRRVLLKNMS  847

Query  1354  TKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIG  1175
              K +KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AGIG+ 
Sbjct  848   KKAIKAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQENPRRESIRQSWFAGIGLA  907

Query  1174  SAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
              +Q LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS 
Sbjct  908   MSQSLTTCTWALDFWYGGRLIEDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSD  967

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
             AV S+FA+LDR + I        D  G   E+L+G++E   V+F+YP+RP+  I  +F +
Sbjct  968   AVGSVFAVLDRYTSIDPE-----DPEGYEPERLTGRVEFLNVDFSYPTRPDVMIFSDFSI  1022

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
             ++ A  S  +VG SGSGKST++ LIERFYD   G +++DG D+RS+++   R+ +ALVSQ
Sbjct  1023  DIDAAKSTAIVGPSGSGKSTVIGLIERFYDPVKGVVKIDGRDLRSYNLRSLRQHIALVSQ  1082

Query  634   EPVIYSGTIRDNILFGKL--DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSG  461
             EP +++GTIR+NI++G+   +  E+EIIEAA+AANAH FI+SL  GYDT CG+RGVQLSG
Sbjct  1083  EPTLFAGTIRENIVYGRASDNIDESEIIEAARAANAHDFITSLTDGYDTYCGDRGVQLSG  1142

Query  460   GQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIK  281
             GQKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+
Sbjct  1143  GQKQRIAIARAVLKNPSLLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQ  1202

Query  280   NLDSIALVSEGKVVEHGTYSQLKNK  206
             N D+IA++ +GK+VE GT+S L  K
Sbjct  1203  NCDAIAVLDKGKLVERGTHSSLLAK  1227



>ref|NP_189475.1| ABC transporter B family member 15 [Arabidopsis thaliana]
 sp|Q9LHD1.1|AB15B_ARATH RecName: Full=ABC transporter B family member 15; Short=ABC transporter 
ABCB.15; Short=AtABCB15; AltName: Full=Multidrug 
resistance protein 13; AltName: Full=P-glycoprotein 15 [Arabidopsis 
thaliana]
 dbj|BAB02627.1| multidrug resistance p-glycoprotein [Arabidopsis thaliana]
 gb|AEE77436.1| ABC transporter B family member 15 [Arabidopsis thaliana]
Length=1240

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/1222 (53%), Positives = 893/1222 (73%), Gaps = 31/1222 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N +G       S  +   
Sbjct  19    SVRSIFMHADGVDWLLMGLGLIGAVGDGFTTPLVLLITSKLMNNIG------GSSFNTDT  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K S+  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNSVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S F+          WRL++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASTFVGSYIVGFILLWRLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S+K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISRKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG+K G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIKQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAIAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID ++  G  L+ IRGE+EFKNVKF YPSR 
Sbjct  313   GGGLSNLKYFFEAASVGERIMEVINRVPKIDSDNPDGHKLEKIRGEVEFKNVKFVYPSRL  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPLAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SM++VV AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATTIKENILFGKEDASMDDVVEAAKASNAHNFISQLPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFA--  2039
             AH+LSTIRNAD+I+VV  G I+E GSH ELME  +G Y+ +  LQ Q    D + S    
Sbjct  553   AHRLSTIRNADVISVVKNGHIVETGSHDELMENIDGQYSTLVHLQ-QIEKQDINVSVKIG  611

Query  2038  ----PSS---NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTE  1880
                 PS    N+ R ST   S +  A+S     T + +  D+  Q  PSF RLL +NL E
Sbjct  612   PISDPSKDIRNSSRVST--LSRSSSANSVTGPSTIKNLSEDNKPQL-PSFKRLLAMNLPE  668

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L +LS  
Sbjct  669   WKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLAVLSFL  728

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             +N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD + NSSGA+C+RL+ +A +V+SL
Sbjct  729   INISQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDRDENSSGAICSRLAKDANVVRSL  788

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             V DR++L+VQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR+VLL +++ K +K
Sbjct  789   VGDRMALVVQTVSAVTIAFTMGLVIAWRLALVMIAVQPVIIVCFYTRRVLLKSMSKKAIK  848

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AG G+  +Q L
Sbjct  849   AQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQESPRRESIRQSWFAGFGLAMSQSL  908

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
             T   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV S+
Sbjct  909   TSCTWALDFWYGGRLIQDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVGSV  968

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             FA+LDR + I        D  G   E+++G++E   V+F+YP+RP+  I + F ++++ G
Sbjct  969   FAVLDRYTSIDPE-----DPDGYETERITGQVEFLDVDFSYPTRPDVIIFKNFSIKIEEG  1023

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
              S  +VG SGSGKSTI+ LIERFYD   G +++DG D+RS+ +   RR +ALVSQEP ++
Sbjct  1024  KSTAIVGPSGSGKSTIIGLIERFYDPLKGIVKIDGRDIRSYHLRSLRRHIALVSQEPTLF  1083

Query  619   SGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQK  452
             +GTIR+NI++G    K+D  E EIIEAAKAANAH FI+SL +GYDT CG+RGVQLSGGQK
Sbjct  1084  AGTIRENIIYGGVSDKID--EAEIIEAAKAANAHDFITSLTEGYDTYCGDRGVQLSGGQK  1141

Query  451   QriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLD  272
             QRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D
Sbjct  1142  QRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQNCD  1201

Query  271   SIALVSEGKVVEHGTYSQLKNK  206
             +IA++ +GK+VE GT+S L +K
Sbjct  1202  AIAVLDKGKLVERGTHSSLLSK  1223



>ref|XP_008379304.1| PREDICTED: ABC transporter B family member 15-like [Malus domestica]
Length=1250

 Score =  1183 bits (3060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/1218 (52%), Positives = 878/1218 (72%), Gaps = 30/1218 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D  LM LG  G++GDG ST  +LL  S L N +G          +    +  
Sbjct  24    IFMHADGVDRLLMILGLFGSLGDGFSTPLVLLITSKLMNNIG-----GSPTSAQDAFLHN  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + L       GF+   C+ +T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  79    INKNAVALLYLACG----GFV--CCFLETGERQAARMRVRYLKAVLRQDVGYFDLHVTST  132

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+VLSEK+P F+M++S+F      +    WRL++V +P +V+L+IP
Sbjct  133   SEVITSVSNDSLVIQDVLSEKLPNFVMNSSMFFGSYIAAFIMMWRLAIVGFPFVVLLVIP  192

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L+++  +EY+KA  I  QA+SSI+T+Y+F  E   +  +S  L  ++KLG
Sbjct  193   GLIYGRTLMGLARQIREEYNKAGNIAEQAISSIRTVYAFVGENKTISEFSVALQGSVKLG  252

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +  G+AKGLA+GS G+ FAIW+F+++YGS ++M+    GG ++A G +  +GGL+LG  L
Sbjct  253   LSQGLAKGLAIGSNGVVFAIWSFMSYYGSTMVMYHSARGGTVFAVGAAIAVGGLALGSGL  312

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA  AA RI   I RVPKID ++  G  L+ + GE+EFK+++FAYPSRPES++
Sbjct  313   SNLKYFSEACSAAERIMEVIRRVPKIDSDNMEGECLEDVSGEVEFKHLEFAYPSRPESII  372

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD NL + AGKTVALVG SGSGKST I+LLQRFYD   G + +DGV IN LQ+KWLR Q
Sbjct  373   FKDFNLTIPAGKTVALVGGSGSGKSTVISLLQRFYDPLGGEVLLDGVAINKLQLKWLRSQ  432

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ GK    +EEV+ A   ANAH+FI QLPQGY+T+VGERG 
Sbjct  433   MGLVSQEPALFATSIKENILFGKEDAEIEEVIEAGKAANAHNFISQLPQGYDTQVGERGV  492

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  493   QMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  552

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQ------SFA  2039
             STIRNAD+IAVV  G ++E GSH EL ++ NGHY  + +LQR     + ++      S +
Sbjct  553   STIRNADVIAVVQNGQVMEIGSHDELSQRENGHYTSLVRLQRTEKEKEPEELGHYGVSSS  612

Query  2038  PSSNAGRQSTEKsspavlassplLIETAQK------VPTDHHHQPSPSFSRLLGLNLTEW  1877
              S++    S+ + S    +SS       +       V  +    P PSF RLL LNL EW
Sbjct  613   ISNDIHSTSSRRLSMVSRSSSANSFAQGRAPDQESVVEYEQKKLPVPSFRRLLALNLPEW  672

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ ++G  SA  FGAVQP YA  +G MIS +F   H+E++A+ + + L F  L + S+ +
Sbjct  673   KQAVMGCTSATLFGAVQPLYAFAMGSMISVYFLKDHDEIKAKTRTYSLCFLGLAIFSLLI  732

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FAYMGE+LT+RIR RML K+LTFE  WFD++ NSSGA+C+RL+ +A +V+SLV
Sbjct  733   NVSQHYNFAYMGEYLTKRIRERMLSKVLTFEVGWFDQDENSSGAICSRLAKDANVVRSLV  792

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L+VQ  S+VT+A  MGL++ W+LALVMIAVQPL I+CFYTR+VLL  ++ K +K+
Sbjct  793   GDRMALVVQTMSAVTVACTMGLIITWRLALVMIAVQPLIIVCFYTRRVLLKNMSQKAIKS  852

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A EAV N R VT+F S N++L + + AQ+ PR+E+ ++SW AGIG+  +Q LT
Sbjct  853   QEESSKLAAEAVSNLRTVTAFSSQNRLLKMLEKAQEGPRRESIRQSWYAGIGLACSQSLT  912

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
              + WA DFWYGGKLV+ G +++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AV S+F
Sbjct  913   TVTWAFDFWYGGKLVAKGYVNAKQLFQTFMILVSTGRVIADAGSMTTDLAKGADAVGSVF  972

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LD+ + I        D  G + ++++G IE++ V+FAYP+RP+  I   F ++++AG 
Sbjct  973   AVLDKYTKIEPE-----DPEGLDPKRITGSIELRNVHFAYPARPDVMIFNGFSIKIEAGK  1027

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   G++++DG DV+S+ +   R+ +ALV QEP +++
Sbjct  1028  STALVGQSGSGKSTIIGLIERFYDPIKGAVKIDGQDVKSYHLKSLRKHIALVXQEPTLFA  1087

Query  616   GTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             GTIR+NI++G  D   E EI+EAA+AANAH FI+ LK GYDT CG+RGVQLSGGQKQRIA
Sbjct  1088  GTIRENIVYGVSDKVDELEIVEAARAANAHDFIAGLKDGYDTSCGDRGVQLSGGQKQRIA  1147

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNP ILLLDEATSALD  SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D I +
Sbjct  1148  IARAILRNPVILLLDEATSALDSRSEKVVQDALERVMVGRTSVVVAHRLSTIQNCDMITV  1207

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +GKVVE GT+S L  K
Sbjct  1208  LDKGKVVEKGTHSSLLAK  1225



>ref|XP_010670369.1| PREDICTED: ABC transporter B family member 15-like [Beta vulgaris 
subsp. vulgaris]
Length=1331

 Score =  1181 bits (3056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/1257 (51%), Positives = 892/1257 (71%), Gaps = 38/1257 (3%)
 Frame = -2

Query  3916  VFSWLAGNIMSSSLSQNKMegeegkkgKSSIIVIFRYADWIDIFLMCLGTLGAIGDGMST  3737
             +F  + G+   S +++NK         K+SI  IF +AD +D+ LM  G +GA+GDG + 
Sbjct  70    IFMSMIGSNKESMVTKNK---------KASIWTIFMHADGVDLVLMFFGLIGAVGDGFTL  120

Query  3736  NCLLLYVSHLFNTLGYgsnnsqsqisngNLMREVEKCSLYFVLLGLAVMVMGFMEGYCWS  3557
                L   S L N +G     + + +S       + + +    ++G    ++ F+EGYCW+
Sbjct  121   PLTLFITSKLMNNIG----ATSNLLSTDVFTHHINQNAAVLCMVGAGAWILCFLEGYCWT  176

Query  3556  KTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVPIFLM  3377
             +T+ERQ  ++RY+YL+A+LRQ+VG+FD    +TSE+  S+S D+  IQ+V+SEKVP F+M
Sbjct  177   RTAERQAARMRYRYLKAVLRQDVGYFDLHVGSTSEVIISVSSDSLAIQDVISEKVPNFVM  236

Query  3376  HTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKANGIVG  3197
             +TS F+     +    W+L++V +P I++LIIPGL+YG+ L+ L++K   EYSKA  I  
Sbjct  237   NTSTFIGSYLAAFLLLWKLAIVGFPFIILLIIPGLLYGRILMGLARKLTLEYSKAGSIAE  296

Query  3196  QALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWY  3017
             QA+SSI+T+Y+F  ER  + ++S+ L+ ++KLG+K G+AKGLA+GS G+SFA+WAF  WY
Sbjct  297   QAISSIRTVYAFVGERKTMTKFSTALEGSVKLGLKQGLAKGLAIGSNGVSFAVWAFSTWY  356

Query  3016  GSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDRVPKID  2837
             GS+L+M+ G  GG ++  G +  +GGL+LG  L  +KYF+EA+ A  +I   I R+P+ID
Sbjct  357   GSKLVMYHGAQGGTVFVVGAALSVGGLALGSGLSNIKYFSEAASAGEKIMEVIKRIPEID  416

Query  2836  GEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTA  2657
              E+  G+ LD + G++EFK+V+F YPSRPES++ +D +L+V AGKTVALVG SGSGKSTA
Sbjct  417   SENMEGLTLDNVSGKVEFKHVEFVYPSRPESIIFRDFSLQVPAGKTVALVGGSGSGKSTA  476

Query  2656  IALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGS  2477
             +ALLQRFY+   G I +DGV I+ LQ+KWLR QMGLVSQE ALF T+I+ENI+ GK   S
Sbjct  477   VALLQRFYNPLGGEIHLDGVSIDKLQLKWLRSQMGLVSQEPALFATTIKENILFGKEDAS  536

Query  2476  MEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDE  2297
             +EEV+ AA  +NAH+FI QLP GY+T+VGERG  +SGGQKQRIAIARAIIK P +LLLDE
Sbjct  537   VEEVIEAAKASNAHNFISQLPLGYDTQVGERGVQMSGGQKQRIAIARAIIKKPRVLLLDE  596

Query  2296  ATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELM  2117
             ATSALDSESE++VQDALD A+ GRTT+V+AH+LSTIRNAD+IAV+  G ++E GSH  LM
Sbjct  597   ATSALDSESERVVQDALDMAALGRTTIVIAHRLSTIRNADIIAVLQNGQVMEIGSHDVLM  656

Query  2116  E-KNGHYAQMAKLQRQFSCADQ------------------DQSFAPSSNAGRQSTEKssp  1994
             + K G Y  + +LQ+     D+                  +  ++ SS         SS 
Sbjct  657   QRKEGLYTSLVRLQQMEKSKDEKLGVPHPSTSNSSILNNIESRYSTSSRRLSLVNRSSSA  716

Query  1993  avlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYA  1814
               + S    I+     PT      +PSF RLL LN  EWKQ  +G I A+ FGAVQP YA
Sbjct  717   NSVTSVDDSIDELDIKPTGEEKFLAPSFKRLLALNAPEWKQATLGCIGAMLFGAVQPLYA  776

Query  1813  LTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRL  1634
               +G MIS +F P +EE++ +   +   F  L + ++ +N+ QHY FAYMGE LT+R+R 
Sbjct  777   FAMGSMISVYFLPDNEEIKRQTTIYASCFLGLAVFTLLVNIVQHYNFAYMGEFLTKRVRE  836

Query  1633  RMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMG  1454
              ML ++LTFE  WFD + N +G +C+RL+ +A +V+SLV DR++L VQ  S+V IA  MG
Sbjct  837   MMLSRMLTFEVGWFDRDENGTGTICSRLAKDANVVRSLVGDRMALAVQTISAVVIAFTMG  896

Query  1453  LVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSF  1274
             L++AW+LA+VMIA+QPL I+ FYTR+VLL +++ K +KAQ+ S+Q+A EAV N R VT+F
Sbjct  897   LIIAWRLAIVMIAIQPLIIISFYTRRVLLKSMSKKAIKAQDESSQLAAEAVSNLRTVTAF  956

Query  1273  GSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEIS  1094
              S  ++L +   AQ+ PRKE+ ++SW AGIG+G++QG+    WA+DFWYGGKL++ G ++
Sbjct  957   SSQARILAMLSKAQEGPRKESIRQSWYAGIGLGTSQGMNICAWAMDFWYGGKLIAQGYLT  1016

Query  1093  SGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGG  914
             + ++F+TF ILVSTG+VIADAGSMT+DL KG+ AV S+FA+LDR + I  P N +    G
Sbjct  1017  AKELFETFMILVSTGRVIADAGSMTTDLVKGADAVRSVFAVLDRITHI-DPDNPE----G  1071

Query  913   TNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIER  734
                +K+SG IEI+ V+F+YP+RP+  I + F + ++AG S  LVG+SGSGKSTI+ LIER
Sbjct  1072  YIPQKISGHIEIRDVDFSYPTRPDVVIFKGFSINIEAGKSTALVGQSGSGKSTIIGLIER  1131

Query  733   FYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDasenei-i  557
             FYD   GS+++DG D+R++++   R+ +ALVSQEP +++GTIR+NI++G  D  E    I
Sbjct  1132  FYDPLKGSVKIDGRDIRTYNLRSLRKHIALVSQEPTLFAGTIRENIIYGASDNVEESEII  1191

Query  556   eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSAL  377
             EAAKAANA  FIS LK GYDT CG+RGVQLSGGQKQRIAIARAI+RNP +LLLDEATSAL
Sbjct  1192  EAAKAANADDFISGLKDGYDTWCGDRGVQLSGGQKQRIAIARAILRNPAVLLLDEATSAL  1251

Query  376   DVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             D +SE+VVQ+AL+ +M+GRT++VVAHRL+TI+N D IA++ +GK+VE G +  L  K
Sbjct  1252  DSQSEKVVQDALERVMVGRTSVVVAHRLSTIQNCDLIAVLDKGKIVEKGAHYSLLAK  1308


 Score =   317 bits (813),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 204/493 (41%), Positives = 293/493 (59%), Gaps = 6/493 (1%)
 Frame = -2

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             YC+    E    R+R R L+ +L  +  +FD    S+  +   +S+++  ++ ++++++ 
Sbjct  173   YCWTRTAERQAARMRYRYLKAVLRQDVGYFDLHVGSTSEVIISVSSDSLAIQDVISEKVP  232

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
               V   S+   + +   ++ WKLA+V      L I+       +L  +  K     + + 
Sbjct  233   NFVMNTSTFIGSYLAAFLLLWKLAIVGFPFIILLIIPGLLYGRILMGLARKLTLEYSKAG  292

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
              IA +A+ + R V +F    K +  F  A +   K   K+    G+ IGS  G++F  WA
Sbjct  293   SIAEQAISSIRTVYAFVGERKTMTKFSTALEGSVKLGLKQGLAKGLAIGS-NGVSFAVWA  351

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
                WYG KLV       G VF     L   G  +    S     ++ ++A   I  ++ R
Sbjct  352   FSTWYGSKLVMYHGAQGGTVFVVGAALSVGGLALGSGLSNIKYFSEAASAGEKIMEVIKR  411

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
                I S      +  G  L+ +SGK+E K V F YPSRPE+ I R+F L+V AG ++ LV
Sbjct  412   IPEIDSE-----NMEGLTLDNVSGKVEFKHVEFVYPSRPESIIFRDFSLQVPAGKTVALV  466

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             G SGSGKST VAL++RFY+  GG I +DGV +    + W R QM LVSQEP +++ TI++
Sbjct  467   GGSGSGKSTAVALLQRFYNPLGGEIHLDGVSIDKLQLKWLRSQMGLVSQEPALFATTIKE  526

Query  601   NILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraii  422
             NILFGK DAS  E+IEAAKA+NAH FIS L  GYDT+ GERGVQ+SGGQKQRIAIARAII
Sbjct  527   NILFGKEDASVEEVIEAAKASNAHNFISQLPLGYDTQVGERGVQMSGGQKQRIAIARAII  586

Query  421   RNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKV  242
             + P +LLLDEATSALD ESE+VVQ+ALD   +GRTT+V+AHRL+TI+N D IA++  G+V
Sbjct  587   KKPRVLLLDEATSALDSESERVVQDALDMAALGRTTIVIAHRLSTIRNADIIAVLQNGQV  646

Query  241   VEHGTYSQLKNKR  203
             +E G++  L  ++
Sbjct  647   MEIGSHDVLMQRK  659



>ref|XP_009590357.1| PREDICTED: ABC transporter B family member 15-like [Nicotiana 
tomentosiformis]
Length=1264

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/1234 (52%), Positives = 894/1234 (72%), Gaps = 36/1234 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S + IF +AD  DI LM LG  GA+ DG S   +L+  S L N LG          +  N
Sbjct  17    SFVSIFMHADRADILLMILGFFGAVCDGFSMPIMLIVTSKLMNNLG-----GTDTSNADN  71

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + + +L  V L     V  F+EG+CW++T+ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  72    FTHHINENALVLVFLACGQWVACFLEGFCWTRTAERQASRLRIRYLKAVLRQDVGYFDLH  131

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
              A+T+++  S+S D+ +IQ+ +SEKVP+FLM+ + F+          WRL+LV +P ++ 
Sbjct  132   VASTADVITSVSSDSLVIQDCISEKVPVFLMNVAAFIGSYVVGFLMLWRLALVGFPFVIF  191

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ + +K   EY KA  +V QA+SS++T+YSF  E   +  YS+ L+ T
Sbjct  192   LVIPGLMYGRALMGIVRKIRDEYGKAGTVVEQAISSVRTVYSFVGENKTIAEYSAALEGT  251

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             ++LG+K G+AKGLA+GS G+ FAIW+F+++YGSRL+M+ G  GG ++A G +  +GGLSL
Sbjct  252   VELGLKQGLAKGLAIGSNGIVFAIWSFMSYYGSRLVMYNGAHGGTVFAVGAAIAIGGLSL  311

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EAS A  R+   I RVPKID ++  G +L+++ GE+EF++V+FAYPSRP
Sbjct  312   GSGLSNVKYFSEASAAGERVMEVIKRVPKIDSDNMEGQILESVTGEVEFRHVEFAYPSRP  371

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++LKD NLKV  GKTVALVG SGSGKST +ALLQRFY+  +G I +DGV I  LQ+KW
Sbjct  372   ESIILKDFNLKVPTGKTVALVGGSGSGKSTVVALLQRFYEPLAGEIFVDGVAIEKLQLKW  431

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF T+I+ENI+ GK   SME+V+ AA  +NAH+FI QLPQGY+T+VG
Sbjct  432   LRSQMGLVSQEPALFATTIKENILFGKEDASMEQVIEAAKASNAHNFISQLPQGYDTQVG  491

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARA IK+P ILLLDEATSALDSESE++VQ+ALD A+ GRTT+++
Sbjct  492   ERGVQMSGGQKQRIAIARATIKSPRILLLDEATSALDSESERVVQEALDMAAVGRTTIII  551

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQR------QFSCADQD  2051
             AH+LSTIRNADLIAVV  G + E GSH +L+ E+NG Y  + +LQ+      +F  A  +
Sbjct  552   AHRLSTIRNADLIAVVQDGQVKEIGSHDDLIEEENGLYTSLVRLQQTEKPSDEFYIAPTN  611

Query  2050  QS--FAPSS-NAGR------QSTEKsspavlassplLIETAQKVPTDHHHQ---------  1925
             ++  FAPS+ N G       Q+T     ++++ S      AQ    D +           
Sbjct  612   KNIVFAPSNLNPGSASDYDIQNTSSRRLSIVSRSSSANSAAQSRRVDQNATISSTTEQVF  671

Query  1924  PSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQ  1745
             P PSF RLL +NL EWK+  +G I AI FG VQP YA  +G MIS +F PSH+E++ + +
Sbjct  672   PVPSFKRLLAMNLPEWKEATLGCIGAILFGGVQPVYAFAMGSMISVYFLPSHDEIKEKTK  731

Query  1744  KFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGA  1565
              + L F  L   S+ +N+ QHY FA MGE LT+R+R RML K+LTFE  W+D++ NS+GA
Sbjct  732   IYALCFLGLAFFSLIVNVLQHYNFAAMGEQLTKRVRERMLSKMLTFEIGWYDKDENSTGA  791

Query  1564  LCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFY  1385
             +C+RL+ +A +V+SLV DR++LL+Q  S+VTIA  MGLV+AWKLALVMIAVQPL I+C+Y
Sbjct  792   ICSRLAKDANVVRSLVGDRMALLIQTVSAVTIACTMGLVIAWKLALVMIAVQPLIIVCYY  851

Query  1384  TRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQK  1205
              ++VLL +++ K +K+Q  S+++A EAV N R VT+F S  ++L +   AQ+ P++E+ +
Sbjct  852   CKRVLLKSMSKKSIKSQEESSKLAAEAVSNLRTVTAFSSQARILQMLKKAQEGPQRESIR  911

Query  1204  KSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGS  1025
             +SW AGIG+G++  L    WALDFWYGGKL++ GEI +  +F+TF ILVSTG+VIADAG+
Sbjct  912   QSWFAGIGLGTSNSLMTCTWALDFWYGGKLMAAGEIGAKALFQTFMILVSTGRVIADAGT  971

Query  1024  MTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRP  845
             MT+DLAKG+ AV S+F++LDR S+I        D+ G   +K++G +E+  V+FAYP+RP
Sbjct  972   MTNDLAKGADAVGSVFSVLDRYSLIEPE-----DSEGYKPKKITGNVELCDVDFAYPARP  1026

Query  844   ETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGW  665
                I + F ++++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG D+RS+ +  
Sbjct  1027  NVIIFKGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPSSGVVKIDGRDIRSYHLRS  1086

Query  664   YRRQMALVSQEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTEC  488
              R+ +ALVSQEP +++GTIR+NI +G  +   E+EIIEAAKAANAH FIS+LK GY+T C
Sbjct  1087  LRKHIALVSQEPTLFAGTIRENIAYGASEEVDESEIIEAAKAANAHDFISALKDGYETWC  1146

Query  487   GERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMV  308
             G+RG+QLSGGQKQRIAIARAI++NP +LLLDEATSALD +SE+VVQ+A++ +M+GRT++V
Sbjct  1147  GDRGLQLSGGQKQRIAIARAILKNPGVLLLDEATSALDSQSEKVVQDAVERVMVGRTSVV  1206

Query  307   VAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             VAHRL+TI+N D+IA++ +GK+VE GT+S L  K
Sbjct  1207  VAHRLSTIQNCDTIAVLDKGKIVEKGTHSSLLAK  1240



>gb|AES74614.2| ABC transporter B family protein [Medicago truncatula]
Length=1255

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1218 (53%), Positives = 870/1218 (71%), Gaps = 28/1218 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D F M  G +G+IGDG+S   LL     L N+       S S  S+ N + +
Sbjct  24    IFMHADVLDWFFMVFGLIGSIGDGISVPLLLFIAGRLMNS-----IGSASGASSNNFVHD  78

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++ F+ L  A  V  F+EGYCW++T ERQ  ++R +YL+AILRQ+V +FD    +T
Sbjct  79    INKNAVLFLYLACASFVACFLEGYCWTRTGERQAARMRVRYLKAILRQDVAYFDLHITST  138

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ +IQ+V+SEKVP FLM+ S+FL     +    WRL++V +P +V+L+IP
Sbjct  139   SEVITSVSNDSLVIQDVISEKVPNFLMNASMFLGSYIAAFALLWRLAIVGFPFLVLLVIP  198

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G +YG+  + L++K  +EY+KA  I  QA+SSI+T+YSF  E   +  +S+ L+ ++KLG
Sbjct  199   GFMYGRISMGLARKIREEYNKAGTIAQQAISSIRTVYSFAGESKTIAAFSNALEGSVKLG  258

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKG+ +GS GL FA+W+ +++YGSR++M+ G  GG +Y+ GIS  LGGL+ G +L
Sbjct  259   LKQGLAKGIGIGSNGLVFAVWSLMSYYGSRMVMYHGAKGGTVYSVGISITLGGLAFGTSL  318

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               VKYF+EAS A  RI   I RVPKID E+  G +++ + GE+EF +V+F YPSRPES++
Sbjct  319   SNVKYFSEASAAGERIMEVIKRVPKIDSENMEGEIIEKVLGEVEFNHVEFVYPSRPESVI  378

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L D  LKV +GKTVALVG SGSGKST ++LLQRFYD   G I +DGV I+ LQ+KWLR Q
Sbjct  379   LNDFCLKVPSGKTVALVGGSGSGKSTVVSLLQRFYDPIGGEILLDGVAIHKLQLKWLRSQ  438

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ G+   + EE+V AA  +NAH+FI  LPQGY+T+VGERG 
Sbjct  439   MGLVSQEPALFATSIKENILFGREDATYEEIVDAAKASNAHNFISLLPQGYDTQVGERGV  498

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  499   QMSGGQKQRIAIARAIIKMPKILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  558

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPSSNAG  2021
             STI+NAD+IAVV  G ++E GSH  LM+  N  Y  + +LQ+       DQS    S   
Sbjct  559   STIQNADIIAVVQNGLVMEMGSHDSLMQNDNSLYTSLVRLQQ----TRNDQSDDTPSIMN  614

Query  2020  RQSTEKsspavlassplLIETAQKVPTDHHHQPS-----------PSFSRLLGLNLTEWK  1874
             R   E +S   L S      +      DH++              PSF RLL +N  EWK
Sbjct  615   RDHMEITSSRRLVSHSSSFNSMTHGVVDHNNNDHKYNKKRENVEVPSFRRLLAMNGPEWK  674

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q  +G  +A+ FGA+QP Y+  +G +IS +F   H+E++ +I+ +   F  L ++S+ +N
Sbjct  675   QACLGCFNAVLFGAIQPVYSFAMGSVISVYFIEDHDEIKKQIRIYGFCFLGLAVISMVIN  734

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY FAYMGE+LT+R+R +M  KILTFE  WFDE+ NS+G++C+RL+ +A +V+SLV 
Sbjct  735   MLQHYSFAYMGEYLTKRVREKMFSKILTFEVGWFDEDQNSTGSVCSRLAKDANVVRSLVG  794

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DRL+L+VQ  S+V IA  MGL++AWKLA+VMIAVQPL I CFYTR+VLL  +++K +KAQ
Sbjct  795   DRLALVVQTISAVVIAFTMGLIIAWKLAIVMIAVQPLIIYCFYTRRVLLKNMSSKAIKAQ  854

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             +  ++IA EAV N R + +F S +++L + + AQ  P  E+ ++SW AGIG+  +Q L +
Sbjct  855   DQCSKIAAEAVSNLRTINAFSSQDRILKMLEKAQQGPSHESVRQSWFAGIGLACSQCLNY  914

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               WALDFWYGGKLVS G IS+  +FKTF ILVSTG+VIADAGSMTSDLAKGS A+ S+FA
Sbjct  915   STWALDFWYGGKLVSQGYISAKALFKTFMILVSTGRVIADAGSMTSDLAKGSDAIGSVFA  974

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR + I        D  G   EKL G IE+  V+FAYP+RP   I + F +++ AG S
Sbjct  975   ILDRYTKIKPN-----DLRGYKAEKLIGIIELFDVHFAYPARPNVMIFQGFSIKIDAGKS  1029

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ LIERFYD   G + +DG D++++++   R  +ALVSQEP ++SG
Sbjct  1030  TALVGESGSGKSTIIGLIERFYDPLKGIVTIDGRDIKTYNLRSLREHIALVSQEPTLFSG  1089

Query  613   TIRDNILFGKLDase--neiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             TIR+NI +G  D     +EIIEA+KAA+AH FISSLK GYDT CG+RGVQLSGGQKQRIA
Sbjct  1090  TIRENIAYGAYDDKVDESEIIEASKAASAHDFISSLKDGYDTLCGDRGVQLSGGQKQRIA  1149

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI++NP +LLLDEATSALD +SE++VQ+AL+ +M+GRT++VVAHRL+TI+N D IA+
Sbjct  1150  IARAILKNPEVLLLDEATSALDSQSEKLVQDALERVMVGRTSVVVAHRLSTIQNCDLIAV  1209

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +G VVE GT+S L +K
Sbjct  1210  LDKGIVVEKGTHSNLLSK  1227



>ref|XP_009151889.1| PREDICTED: ABC transporter B family member 15 [Brassica rapa]
Length=1244

 Score =  1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/1225 (52%), Positives = 883/1225 (72%), Gaps = 33/1225 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S      
Sbjct  19    SIRSIFMHADGVDWVLMGLGLIGAVGDGFTTPLVLLITSKLMNNLG------GSSFKTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               + S++  S+S D+ +IQ+VLSEK+P FLM  S+F+          WRL++V  P IV+
Sbjct  133   VTSPSDVITSVSSDSFVIQDVLSEKLPNFLMSASMFVGSYIVGFILLWRLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGRALISISSKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSAALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G+ FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGIPFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID  +  G+ L+ +RGE+EFK+VKF YPSRP
Sbjct  313   GGGLSNLKYFFEAASVGERIMEVINRVPKIDSNNPEGLKLEKVRGEVEFKHVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ + +D  L+V +GKTVALVG SGSGKST I+LLQRFY+  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFEDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYNPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   +M++VV AA  +NAH+FI QLP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDATMDDVVEAAKASNAHNFISQLPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+I VV  G ++E GSH ELM+  +G YA + +LQ+       D S   S
Sbjct  553   AHRLSTIRNADVITVVRNGHVVETGSHDELMDNIDGQYASLVRLQQ---IEKDDSSVNMS  609

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDH--------------HHQPSPSFSRLLG  1895
              N   Q++    P     S   + T  +  + +                 P PSF RLL 
Sbjct  610   VNV--QTSPTLDPTKDFRSCSRVSTLSRSSSTNSVTGSSIVKNLSKDDKPPLPSFKRLLA  667

Query  1894  LNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllc  1715
             +NL EWKQ L G ISA  FGA+QP YA ++G M+S +F  SH+E++ + + + L F  L 
Sbjct  668   MNLPEWKQALYGCISATLFGAIQPAYAYSLGSMVSVYFLTSHDEIKEKTRIYALSFVGLA  727

Query  1714  llsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAA  1535
             +LS  +N+ QHY FAYMGE+LT+R+R RML K+LTFE  WFD + NSSGA+C+RL+ +A 
Sbjct  728   VLSFLINISQHYNFAYMGEYLTKRVRERMLSKVLTFEVGWFDRDENSSGAICSRLAKDAN  787

Query  1534  MVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTIT  1355
             +V+SLV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQPL I+CFYTR+VLL  ++
Sbjct  788   VVRSLVGDRMALLVQTISAVTIACTMGLVIAWRLALVMIAVQPLIIVCFYTRRVLLKNMS  847

Query  1354  TKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIG  1175
              K +KAQ+ S+++A EAV N R +T+F S  +++ + + AQ+ PR+E+ ++SW AGIG+ 
Sbjct  848   KKAIKAQDESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQENPRRESIRQSWFAGIGLA  907

Query  1174  SAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
              +Q LT   WALDFWYGG+L+ +G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS 
Sbjct  908   MSQSLTTCTWALDFWYGGRLIEDGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSD  967

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
             AV S+FA+LDR + I        D  G   E+L+G++E   V+F+YP+RP+  I  +F +
Sbjct  968   AVGSVFAVLDRYTSIDPE-----DPEGYEPERLTGRVEFLNVDFSYPTRPDVMIFSDFSI  1022

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
             ++ A  S  +VG SGSGKST++ LIERFYD   G +++DG D+RS+++   R+ +ALVSQ
Sbjct  1023  DIDAAKSTAIVGPSGSGKSTVIGLIERFYDPVKGVVKIDGRDLRSYNLRSLRQHIALVSQ  1082

Query  634   EPVIYSGTIRDNILFGKL--DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSG  461
             EP +++GTIR+NI++G+   +  E+EIIEAA+AANAH FI+SL  GYDT CG+RG QLSG
Sbjct  1083  EPTLFAGTIRENIVYGRASDNIDESEIIEAARAANAHDFITSLTDGYDTYCGDRGGQLSG  1142

Query  460   GQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIK  281
             GQKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+
Sbjct  1143  GQKQRIAIARAVLKNPSLLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIQ  1202

Query  280   NLDSIALVSEGKVVEHGTYSQLKNK  206
             N D+IA++ +GK+VE GT+S L  K
Sbjct  1203  NCDAIAVLDKGKLVERGTHSSLLAK  1227



>ref|XP_004232253.1| PREDICTED: ABC transporter B family member 15-like [Solanum lycopersicum]
Length=1262

 Score =  1177 bits (3045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1230 (52%), Positives = 882/1230 (72%), Gaps = 38/1230 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F +AD +DI LM LG LGAI DG+S   +L+  S L N LG          S+      
Sbjct  21    VFMHADSVDILLMVLGFLGAICDGVSMPVMLIVTSKLMNNLG-------GNDSSDTFTHH  73

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + + +L  V L     V  F+EG+CW++T+ERQ  ++R +YL+A+LRQ+VG+FD   A+T
Sbjct  74    INENALALVYLACGQWVACFLEGFCWTRTAERQASRLRIRYLKAVLRQDVGYFDLHVAST  133

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +++  S+S D+ +IQE +SEKVP+FLM+ + F           W+L+LV +P I+ L+IP
Sbjct  134   ADVIASVSSDSLVIQECISEKVPVFLMNVATFTGSYVVGFLMIWKLALVGFPFIIFLVIP  193

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ +++K   EY KA  IV QA+SS++T+YSF  E   L  YS+ L  T+ LG
Sbjct  194   GLMYGRALMGIARKIRDEYGKAGIIVEQAISSVRTVYSFVGENKTLAEYSNALQGTVDLG  253

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G+ FAIW+F+++YGSR++M+ GE GG ++A G +  +GGLSLG  L
Sbjct  254   LKQGLAKGLAIGSNGIVFAIWSFMSYYGSRMVMYNGEHGGTVFAVGAAIAIGGLSLGSGL  313

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EAS A  R+   I RVPKID ++  G  LD + GE+EFK+++FAYPSRPES++
Sbjct  314   SNLKYFSEASAAGERVVQVIKRVPKIDSDNLEGQTLDNVMGEVEFKHIEFAYPSRPESII  373

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L D +LKV  GKTVALVG SGSGKST +ALLQRFYD   G I +DG+ I+ LQ+KWLR Q
Sbjct  374   LNDFSLKVPTGKTVALVGGSGSGKSTVVALLQRFYDPLGGEILLDGIAIDKLQLKWLRSQ  433

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF T+I+ENI+ GK   SME+V+ AA  +NAH+FI QLPQ Y+T+VGERG 
Sbjct  434   MGLVSQEPALFATTIKENILFGKEDASMEQVIEAAKASNAHNFICQLPQSYDTQVGERGV  493

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+L
Sbjct  494   QMSGGQKQRIAIARAIIKSPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRL  553

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQ--------DQS  2045
             STIRNADLIAVV  G + E GSH EL+E ++G Y  + +LQ+  + +D+        +  
Sbjct  554   STIRNADLIAVVQSGQVKEIGSHDELIEDEDGLYTSLVRLQQTENPSDEISIAPTNRNTV  613

Query  2044  FAPSS-NAGRQSTEKsspavlassplLI---------------ETAQKVPTDHHHQPSPS  1913
             FAPS+ N+G  S  +          ++                + A    T     P PS
Sbjct  614   FAPSNLNSGFTSDHEVQNTSSRRLSIVSRSSSANSAAQSCRFDQNATISNTPEQVFPVPS  673

Query  1912  FSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCL  1733
             F RLL +NL EWK+  +G I AI FG VQP YA  +G MIS +F PSH+E++ + + + L
Sbjct  674   FKRLLAMNLPEWKEATLGCIGAILFGGVQPVYAFAMGSMISVYFLPSHDEIKEKTKIYAL  733

Query  1732  VFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCAR  1553
              F  L   S+ +N+ QHY FA MGE LT+RIR RML K+LTFE  W+D+E NS+GA+C+R
Sbjct  734   CFLGLAFFSLFVNVLQHYNFAAMGEKLTKRIRERMLSKMLTFEIGWYDKEENSTGAVCSR  793

Query  1552  LSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKV  1373
             L+ +A +V+SLV DR++LL+Q  S+VTIA  MGLV+AW+LA VMIAVQPL I+C+Y ++V
Sbjct  794   LAKDANVVRSLVGDRMALLIQTVSAVTIACTMGLVIAWRLAWVMIAVQPLIIVCYYFKRV  853

Query  1372  LLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWL  1193
             LL  ++ K +KAQ  S+++A EAV N R VT+F S +++L +   AQ+ P +E+ ++SW 
Sbjct  854   LLKNMSKKSIKAQEESSKLAAEAVSNLRTVTAFSSQSRILQMLKKAQEGPLRESIRQSWF  913

Query  1192  AGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSD  1013
             AGIG+G++  L    WALDFWYGGKL++ G I +  +F+TF ILVSTG+VIADAG+MT+D
Sbjct  914   AGIGLGTSNSLMTCTWALDFWYGGKLMAEGLIGAQALFQTFMILVSTGRVIADAGTMTND  973

Query  1012  LAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPI  833
             LAK + AV S+FA+LDR S+I        D+ G   +K++G +E+  V+FAYP+RP   I
Sbjct  974   LAKSADAVGSVFAVLDRYSLIEPE-----DSDGYKPKKITGNVELCDVDFAYPARPNVII  1028

Query  832   LREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQ  653
              + F ++++AG S  LVG+SGSGKSTI+ LIERFYD   G +++DG DVRS+ +   R+ 
Sbjct  1029  FKGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPLRGEVKIDGRDVRSYHLRSLRKH  1088

Query  652   MALVSQEPVIYSGTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERG  476
             +ALVSQEP +++GTIR NI +G   +  E+EIIEAAKAANAH FIS+LK GY+T CG+RG
Sbjct  1089  IALVSQEPTLFAGTIRQNIAYGASEEVDESEIIEAAKAANAHDFISALKDGYETWCGDRG  1148

Query  475   VQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHR  296
             +QLSGGQKQRIAIARAI++NP +LLLDEATSALD +SE+VVQ+AL+ +M+GRT++VVAHR
Sbjct  1149  LQLSGGQKQRIAIARAILKNPAVLLLDEATSALDSQSEKVVQDALERVMVGRTSVVVAHR  1208

Query  295   LNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             L+TI+N D+IA++ +GK+VE GT+S L  K
Sbjct  1209  LSTIQNCDTIAVLDKGKIVEKGTHSSLLAK  1238



>emb|CDX85192.1| BnaC07g25030D [Brassica napus]
Length=1269

 Score =  1176 bits (3041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/1254 (51%), Positives = 890/1254 (71%), Gaps = 66/1254 (5%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S  +   
Sbjct  19    SIRSIFMHADGVDWVLMGLGLIGAVGDGFTTPLVLLITSKLMNNLG------GSSFNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K ++  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQSISKNAVALLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+VLSEK+P FLM  S+F+          WRL++V  P IV+
Sbjct  133   VTSTSDVITSVSSDSFVIQDVLSEKLPNFLMSASMFVGSYIVGFILLWRLAIVGLPFIVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  +  +S+ L  +
Sbjct  193   LVIPGLMYGRALISISSKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISNFSAALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I+RVPKID  +  G  L+ +RGE+EFK+VKF YPSRP
Sbjct  313   GGGLSNLKYFFEAASVGERIMEVINRVPKIDSNNPEGQKLEKVRGEVEFKHVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ + +D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFEDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK--  2396
             LR QMGLVSQE ALF TSI+ENI+ GK   +M++VV AA  +NAH FI QLP GYET+  
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDATMDDVVEAAKASNAHTFISQLPNGYETQKC  492

Query  2395  -----------------------VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSA  2285
                                    VGERG  +SGGQKQRIAIARAIIK+P ILLLDEATSA
Sbjct  493   EHSLYSETKNKRKIHAFFFYEKQVGERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSA  552

Query  2284  LDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-N  2108
             LDSESE++VQ+AL+ AS GRTT+++AH+LSTIRNAD+I+VV  G ++E GSH +LME  +
Sbjct  553   LDSESERVVQEALENASIGRTTILIAHRLSTIRNADVISVVRNGHVVETGSHDKLMENID  612

Query  2107  GHYAQMAKLQRQFSCADQDQSFAPSSN---------------AGRQST-EKsspavlass  1976
             G YA + +LQ+      +D S   S N                 R ST  +SS     + 
Sbjct  613   GQYASLVRLQQ---IEKEDSSVNMSVNVQTGPTLDPTKDLRSCSRVSTLSRSSSTNSVTG  669

Query  1975  plLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGM  1796
               +++   KV       P PSF RLL +NL EWKQ L G ISA  FGA+QP YA ++G M
Sbjct  670   SSIVKNLAKV----EKPPLPSFKRLLAMNLPEWKQALYGCISATLFGAIQPVYAFSLGSM  725

Query  1795  ISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKI  1616
             +S +F  SH+E++ + + + L F  L ++S  +N+ QHY FAYMGE+LT+RIR RML K+
Sbjct  726   VSVYFLTSHDEIKEKTRIYALSFVGLAVVSFLINISQHYNFAYMGEYLTKRIRERMLSKV  785

Query  1615  LTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWK  1436
             LTFE  WFD++ NSSG++C+RL+ +A +V+SLV DR++LLVQ  S+VTIA  MGLV+AW+
Sbjct  786   LTFEVGWFDQDENSSGSICSRLAKDANVVRSLVGDRMALLVQTISAVTIACTMGLVIAWR  845

Query  1435  LALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKV  1256
             LALVMIAVQPL I+CFYTR+VLL  ++ K +KAQ+ S+++A EAV N R +T+F S  ++
Sbjct  846   LALVMIAVQPLIIVCFYTRRVLLKNMSKKAIKAQDESSKLAAEAVSNVRTITAFSSQERI  905

Query  1255  LDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFK  1076
             + + + AQ+ PR+E+ ++SW AGIG+  +Q LT   WALDFWYGG+L+ +G I++  +F+
Sbjct  906   MKMLEKAQENPRRESIRQSWFAGIGLAMSQSLTTCTWALDFWYGGRLIEDGYITAKALFE  965

Query  1075  TFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKL  896
             TF ILVSTG+VIADAGSMT+DLAKGS AV S+FA+LDR + I        D  G  LE+L
Sbjct  966   TFMILVSTGRVIADAGSMTTDLAKGSDAVGSVFAVLDRYTSIDPE-----DPEGYELERL  1020

Query  895   SGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDG  716
             +G++E   V+F+YP+RP+  I  +F +++ A  S  +VG SGSGKST++ LIERFYD   
Sbjct  1021  TGRVEFLNVDFSYPTRPDVMIFTDFSIDIDAAKSTAIVGPSGSGKSTVIGLIERFYDPVK  1080

Query  715   GSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFG----KLDaseneiieaa  548
             G +++DG D+RS+++   R+ +ALVSQEP +++GTIR+NI++G    K+D  E+EIIEAA
Sbjct  1081  GVVKIDGRDLRSYNLRSLRQHIALVSQEPTLFAGTIRENIVYGRASDKID--ESEIIEAA  1138

Query  547   kaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVE  368
              AANAH FI+SL  GYDT CG+RGVQLSGGQKQRIAIARA+++NP++LLLDEATSALD +
Sbjct  1139  SAANAHDFITSLTDGYDTYCGDRGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQ  1198

Query  367   SEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D+IA++ +GK+VE GT+S L  K
Sbjct  1199  SERVVQDALERVMVGRTSVVIAHRLSTIQNCDAIAVLDKGKLVERGTHSSLLAK  1252



>dbj|BAJ99881.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1238

 Score =  1172 bits (3031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/1217 (52%), Positives = 894/1217 (73%), Gaps = 19/1217 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS++ +F +AD  D+ LM LG +GAIGDG+ST  +LL  S +FN LG             
Sbjct  14    SSLMSVFMHADAADVALMVLGLVGAIGDGISTPVMLLITSRIFNDLG------SGPDLLQ  67

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
                 ++++ +   V L L   VM F+EGYCWS+T+ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  68    EFSSKIDENARNLVFLALGRWVMAFLEGYCWSRTAERQASRMRARYLAAVLRQDVEYFDL  127

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             +  +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++F      +    WRL++VA P+++
Sbjct  128   KVGSTAEVIASVSNDSLVVQDVLSEKVPNFVMNAAMFFGSYAVALALLWRLTVVALPSVL  187

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG +YG+ L+ L+++  ++Y++   +  QA+SS++T+YSF AER+ +  +S+ L+ 
Sbjct  188   LLIIPGFMYGRILIGLARRIREQYTRPGAVAEQAISSVRTVYSFAAERATMAHFSAALEE  247

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             + +LG+K G+AKG+AVGS G++FAIWAF  WYGSRL+M+ G  GG ++AA  S +LGGL+
Sbjct  248   STRLGIKQGLAKGIAVGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAASASIILGGLA  307

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG  L  VKYF+EAS A  R+ + I RVPKID    +G  L  + GE+EFK V+F YPSR
Sbjct  308   LGSGLSNVKYFSEASAAGERVLAVIRRVPKIDSGSDTGEELANVAGEVEFKKVEFCYPSR  367

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PES +     L+V AG+T ALVG+SGSGKST +ALL+RFYD + G + +DGV+I  L++K
Sbjct  368   PESPIFSSFCLRVPAGRTAALVGSSGSGKSTVVALLERFYDPSGGEVALDGVDIRRLRLK  427

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE ALF TSI ENI+ GK   + EEV AAA  ANAH+FI QLPQGY+T+V
Sbjct  428   WLRAQMGLVSQEPALFATSIMENILFGKEDATPEEVTAAAKAANAHNFISQLPQGYDTQV  487

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V
Sbjct  488   GERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIV  547

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-SFA  2039
             VAH+LSTIRNAD+IAV+  G + E GSH EL+ ++NG Y+ + +LQ+     + D+ S A
Sbjct  548   VAHRLSTIRNADMIAVMQYGEVKELGSHEELIADENGLYSSLVRLQQTRESNEVDEVSGA  607

Query  2038  PSSNAGRQSTEKsspavlassplLI------ETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              S++A  QS+  S     +++          +      ++    P PSF RLL LN  EW
Sbjct  608   GSTSAVGQSSSHSMSRRFSAASRSSSARSLGDAGDADNSEEPKLPLPSFRRLLMLNAPEW  667

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             +Q L+GS+SAI FG +QP YA  +G MIS +F   H+E++ + + + L+F  L +LS  +
Sbjct  668   RQALMGSLSAIVFGGIQPAYAYAMGSMISVYFLTDHDEIKDKTRAYALIFVALAVLSFLI  727

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV
Sbjct  728   NIGQHYNFGAMGEYLTKRIREQMLTKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLV  787

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K ++A
Sbjct  788   GDRMALVIQTVSAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIQA  847

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q+ S+++A EAV N R +T+F S +++L +F+ AQ+ PRKE+ ++SW+AG+G+G++  L 
Sbjct  848   QSESSKLAAEAVSNLRTITAFSSQDRILGLFNQAQNGPRKESIRQSWIAGLGLGTSMSLM  907

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WALDFW+GG+L++   I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ A+AS+F
Sbjct  908   TCTWALDFWFGGRLIAQHHITAKALFQTFMILVSTGRVIADAGSMTTDLAKGADAIASVF  967

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LDR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L +++G 
Sbjct  968   AVLDRVTEI-DPDNPQ----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFSLSIQSGK  1022

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   G +++DG D++++++   R+ + LVSQEP +++
Sbjct  1023  STALVGQSGSGKSTIIGLIERFYDPVRGMVKIDGRDIKTYNLRALRQHIGLVSQEPTLFA  1082

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             GTIR+N+++G   ASE EI  AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAI
Sbjct  1083  GTIRENVVYGTETASEAEIENAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAI  1142

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAI++NP ILLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D I ++
Sbjct  1143  ARAILKNPAILLLDEATSALDSQSEKVVQEALERVMVGRTSVVVAHRLSTIQNCDLITVL  1202

Query  256   SEGKVVEHGTYSQLKNK  206
              +G VVE GT+S L +K
Sbjct  1203  DKGIVVEKGTHSSLMSK  1219



>ref|XP_006647008.1| PREDICTED: LOW QUALITY PROTEIN: putative multidrug resistance 
protein-like [Oryza brachyantha]
Length=1224

 Score =  1170 bits (3027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/1214 (53%), Positives = 884/1214 (73%), Gaps = 27/1214 (2%)
 Frame = -2

Query  3823  IVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLM  3644
             + +F +AD  D+ LM LG LGA+GDG+ST  +LL  S +FN LG G++  Q   S     
Sbjct  8     MAVFMHADATDVALMALGLLGAMGDGVSTPVMLLITSRIFNDLGSGADIVQQFSSKV---  64

Query  3643  REVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
               V   +L F+            EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD ++ 
Sbjct  65    -NVNARNLVFLA----------AEGYCWARTAERQASRMRARYLRAVLRQDVEYFDLKKG  113

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++F           WRL+LVA P++V+LI
Sbjct  114   STAEVITSVSNDSLVVQDVLSEKVPNFVMNAAMFAGSYAVGFALLWRLTLVALPSVVLLI  173

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
             IPG +YG+ L+ ++++  ++Y++      QA+SS++T+Y+F AER+ + R+S+ L+ + +
Sbjct  174   IPGYMYGRILVGVARRIREQYAQPGAFAEQAVSSVRTVYAFAAERATMARFSAALEESAR  233

Query  3103  LGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGM  2924
             LG+K G+AKG+AVGS G++FAIWAF  WYGS L+M+ G+ GG ++A   + V+GGL+LG 
Sbjct  234   LGLKQGLAKGVAVGSNGITFAIWAFNVWYGSHLVMYHGQQGGTVFAVSAAIVVGGLALGS  293

Query  2923  ALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPES  2744
              L  VKYF+EAS AA R+   I RVPKID E  +G  L ++ GE+EF+NV+F YPSRPES
Sbjct  294   GLSNVKYFSEASSAAERVLEVIRRVPKIDSESGAGEELGSVAGEVEFRNVEFCYPSRPES  353

Query  2743  LVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLR  2564
              +    +L+V AG+TVALVG SGSGKST IALL+RFYD  +G + +DGV++  L++KW+R
Sbjct  354   PIFVSFSLRVPAGRTVALVGGSGSGKSTVIALLERFYDPAAGEVTLDGVDLRRLRLKWVR  413

Query  2563  GQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGER  2384
              QMGLVSQE ALF T+IRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+VGER
Sbjct  414   AQMGLVSQEPALFATTIRENILFGKEDATAEEVVAAAKAANAHNFISQLPQGYDTQVGER  473

Query  2383  GALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAH  2204
             G  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V+AH
Sbjct  474   GVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASVGRTTIVIAH  533

Query  2203  KLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQR-QFSCADQDQSFAPSS  2030
             +LSTIRNAD+IAV+  G + E G H EL+  +NG Y+ + +LQ+ + S    +     S+
Sbjct  534   RLSTIRNADIIAVMQSGEVKELGPHDELIANENGLYSSLVRLQQTRDSNGSVEIGVNGST  593

Query  2029  NAGRQSTEKsspavlassplLI------ETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQG  1868
             +A  QS+  S     +++          +      T+    P PSF RLL LN  EWKQ 
Sbjct  594   SAVGQSSSHSMSRRFSAASRSSSARSLGDARDADSTEKPKLPVPSFRRLLMLNAPEWKQA  653

Query  1867  LIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLC  1688
             L+GS SAI FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  +N+ 
Sbjct  654   LMGSFSAIVFGGIQPAYAYAMGSMISVYFLTDHAEIKDKTRTYALIFVGLAVLSFLINIG  713

Query  1687  QHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADR  1508
             QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ EA +V+SLV DR
Sbjct  714   QHYNFGAMGEYLTKRIREQMLSKILTFEVGWFDRDENSSGAICSQLAKEANVVRSLVGDR  773

Query  1507  LSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNS  1328
             ++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K + AQ  
Sbjct  774   MALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIHAQAE  833

Query  1327  STQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMC  1148
             S+++A EAV N R +T+F S  ++L +FD AQD PRKE+ ++SW AG+G+G++  L    
Sbjct  834   SSKLAAEAVSNLRTITAFSSQERILHLFDQAQDGPRKESIRQSWFAGLGLGTSMSLMTCT  893

Query  1147  WALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAIL  968
             WALDFWYGG+L++   I++ ++F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+FA+L
Sbjct  894   WALDFWYGGRLMAEHHINAKELFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVFAVL  953

Query  967   DRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIG  788
             DR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G S  
Sbjct  954   DRETEI-DPDNPQ----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFTLSIQPGKSTA  1008

Query  787   LVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTI  608
             LVG+SGSGKSTI+ LIERFYD   GS+++DG D++ +++   RR + LVSQEP +++GTI
Sbjct  1009  LVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKGYNLRALRRHIGLVSQEPTLFAGTI  1068

Query  607   RDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             R+NI++G   ASE EI +AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAIARA
Sbjct  1069  RENIVYGTETASEAEIEDAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAIARA  1128

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I++NP ILLLDEATSALD +SE+VVQEALD +M+GRT++VVAHRL+TI+N D I ++ +G
Sbjct  1129  ILKNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSVVVAHRLSTIQNCDLITVLEKG  1188

Query  247   KVVEHGTYSQLKNK  206
              VVE GT++ L  K
Sbjct  1189  TVVEKGTHASLMAK  1202


 Score =   325 bits (834),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 203/526 (39%), Positives = 312/526 (59%), Gaps = 6/526 (1%)
 Frame = -2

Query  3634  EKCSLY-FVLLGLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             +K   Y  + +GLAV+  ++   + Y +    E    +IR + L  IL  EVG+FD  E 
Sbjct  691   DKTRTYALIFVGLAVLSFLINIGQHYNFGAMGEYLTKRIREQMLSKILTFEVGWFDRDEN  750

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++K+ ++++ ++ +++ + +   S  L         +WRL+LV      ++I
Sbjct  751   SSGAICSQLAKEANVVRSLVGDRMALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLII  810

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
             +        L  +SKKS    ++++ +  +A+S+++TI +F+++  IL  +    D   K
Sbjct  811   VCFYARRVLLKSMSKKSIHAQAESSKLAAEAVSNLRTITAFSSQERILHLFDQAQDGPRK  870

Query  3103  LGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
               ++     GL +G S  L    WA   WYG RL+     +   ++   +  V  G  + 
Sbjct  871   ESIRQSWFAGLGLGTSMSLMTCTWALDFWYGGRLMAEHHINAKELFQTFMILVSTGRVIA  930

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + + A + +F+ +DR  +ID ++  G   + ++GE++ + V FAYPSRP+
Sbjct  931   DAGSMTTDLAKGADAVASVFAVLDRETEIDPDNPQGYKPEKLKGEVDIRGVDFAYPSRPD  990

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
              ++ K   L ++ GK+ ALVG SGSGKST I L++RFYD   GS+ IDG +I    ++ L
Sbjct  991   VIIFKGFTLSIQPGKSTALVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKGYNLRAL  1050

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R  +GLVSQE  LF  +IRENI+ G    S  E+  AA +ANAHDFI  L  GY+T  GE
Sbjct  1051  RRHIGLVSQEPTLFAGTIRENIVYGTETASEAEIEDAARSANAHDFISNLKDGYDTWCGE  1110

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  LSGGQKQRIAIARAI+KNP ILLLDEATSALDS+SEK+VQ+ALD+   GRT++VVA
Sbjct  1111  RGVQLSGGQKQRIAIARAILKNPAILLLDEATSALDSQSEKVVQEALDRVMVGRTSVVVA  1170

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQR  2075
             H+LSTI+N DLI V+  G ++E+G+H+ LM K  +G Y  +  LQ+
Sbjct  1171  HRLSTIQNCDLITVLEKGTVVEKGTHASLMAKGLSGTYFSLVSLQQ  1216



>gb|KHN34172.1| ABC transporter B family member 15 [Glycine soja]
Length=1231

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1221 (53%), Positives = 876/1221 (72%), Gaps = 35/1221 (3%)
 Frame = -2

Query  3808  YADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMREVEK  3629
             +AD +D FLM  G  GAIGDG+ T  +L   S + N +G       S       +  + +
Sbjct  2     HADGLDWFLMIFGLFGAIGDGIGTPLVLFITSKIMNNIG-----GFSSNIGSTFIHSINE  56

Query  3628  CSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEI  3449
              ++  + L     +  F+EGYCW++T ERQ  ++R +YL+A+LRQEV +FD    +TSE+
Sbjct  57    NAVVLLYLAGGSFIACFLEGYCWTRTGERQAARMRVRYLKAVLRQEVAYFDLHVTSTSEV  116

Query  3448  TNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgli  3269
               S+S D+ +IQ+ LSEKVP FLM+ S+F+     +    WRL++V +P + +L+IPG +
Sbjct  117   ITSVSNDSLVIQDCLSEKVPNFLMNASMFVGSYIVAFALLWRLAIVGFPFVALLVIPGFM  176

Query  3268  ygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKI  3089
             YG+ L+ L+ K  +EY+KA  I  QA+SSI+T+YSF  E   ++ +S  L  +++LG++ 
Sbjct  177   YGRTLMGLASKIREEYNKAGTIAEQAISSIRTVYSFVGESKTIDAFSEALQGSVELGLRQ  236

Query  3088  GIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEV  2909
             G+AKGLA+GS G+ FAIWAF+++YGSRL+M+ G  GG ++A G +  LGGL+LG  L  V
Sbjct  237   GLAKGLAIGSNGVVFAIWAFMSYYGSRLVMYHGAKGGTVFAVGAAIALGGLALGAGLSNV  296

Query  2908  KYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKD  2729
             KYF+EAS A  RI   I RVPKID +  +  +L+ + GE+EF +V F YPSRP+S++L D
Sbjct  297   KYFSEASTAGERIMEVIKRVPKIDSDSMAEEILENVSGEVEFNHVDFVYPSRPDSVILND  356

Query  2728  LNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGL  2549
               LK+ AGKTVALVG SGSGKST I+LLQRFYD   G I +DGV I+ LQ+KWLR QMGL
Sbjct  357   FCLKIPAGKTVALVGGSGSGKSTVISLLQRFYDPIEGEIFLDGVAIHKLQLKWLRSQMGL  416

Query  2548  VSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLS  2369
             VSQE ALF TSI+ENI+ G+   + EEVV AA  +NAH+FI QLPQGY+T+VGERG  +S
Sbjct  417   VSQEPALFATSIKENILFGREDATQEEVVEAAKASNAHNFISQLPQGYDTQVGERGVQMS  476

Query  2368  GGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTI  2189
             GGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++AH+LSTI
Sbjct  477   GGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIIIAHRLSTI  536

Query  2188  RNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS-----SN  2027
             RNA++IAVV  G I+E GSH EL++  NG Y  + +LQ Q     +D  F P+     SN
Sbjct  537   RNANVIAVVQSGKIMEMGSHHELIQNDNGLYTSLVRLQ-QAKNEKEDTLFHPTPPSSISN  595

Query  2026  AGRQSTEKsspavlassplLIETAQKV-----------PTDHHHQPSPSFSRLLGLNLTE  1880
                 +T     +V+ S      +  ++             + +  P PSF RLL LN+ E
Sbjct  596   KDNHNTSSRRLSVVMSRSSSTNSIPRIGGGDNNNIVEEVVEDNKPPLPSFRRLLALNIPE  655

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WKQ  +G ++A+ FGA+QP YA  +G +IS +F P H E++ +   + L F  L + S+ 
Sbjct  656   WKQACLGCLNAVLFGAIQPVYAFAMGSVISVYFLPDHNEIKKKTMIYSLCFLGLAVFSLV  715

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             +N+ QHY FAY+GE+LT+RIR RM  KILTFE  WFD++ NS+GA+C+RL+ EA +V+SL
Sbjct  716   VNILQHYNFAYIGEYLTKRIRERMFSKILTFEVGWFDQDENSTGAVCSRLAKEANVVRSL  775

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             V DR++L+VQ  S+V IA  MGL++AW+LA+VMIAVQP+ I CFYTR+VLL ++++K +K
Sbjct  776   VGDRMALVVQTISAVVIAFTMGLIIAWRLAIVMIAVQPIIIACFYTRRVLLKSMSSKAIK  835

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQ+ S++IAVEAV N R +T+F S +++L + + AQ+ P +E+ ++SW AGIG+  +Q L
Sbjct  836   AQDESSKIAVEAVSNLRTITAFSSQDRILKMLEKAQEGPSRESIRQSWFAGIGLACSQSL  895

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
             TF  WALDFWYGGKLV  G I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AV S+
Sbjct  896   TFCTWALDFWYGGKLVFQGFINAKALFETFMILVSTGRVIADAGSMTNDLAKGADAVGSV  955

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             FAILDR + I  P +   D  G   EKL+GKIE+  V+FAYP+RP   I + F +++ AG
Sbjct  956   FAILDRYTKI-EPDD---DIDGYKPEKLTGKIELHDVHFAYPARPNVMIFQGFSIKIDAG  1011

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
              S  LVG+SGSGKSTI+ LIERFYD   G + +DG D++S+ +   R+ +ALVSQEP ++
Sbjct  1012  RSTALVGQSGSGKSTIIGLIERFYDPLKGIVTIDGRDIKSYHLRSLRKHIALVSQEPTLF  1071

Query  619   SGTIRDNILFG------KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
              GTIR+NI +G      K+D  E EIIEAA+AANAH FI+SLK GYDT CG+RGVQLSGG
Sbjct  1072  GGTIRENIAYGASNNNNKVD--ETEIIEAARAANAHDFIASLKDGYDTSCGDRGVQLSGG  1129

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARAI++NP +LLLDEATSALD +SE++VQ+AL+ +M+GRT++VVAHRL+TI+N
Sbjct  1130  QKQRIAIARAILKNPEVLLLDEATSALDSQSEKLVQDALERVMVGRTSVVVAHRLSTIQN  1189

Query  277   LDSIALVSEGKVVEHGTYSQL  215
              D IA++ +GKVVE GT+S L
Sbjct  1190  CDLIAVLDKGKVVEKGTHSSL  1210


 Score =   313 bits (802),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 197/535 (37%), Positives = 316/535 (59%), Gaps = 12/535 (2%)
 Frame = -2

Query  3640  EVEKCSLYFVL--LGLAV--MVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             E++K ++ + L  LGLAV  +V+  ++ Y ++   E    +IR +    IL  EVG+FD 
Sbjct  694   EIKKKTMIYSLCFLGLAVFSLVVNILQHYNFAYIGEYLTKRIRERMFSKILTFEVGWFDQ  753

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
              E +T  + + ++K+ ++++ ++ +++ + +   S  +         +WRL++V      
Sbjct  754   DENSTGAVCSRLAKEANVVRSLVGDRMALVVQTISAVVIAFTMGLIIAWRLAIVMIAVQP  813

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             I+I         L  +S K+ K   +++ I  +A+S+++TI +F+++  IL+      + 
Sbjct  814   IIIACFYTRRVLLKSMSSKAIKAQDESSKIAVEAVSNLRTITAFSSQDRILKMLEKAQEG  873

Query  3112  TIKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
               +  ++     G+ +  S  L+F  WA   WYG +L+     +   ++   +  V  G 
Sbjct  874   PSRESIRQSWFAGIGLACSQSLTFCTWALDFWYGGKLVFQGFINAKALFETFMILVSTGR  933

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDK-SGMVLDTIRGELEFKNVKFAYP  2759
              +  A        + + A   +F+ +DR  KI+ +D   G   + + G++E  +V FAYP
Sbjct  934   VIADAGSMTNDLAKGADAVGSVFAILDRYTKIEPDDDIDGYKPEKLTGKIELHDVHFAYP  993

Query  2758  SRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQ  2579
             +RP  ++ +  ++K++AG++ ALVG SGSGKST I L++RFYD   G + IDG +I +  
Sbjct  994   ARPNVMIFQGFSIKIDAGRSTALVGQSGSGKSTIIGLIERFYDPLKGIVTIDGRDIKSYH  1053

Query  2578  VKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSME----EVVAAAMTANAHDFIRQLPQ  2411
             ++ LR  + LVSQE  LFG +IRENI  G    + +    E++ AA  ANAHDFI  L  
Sbjct  1054  LRSLRKHIALVSQEPTLFGGTIRENIAYGASNNNNKVDETEIIEAARAANAHDFIASLKD  1113

Query  2410  GYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASA  2231
             GY+T  G+RG  LSGGQKQRIAIARAI+KNP +LLLDEATSALDS+SEKLVQDAL++   
Sbjct  1114  GYDTSCGDRGVQLSGGQKQRIAIARAILKNPEVLLLDEATSALDSQSEKLVQDALERVMV  1173

Query  2230  GRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELME--KNGHYAQMAKLQRQ  2072
             GRT++VVAH+LSTI+N DLIAV+  G ++E+G+HS L+     G Y  +  LQR+
Sbjct  1174  GRTSVVVAHRLSTIQNCDLIAVLDKGKVVEKGTHSSLLAHGPGGAYYSLISLQRR  1228



>gb|KCW56134.1| hypothetical protein EUGRSUZ_I01885 [Eucalyptus grandis]
Length=1233

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1218 (52%), Positives = 871/1218 (72%), Gaps = 19/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SSI  IF +AD +D  LM LG  GA+ DG ST  +L     L N +G     S S +   
Sbjct  8     SSIGSIFMHADGVDRCLMGLGFFGAVADGFSTPIVLYVAGQLLNDIG-----SASSMDPA  62

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             + +  + K +L  + +   ++   F+EGYCW++T ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  63    SFLHSINKKALALLYIACGLLFACFLEGYCWTRTGERQAARVRARYLRAVLRQDVTYFDM  122

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             Q  +TS+I  S+S D+ +IQ+VLSEKVP  L++ S+F+     +    WRL++V +P +V
Sbjct  123   QVTSTSDIVTSVSSDSLVIQDVLSEKVPNLLVNVSLFVGSYIVAFIMLWRLAIVGFPFVV  182

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYG+ LL +++K  +EYSKA  I  QA+SSI+T+Y+F  E   L  +S  L+ 
Sbjct  183   LLIIPGMIYGRTLLIIARKIREEYSKAGTIAEQAVSSIRTVYAFVGESKTLSEFSKALEG  242

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+A+GLA+GS G+ FAIW+F+A+YGSR++M+    GG +Y  G+S  LGG++
Sbjct  243   SVKLGLRQGLARGLAIGSNGIVFAIWSFMAYYGSRMVMYHHYKGGTVYIVGLSVSLGGVA  302

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              G AL  +KYF+EA  A  RI   I RVP ID E+  G  +  ++G ++F++V+FAYPSR
Sbjct  303   CGTALSNLKYFSEACSAGERIEEVIKRVPPIDPENMEGQTIPNLKGNIKFRHVEFAYPSR  362

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PE+++ +D +L + +GKT+ALVG SGSGKST I+LLQRFYD  SG I +DG+ IN LQ+K
Sbjct  363   PENIIFRDFSLTIPSGKTLALVGGSGSGKSTVISLLQRFYDPLSGRILLDGIAINKLQIK  422

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE  LF TSI+ENI+ GK    M++V+ AA  +NAH+FI QLPQGY+T+V
Sbjct  423   WLRSQMGLVSQEPTLFATSIKENILFGKKNAKMKKVIEAAKASNAHNFISQLPQGYDTQV  482

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAIIK P ILLLDEATSALDSESEK VQDAL+QAS GRTT++
Sbjct  483   GERGIQLSGGQKQRIAIARAIIKAPRILLLDEATSALDSESEKTVQDALNQASIGRTTII  542

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAP  2036
             +AH+LSTIR+A+ IAVV  G +IE G+H EL++K +G YA +  LQ+       +Q   P
Sbjct  543   IAHRLSTIRHANSIAVVQNGQVIETGNHEELLQKEDGLYASLVNLQKSEKQKPINQVEKP  602

Query  2035  SS-------NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              +       N    ST         S      +   V +D    P PSF RL+ LN+ EW
Sbjct  603   KNQTLPFILNTDGYSTSSRPSLSRVSHCSSARSMAGVGSDDQKIPIPSFQRLIALNMPEW  662

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ ++G I AI FGAVQP Y+  +G M+S +FS  HEE++A+I+ +   F  L + ++ +
Sbjct  663   KQAILGCIGAILFGAVQPVYSFAMGSMVSLYFSEDHEEIKAKIRIYAFWFLGLAVFTLAV  722

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FA+MGE LT+RIR +ML KILTFE  WFD++ NSSG++C+RL+N+A MV+SLV
Sbjct  723   NVIQHYYFAFMGECLTKRIREKMLSKILTFEVGWFDQDQNSSGSVCSRLANDANMVRSLV  782

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L+VQ  S++ +A  MGL++AW+LALVMIA QPL IL FY R+VLL T++ K +KA
Sbjct  783   GDRMALIVQTCSAIIVAFTMGLIIAWRLALVMIAAQPLVILSFYMRRVLLITMSQKAIKA  842

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A +AV NHR +TSF S  ++L + + A + P +E+ ++SW AGIG+ ++Q  T
Sbjct  843   QEESSKLAADAVSNHRTITSFSSQERILKMLEKAHEAPEQESIQQSWYAGIGLAASQFFT  902

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WAL FWYGGKL+ +G+I+S  +F+TFFIL++TGKVIADAGSMT+D+A GS  V S+F
Sbjct  903   KCTWALYFWYGGKLIFHGQITSSALFETFFILITTGKVIADAGSMTTDIANGSDTVGSVF  962

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             AILDR + I           G    K++G +E  +V+FAYP RP+  IL+ F  +++AG 
Sbjct  963   AILDRQTRIEPE-----GTEGYQPRKITGHVEFCRVDFAYPERPDVIILKGFSFKIEAGK  1017

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKST++ LIERFYD   G +++DG DVRS+ +  +R+ +ALVSQEP +++
Sbjct  1018  STALVGQSGSGKSTLIGLIERFYDPIKGIVKIDGRDVRSYHLRAFRKHIALVSQEPTLFA  1077

Query  616   GTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             GTIR+NI++G   + SE EIIEAA+AANAH FI +LK GYDT CG +G QLSGGQKQR+A
Sbjct  1078  GTIRENIVYGISHEMSETEIIEAARAANAHDFIVALKDGYDTWCGNKGAQLSGGQKQRVA  1137

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNPT+LLLDEATSALD +SE+VVQ AL+ +M+GRTT+VVAHRL+TI+  D IA+
Sbjct  1138  IARAILRNPTLLLLDEATSALDSQSEKVVQSALERLMVGRTTLVVAHRLSTIQRCDVIAV  1197

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +GKV+E G++S L  K
Sbjct  1198  LDKGKVMEKGSHSSLLAK  1215



>ref|XP_009129375.1| PREDICTED: ABC transporter B family member 15-like isoform X1 
[Brassica rapa]
 emb|CDY47241.1| BnaA02g29270D [Brassica napus]
Length=1244

 Score =  1168 bits (3022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/1221 (52%), Positives = 882/1221 (72%), Gaps = 31/1221 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S ++   
Sbjct  19    SVRSIFMHADCVDWLLMGLGFIGAVGDGFTTPLVLLITSKLMNNLG------GSYLNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K S+  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQNISKNSVILLYVACGSWVVCFLEGYCWTRTGERQTARMRKKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ LIQ+VLSEK+P FL+  S F+          W+L+LV  P +V+
Sbjct  133   ATSTSDVITSVSSDSFLIQDVLSEKLPNFLVSASTFIGSYIVGFILLWKLALVGLPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGQALISISTKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I++VPKID ++  G  L+ I+GE+EFK+VKF YPSRP
Sbjct  313   GGGLSNLKYFFEAASVGERIIEVINKVPKIDSDNPEGQKLENIKGEVEFKHVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L+V +GKTVALVG SGSGKST I+LLQRFY+  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYNPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             +R QMGLVSQE ALF TSI+ENI+ GK   S+++VV AA  +NAH+FI +LP GYET+VG
Sbjct  433   VRSQMGLVSQEPALFATSIKENILFGKEDASLDDVVEAAKASNAHNFISELPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+AL+ AS GRTT+++
Sbjct  493   ERGVKMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFA--  2039
             AH+LSTIRNAD+I+VV  G ++E GSH ELME  +G YA + +LQ Q    D D + +  
Sbjct  553   AHRLSTIRNADIISVVQNGHVVETGSHDELMENLDGQYASLVRLQ-QIEKNDSDVNMSVN  611

Query  2038  --------PSSN-AGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNL  1886
                     PS +   R      S +  A+S   + T + +  D    P PSF RL  +NL
Sbjct  612   VLMGPVSDPSKDLRSRSRVSTLSRSSSANSISGLHTLKNLSGD-DKPPLPSFKRLFAMNL  670

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWKQ L G +SA  FGA+QP YA ++G M+S +F  SH+E++ +   + L F  L +LS
Sbjct  671   PEWKQALYGCVSATLFGAIQPAYAYSLGSMVSVYFLKSHDEIKEKTMIYALSFVGLAVLS  730

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
             + +N+ QHY FA MGE+LT+RIR RML K+LTFE  WFD + NSSGA+C+RL+ +A +V+
Sbjct  731   LLINISQHYNFACMGEYLTKRIRERMLSKVLTFEVGWFDRDENSSGAICSRLAKDANVVR  790

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLV DR++LLVQ  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR VLL  ++ K 
Sbjct  791   SLVGDRMALLVQTISAVTIACTMGLVIAWRLALVMIAVQPVIIVCFYTRLVLLKNMSKKA  850

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             +K Q+ S+++A EAV N R +T+F S  +++++ + AQ+ PR+E+ ++SW AGIG+  +Q
Sbjct  851   IKTQDESSKLAAEAVSNVRTITAFSSQERIMNMLEKAQETPRRESIRQSWFAGIGLAMSQ  910

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              LT   WALDFWYGGKL+  G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV 
Sbjct  911   SLTSCTWALDFWYGGKLIDGGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVG  970

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+FA+LDR + I        D  G   E+++G++E   V+F+YP+RP+  I   F + + 
Sbjct  971   SVFAVLDRYTSIDPE-----DPDGYEPERITGRVEFLNVDFSYPTRPDVTIFSGFSINID  1025

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             A  S  +VG SGSGKST++ LIERFYD   G +R+DG D+R++++   R+ +ALVSQEP 
Sbjct  1026  AAKSTAIVGPSGSGKSTVIGLIERFYDPVNGVVRIDGRDLRTYNLRALRQHIALVSQEPT  1085

Query  625   IYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             +++GTIR+NI++G    K+D  E EIIEAA+AANAH FI++L  GYDT CG RGVQLSGG
Sbjct  1086  LFAGTIRENIIYGRASDKID--EAEIIEAARAANAHDFITALSDGYDTYCGNRGVQLSGG  1143

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N
Sbjct  1144  QKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSIVIAHRLSTIQN  1203

Query  277   LDSIALVSEGKVVEHGTYSQL  215
              D IA++ +GK+VE GT+S L
Sbjct  1204  CDMIAVLEKGKLVERGTHSSL  1224


 Score =   299 bits (765),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 202/540 (37%), Positives = 310/540 (57%), Gaps = 25/540 (5%)
 Frame = -2

Query  3634  EKCSLY---FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y   FV L +  +++   + Y ++   E    +IR + L  +L  EVG+FD  E 
Sbjct  714   EKTMIYALSFVGLAVLSLLINISQHYNFACMGEYLTKRIRERMLSKVLTFEVGWFDRDEN  773

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++KD ++++ ++ +++ + +   S            +WRL+LV      ++I
Sbjct  774   SSGAICSRLAKDANVVRSLVGDRMALLVQTISAVTIACTMGLVIAWRLALVMIAVQPVII  833

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSI---LERYSSILDR  3113
             +        L  +SKK+ K   +++ +  +A+S+++TI +F+++  I   LE+      R
Sbjct  834   VCFYTRLVLLKNMSKKAIKTQDESSKLAAEAVSNVRTITAFSSQERIMNMLEKAQETPRR  893

Query  3112  -TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              +I+     GI  GLA+ S  L+   WA   WYG +LI      GG I A  +      L
Sbjct  894   ESIRQSWFAGI--GLAM-SQSLTSCTWALDFWYGGKLI-----DGGYITAKALFETFMIL  945

Query  2935  -SLGMALPEVKYFT----EASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVK  2771
              S G  + +    T    + S A   +F+ +DR   ID ED  G   + I G +EF NV 
Sbjct  946   VSTGRVIADAGSMTTDLAKGSDAVGSVFAVLDRYTSIDPEDPDGYEPERITGRVEFLNVD  1005

Query  2770  FAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEI  2591
             F+YP+RP+  +    ++ ++A K+ A+VG SGSGKST I L++RFYD  +G + IDG ++
Sbjct  1006  FSYPTRPDVTIFSGFSINIDAAKSTAIVGPSGSGKSTVIGLIERFYDPVNGVVRIDGRDL  1065

Query  2590  NALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTA--NAHDFIRQL  2417
                 ++ LR  + LVSQE  LF  +IRENI+ G+    ++E          NAHDFI  L
Sbjct  1066  RTYNLRALRQHIALVSQEPTLFAGTIRENIIYGRASDKIDEAEIIEAARAANAHDFITAL  1125

Query  2416  PQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQA  2237
               GY+T  G RG  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE++VQDAL++ 
Sbjct  1126  SDGYDTYCGNRGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERV  1185

Query  2236  SAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSEL--MEKNGHYAQMAKLQRQFSC  2063
               GRT++V+AH+LSTI+N D+IAV+  G ++E+G+HS L  M   G Y  +  LQR  SC
Sbjct  1186  MVGRTSIVIAHRLSTIQNCDMIAVLEKGKLVERGTHSSLLAMGPTGVYYSLVSLQRT-SC  1244



>gb|EEE56475.1| hypothetical protein OsJ_05694 [Oryza sativa Japonica Group]
Length=1243

 Score =  1166 bits (3017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1216 (52%), Positives = 873/1216 (72%), Gaps = 19/1216 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S + +F +AD +D+ LM LG LGA+GDG+S   LLL    ++N  G          +   
Sbjct  17    SFMTVFMHADAVDVVLMVLGLLGAVGDGLSMPVLLLITGSVYNNFG------GGADNVQE  70

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                +V   +   + L     VM F+EGYCW++T+ERQ  ++R +YL+A+LRQ+V +FD +
Sbjct  71    FSSKVNMNARNLLFLAAGQWVMTFLEGYCWTRTAERQASRMRARYLQAVLRQDVEYFDLK  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + +T+E+  S++ D+ ++Q+VLSEKVP F+M+ ++F+    F      +L LVA P++V+
Sbjct  131   KGSTAEVITSVANDSLVVQDVLSEKVPNFVMNAAMFVGNYAFGFALMRQLMLVALPSVVL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             LIIP  +YG+ ++ L+++  ++Y++   I  QA+SS++T+YSF AER+ + ++S+ L+ +
Sbjct  191   LIIPTFMYGRVVVDLARRIREQYTRPGAIAEQAMSSVRTVYSFVAERTTMAQFSAALEES  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             ++LG+K G+AKG+A+GS G++FAI AF  WYGSRL+M  G  GG ++    + + GGL+L
Sbjct  251   VRLGLKQGLAKGVAIGSNGITFAILAFNVWYGSRLVMSHGYKGGTVFVVSYAVIQGGLAL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKY +EAS AA RI   I RVPKID E  +G  L  + GE+EF+NVKF YPSRP
Sbjct  311   GSVLSNVKYLSEASSAAERILEVIRRVPKIDSESDTGEELGNVAGEVEFRNVKFCYPSRP  370

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES +    NL+V AG+TVALVG SGSGKST IALL+RFYD ++G + +DGV+I  L++KW
Sbjct  371   ESPIFVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPSAGEVMVDGVDIRRLRLKW  430

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSIRENI+ GK   + EEV+AAA  ANAH FI QLPQGY+T+VG
Sbjct  431   LRAQMGLVSQEPALFATSIRENILFGKEDATAEEVIAAAKAANAHSFISQLPQGYDTQVG  490

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE +VQ+ALD AS GRTT+V+
Sbjct  491   ERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESESVVQEALDLASMGRTTIVI  550

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ--SFA  2039
             AH+LSTIRNAD+IAV+  G + E GSH EL+  +NG Y+ + +LQ+     + D+     
Sbjct  551   AHRLSTIRNADIIAVMQSGEVKELGSHDELIANENGLYSSLVRLQQTRDSNEIDEIGVIG  610

Query  2038  PSSNAGRQSTEKsspavlassplLI-----ETAQKVPTDHHHQPSPSFSRLLGLNLTEWK  1874
              +S  G+ S+   S    A+S         +      T+    P PSF RLL LN  EWK
Sbjct  611   STSALGQSSSHSMSRRFSAASRSSSVRSLGDARDADNTEKPKLPVPSFRRLLMLNAPEWK  670

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q LIGS  A+ FG +QP +A  +G MIS +F   H E++ + + + L+F  L +LS  +N
Sbjct  671   QALIGSFGAVVFGGIQPAFAYAMGSMISVYFLTDHAEIKDKTRTYALIFVGLAVLSFLIN  730

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV 
Sbjct  731   IGQHYNFGAMGEYLTKRIREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLVG  790

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K + AQ
Sbjct  791   DRMALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIHAQ  850

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
               S+++A EAV N R +T+F S  ++L +FD +QD PRKE+ ++SW AG+G+G+A  L  
Sbjct  851   AESSKLAAEAVSNLRTITAFSSQERILRLFDQSQDGPRKESIRQSWFAGLGLGTAMSLMA  910

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               W + FWY G+L++  +I++ ++F+TF IL STG+VIA+AGSMT+DLAKG+ AVAS+FA
Sbjct  911   CSWTIGFWYSGRLMAEHQITAKEIFQTFIILASTGRVIAEAGSMTTDLAKGADAVASVFA  970

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             +LDR + I  P N +    G   EKL G+++I++V+FAYPSRP+  I + F L ++ G S
Sbjct  971   VLDRETEI-DPDNPQ----GYKPEKLKGEVDIRRVDFAYPSRPDVIIFKGFTLSIQPGKS  1025

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ LIERFYD   GS+++DG D+++++    RR + LVSQEP +++G
Sbjct  1026  TALVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKAYNPRALRRHIGLVSQEPTLFAG  1085

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TIR+NI++G   ASE EI +AA++ANAH FIS+LK GY T CGERGVQLSGGQKQRIAIA
Sbjct  1086  TIRENIVYGTETASEAEIEDAARSANAHDFISNLKDGYGTWCGERGVQLSGGQKQRIAIA  1145

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP ILLLDEATSALD +SE+VVQEALD +MI RT++VVAHRL+TI+N D I ++ 
Sbjct  1146  RAILKNPAILLLDEATSALDSQSEKVVQEALDRVMIDRTSVVVAHRLSTIQNCDLITVLE  1205

Query  253   EGKVVEHGTYSQLKNK  206
             +G VVE GT++ L  K
Sbjct  1206  KGIVVEKGTHASLMAK  1221



>ref|XP_006431030.1| hypothetical protein CICLE_v10010936mg [Citrus clementina]
 gb|ESR44270.1| hypothetical protein CICLE_v10010936mg [Citrus clementina]
Length=1222

 Score =  1163 bits (3008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1213 (52%), Positives = 854/1213 (70%), Gaps = 64/1213 (5%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+FLM LG +GAIGDG ST  +L                             
Sbjct  24    IFMHADGVDMFLMVLGYIGAIGDGFSTPLVLF----------------------------  55

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
                                  +GYCW++T ERQ  ++R +YL+A+LRQ+VG+FD    +T
Sbjct  56    -------------------LTKGYCWTRTGERQATRMRARYLKAVLRQDVGYFDLHVTST  96

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             +E+  S+S D+ +IQ+ +SEK+P F+M+ S+F      +    WRL++V +P +V+L+IP
Sbjct  97    AEVITSVSNDSLVIQDAISEKLPNFVMNASLFFGCYLVAFLMLWRLAIVGFPFVVLLVIP  156

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ L++K   EY+KA  I  QA+SSI+T+Y+F  E   +  +SS L  +++LG
Sbjct  157   GLMYGRTLMSLARKMRDEYNKAGTIAEQAISSIRTVYAFVGESKTINEFSSALQGSVQLG  216

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G++F IW+F+ +YGSR++M+ G  GG ++A G S  +GGL+LG  L
Sbjct  217   LKQGLAKGLAIGSNGVTFGIWSFMCYYGSRMVMYHGAQGGTVFAVGASIAVGGLALGAGL  276

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
             P +KYF+EA  A  RI   I RVPKID +   G +L+ + GE+EFK V+FAYPSRPES++
Sbjct  277   PNLKYFSEAMAAGERIMEVIKRVPKIDSDSVEGEILENVLGEVEFKRVQFAYPSRPESII  336

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD  L + AGKTVALVG SGSGKST IALLQRFY    G I +DGV I+ LQ+KWLR Q
Sbjct  337   FKDFCLTIPAGKTVALVGGSGSGKSTVIALLQRFYAPLGGEIILDGVSIDKLQLKWLRSQ  396

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI+ENI+ GK   SMEEV+ AA  +NAH+FIRQLPQ Y+T+VGERG 
Sbjct  397   MGLVSQEPALFATSIKENILFGKEDASMEEVIEAAKASNAHNFIRQLPQQYDTQVGERGV  456

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A  GRTT+++AH+L
Sbjct  457   QMSGGQKQRIAIARAIIKAPRILLLDEATSALDSESERVVQEALDKAVVGRTTIIIAHRL  516

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSF----APS  2033
             STIRNAD+IAVV  G ++E GSH EL++ ++G Y  + +LQ      + + +     + S
Sbjct  517   STIRNADVIAVVQDGQVMETGSHDELIQVESGLYTSLVRLQTTTPDDNNNATMHSLASKS  576

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQ------PSPSFSRLLGLNLTEWKQ  1871
             SN    +T     ++++ S      AQ       ++      P PSF RL+ LN  EWKQ
Sbjct  577   SNMDMNNTSSRRLSIVSLSSSANSFAQGRGASQSNEEDIKKLPVPSFRRLVALNAPEWKQ  636

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
               +G + A  FGAVQP YA  +G MIS +F   H+E++ +   +   F  L + ++ +N+
Sbjct  637   ATLGCVGATLFGAVQPIYAFAMGSMISVYFLTDHDEIKKKTSIYAFCFLGLAVFTLVINI  696

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGEHLT+RIR RML KILTFE  WFD++ NSSGA+C+RL+ +A +V+SLV D
Sbjct  697   IQHYNFAYMGEHLTKRIRERMLSKILTFEVGWFDQDENSSGAICSRLAKDANVVRSLVGD  756

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R +LLVQ  S+VTIA  MGL +AW+LALVMIAVQPL I+CFY R+VLL +++ K +KAQ 
Sbjct  757   RTALLVQTISAVTIAFTMGLFIAWRLALVMIAVQPLVIICFYARRVLLRSMSNKAIKAQA  816

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              S+++A EAV N R +T+F S +++L + + AQ  PR+E+ ++SW AGIG+  +Q L   
Sbjct  817   ESSKLAAEAVSNLRTITAFSSQHRILKMLEKAQQGPRRESIRQSWYAGIGLAFSQSLASC  876

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WALDFWYGG+L+++G ISS  +F+TF ILVSTG+VIADAGSMT+D+AKGS AV S+FA+
Sbjct  877   TWALDFWYGGRLIADGYISSKALFETFMILVSTGRVIADAGSMTTDIAKGSDAVGSVFAV  936

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             +DR + I        D  G   E+++G IE++ V+FAYP+RP+  I   F ++++AG S 
Sbjct  937   MDRYTKIEPE-----DPEGHQPERITGNIELQNVHFAYPARPDVMIFEGFSIKIEAGKST  991

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
              LVG+SGSGKSTI+ LIERFYD   G +++D  D+RS+ +   RR +ALVSQEP +++GT
Sbjct  992   ALVGQSGSGKSTIIGLIERFYDPLKGDVKIDDRDIRSYHLRSLRRHIALVSQEPTLFAGT  1051

Query  610   IRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             IR+NI +G  D   E+EI+EAAKAANAH FI+ L +GYDT CG+RG+QLSGGQKQRIAIA
Sbjct  1052  IRENIAYGASDEIDESEIVEAAKAANAHDFIAGLNEGYDTWCGDRGLQLSGGQKQRIAIA  1111

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP +LLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI+N D IA++ 
Sbjct  1112  RAILKNPAVLLLDEATSALDSQSEKVVQEALERLMVGRTSVVVAHRLSTIQNSDIIAVLD  1171

Query  253   EGKVVEHGTYSQL  215
             +G V E GT+  L
Sbjct  1172  KGHVAEKGTHQSL  1184


 Score =   320 bits (820),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 213/545 (39%), Positives = 319/545 (59%), Gaps = 15/545 (3%)
 Frame = -2

Query  3634  EKCSLY-FVLLGLAV--MVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             +K S+Y F  LGLAV  +V+  ++ Y ++   E    +IR + L  IL  EVG+FD  E 
Sbjct  675   KKTSIYAFCFLGLAVFTLVINIIQHYNFAYMGEHLTKRIRERMLSKILTFEVGWFDQDEN  734

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++KD ++++ ++ ++  + +   S          + +WRL+LV      ++I
Sbjct  735   SSGAICSRLAKDANVVRSLVGDRTALLVQTISAVTIAFTMGLFIAWRLALVMIAVQPLVI  794

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD----  3116
             I        L  +S K+ K  ++++ +  +A+S+++TI +F+++  IL+           
Sbjct  795   ICFYARRVLLRSMSNKAIKAQAESSKLAAEAVSNLRTITAFSSQHRILKMLEKAQQGPRR  854

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              +I+     GI  GLA  S  L+   WA   WYG RLI     S   ++   +  V  G 
Sbjct  855   ESIRQSWYAGI--GLAF-SQSLASCTWALDFWYGGRLIADGYISSKALFETFMILVSTGR  911

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
              +  A        + S A   +F+ +DR  KI+ ED  G   + I G +E +NV FAYP+
Sbjct  912   VIADAGSMTTDIAKGSDAVGSVFAVMDRYTKIEPEDPEGHQPERITGNIELQNVHFAYPA  971

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+ ++ +  ++K+EAGK+ ALVG SGSGKST I L++RFYD   G + ID  +I +  +
Sbjct  972   RPDVMIFEGFSIKIEAGKSTALVGQSGSGKSTIIGLIERFYDPLKGDVKIDDRDIRSYHL  1031

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSME-EVVAAAMTANAHDFIRQLPQGYET  2399
             + LR  + LVSQE  LF  +IRENI  G      E E+V AA  ANAHDFI  L +GY+T
Sbjct  1032  RSLRRHIALVSQEPTLFAGTIRENIAYGASDEIDESEIVEAAKAANAHDFIAGLNEGYDT  1091

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               G+RG  LSGGQKQRIAIARAI+KNP +LLLDEATSALDS+SEK+VQ+AL++   GRT+
Sbjct  1092  WCGDRGLQLSGGQKQRIAIARAILKNPAVLLLDEATSALDSQSEKVVQEALERLMVGRTS  1151

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSEL--MEKNGHYAQMAKLQR--QFSCADQD  2051
             +VVAH+LSTI+N+D+IAV+  G + E+G+H  L  M   G Y  +  LQR  Q +    +
Sbjct  1152  VVVAHRLSTIQNSDIIAVLDKGHVAEKGTHQSLLAMGPTGAYYSLVSLQRTPQNTTHAAN  1211

Query  2050  QSFAP  2036
             +  AP
Sbjct  1212  KVLAP  1216



>ref|XP_010029251.1| PREDICTED: ABC transporter B family member 15-like [Eucalyptus 
grandis]
 gb|KCW56137.1| hypothetical protein EUGRSUZ_I01888 [Eucalyptus grandis]
Length=1254

 Score =  1159 bits (2999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/1240 (51%), Positives = 879/1240 (71%), Gaps = 19/1240 (2%)
 Frame = -2

Query  3898  GNIMSSSLSQNKMegeegkkgKSSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLY  3719
             GN   S++++ K   ++ KKG SSI  IF +AD +D  LM LG  G I DG ST  +L  
Sbjct  2     GNERQSNVAEEKKMKKKKKKGWSSIGSIFMHADGVDKCLMGLGFFGTIADGFSTPLVLFV  61

Query  3718  VSHLFNTLGYgsnnsqsqisngNLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQ  3539
              S L N +G     S S +   +    + K +L  + +   +    F+EGYCW++T ERQ
Sbjct  62    TSQLMNNIG-----SASSMDPASFRHSMNKNALVLLYIACGLSFACFLEGYCWTRTGERQ  116

Query  3538  VLKIRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFL  3359
               ++R +YL A+LRQ+V +FD    +TS+I  S+S D+ +IQ+VLSEKVP FL++ S+F+
Sbjct  117   AARMRARYLRAVLRQDVTYFDMHVTSTSDIVTSVSSDSLVIQDVLSEKVPNFLVNISLFV  176

Query  3358  SGLGFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKANGIVGQALSSI  3179
                  +    WRL++V +P +  LIIPG+IYG+ L+ +++K  +EYSKA  I  QA+SSI
Sbjct  177   GSYIAAFVMLWRLAIVGFPFVTFLIIPGMIYGRTLITIARKIREEYSKAGTIAEQAVSSI  236

Query  3178  KTIYSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIM  2999
             +T+Y+F  E   L  +S  L+ ++KLG++ G+AKGLA+GS  + FAIW+F+A+YGSR++M
Sbjct  237   RTVYAFIGEGKTLSEFSKALEGSVKLGLRQGLAKGLAIGSNSIVFAIWSFMAYYGSRMVM  296

Query  2998  HKGESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSG  2819
             + G  GG +YA G++   GG++LG AL  +KYF+EA  A  RI   I RVP ID E+  G
Sbjct  297   YHGYKGGTVYAVGVAITFGGVALGTALSNLKYFSEACSAGERIEEVIKRVPPIDPENMEG  356

Query  2818  MVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQR  2639
               +  + G L+F++++FAYPSRPE+++ +D +L + +GKT+ALVG SGSGKST I+LLQR
Sbjct  357   ETIPNLEGNLKFRHIEFAYPSRPENIIFRDFSLTIPSGKTLALVGGSGSGKSTVISLLQR  416

Query  2638  FYDANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVA  2459
             FYD  SG I +DG+ IN LQ+KWLR QMGLVSQE  LF TSI+ENI+ GK    M+EV+ 
Sbjct  417   FYDPLSGQILLDGIAINKLQIKWLRSQMGLVSQEPTLFATSIKENILFGKENAEMKEVIE  476

Query  2458  AAMTANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALD  2279
             AA  +NAH+FI QLPQGY+T+VGERG  LSGGQKQRIAIARAIIK P ILLLDEATSALD
Sbjct  477   AAKASNAHNFISQLPQGYDTQVGERGIQLSGGQKQRIAIARAIIKAPRILLLDEATSALD  536

Query  2278  SESEKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGH  2102
             SESEK+VQDALD+AS GRTT+++AH+LST+R+A+ IAV+  G +IE G+H EL++ ++G 
Sbjct  537   SESEKIVQDALDRASIGRTTIIIAHRLSTVRHANNIAVIQNGQVIETGNHEELIQNEDGL  596

Query  2101  YAQMAKLQRQFSCADQDQSFAPSSNAGRQ-------STEKsspavlassplLIETAQKVP  1943
             Y  +  LQ+       DQ   P +            ST         S      +   V 
Sbjct  597   YTSLVNLQKSEKQKPTDQVEKPENQITSSILSMDGYSTSGRLSLSKVSRSSSARSMAAVS  656

Query  1942  TDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEE  1763
              D    P PSF RL+ LN+ EWKQ  +G I A+ +GAVQP YA  +G MIS +F   HEE
Sbjct  657   LDDQKIPIPSFRRLIALNMPEWKQATLGCIGAVLYGAVQPVYAFAMGSMISVYFLKDHEE  716

Query  1762  MQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEE  1583
             ++A+++ +   F  L + S+ +N+ QHY FA+MGE+LT+R+R +ML KILTFE  WFD++
Sbjct  717   IKAKVKIYAFCFLGLAVFSLAVNVIQHYNFAFMGEYLTKRVREKMLSKILTFEVGWFDQD  776

Query  1582  HNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPL  1403
              NSSG++C+RL+N+A +V+SLV DR++L+VQ  S++ IA  MGL++AW+LALV+IA QPL
Sbjct  777   QNSSGSVCSRLANDANVVRSLVGDRMALIVQTCSAIIIAFTMGLIIAWRLALVVIAAQPL  836

Query  1402  TILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEP  1223
              I+ FY R+VLL T++ K +KAQ  S+++A +AV NHR +TSF S  ++L + +  Q+ P
Sbjct  837   IIVSFYMRRVLLKTMSQKAIKAQEESSKLAADAVSNHRTITSFSSQERILKMLEKVQEAP  896

Query  1222  RKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKV  1043
              +E+ ++SW AGIG+ ++Q      WALDFWYGGKL+S G+I+S  +F+TF IL+STGKV
Sbjct  897   ERESIRQSWYAGIGLAASQFFMMCVWALDFWYGGKLISQGQITSNALFETFMILISTGKV  956

Query  1042  IADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNF  863
             IADAGSMT+DLAKGS  V S+F ILDR + I  P   +    G   +K++G +E  +V+F
Sbjct  957   IADAGSMTTDLAKGSDTVGSVFDILDRQTRI-EPEGME----GYRPKKITGHVEFCRVDF  1011

Query  862   AYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVR  683
             AYP R +  IL++F  +++ G S  LVG+SGSGKST++ LIERFYD   G++++DG D+R
Sbjct  1012  AYPERLDVIILKDFSFKIEVGKSTALVGQSGSGKSTLICLIERFYDPIRGTVKIDGRDLR  1071

Query  682   SFDIGWYRRQMALVSQEPVIYSGTIRDNILFG-KLDaseneiieaakaanAHQFISSLKK  506
             S+ +   R+ +ALVSQEP +++GTIR+NI++G   + SE EI+EA +AANAH FI +LK 
Sbjct  1072  SYHLRALRKHIALVSQEPTLFAGTIRENIVYGISREMSETEIVEATRAANAHDFIVTLKD  1131

Query  505   GYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMI  326
             GY+T CG++GVQLSGGQKQR+AIARAI+RNPT+LLLDEATSALD +SE+VVQ AL+ +M+
Sbjct  1132  GYNTWCGDKGVQLSGGQKQRVAIARAILRNPTLLLLDEATSALDSQSEKVVQNALERLMV  1191

Query  325   GRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             GRTT+VVAHRL+TI+  D IA++ +GKVVE G++S L  K
Sbjct  1192  GRTTLVVAHRLSTIQRCDVIAVLDKGKVVERGSHSSLLAK  1231



>ref|XP_010029252.1| PREDICTED: ABC transporter B family member 15-like [Eucalyptus 
grandis]
Length=1229

 Score =  1157 bits (2994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/1214 (52%), Positives = 878/1214 (72%), Gaps = 21/1214 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF++AD  D +LM LG +GA+GDG+ST  +LL  S L N +G     +   +  G   R 
Sbjct  11    IFKHADAADRWLMALGLIGAVGDGISTPFVLLLSSRLMNNIG-----NAPSLGEGQFPRV  65

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +++ +L  V +   +    F+EGYCW++T ERQ  ++R  YL A+LRQ+VG+FD    +T
Sbjct  66    IDEDALSLVYMACGLFFAAFLEGYCWTRTGERQASRMRSMYLRAVLRQDVGYFDLNVTST  125

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  SIS DT +IQ+ LS KVP F+++TS FL     +    WRL+LV++P +V+L+IP
Sbjct  126   SEVVTSISNDTIVIQDALSVKVPSFVVNTSTFLGSYIAALLLQWRLALVSFPFVVLLVIP  185

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L+++  +EY KA  I  Q +SSI+T+Y+F  E      +S  L+ +++LG
Sbjct  186   GLIYGRTLMGLARRVREEYDKAGTIAEQVISSIRTVYAFVGESKTKSDFSGALEGSVRLG  245

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G+ + IWAF+A+Y SR++M+ G  GG +YA G    +GGL+ G  L
Sbjct  246   LKQGLAKGLAIGSNGVVYGIWAFMAYYSSRMVMYHGAEGGTVYAVGAGLAVGGLAFGTGL  305

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF EA  A  RI   IDRVPKID  +  G +++ + GE+EFK+V+FAYPSRP ++V
Sbjct  306   SNLKYFAEAISAVERITEVIDRVPKIDTNNLEGRIVEKVSGEIEFKHVEFAYPSRP-NIV  364

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD  L++ AGK++ALVG SGSGKST I+LLQRFYD  +G I +DGV I+ LQ+KWLR Q
Sbjct  365   FKDFCLRIPAGKSIALVGGSGSGKSTVISLLQRFYDPLNGEILLDGVPIDKLQLKWLRSQ  424

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE  LF T+I+ENI+ GK   +MEEVV AA  +NAH+FI Q+PQGY+T+VGERG 
Sbjct  425   MGLVSQEPTLFATTIKENILFGKEDATMEEVVEAAKASNAHNFISQMPQGYDTQVGERGI  484

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALD ESE++VQ+AL++   GRTT++VAH+L
Sbjct  485   QMSGGQKQRIAIARAIIKSPRILLLDEATSALDLESERIVQEALEKVVVGRTTIIVAHRL  544

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQD--QSFAP-SS  2030
             STI+NAD+IAVV  G ++E GSH EL+  K G Y+ +  LQ+  S   QD  Q  +P S 
Sbjct  545   STIQNADVIAVVQNGQVMESGSHQELIRFKGGIYSSLVHLQQMESKKTQDEAQVISPRSP  604

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFS-----RLLGLNLTEWKQGL  1865
             ++ +  + +   A +  S    E+AQ +    + +    F      RLL  +  EWKQ  
Sbjct  605   SSAKIDSTRDPTASIFGSANNAESAQMLTERRNTREGLRFQTSMLRRLLSFSRPEWKQVA  664

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
             +  +SA+  GA+QP +A  +G MIS FF   H+E++ + + + L FA   ++S+ +N  Q
Sbjct  665   LACVSAVLGGAIQPVFAFMLGSMISVFFLTDHDEIKEKTRTYTLCFAGFFMISLLINTSQ  724

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FAY GE+LT+RIR  ML KILTFE  WFD++ NSSGA+C+RL+ +  +V+SLV D++
Sbjct  725   HYNFAYAGEYLTKRIREMMLAKILTFEVGWFDQDKNSSGAVCSRLAKDTNVVRSLVGDQM  784

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SLLVQA S+VTIA +MGLV+AW+LA+VMIA++PL ILCFY RK LL  ++ K ++AQN  
Sbjct  785   SLLVQAISAVTIACIMGLVIAWRLAIVMIAIEPLIILCFYGRKTLLKGMSQKAIEAQNEC  844

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             +++A EAV +HR++T+F S  K+L +   AQ+ P +E++++SW AG+G+G++Q LT    
Sbjct  845   SKLAAEAVSSHRMITAFSSQEKILKMLKKAQEGPWRESKRQSWFAGVGLGASQSLTKCTM  904

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             A DFWYGGKLV+ G I+  +VF+TF IL+STGKVIADAGSMT+D+A+GS A+ S+FA+LD
Sbjct  905   AFDFWYGGKLVTQGYITYKEVFETFMILLSTGKVIADAGSMTTDIARGSGAMKSVFAVLD  964

Query  964   RPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
             R + I        D  G   EK+SG +E++ V+FAYP+RP+  IL+ F ++++AG S  L
Sbjct  965   RETNIE-----PADPQGFKPEKISGHVEVRDVDFAYPARPDAMILKGFSIDIEAGKSTAL  1019

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG+SGSGKSTI++LIERFYD   G+I++DG ++RS+ +   R+ +ALVSQEP +++GT++
Sbjct  1020  VGQSGSGKSTIISLIERFYDPLRGTIKIDGREIRSYHLQSLRQHIALVSQEPTLFAGTVK  1079

Query  604   DNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             +NI+FG   A  E EI+EAA+ ANAH FIS LK GYDT CG++GVQLSGGQKQR+AIARA
Sbjct  1080  ENIIFGVSSAVDEMEILEAARVANAHGFISGLKDGYDTWCGDKGVQLSGGQKQRVAIARA  1139

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I++NP++LLLDEATSALD +SE++VQ+AL+G+M+GRT++VVAHRL+TI N D IA++ +G
Sbjct  1140  ILKNPSVLLLDEATSALDGQSERMVQDALEGLMVGRTSVVVAHRLSTIHNCDVIAVLEKG  1199

Query  247   KVVEHGTYSQLKNK  206
             K+VE GT+S L  K
Sbjct  1200  KLVEKGTHSSLLAK  1213


 Score =   313 bits (803),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 197/495 (40%), Positives = 297/495 (60%), Gaps = 9/495 (2%)
 Frame = -2

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             YC+   GE    R+R   L  +L  +  +FD    S+  +   +SN+  +++  ++ ++ 
Sbjct  89    YCWTRTGERQASRMRSMYLRAVLRQDVGYFDLNVTSTSEVVTSISNDTIVIQDALSVKVP  148

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
               V   S+   + +  L++ W+LALV      L ++        L  +  +  +  + + 
Sbjct  149   SFVVNTSTFLGSYIAALLLQWRLALVSFPFVVLLVIPGLIYGRTLMGLARRVREEYDKAG  208

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
              IA + + + R V +F   +K    F  A +   +   K+    G+ IGS  G+ +  WA
Sbjct  209   TIAEQVISSIRTVYAFVGESKTKSDFSGALEGSVRLGLKQGLAKGLAIGS-NGVVYGIWA  267

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
                +Y  ++V       G V+     L   G       S     A+  +AV  I  ++DR
Sbjct  268   FMAYYSSRMVMYHGAEGGTVYAVGAGLAVGGLAFGTGLSNLKYFAEAISAVERITEVIDR  327

Query  961   -PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
              P I T+   G++      +EK+SG+IE K V FAYPSRP   + ++FCL + AG SI L
Sbjct  328   VPKIDTNNLEGRI------VEKVSGEIEFKHVEFAYPSRPNI-VFKDFCLRIPAGKSIAL  380

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG SGSGKST+++L++RFYD   G I +DGV +    + W R QM LVSQEP +++ TI+
Sbjct  381   VGGSGSGKSTVISLLQRFYDPLNGEILLDGVPIDKLQLKWLRSQMGLVSQEPTLFATTIK  440

Query  604   DNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiarai  425
             +NILFGK DA+  E++EAAKA+NAH FIS + +GYDT+ GERG+Q+SGGQKQRIAIARAI
Sbjct  441   ENILFGKEDATMEEVVEAAKASNAHNFISQMPQGYDTQVGERGIQMSGGQKQRIAIARAI  500

Query  424   iRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGK  245
             I++P ILLLDEATSALD+ESE++VQEAL+ +++GRTT++VAHRL+TI+N D IA+V  G+
Sbjct  501   IKSPRILLLDEATSALDLESERIVQEALEKVVVGRTTIIVAHRLSTIQNADVIAVVQNGQ  560

Query  244   VVEHGTYSQLKNKRG  200
             V+E G++ +L   +G
Sbjct  561   VMESGSHQELIRFKG  575



>gb|KCW56138.1| hypothetical protein EUGRSUZ_I01889 [Eucalyptus grandis]
Length=1244

 Score =  1157 bits (2994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/1214 (52%), Positives = 878/1214 (72%), Gaps = 21/1214 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF++AD  D +LM LG +GA+GDG+ST  +LL  S L N +G     +   +  G   R 
Sbjct  26    IFKHADAADRWLMALGLIGAVGDGISTPFVLLLSSRLMNNIG-----NAPSLGEGQFPRV  80

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +++ +L  V +   +    F+EGYCW++T ERQ  ++R  YL A+LRQ+VG+FD    +T
Sbjct  81    IDEDALSLVYMACGLFFAAFLEGYCWTRTGERQASRMRSMYLRAVLRQDVGYFDLNVTST  140

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  SIS DT +IQ+ LS KVP F+++TS FL     +    WRL+LV++P +V+L+IP
Sbjct  141   SEVVTSISNDTIVIQDALSVKVPSFVVNTSTFLGSYIAALLLQWRLALVSFPFVVLLVIP  200

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYG+ L+ L+++  +EY KA  I  Q +SSI+T+Y+F  E      +S  L+ +++LG
Sbjct  201   GLIYGRTLMGLARRVREEYDKAGTIAEQVISSIRTVYAFVGESKTKSDFSGALEGSVRLG  260

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLA+GS G+ + IWAF+A+Y SR++M+ G  GG +YA G    +GGL+ G  L
Sbjct  261   LKQGLAKGLAIGSNGVVYGIWAFMAYYSSRMVMYHGAEGGTVYAVGAGLAVGGLAFGTGL  320

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF EA  A  RI   IDRVPKID  +  G +++ + GE+EFK+V+FAYPSRP ++V
Sbjct  321   SNLKYFAEAISAVERITEVIDRVPKIDTNNLEGRIVEKVSGEIEFKHVEFAYPSRP-NIV  379

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
              KD  L++ AGK++ALVG SGSGKST I+LLQRFYD  +G I +DGV I+ LQ+KWLR Q
Sbjct  380   FKDFCLRIPAGKSIALVGGSGSGKSTVISLLQRFYDPLNGEILLDGVPIDKLQLKWLRSQ  439

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE  LF T+I+ENI+ GK   +MEEVV AA  +NAH+FI Q+PQGY+T+VGERG 
Sbjct  440   MGLVSQEPTLFATTIKENILFGKEDATMEEVVEAAKASNAHNFISQMPQGYDTQVGERGI  499

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALD ESE++VQ+AL++   GRTT++VAH+L
Sbjct  500   QMSGGQKQRIAIARAIIKSPRILLLDEATSALDLESERIVQEALEKVVVGRTTIIVAHRL  559

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQD--QSFAP-SS  2030
             STI+NAD+IAVV  G ++E GSH EL+  K G Y+ +  LQ+  S   QD  Q  +P S 
Sbjct  560   STIQNADVIAVVQNGQVMESGSHQELIRFKGGIYSSLVHLQQMESKKTQDEAQVISPRSP  619

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFS-----RLLGLNLTEWKQGL  1865
             ++ +  + +   A +  S    E+AQ +    + +    F      RLL  +  EWKQ  
Sbjct  620   SSAKIDSTRDPTASIFGSANNAESAQMLTERRNTREGLRFQTSMLRRLLSFSRPEWKQVA  679

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
             +  +SA+  GA+QP +A  +G MIS FF   H+E++ + + + L FA   ++S+ +N  Q
Sbjct  680   LACVSAVLGGAIQPVFAFMLGSMISVFFLTDHDEIKEKTRTYTLCFAGFFMISLLINTSQ  739

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FAY GE+LT+RIR  ML KILTFE  WFD++ NSSGA+C+RL+ +  +V+SLV D++
Sbjct  740   HYNFAYAGEYLTKRIREMMLAKILTFEVGWFDQDKNSSGAVCSRLAKDTNVVRSLVGDQM  799

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SLLVQA S+VTIA +MGLV+AW+LA+VMIA++PL ILCFY RK LL  ++ K ++AQN  
Sbjct  800   SLLVQAISAVTIACIMGLVIAWRLAIVMIAIEPLIILCFYGRKTLLKGMSQKAIEAQNEC  859

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             +++A EAV +HR++T+F S  K+L +   AQ+ P +E++++SW AG+G+G++Q LT    
Sbjct  860   SKLAAEAVSSHRMITAFSSQEKILKMLKKAQEGPWRESKRQSWFAGVGLGASQSLTKCTM  919

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             A DFWYGGKLV+ G I+  +VF+TF IL+STGKVIADAGSMT+D+A+GS A+ S+FA+LD
Sbjct  920   AFDFWYGGKLVTQGYITYKEVFETFMILLSTGKVIADAGSMTTDIARGSGAMKSVFAVLD  979

Query  964   RPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
             R + I        D  G   EK+SG +E++ V+FAYP+RP+  IL+ F ++++AG S  L
Sbjct  980   RETNIE-----PADPQGFKPEKISGHVEVRDVDFAYPARPDAMILKGFSIDIEAGKSTAL  1034

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG+SGSGKSTI++LIERFYD   G+I++DG ++RS+ +   R+ +ALVSQEP +++GT++
Sbjct  1035  VGQSGSGKSTIISLIERFYDPLRGTIKIDGREIRSYHLQSLRQHIALVSQEPTLFAGTVK  1094

Query  604   DNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             +NI+FG   A  E EI+EAA+ ANAH FIS LK GYDT CG++GVQLSGGQKQR+AIARA
Sbjct  1095  ENIIFGVSSAVDEMEILEAARVANAHGFISGLKDGYDTWCGDKGVQLSGGQKQRVAIARA  1154

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I++NP++LLLDEATSALD +SE++VQ+AL+G+M+GRT++VVAHRL+TI N D IA++ +G
Sbjct  1155  ILKNPSVLLLDEATSALDGQSERMVQDALEGLMVGRTSVVVAHRLSTIHNCDVIAVLEKG  1214

Query  247   KVVEHGTYSQLKNK  206
             K+VE GT+S L  K
Sbjct  1215  KLVEKGTHSSLLAK  1228


 Score =   313 bits (803),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 197/495 (40%), Positives = 297/495 (60%), Gaps = 9/495 (2%)
 Frame = -2

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             YC+   GE    R+R   L  +L  +  +FD    S+  +   +SN+  +++  ++ ++ 
Sbjct  104   YCWTRTGERQASRMRSMYLRAVLRQDVGYFDLNVTSTSEVVTSISNDTIVIQDALSVKVP  163

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
               V   S+   + +  L++ W+LALV      L ++        L  +  +  +  + + 
Sbjct  164   SFVVNTSTFLGSYIAALLLQWRLALVSFPFVVLLVIPGLIYGRTLMGLARRVREEYDKAG  223

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
              IA + + + R V +F   +K    F  A +   +   K+    G+ IGS  G+ +  WA
Sbjct  224   TIAEQVISSIRTVYAFVGESKTKSDFSGALEGSVRLGLKQGLAKGLAIGS-NGVVYGIWA  282

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
                +Y  ++V       G V+     L   G       S     A+  +AV  I  ++DR
Sbjct  283   FMAYYSSRMVMYHGAEGGTVYAVGAGLAVGGLAFGTGLSNLKYFAEAISAVERITEVIDR  342

Query  961   -PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
              P I T+   G++      +EK+SG+IE K V FAYPSRP   + ++FCL + AG SI L
Sbjct  343   VPKIDTNNLEGRI------VEKVSGEIEFKHVEFAYPSRPNI-VFKDFCLRIPAGKSIAL  395

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG SGSGKST+++L++RFYD   G I +DGV +    + W R QM LVSQEP +++ TI+
Sbjct  396   VGGSGSGKSTVISLLQRFYDPLNGEILLDGVPIDKLQLKWLRSQMGLVSQEPTLFATTIK  455

Query  604   DNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiarai  425
             +NILFGK DA+  E++EAAKA+NAH FIS + +GYDT+ GERG+Q+SGGQKQRIAIARAI
Sbjct  456   ENILFGKEDATMEEVVEAAKASNAHNFISQMPQGYDTQVGERGIQMSGGQKQRIAIARAI  515

Query  424   iRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGK  245
             I++P ILLLDEATSALD+ESE++VQEAL+ +++GRTT++VAHRL+TI+N D IA+V  G+
Sbjct  516   IKSPRILLLDEATSALDLESERIVQEALEKVVVGRTTIIVAHRLSTIQNADVIAVVQNGQ  575

Query  244   VVEHGTYSQLKNKRG  200
             V+E G++ +L   +G
Sbjct  576   VMESGSHQELIRFKG  590



>ref|XP_010040632.1| PREDICTED: ABC transporter B family member 15-like isoform X1 
[Eucalyptus grandis]
 gb|KCW45046.1| hypothetical protein EUGRSUZ_L01362 [Eucalyptus grandis]
Length=1248

 Score =  1154 bits (2985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/1218 (51%), Positives = 863/1218 (71%), Gaps = 19/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SSI  IF +AD +D  LM LG  G I DG ST  +L   S L N +G     S S +   
Sbjct  18    SSIGSIFMHADGVDKCLMGLGFFGTIADGFSTPLVLFVTSQLMNNIG-----SASSMDPA  72

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             +    + K +L  + +   +    F+EGYCW++T ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  73    SFRHSMNKNALVLLYIACGLSFACFLEGYCWTRTGERQAARMRARYLRAVLRQDVTYFDM  132

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
                +TS+I  S+S D+ +IQ+VLSEKVP FL++ S+F+     +    WRL++V +P + 
Sbjct  133   HVTSTSDIVTSVSSDSLVIQDVLSEKVPNFLVNISLFVGSYIAAFVMLWRLAIVGFPFVT  192

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
              LIIPG+IYG+ L+ +++K  +EY+KA  I  QALSSI+T+Y+F  E   L  +S  L+ 
Sbjct  193   FLIIPGMIYGRTLITIARKIREEYNKAGTIAEQALSSIRTVYAFAGESKTLSEFSKALEG  252

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+AKGLA+GS  + FAIW+F+A+YGSR++M+ G  GG +Y  G +   GG++
Sbjct  253   SVKLGLRQGLAKGLAIGSNSIVFAIWSFMAYYGSRMVMYHGYKGGTVYVVGAAITFGGVA  312

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG AL  +KYF+EA  A  RI   I RVP ID E+  G  +  + G +EF++++FAYPSR
Sbjct  313   LGAALSNLKYFSEACSAGERIEEVIKRVPLIDPENMEGQTIPNLEGNIEFRHIEFAYPSR  372

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PE+++  D +L + +GKT+ALVG SGSGKST I+LLQRFYD  SG I +DG+ IN LQ+K
Sbjct  373   PENIIFGDFSLTIPSGKTLALVGGSGSGKSTVISLLQRFYDPLSGQILLDGIAINKLQIK  432

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE  LF TSI+ENI+ GK    M+EV+ AA  +NAH+FI QLPQGY T+V
Sbjct  433   WLRSQMGLVSQEPTLFATSIKENILFGKENAEMKEVIEAAKASNAHNFISQLPQGYNTQV  492

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAIIK P ILLLDEATSALDSESEK+VQDALD+AS GRTT++
Sbjct  493   GERGIQLSGGQKQRIAIARAIIKAPRILLLDEATSALDSESEKIVQDALDRASIGRTTII  552

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAP  2036
             +AH+LST+R+A+ IAV+  G +IE G+H EL++ ++G Y  +  LQ+       DQ   P
Sbjct  553   IAHRLSTVRHANNIAVIQNGQVIETGNHEELIQNEDGLYTSLVNLQKSEKQKPTDQVEKP  612

Query  2035  SSNAGRQ-------STEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              +            ST         S      +   V  D    P PSF RL+ LN+ EW
Sbjct  613   ENQITSSILSMDGYSTSSRLSLSKVSRSSSARSMAAVSLDDQKIPIPSFRRLIALNMPEW  672

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ  +G I A+ +GAVQP YA  +G MIS +F    EE++A+++ +   F  L + S+ +
Sbjct  673   KQATLGCIGAVLYGAVQPVYAFAMGSMISVYFLKDPEEIKAKVRIYAFCFLGLAVFSLAV  732

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FA+MGE+LT+R+R +ML KILTFE  WFD++ NSSG++C+RL+N+A +V+SLV
Sbjct  733   NVIQHYNFAFMGEYLTKRVREKMLSKILTFEVGWFDQDQNSSGSVCSRLANDANVVRSLV  792

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L+VQ  S++ IA  MGL++AW+LALV+IA QPL I+ FY R+VLL T++ K +KA
Sbjct  793   GDRMALIVQTCSAIIIAFTMGLIIAWRLALVVIAAQPLIIVSFYMRRVLLKTMSQKAIKA  852

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A +AV NHR +TSF S  ++L + + AQ+ P +E+ ++SW AGIG+ ++Q   
Sbjct  853   QEESSKLAADAVSNHRTITSFSSQERILKMLEKAQEAPERESIRQSWYAGIGLAASQFFM  912

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WALDFWYGGKL+S G+I+S  +F+TF IL+STGKVIADAGSMT+DLAKGS  V S+F
Sbjct  913   KCVWALDFWYGGKLISQGQITSKALFETFMILISTGKVIADAGSMTTDLAKGSDTVGSVF  972

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             AILDR + I  P   +    G   +K++G +E  +V+FAYP R +  IL++F  +++ G 
Sbjct  973   AILDRQTRI-EPEGME----GYRPKKITGHVEFCRVDFAYPERLDVIILKDFSFKIELGK  1027

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKST++ LIERFYD   G++++DG D+RS+ +   R+ +ALVSQEP +++
Sbjct  1028  STALVGQSGSGKSTLICLIERFYDPIRGTVKIDGRDLRSYHLRALRKHIALVSQEPTLFA  1087

Query  616   GTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             GTIR+NI++G   + SE EI+EA +AANAH FI +LK GY+T CG++GVQLSGGQKQR+A
Sbjct  1088  GTIRENIVYGISREMSETEIVEATRAANAHDFIMTLKDGYNTWCGDKGVQLSGGQKQRVA  1147

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNPT+LLLDEATSALD +SE+VVQ AL+ +M+GRTT+VVAHRL+TI+  D IA+
Sbjct  1148  IARAILRNPTLLLLDEATSALDSQSEKVVQNALERLMVGRTTLVVAHRLSTIQRCDVIAV  1207

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +GKVVE G++S L  K
Sbjct  1208  LDKGKVVERGSHSSLLAK  1225



>ref|XP_007151162.1| hypothetical protein PHAVU_004G023100g [Phaseolus vulgaris]
 gb|ESW23156.1| hypothetical protein PHAVU_004G023100g [Phaseolus vulgaris]
Length=1235

 Score =  1151 bits (2978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/1208 (53%), Positives = 868/1208 (72%), Gaps = 24/1208 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD  D+FLM LG +GAIGDG+ T  +L   S + N +G     S S   + +
Sbjct  25    SIRSIFMHADGQDMFLMILGLVGAIGDGIGTPLVLFITSKIMNNIG-----SFSGGIDSS  79

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              +  + + ++  + L     V  F+EGYCW++T ERQ  ++R  YL+A+LRQEV +FD  
Sbjct  80    FIHAINQNAVVLLYLASGSFVACFLEGYCWTRTGERQAARMRVSYLKAVLRQEVAYFDLH  139

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
              ++TSE+  S+S D+ +IQ+VLSEKVP FLM+ S+F+          WRL+LV +P + +
Sbjct  140   VSSTSEVITSVSNDSLVIQDVLSEKVPNFLMNASMFVGSYIVGFALLWRLTLVGFPFVAL  199

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPG +YG+ L+ L+ K  +EY+KA  I  QA+SSI+T+YSF  E   ++ +S  L  +
Sbjct  200   LVIPGFMYGRTLMGLASKIREEYNKAGTIAEQAISSIRTVYSFVGESKTIDAFSDALQGS  259

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             ++LG++ G+AKGLA+GS G+ FAIWAF+++YGSRL+M+ G  GG ++A G +  LGGL+L
Sbjct  260   VELGLRQGLAKGLAIGSNGVVFAIWAFISYYGSRLVMYHGAKGGTVFAVGAAIALGGLAL  319

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  VKYF+EAS A  RI   I RVPKID E+  G +L+ + GE+EF +V F YPSRP
Sbjct  320   GAGLSNVKYFSEASSAGERIMEVIKRVPKIDSENMGGEILEEVGGEVEFVHVDFVYPSRP  379

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             +S++LKD +L+V AGKTVALVG SGSGKST I+LLQRFYD   G I +DGV I+ LQ+KW
Sbjct  380   DSVILKDFSLRVPAGKTVALVGGSGSGKSTVISLLQRFYDPVEGEIRVDGVAIHRLQLKW  439

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   + EEV+ AA  +NAH FI  LPQGY T+VG
Sbjct  440   LRSQMGLVSQEPALFATSIKENILFGKEDATEEEVIEAAKASNAHTFISHLPQGYHTQVG  499

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE++VQ+ALD+A+ GRTT+++
Sbjct  500   ERGIQMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERVVQEALDKAAVGRTTIII  559

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSS  2030
             AH+LSTIRNAD+IAVV  G I+E G  +         +     +   + + +  S    S
Sbjct  560   AHRLSTIRNADVIAVVQSGKIMEMGEDTPFHPHPASSSSSIANKDNHNTSSRRLSLVSQS  619

Query  2029  NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSIS  1850
             ++   ++             ++   +K+P        PSF RLL LN+ EWKQ  +G ++
Sbjct  620   SSA--NSIPRVGGGDDVVEEVVVEDKKLPL-------PSFRRLLALNVPEWKQACMGCLN  670

Query  1849  AIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFA  1670
             A+ FGA+QP YA ++G +IS +F   H+E++ + + + L F  L + S+ +N+ QHY FA
Sbjct  671   AVLFGAIQPVYAFSMGSVISVYFLQDHDEIKEKTRIYSLCFLGLAVFSLVVNILQHYNFA  730

Query  1669  YMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQ  1490
             YMGE+LT+RIR RML KILTFE  WFD++ NS+GA+C+RL+ EA +V+SLV DRL+L+VQ
Sbjct  731   YMGEYLTKRIRERMLSKILTFEVGWFDQDENSTGAVCSRLAKEANVVRSLVGDRLALVVQ  790

Query  1489  AASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAV  1310
               S+V IA  MGLV+AW+LA+VMIAVQP+ I CFYTR+VLL ++++K +KAQ+ S++IA 
Sbjct  791   TISAVVIAFTMGLVIAWRLAIVMIAVQPIIIACFYTRRVLLKSMSSKAIKAQDESSKIAA  850

Query  1309  EAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFW  1130
             EAV N R +T+F S  ++L + + AQ+ P  E+ ++SW AG+G+  +Q LTF  WALDFW
Sbjct  851   EAVSNLRTITAFSSQERILKMLEKAQEGPSHESIRQSWFAGVGLACSQSLTFCTWALDFW  910

Query  1129  YGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSII  950
             YGGKLV  G I++  +F+TF ILVSTG+VIADAGSMT+DLAKG+ AV S+F ILDR +  
Sbjct  911   YGGKLVFQGVINAKALFETFMILVSTGRVIADAGSMTNDLAKGADAVGSVFTILDRYT-K  969

Query  949   TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSG  770
             T P     D  G   EKL+GKIE+  V+FAYP+RP   I + F +++ AG S  LVG+SG
Sbjct  970   TEPD----DIDGYKPEKLTGKIELHDVHFAYPARPNVMIFQGFSIKIDAGKSTALVGQSG  1025

Query  769   SGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILF  590
             SGKSTI+ LIERFYD   G + +DG D++S+ +   R+ + LVSQEP ++ GTIR+NI +
Sbjct  1026  SGKSTIIGLIERFYDPLKGIVTIDGRDIKSYHLRSIRKHIGLVSQEPTLFGGTIRENIAY  1085

Query  589   G---KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiR  419
             G   K+D  E EIIEAA+AANAH FISSLK+GY+T CG+RGVQLSGGQKQRIAIARAI++
Sbjct  1086  GASNKVD--ETEIIEAARAANAHDFISSLKEGYETWCGDRGVQLSGGQKQRIAIARAILK  1143

Query  418   NPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVV  239
             NP +LLLDEATSALD +SE++VQ+ALD +M+GRT++VVAHRL+TI+N D IA++ +GKVV
Sbjct  1144  NPEVLLLDEATSALDSQSEKLVQDALDRVMVGRTSVVVAHRLSTIQNCDLIAVLDKGKVV  1203

Query  238   EHGTYSQL  215
             E GT+S L
Sbjct  1204  EKGTHSSL  1211


 Score =   326 bits (835),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 205/531 (39%), Positives = 317/531 (60%), Gaps = 13/531 (2%)
 Frame = -2

Query  3634  EKCSLY-FVLLGLAV--MVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y    LGLAV  +V+  ++ Y ++   E    +IR + L  IL  EVG+FD  E 
Sbjct  702   EKTRIYSLCFLGLAVFSLVVNILQHYNFAYMGEYLTKRIRERMLSKILTFEVGWFDQDEN  761

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             +T  + + ++K+ ++++ ++ +++ + +   S  +         +WRL++V      I+I
Sbjct  762   STGAVCSRLAKEANVVRSLVGDRLALVVQTISAVVIAFTMGLVIAWRLAIVMIAVQPIII  821

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD----  3116
                      L  +S K+ K   +++ I  +A+S+++TI +F+++  IL+      +    
Sbjct  822   ACFYTRRVLLKSMSSKAIKAQDESSKIAAEAVSNLRTITAFSSQERILKMLEKAQEGPSH  881

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              +I+     G+  GLA  S  L+F  WA   WYG +L+     +   ++   +  V  G 
Sbjct  882   ESIRQSWFAGV--GLAC-SQSLTFCTWALDFWYGGKLVFQGVINAKALFETFMILVSTGR  938

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
              +  A        + + A   +F+ +DR  K + +D  G   + + G++E  +V FAYP+
Sbjct  939   VIADAGSMTNDLAKGADAVGSVFTILDRYTKTEPDDIDGYKPEKLTGKIELHDVHFAYPA  998

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP  ++ +  ++K++AGK+ ALVG SGSGKST I L++RFYD   G + IDG +I +  +
Sbjct  999   RPNVMIFQGFSIKIDAGKSTALVGQSGSGKSTIIGLIERFYDPLKGIVTIDGRDIKSYHL  1058

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSME-EVVAAAMTANAHDFIRQLPQGYET  2399
             + +R  +GLVSQE  LFG +IRENI  G      E E++ AA  ANAHDFI  L +GYET
Sbjct  1059  RSIRKHIGLVSQEPTLFGGTIRENIAYGASNKVDETEIIEAARAANAHDFISSLKEGYET  1118

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
               G+RG  LSGGQKQRIAIARAI+KNP +LLLDEATSALDS+SEKLVQDALD+   GRT+
Sbjct  1119  WCGDRGVQLSGGQKQRIAIARAILKNPEVLLLDEATSALDSQSEKLVQDALDRVMVGRTS  1178

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQRQ  2072
             +VVAH+LSTI+N DLIAV+  G ++E+G+HS L+ +  +G Y  +  LQR+
Sbjct  1179  VVVAHRLSTIQNCDLIAVLDKGKVVEKGTHSSLLAQGPSGAYYSLVSLQRR  1229



>ref|XP_011035776.1| PREDICTED: ABC transporter B family member 15-like [Populus euphratica]
Length=1251

 Score =  1150 bits (2976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/1232 (51%), Positives = 867/1232 (70%), Gaps = 43/1232 (3%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D FLM LG +G+IG+G S+  +    + L N L        +  ++  
Sbjct  12    SIRSIFMHADSLDCFLMVLGLIGSIGEGFSSPLIFFVSTKLLNNLA------GADSASEA  65

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
                 + K +L    L     ++ F+EGYCW++T ERQ ++ R +YL+A+LRQ+VG+FD  
Sbjct  66    FSDSINKNALALCYLACGQWLVCFIEGYCWTRTGERQAMRTRTRYLKAVLRQDVGYFDLH  125

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +T+EI   +S D  +IQ+VLSEKVP FLM+ S F+     +    WRL++V +P I++
Sbjct  126   VTSTAEIITGVSNDCFVIQDVLSEKVPNFLMNVSTFIGCYLLAFILLWRLTIVTFPFILL  185

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YGK L+ +S+K  +EYSKA  I  QA+SS +TIY+F  E   +  YS+ L   
Sbjct  186   LVIPGLMYGKILMGISRKMKREYSKAETIAEQAISSTRTIYAFVGETKAITAYSAALQLP  245

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKGLAVGS  + FA+W+F+++YGSR++M+ G  GG ++ AG   V+GGL+ 
Sbjct  246   LKLGLRQGMAKGLAVGSNAVIFAVWSFMSYYGSRMVMYHGCRGGTVFNAGACVVVGGLAF  305

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  +  +KYF +A  A  RI   I RVPKID E+  G +LD   GE+EF+ VKFAYPSRP
Sbjct  306   GAGISNMKYFADACSAGERIMEVIRRVPKIDLENMEGEILDNCSGEVEFRQVKFAYPSRP  365

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             ES++ +D  L++ AGK+VALVG SGSGKSTAIALL+RFYD   G I +DG+ I+ LQ+KW
Sbjct  366   ESIIFEDFCLQIPAGKSVALVGGSGSGKSTAIALLKRFYDPLGGEILLDGIAIDKLQLKW  425

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR Q+GLVSQE ALF T+I+ENI+ GK   +M+EVV AA  +NAH+FI Q PQGY T+VG
Sbjct  426   LRSQIGLVSQEPALFATTIKENILFGKETATMDEVVEAAKASNAHNFISQFPQGYSTQVG  485

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  LSGGQKQRIAIARA+IK+P ILLLDEATSALD+ESE++VQ+ALD+A+ GRTT+++
Sbjct  486   ERGVQLSGGQKQRIAIARAVIKSPRILLLDEATSALDTESERIVQEALDRAAVGRTTIII  545

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRN D+IAVV  G + E GSH+EL+E +NG YA + +LQ       Q Q+  P 
Sbjct  546   AHRLSTIRNVDVIAVVQDGRVTEIGSHNELIENENGMYASLVRLQ-------QTQTEKPC  598

Query  2032  SNA---------------GRQSTEKs------spavlassplLIETAQKVPTDHHHQPSP  1916
              NA                R S++ S      S   +A S + I   +   T+  +  +P
Sbjct  599   ENATTTSVSSSAIPVLKTNRTSSDTSSRRLSRSANSVAPSKVSISAEENAATEGQNFSAP  658

Query  1915  SFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFC  1736
             SF RLL LNL EWKQ   G + AI FG VQP YA  +G MIS FF   H E++ +I+ + 
Sbjct  659   SFLRLLALNLPEWKQASFGCLGAILFGGVQPVYAFVLGSMISVFFLKDHNEIKEKIKIYS  718

Query  1735  LVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCA  1556
             L F  L   S+ +N+ QHY FAYMGEHLT+RIR RML KILTFE  WFD + NSSGA+C+
Sbjct  719   LFFLGLTFFSLIINVIQHYNFAYMGEHLTKRIRERMLSKILTFEVGWFDRDENSSGAICS  778

Query  1555  RLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRK  1376
             RL+ +A  V+S+V DR+SL+VQ  S+VTIA  MGLV+AW+LA+VMIAVQP+ I C+YTR 
Sbjct  779   RLTTDADAVRSVVGDRISLVVQTMSAVTIAWTMGLVIAWRLAIVMIAVQPIIIACYYTRS  838

Query  1375  VLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSW  1196
             VLL +++ K +KAQ+ S+++A +AV N R +T+F S  ++L + +  Q+ PR+E  ++S 
Sbjct  839   VLLKSMSRKAIKAQDESSKLAADAVSNFRTITAFSSQERILKMLEKVQEGPRRENIRQSL  898

Query  1195  LAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTS  1016
              AGIG+ ++Q L     ALD+WYGGKL++ G ++   +F+TF ILVSTG+VIADAGSMT 
Sbjct  899   FAGIGLSTSQSLMSCTVALDYWYGGKLIAQGYMTYKAMFETFLILVSTGRVIADAGSMTM  958

Query  1015  DLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETP  836
             DLAKGS ++ S+FA+LDR + I        D  G   EK++G +E++ V+FAYP+RP   
Sbjct  959   DLAKGSDSIRSVFAVLDRCTKIEPE-----DPDGYRPEKITGHVELQDVDFAYPARPNVM  1013

Query  835   ILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRR  656
             I ++F + ++AG S  LVG+SGSGKSTI+ LIER+YD   G++R+DG D++S+++   R+
Sbjct  1014  IFKDFSINIEAGKSTALVGQSGSGKSTIIGLIERYYDPLKGTVRIDGRDIKSYNLRSLRK  1073

Query  655   QMALVSQEPVIYSGTIRDNILFGKLDaseneii--eaakaanAHQFISSLKKGYDTECGE  482
              +ALVSQEP +++GTI++NI++G      NE    EAAKAANAH FIS LK GY+T CG+
Sbjct  1074  CIALVSQEPTLFAGTIKENIIYGASSDKINESEIIEAAKAANAHDFISGLKDGYETWCGD  1133

Query  481   RGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVA  302
             RGVQLSGGQKQR+AIARA+++NP ILLLDEATSALD +SE+VVQEA++ +M GRT++VVA
Sbjct  1134  RGVQLSGGQKQRLAIARAMLKNPAILLLDEATSALDSQSEKVVQEAIEHVMAGRTSVVVA  1193

Query  301   HRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             HRL+ I++ D IA++ +GK VE GT+S L  K
Sbjct  1194  HRLSAIQSCDLIAVLDKGK-VEMGTHSSLMAK  1224



>ref|XP_006293094.1| hypothetical protein CARUB_v10019381mg [Capsella rubella]
 gb|EOA25992.1| hypothetical protein CARUB_v10019381mg [Capsella rubella]
Length=1231

 Score =  1150 bits (2975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/1219 (51%), Positives = 862/1219 (71%), Gaps = 23/1219 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF  AD +D+ LM LG +GA+GDG  T  +    S L N  G          ++  
Sbjct  8     SIKSIFMQADGVDLMLMALGLIGAVGDGFITPMIFFICSKLLNDFG------GFSFNDET  61

Query  3649  LMREVEKC-SLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
              ++ + K  SL  + +  A +V+ F+EGYCW++T ERQ  K+R KYL A+LRQ+VG+FD 
Sbjct  62    FIQAISKVFSLSLLYVACASLVICFLEGYCWTRTGERQAAKMREKYLIAVLRQDVGYFDL  121

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
                +TS+   S+S D+ +IQ+ +SEK+P FLM+   F+          WRL++V +P IV
Sbjct  122   NVTSTSDAVTSVSSDSLVIQDFISEKLPNFLMNVYAFVGSYIVGFVLLWRLTIVGFPFIV  181

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +L+IPGL+YG+ L+ +S+K  +EY+ A  I  QA++S++T+Y+F++E+ ++E +S+ L  
Sbjct  182   LLLIPGLMYGRALINISRKIREEYNVAGSIAEQAIASVRTVYAFSSEKKMIENFSNALQG  241

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+AKG+A+GS G+++AIW F+ WYGSRL+M  G  GG +    +    GG S
Sbjct  242   SVKLGLRQGLAKGIAIGSNGITYAIWGFMTWYGSRLVMKHGSKGGTVSTVIVCVTFGGTS  301

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG +L  +KYF+EA VAA R+   I RVP ID  +  G +L+  RGE+EF +VKF YPSR
Sbjct  302   LGQSLSNLKYFSEAFVAAERMIKLIKRVPDIDSNNLEGQILEKTRGEVEFNHVKFTYPSR  361

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P + +  D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDG+ I+ LQVK
Sbjct  362   PLTTIFDDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPIAGEILIDGMPIHKLQVK  421

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE  LF TSI ENI+ GK   SM+EVV AA  +NAH+FI Q P  Y+T+V
Sbjct  422   WLRSQMGLVSQEPVLFATSITENILFGKEDASMDEVVEAAKASNAHNFISQFPNSYKTQV  481

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAIIK+P+ILLLDEATSALDSESE++VQ+AL+ AS GRTT+V
Sbjct  482   GERGVQLSGGQKQRIAIARAIIKSPIILLLDEATSALDSESERVVQEALENASVGRTTIV  541

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAP  2036
             +AH+LSTIRNAD+I VV  G I E GSH EL+EK +GHY  +  LQ Q    + D +   
Sbjct  542   IAHRLSTIRNADIICVVQNGRITETGSHDELLEKLDGHYTSLIHLQ-QMENKESDININV  600

Query  2035  SSNAGRQSTEKsspavlassplLIETAQKVPTD-------HHHQPSPSFSRLLGLNLTEW  1877
             S   G+Q +         +  +   T+  + TD        +    PSF RL+ +N  EW
Sbjct  601   SVKEGQQRSLGKDLKYSPNEYIHSTTSSNIVTDFSDMTPKDNKSRVPSFKRLMAMNRPEW  660

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             K  L G + A  FGAV P YA + G M++ FF  SHEEM+ + + + LVF  L L +   
Sbjct  661   KHALYGCVGAALFGAVIPIYAFSTGAMVTVFFLTSHEEMKEKTRIYVLVFVGLALCTFLT  720

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FAYMGE+LT+RIR  ML KILTFE  WFDE+ NSSGA+C+RL+N+A +V+SLV
Sbjct  721   NISQHYNFAYMGEYLTKRIREHMLGKILTFEVNWFDEDENSSGAVCSRLANDANVVRSLV  780

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR+SLLVQ  S+V+I   +GLV++W+ A+VMI+VQPL ++CFYTR +LL  ++   + A
Sbjct  781   GDRMSLLVQTISAVSITCTIGLVISWRFAIVMISVQPLVVVCFYTRNILLKRMSKIAINA  840

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q+ ST++A EAV N R +T+F S  +++++F  AQ+ PR+E+ ++SWLAGI +G++QGL 
Sbjct  841   QDESTKLASEAVSNIRTITAFSSQERIIELFKRAQEGPRRESARQSWLAGIMLGTSQGLI  900

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                 AL+FWYGGKLV++G++ S +  + F I  STG++IA+AG+MT DLAKGS AVAS+F
Sbjct  901   TCVSALNFWYGGKLVADGKMVSKEFLEIFMIFSSTGRLIAEAGTMTKDLAKGSDAVASVF  960

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LDR + I  P N  +D  G   +K+ G+I    V+F+YP+RP+  I + F +++ AG 
Sbjct  961   AVLDRCTTI-EPEN--LD--GYVPKKIKGQIRFLNVDFSYPTRPDVTIFKNFSIDIDAGK  1015

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  +VG SGSGKSTI++LIERFYD   G +++DG D+RS+ +   RR +ALVSQEP ++S
Sbjct  1016  STAIVGPSGSGKSTIISLIERFYDPLKGIVKIDGHDIRSYHLRSLRRHIALVSQEPTLFS  1075

Query  616   GTIRDNILFGKL--DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQri  443
             GTIR+NI++G      +E+EIIEAAKAANAH FI SL  GYDT CG++GVQLSGGQKQRI
Sbjct  1076  GTIRENIMYGGAYNKINESEIIEAAKAANAHDFIISLSGGYDTYCGDKGVQLSGGQKQRI  1135

Query  442   aiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIA  263
             AIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D I 
Sbjct  1136  AIARAVLKNPSVLLLDEATSALDSQSERVVQDALERLMVGRTSVVIAHRLSTIQNCDMIT  1195

Query  262   LVSEGKVVEHGTYSQLKNK  206
             ++ +G+VVE GT+S L  K
Sbjct  1196  VLDKGEVVECGTHSSLLAK  1214



>gb|EEE56476.1| hypothetical protein OsJ_05696 [Oryza sativa Japonica Group]
Length=1221

 Score =  1149 bits (2972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/1217 (52%), Positives = 868/1217 (71%), Gaps = 43/1217 (4%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS + +F +AD  D+ LM LG LGA+GDG+ST  +LL  S +FN LG             
Sbjct  18    SSFMTVFMHADAADVALMVLGLLGAMGDGISTPVMLLITSRIFNDLG------SGADIVK  71

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
                 +V   +   V L  A  VM F+EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  72    EFSSKVNVNARNLVFLAAASWVMAFLEGYCWARTAERQASRMRARYLRAVLRQDVEYFDL  131

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             ++ +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++F           WRL+LVA P++V
Sbjct  132   KKGSTAEVITSVSNDSLVVQDVLSEKVPNFVMNAAMFAGSYAVGFALLWRLTLVALPSVV  191

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG +YG+ L+ L+++  ++Y++   I  QA+SS +T+YSF AER+ + ++S+ L+ 
Sbjct  192   LLIIPGFMYGRILVGLARRIREQYTRPGAIAEQAVSSARTVYSFVAERTTMAQFSAALEE  251

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             + +LG+K G+AKG+AVGS G++FAIWAF  WYGSRL+M+ G  GG ++A   + V+GGL+
Sbjct  252   SARLGLKQGLAKGIAVGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGLA  311

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG  L  VKYF+EAS AA RI   I RVPKID E                        S 
Sbjct  312   LGSGLSNVKYFSEASSAAERILEVIRRVPKIDSE------------------------SD  347

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
              ES +    NL+V AG+TVALVG SGSGKST IALL+RFYD ++G + +DGV+I  L++K
Sbjct  348   TESPIFVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPSAGEVMVDGVDIRRLRLK  407

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE ALF TSIRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+V
Sbjct  408   WLRAQMGLVSQEPALFATSIRENILFGKEEATAEEVVAAAKAANAHNFISQLPQGYDTQV  467

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+V
Sbjct  468   GERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASMGRTTIV  527

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ-SFA  2039
             +AH+LSTIRNAD+IAV+  G + E G H EL+   NG Y+ + +LQ+     + D+    
Sbjct  528   IAHRLSTIRNADIIAVMQSGEVKELGPHDELIANDNGLYSSLVRLQQTRDSNEIDEIGVT  587

Query  2038  PSSNAGRQSTEKsspavlassplLI------ETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              S++A  QS+  S     +++          +      T+    P PSF RLL LN  EW
Sbjct  588   GSTSAVGQSSSHSMSRRFSAASRSSSARSLGDARDDDNTEKPKLPVPSFRRLLMLNAPEW  647

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ L+GS SA+ FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  +
Sbjct  648   KQALMGSFSAVVFGGIQPAYAYAMGSMISVYFLTDHAEIKDKTRTYALIFVGLAVLSFLI  707

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SLV
Sbjct  708   NIGQHYNFGAMGEYLTKRIREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSLV  767

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K + A
Sbjct  768   GDRMALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIHA  827

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A EAV N R +T+F S  ++L +F+ +QD PRKE+ ++SW AG+G+G++  L 
Sbjct  828   QAESSKLAAEAVSNLRTITAFSSQERILRLFEQSQDGPRKESIRQSWFAGLGLGTSMSLM  887

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WALDFWYGG+L++   IS+ ++F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+F
Sbjct  888   TCTWALDFWYGGRLMAEHHISAKELFQTFMILVSTGRVIADAGSMTTDLAKGADAVASVF  947

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             A+LDR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G 
Sbjct  948   AVLDRETEI-DPDNPQ----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFTLSIQPGK  1002

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   GS+++DG D++++++   RR + LVSQEP +++
Sbjct  1003  STALVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKAYNLRALRRHIGLVSQEPTLFA  1062

Query  616   GTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriai  437
             GTIR+NI++G   ASE EI +AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIAI
Sbjct  1063  GTIRENIVYGTETASEAEIEDAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIAI  1122

Query  436   araiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALV  257
             ARAI++NP ILLLDEATSALD +SE+VVQEALD +MIGRT++VVAHRL+TI+N D I ++
Sbjct  1123  ARAILKNPAILLLDEATSALDSQSEKVVQEALDRVMIGRTSVVVAHRLSTIQNCDLITVL  1182

Query  256   SEGKVVEHGTYSQLKNK  206
              +G VVE GT++ L  K
Sbjct  1183  EKGTVVEKGTHASLMAK  1199



>ref|XP_010660995.1| PREDICTED: ABC transporter B family member 15-like isoform X2 
[Vitis vinifera]
 ref|XP_010660996.1| PREDICTED: ABC transporter B family member 15-like isoform X2 
[Vitis vinifera]
Length=1138

 Score =  1149 bits (2971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/1126 (55%), Positives = 832/1126 (74%), Gaps = 29/1126 (3%)
 Frame = -2

Query  3529  IRYKYLEAILRQEVGFFDSQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGL  3350
             +R +YL+A+LRQ+VG+FD    +T+E+  S+S D+ +IQ+VLSEKVP FLM+ + FL   
Sbjct  1     MRARYLKAVLRQDVGYFDLHVTSTAEVITSVSNDSLVIQDVLSEKVPNFLMNAATFLGSY  60

Query  3349  GFSTYFSWRLSLVAYPTIViliipgliygkyllylskksfkeysKANGIVGQALSSIKTI  3170
               +    WRL++V +P +V+L+IPGL+YG+ L+ L++   +EY+KA  I  QA+SSI+T+
Sbjct  61    IAAFAMLWRLAIVGFPFVVVLVIPGLMYGRTLMGLARTIREEYNKAGTIAEQAISSIRTV  120

Query  3169  YSFTAERSILERYSSILDRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKG  2990
             YSF  E      +S+ L  ++KLG++ G+AKGLA+GS G+ FAIW+F++WYGSR++M+ G
Sbjct  121   YSFVGESKTRSDFSAALQGSVKLGLRQGLAKGLAIGSNGIVFAIWSFMSWYGSRMVMYHG  180

Query  2989  ESGGRIYAAGISYVLGGLSLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVL  2810
               GG ++  G +  +GGLSLG  L  +KYF+EA  A  RI   I RVPKID ++  G +L
Sbjct  181   ARGGTVFVVGAAIAVGGLSLGAGLSNLKYFSEACSAGERIMEMIKRVPKIDSDNMEGQIL  240

Query  2809  DTIRGELEFKNVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYD  2630
             + + GE+EF++V+FAYPSRPES++ KD NLK+ AGKTVALVG SGSGKSTAI+LLQRFYD
Sbjct  241   ENVSGEVEFRHVEFAYPSRPESIIFKDFNLKIPAGKTVALVGGSGSGKSTAISLLQRFYD  300

Query  2629  ANSGSICIDGVEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAM  2450
                G I +DGV I+ LQ+KW+R QMGLVSQE ALF T+I+ENI+ GK    MEEVVAAA 
Sbjct  301   PLGGEILLDGVAIDKLQLKWVRSQMGLVSQEPALFATTIKENILFGKEDAVMEEVVAAAK  360

Query  2449  TANAHDFIRQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSES  2270
              +NAH+FI QLPQGY+T+VGERG  +SGGQKQRIAIARAIIK P ILLLDEATSALDSES
Sbjct  361   ASNAHNFICQLPQGYDTQVGERGVQMSGGQKQRIAIARAIIKAPQILLLDEATSALDSES  420

Query  2269  EKLVQDALDQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQ  2093
             E++VQ+ALD A+ GRTT+++AH+LSTIRNAD+I VV  G I+E GSH +L++  +G Y  
Sbjct  421   ERVVQEALDNAAVGRTTIIIAHRLSTIRNADIITVVQNGQIMETGSHDDLIQNDDGLYTS  480

Query  2092  MAKLQRQFSCADQDQSFAP----------SSNAGRQSTEKsspavlassplLIETAQKVP  1943
             + +LQ+       ++S AP          S++    ST     ++++ S      A   P
Sbjct  481   LVRLQQ------TEKSEAPSLPISSTAAISTSMDLHSTSSRRLSLVSRSSSANSNAPSRP  534

Query  1942  TD------HHHQPSPSFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFF  1781
                         P PSF RLL +NL EWKQ  +G +SA+ FGAVQP YA  +G MIS +F
Sbjct  535   AGEVFTAAEQDFPVPSFRRLLAMNLPEWKQASMGCLSAVLFGAVQPVYAFAMGSMISVYF  594

Query  1780  SPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFET  1601
              P H+E++ + + + L F  L + S  +N+ QHY FA MGE+LT+R+R RM  KILTFE 
Sbjct  595   FPEHDEIKKKTRTYALCFVGLAVFSFLVNISQHYNFAAMGEYLTKRVRERMFSKILTFEV  654

Query  1600  AWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVM  1421
              WFD++ NS+GA+C+RL+ +A +V+SLV DR++LLVQ  S+V IA  MGLV+AW+LA+VM
Sbjct  655   GWFDQDQNSTGAICSRLAKDANVVRSLVGDRMALLVQTFSAVIIACTMGLVIAWRLAVVM  714

Query  1420  IAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFD  1241
             IAVQPL I+C+YTR+VLL +++ K +KAQ  S+++A EAV N RI+T+F S  ++L + +
Sbjct  715   IAVQPLIIVCYYTRRVLLKSMSAKGIKAQEESSKLAAEAVSNLRIITAFSSQARILKMLE  774

Query  1240  NAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFIL  1061
              AQ+ P +E+ ++SW AGIG+G++Q L    WALDFWYGGKL+S G ISS  +F+TF IL
Sbjct  775   AAQEGPLRESIRQSWFAGIGLGTSQSLMTCTWALDFWYGGKLISQGYISSKALFETFMIL  834

Query  1060  VSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIE  881
             VSTG+VIADAGSMTSDLAKGS AV S+FA+LDR + I        D  G   EK+ G++E
Sbjct  835   VSTGRVIADAGSMTSDLAKGSDAVGSVFAVLDRYTRIEPE-----DPDGHQPEKIIGRVE  889

Query  880   IKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRV  701
             I+ V+FAYP+RP+  + + F + + AG S  LVG+SGSGKSTI+ LIERFYD   GS+++
Sbjct  890   IRDVDFAYPARPDVLVFKSFSINIDAGKSTALVGQSGSGKSTIIGLIERFYDPLQGSVKI  949

Query  700   DGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQF  524
             DG D+RS+ +   R+ +ALVSQEP +++GTIR+NI +G  D   E+EIIEAA+AANAH F
Sbjct  950   DGKDIRSYHLRVLRKHIALVSQEPTLFAGTIRENIAYGASDKIDESEIIEAARAANAHDF  1009

Query  523   ISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEA  344
             I+ LK GYDT CG+RGVQLSGGQKQR+AIARAI++NP +LLLDEATSALD +SE+VVQ+A
Sbjct  1010  IAGLKNGYDTWCGDRGVQLSGGQKQRVAIARAILKNPAVLLLDEATSALDSQSEKVVQDA  1069

Query  343   LDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             L+ +M+GRT++VVAHRL+TI+N D IA++ +GKVVE GT+S L  K
Sbjct  1070  LERVMVGRTSVVVAHRLSTIQNCDLIAVLDKGKVVEKGTHSSLLGK  1115


 Score =   316 bits (809),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 196/530 (37%), Positives = 311/530 (59%), Gaps = 4/530 (1%)
 Frame = -2

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             + ++    +L FV L +   ++   + Y ++   E    ++R +    IL  EVG+FD  
Sbjct  601   IKKKTRTYALCFVGLAVFSFLVNISQHYNFAAMGEYLTKRVRERMFSKILTFEVGWFDQD  660

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
             + +T  I + ++KD ++++ ++ +++ + +   S  +         +WRL++V      +
Sbjct  661   QNSTGAICSRLAKDANVVRSLVGDRMALLVQTFSAVIIACTMGLVIAWRLAVVMIAVQPL  720

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             +I+        L  +S K  K   +++ +  +A+S+++ I +F+++  IL+   +  +  
Sbjct  721   IIVCYYTRRVLLKSMSAKGIKAQEESSKLAAEAVSNLRIITAFSSQARILKMLEAAQEGP  780

Query  3109  IKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++  ++     G+ +G S  L    WA   WYG +LI     S   ++   +  V  G  
Sbjct  781   LRESIRQSWFAGIGLGTSQSLMTCTWALDFWYGGKLISQGYISSKALFETFMILVSTGRV  840

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             +  A        + S A   +F+ +DR  +I+ ED  G   + I G +E ++V FAYP+R
Sbjct  841   IADAGSMTSDLAKGSDAVGSVFAVLDRYTRIEPEDPDGHQPEKIIGRVEIRDVDFAYPAR  900

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+ LV K  ++ ++AGK+ ALVG SGSGKST I L++RFYD   GS+ IDG +I +  ++
Sbjct  901   PDVLVFKSFSINIDAGKSTALVGQSGSGKSTIIGLIERFYDPLQGSVKIDGKDIRSYHLR  960

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSME-EVVAAAMTANAHDFIRQLPQGYETK  2396
              LR  + LVSQE  LF  +IRENI  G      E E++ AA  ANAHDFI  L  GY+T 
Sbjct  961   VLRKHIALVSQEPTLFAGTIRENIAYGASDKIDESEIIEAARAANAHDFIAGLKNGYDTW  1020

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
              G+RG  LSGGQKQR+AIARAI+KNP +LLLDEATSALDS+SEK+VQDAL++   GRT++
Sbjct  1021  CGDRGVQLSGGQKQRVAIARAILKNPAVLLLDEATSALDSQSEKVVQDALERVMVGRTSV  1080

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQRQ  2072
             VVAH+LSTI+N DLIAV+  G ++E+G+HS L+ K  +G Y  +  LQR+
Sbjct  1081  VVAHRLSTIQNCDLIAVLDKGKVVEKGTHSSLLGKGPSGAYYSLVNLQRR  1130



>ref|XP_010030763.1| PREDICTED: ABC transporter B family member 15-like [Eucalyptus 
grandis]
Length=1243

 Score =  1147 bits (2968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/1218 (52%), Positives = 867/1218 (71%), Gaps = 24/1218 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SSI  IF +AD +D  LM LG  GA+ DG ST  +L     L N +G     S S +   
Sbjct  23    SSIGSIFMHADGVDRCLMGLGFFGAVADGFSTPIVLYVAGQLLNDIG-----SASSMDPA  77

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             + +  + K +L  + +   ++   F+ G     T ERQ  ++R +YL A+LRQ+V +FD 
Sbjct  78    SFLHSINKKALALLYIACGLLFACFLGG-----TGERQAARVRARYLRAVLRQDVTYFDM  132

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             Q  +TS+I  S+S D+ +IQ+VLSEKVP  L++ S+F+     +    WRL++V +P +V
Sbjct  133   QVTSTSDIVTSVSSDSLVIQDVLSEKVPNLLVNVSLFVGSYIVAFIMLWRLAIVGFPFVV  192

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +LIIPG+IYG+ LL +++K  +EYSKA  I  QA+SSI+T+Y+F  E   L  +S  L+ 
Sbjct  193   LLIIPGMIYGRTLLIIARKIREEYSKAGTIAEQAVSSIRTVYAFVGESKTLSEFSKALEG  252

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+A+GLA+GS G+ FAIW+F+A+YGSR++M+    GG +Y  G+S  LGG++
Sbjct  253   SVKLGLRQGLARGLAIGSNGIVFAIWSFMAYYGSRMVMYHHYKGGTVYIVGLSVSLGGVA  312

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              G AL  +KYF+EA  A  RI   I RVP ID E+  G  +  ++G ++F++V+FAYPSR
Sbjct  313   CGTALSNLKYFSEACSAGERIEEVIKRVPPIDPENMEGQTIPNLKGNIKFRHVEFAYPSR  372

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PE+++ +D +L + +GKT+ALVG SGSGKST I+LLQRFYD  SG I +DG+ IN LQ+K
Sbjct  373   PENIIFRDFSLTIPSGKTLALVGGSGSGKSTVISLLQRFYDPLSGRILLDGIAINKLQIK  432

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE  LF TSI+ENI+ GK    M++V+ AA  +NAH+FI QLPQGY+T+V
Sbjct  433   WLRSQMGLVSQEPTLFATSIKENILFGKKNAKMKKVIEAAKASNAHNFISQLPQGYDTQV  492

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  LSGGQKQRIAIARAIIK P ILLLDEATSALDSESEK VQDAL+QAS GRTT++
Sbjct  493   GERGIQLSGGQKQRIAIARAIIKAPRILLLDEATSALDSESEKTVQDALNQASIGRTTII  552

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAP  2036
             +AH+LSTIR+A+ IAVV  G +IE G+H EL++K +G YA +  LQ+       +Q   P
Sbjct  553   IAHRLSTIRHANSIAVVQNGQVIETGNHEELLQKEDGLYASLVNLQKSEKQKPINQVEKP  612

Query  2035  SS-------NAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEW  1877
              +       N    ST         S      +   V +D    P PSF RL+ LN+ EW
Sbjct  613   KNQTLPFILNTDGYSTSSRPSLSRVSHCSSARSMAGVGSDDQKIPIPSFQRLIALNMPEW  672

Query  1876  KQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitl  1697
             KQ ++G I AI FGAVQP Y+  +G M+S +FS  HEE++A+I+ +   F  L + ++ +
Sbjct  673   KQAILGCIGAILFGAVQPVYSFAMGSMVSLYFSEDHEEIKAKIRIYAFWFLGLAVFTLAV  732

Query  1696  nLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLV  1517
             N+ QHY FA+MGE LT+RIR +ML KILTFE  WFD++ NSSG++C+RL+N+A MV+SLV
Sbjct  733   NVIQHYYFAFMGECLTKRIREKMLSKILTFEVGWFDQDQNSSGSVCSRLANDANMVRSLV  792

Query  1516  ADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKA  1337
              DR++L+VQ  S++ +A  MGL++AW+LALVMIA QPL IL FY R+VLL T++ K +KA
Sbjct  793   GDRMALIVQTCSAIIVAFTMGLIIAWRLALVMIAAQPLVILSFYMRRVLLITMSQKAIKA  852

Query  1336  QNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLT  1157
             Q  S+++A +AV NHR +TSF S  ++L + + A + P +E+ ++SW AGIG+ ++Q  T
Sbjct  853   QEESSKLAADAVSNHRTITSFSSQERILKMLEKAHEAPEQESIQQSWYAGIGLAASQFFT  912

Query  1156  FMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIF  977
                WAL FWYGGKL+ +G+I+S  +F+TFFIL++TGKVIADAGSMT+D+A GS  V S+F
Sbjct  913   KCTWALYFWYGGKLIFHGQITSSALFETFFILITTGKVIADAGSMTTDIANGSDTVGSVF  972

Query  976   AILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             AILDR + I  P   +    G    K++G +E  +V+FAYP RP+  IL+ F  +++AG 
Sbjct  973   AILDRQTRI-EPEGTE----GYQPRKITGHVEFCRVDFAYPERPDVIILKGFSFKIEAGK  1027

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKST++ LIERFYD   G +++DG DVRS+ +  +R+ +ALVSQEP +++
Sbjct  1028  STALVGQSGSGKSTLIGLIERFYDPIKGIVKIDGRDVRSYHLRAFRKHIALVSQEPTLFA  1087

Query  616   GTIRDNILFG-KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             GTIR+NI++G   + SE EIIEAA+AANAH FI +LK GYDT CG +G QLSGGQKQR+A
Sbjct  1088  GTIRENIVYGISHEMSETEIIEAARAANAHDFIVALKDGYDTWCGNKGAQLSGGQKQRVA  1147

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIAL  260
             IARAI+RNPT+LLLDEATSALD +SE+VVQ AL+ +M+GRTT+VVAHRL+TI+  D IA+
Sbjct  1148  IARAILRNPTLLLLDEATSALDSQSEKVVQSALERLMVGRTTLVVAHRLSTIQRCDVIAV  1207

Query  259   VSEGKVVEHGTYSQLKNK  206
             + +GKV+E G++S L  K
Sbjct  1208  LDKGKVMEKGSHSSLLAK  1225



>ref|XP_009413177.1| PREDICTED: putative multidrug resistance protein isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1236

 Score =  1147 bits (2966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1230 (50%), Positives = 862/1230 (70%), Gaps = 45/1230 (4%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS   IF +AD  D+ LM +G +GA G G +T  +LL  + + N LG          ++ 
Sbjct  16    SSFWTIFMHADATDMLLMTVGFVGAAGSGFTTPFILLVTTSIMNNLG------AGPSTST  69

Query  3652  NLMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             + +  V K SL FV L L V V  F+EGYCW++T +RQ +++R +YL+AILRQ+V +FD 
Sbjct  70    HFIDNVNKNSLDFVYLSLLVFVTCFLEGYCWTRTGDRQAMRMRTRYLKAILRQDVEYFDL  129

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
                + SE+  S+S D+ +IQ+VL EKVP F+ + ++F+          WRL+LVA+PT +
Sbjct  130   NVTSMSEVITSVSSDSFIIQDVLGEKVPNFVKNVALFVGSYSIGFVVMWRLALVAFPTFL  189

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +L+IPG++YG+  + L+K    EY KA  I  QA+SS++T YS  AE   +  +S+ L+ 
Sbjct  190   LLVIPGIMYGRIFMDLAKNIRDEYEKAGAIAEQAVSSVRTAYSSVAELRTMSMFSNALED  249

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+AKG+AVGS  ++FAIWAF+ WYGSR+ MH G  GG I+A G + V GGL+
Sbjct  250   SVKLGLRQGLAKGVAVGSNAVTFAIWAFITWYGSRVAMHHGVKGGHIFAVGTAIVRGGLA  309

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
              G  L  +KYF+EAS A  RI   + R+P+ID +   G+V++ I G++EF++V+F YPSR
Sbjct  310   FGSGLSNIKYFSEASSAGERILKVMKRIPRIDSDSTEGIVMEKISGDVEFRSVEFVYPSR  369

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             P+S++L D NLKV AG TVALVG SGSGKST IAL++RFYD   G + +DG++I +L++K
Sbjct  370   PDSIILNDFNLKVAAGTTVALVGVSGSGKSTVIALMERFYDPRRGEVLLDGIDIRSLRLK  429

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR Q+GLVSQE  LF TSI+ENI+ GK   +MEEVVAAA  +NAH+FI QLPQGY+TKV
Sbjct  430   WLRSQIGLVSQEPTLFATSIKENILFGKEEATMEEVVAAAKASNAHNFISQLPQGYDTKV  489

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARA++K+P ILLLDEATSALDSESE++VQ+ALD AS GRTT+V
Sbjct  490   GERGIQMSGGQKQRIAIARAVLKSPKILLLDEATSALDSESERIVQEALDLASVGRTTIV  549

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQ------------  2072
             VAH+LSTIRNAD IAVV  G ++E GSH +L+ +++G Y+ + +LQ+             
Sbjct  550   VAHRLSTIRNADAIAVVQAGRVMELGSHDDLIRDEDGLYSSLVRLQQTTRATVGEDSSSS  609

Query  2071  --------FSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSP  1916
                       C  + +SF+  S +   ++ +   A      +              +P P
Sbjct  610   SVAPVASSLLCDRKSRSFSVCSRSNSATSSRHQEAHDELEAIA-------------RPVP  656

Query  1915  SFSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFC  1736
             S  RLL LN  EW+Q ++GS+ A+AFGAVQP Y+  +G MIS FF   HE++++    +C
Sbjct  657   SLRRLLLLNAPEWRQAVMGSLGAVAFGAVQPLYSFVMGSMISMFFLTDHEQIKSNTTTYC  716

Query  1735  LVFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCA  1556
             LVF  L +LS  +N+  HY F  MGE+LT+R+R RML KILTFE  WFD + N +GA+C+
Sbjct  717   LVFVALSVLSFLVNILLHYNFGAMGEYLTKRVRERMLSKILTFEVGWFDRDENCTGAVCS  776

Query  1555  RLSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRK  1376
             RL+N+A +V+ LV DR+SL++Q  S+VTIA  MGL +AWKL LV+IA+QPL I+C+Y RK
Sbjct  777   RLANDANVVRMLVGDRMSLIIQTVSAVTIAWTMGLAIAWKLGLVLIAIQPLIIVCYYCRK  836

Query  1375  VLLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSW  1196
             V+L +++ K   +Q+ S+++A EAV N R +T+F S ++++ +F+  QD PR+++  +S 
Sbjct  837   VILQSMSKKARASQSESSKVATEAVANVRTITAFSSQDRIIHLFERTQDRPRQKSVWQSC  896

Query  1195  LAGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTS  1016
             +AGI +G ++ L    W+L FWYGG+L+ +G I++  +F+   IL+STG+VIA+ GSMTS
Sbjct  897   VAGIVLGLSEALMRCSWSLAFWYGGRLMFHGHITAKALFQNVLILISTGRVIAEGGSMTS  956

Query  1015  DLAKGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETP  836
             DLAKG+  V+S+FA+LDR + I        D+ G   +KL+G+I+I  V+FAYPSRP+  
Sbjct  957   DLAKGADGVSSVFAVLDRCTHIDPE-----DDRGYRPKKLAGEIDINGVDFAYPSRPDVF  1011

Query  835   ILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRR  656
             I R+F L V+AG +  LVG+SGSGKST++ LIERFYD   G +R+DG DV+S+ +   R+
Sbjct  1012  IFRDFSLAVEAGKTTALVGQSGSGKSTVIGLIERFYDPLKGEVRIDGRDVKSYHLRSLRK  1071

Query  655   QMALVSQEPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERG  476
              + LV QEP +++GT+RDNI +G   A+E EI EAA+ A+AH FIS LK GYDT CG+RG
Sbjct  1072  HIGLVGQEPTLFAGTVRDNIAYGTEGATEGEIEEAARTADAHDFISCLKDGYDTCCGDRG  1131

Query  475   VQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHR  296
              QLSGGQKQRIAIARA+++NP +LLLDEATSALD +SE+VVQ AL+ +M+GRT +VVAHR
Sbjct  1132  AQLSGGQKQRIAIARAVLKNPAVLLLDEATSALDSQSEKVVQAALERVMVGRTCVVVAHR  1191

Query  295   LNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             L+T+++   IA++ +G VVE GT+  L  K
Sbjct  1192  LSTVRSCHLIAVLEKGSVVEKGTHESLLAK  1221



>emb|CDY04018.1| BnaC02g37330D [Brassica napus]
Length=1241

 Score =  1145 bits (2962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1219 (51%), Positives = 875/1219 (72%), Gaps = 24/1219 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             S+  IF +AD +D  LM LG +GA+GDG +T  +LL  S L N LG       S ++   
Sbjct  19    SVRSIFMHADCVDWLLMGLGFIGAVGDGFTTPLVLLITSKLMNNLG------GSYLNTET  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K S+  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQNISKNSVVLLYVACGSWVVCFLEGYCWTRTGERQTARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ LIQ+VLSEK+P FL+  S F+          W+L+LV  P +V+
Sbjct  133   ATSTSDVITSVSSDSFLIQDVLSEKLPNFLVSASTFMGSYIVGFILLWKLALVGLPFVVL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  +  QA+SS++T+Y+F+ ER  + ++S+ L  +
Sbjct  193   LVIPGLMYGQALISISTKIREEYNEAGFVAEQAISSVRTVYAFSGERKTISKFSTALQGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++FA+W F++WYGSR++M+ G  GG ++A   +  +GG+SL
Sbjct  253   VKLGIRQGLAKGITIGSNGITFAMWGFMSWYGSRMVMYHGAQGGTVFAVAAAVAIGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF EA+    RI   I++VPKID ++  G  L+ I+GE+EFK+VKF YPSRP
Sbjct  313   GGGLSNLKYFFEAASVGERIIEVINKVPKIDSKNSEGQKLENIKGEVEFKHVKFVYPSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  L+V +GKTVALVG SGSGKS+ I+LLQRFY+  +G I IDGV I+ LQVKW
Sbjct  373   ETSIFDDFCLRVPSGKTVALVGGSGSGKSSVISLLQRFYNPVAGEILIDGVSIDKLQVKW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   S+++VV AA  +NAH+FI +LP GYET+VG
Sbjct  433   LRSQMGLVSQEPALFATSIKENILFGKEDASLDDVVEAAKASNAHNFISELPNGYETQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQDA++ AS GRTT+++
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQDAVENASIGRTTILI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR------QFSCADQD  2051
             AH LSTIRNAD+I+V+  G  +E GSH ELME  +G YA + +LQ+         CA+  
Sbjct  553   AHHLSTIRNADIISVIQNGHGVETGSHDELMENLDGQYASLVRLQQIEKNDSDCQCANMG  612

Query  2050  QSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQ  1871
                 PS +   ++   +     +++ +   +  K  ++    P PSF RL  +NL EWKQ
Sbjct  613   PVSDPSKDLRSRARVSTLSRSSSANSITGSSIVKNLSEDDKPPLPSFKRLFAMNLPEWKQ  672

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
              L G ISA  FGA+QP Y  ++G M+S +F  SH+E++ +   + L F  L +LS+ +N+
Sbjct  673   ALYGCISATLFGAIQPAYPYSLGSMVSVYFLKSHDEIKEKTMIYALSFVGLAVLSLLINI  732

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FA MGE+LT+RIR RML K+LTFE  WFD + NSSGA+C RL  +A +V+SLV D
Sbjct  733   SQHYNFACMGEYLTKRIRERMLSKVLTFEIGWFDRDENSSGAICTRLVKDANVVRSLVGD  792

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R++LL+Q  S+VTIA  MGLV+AW+LALVMIAVQP+ I+CFYTR VLL  ++ K +KAQ+
Sbjct  793   RMALLIQTISAVTIACTMGLVIAWRLALVMIAVQPVIIVCFYTRLVLLKNMSKKAIKAQD  852

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              S+++A EAV N R +T+F S  +++ + + AQ  PR+E+ ++SW  GIG+  +Q LT  
Sbjct  853   ESSKLAAEAVSNVRTITAFSSQERIMKMLEKAQQNPRRESIRQSWFVGIGLAMSQSLTSC  912

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
              WALDFWYGG+L+  G I++  +F+TF ILVSTG+VIADAGSMT+DLAKGS AV S+FA+
Sbjct  913   MWALDFWYGGRLIEGGYITAKALFETFMILVSTGRVIADAGSMTTDLAKGSDAVGSVFAV  972

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             LDR + I        D  G   E+++G++E   V F+YP+R +  I  +F + + A  S 
Sbjct  973   LDRYTSIDPE-----DPDGYEPERITGRVEFLNVGFSYPTRRDVTIFSDFSINIDAAKST  1027

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
              +VG SGSGKST++ LIERFYD   G +R+DG D+R++++   R+ +ALVSQEP +++GT
Sbjct  1028  AIVGPSGSGKSTVIGLIERFYDPVNGVVRIDGRDLRTYNLRSLRQHIALVSQEPTLFAGT  1087

Query  610   IRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQri  443
             IR+NI++G    K+D  E EIIEAA+AANAH FI++L  GYDT CG RG+QLSGGQKQRI
Sbjct  1088  IRENIIYGRASDKID--EAEIIEAARAANAHDFITALSDGYDTYCGNRGLQLSGGQKQRI  1145

Query  442   aiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIA  263
             AIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI N D+IA
Sbjct  1146  AIARAMLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSVVIAHRLSTIHNCDAIA  1205

Query  262   LVSEGKVVEHGTYSQLKNK  206
             ++ +GK+VEHGT+S L  K
Sbjct  1206  VLEKGKLVEHGTHSSLLAK  1224



>ref|NP_189480.1| ABC transporter B family member 18 [Arabidopsis thaliana]
 sp|Q9LSJ5.1|AB18B_ARATH RecName: Full=ABC transporter B family member 18; Short=ABC transporter 
ABCB.18; Short=AtABCB18; AltName: Full=P-glycoprotein 
18; AltName: Full=Putative multidrug resistance protein 
20 [Arabidopsis thaliana]
 dbj|BAB02855.1| multidrug resistance p-glycoprotein; ABC transporter-like protein 
[Arabidopsis thaliana]
 gb|AEE77440.1| ABC transporter B family member 18 [Arabidopsis thaliana]
Length=1225

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 620/1219 (51%), Positives = 865/1219 (71%), Gaps = 28/1219 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG  T  +    S L N +G       S   +  
Sbjct  7     SIRSIFMHADGVDWMLMALGLIGAVGDGFITPIIFFICSKLLNNVG------GSSFDDET  60

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ V K ++  V +  A  V+ F+EGYCW++T ERQ  K+R KYL+A+LRQ+VG+FD  
Sbjct  61    FMQTVAKNAVALVYVACASWVICFIEGYCWTRTGERQAAKMREKYLKAVLRQDVGYFDLH  120

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+ LSEK+P FLM+TS F++         WRL++V +P I++
Sbjct  121   VTSTSDVITSVSSDSLVIQDFLSEKLPNFLMNTSAFVASYIVGFLLLWRLTIVGFPFIIL  180

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG+ L+ +S K  +EY++A  I  Q +SS++T+Y+F +E+ ++E++S+ L  +
Sbjct  181   LLIPGLMYGRALIRISMKIREEYNEAGSIAEQVISSVRTVYAFGSEKKMIEKFSTALQGS  240

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+A+GS G+++AIW FL WYGSR++M+ G  GG + +  +    GG SL
Sbjct  241   VKLGLRQGLAKGIAIGSNGITYAIWGFLTWYGSRMVMNHGSKGGTVSSVIVCVTFGGTSL  300

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L  +KYF+EA V   RI   I+RVP ID ++  G +L+  RGE+EF +VKF YPSRP
Sbjct  301   GQSLSNLKYFSEAFVVGERIMKVINRVPGIDSDNLEGQILEKTRGEVEFNHVKFTYPSRP  360

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  DL L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDG+ IN LQVKW
Sbjct  361   ETPIFDDLCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPIAGEILIDGLPINKLQVKW  420

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE  LF TSI+ENI+ GK   SM+EVV AA  +NAH FI Q P  Y+T+VG
Sbjct  421   LRSQMGLVSQEPVLFATSIKENILFGKEDASMDEVVEAAKASNAHSFISQFPNSYQTQVG  480

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  LSGGQKQRIAIARAIIK+P+ILLLDEATSALDSESE++VQ+ALD AS GRTT+V+
Sbjct  481   ERGVQLSGGQKQRIAIARAIIKSPIILLLDEATSALDSESERVVQEALDNASIGRTTIVI  540

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+I VV  G IIE GSH EL+EK +G Y  + +LQ+     D  +S   S
Sbjct  541   AHRLSTIRNADVICVVHNGRIIETGSHEELLEKLDGQYTSLVRLQQ----VDNKESDHIS  596

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPS------PSFSRLLGLNLTEWKQ  1871
                G+ S+            +   ++  V    +  P       PSF RL+ +N  EWK 
Sbjct  597   VEEGQASSLSKDLKYSPKEFIHSTSSNIVRDFPNLSPKDGKSLVPSFKRLMSMNRPEWKH  656

Query  1870  GLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
              L G + A  FGAVQP Y+ + G M+S +F  SH++++ + + + L+F  L L +   N+
Sbjct  657   ALYGCLGAALFGAVQPIYSYSSGSMVSVYFLASHDQIKEKTRIYVLLFVGLALFTFLSNI  716

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              QHY FAYMGE+LT+RIR RML KILTFE  WFD++ NSSGA+C+RL+ +A MV+SLV D
Sbjct  717   SQHYGFAYMGEYLTKRIRERMLGKILTFEVNWFDKDENSSGAICSRLAKDANMVRSLVGD  776

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             R+SLLVQ  S+V+I   +GLV++W+ ++VM++VQP+ ++CFYT++VLL +++   +K Q+
Sbjct  777   RMSLLVQTISAVSITCAIGLVISWRFSIVMMSVQPVIVVCFYTQRVLLKSMSRNAIKGQD  836

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              S+++A EAV N R +T+F S  +++++    Q+ PRK++ ++SWLAGI +G++Q L   
Sbjct  837   ESSKLAAEAVSNIRTITAFSSQERIINLLKMVQEGPRKDSARQSWLAGIMLGTSQSLITC  896

Query  1150  CWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAI  971
               AL+FWYGGKL+++G++ S +  + F I  STG+VIA+AG+MT DL KGS AVAS+FA+
Sbjct  897   VSALNFWYGGKLIADGKMMSKEFLEIFLIFASTGRVIAEAGTMTKDLVKGSDAVASVFAV  956

Query  970   LDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSI  791
             LDR + I  P N      G   +K+ G+I    V+FAYP+RP+  I + F ++++ G S 
Sbjct  957   LDRNTTI-EPENPD----GYVPKKVKGQISFSNVDFAYPTRPDVIIFQNFSIDIEDGKST  1011

Query  790   GLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGT  611
              +VG SGSGKSTI++LIERFYD   G +++DG D+RS  +   R+ +ALVSQEP +++GT
Sbjct  1012  AIVGPSGSGKSTIISLIERFYDPLKGIVKIDGRDIRSCHLRSLRQHIALVSQEPTLFAGT  1071

Query  610   IRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQri  443
             IR+NI++G    K+D  E+EIIEAAKAANAH FI+SL  GYDT CG+RGVQLSGGQKQRI
Sbjct  1072  IRENIMYGGASNKID--ESEIIEAAKAANAHDFITSLSNGYDTCCGDRGVQLSGGQKQRI  1129

Query  442   aiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIA  263
             AIARA+++NP++LLLDEATSALD +SE VVQ+AL+ +M+GRT++V+AHRL+TI+  D+IA
Sbjct  1130  AIARAVLKNPSVLLLDEATSALDSQSESVVQDALERLMVGRTSVVIAHRLSTIQKCDTIA  1189

Query  262   LVSEGKVVEHGTYSQLKNK  206
             ++  G VVE G +S L  K
Sbjct  1190  VLENGAVVECGNHSSLLAK  1208



>gb|EAY84812.1| hypothetical protein OsI_06180 [Oryza sativa Indica Group]
Length=1201

 Score =  1140 bits (2949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/1180 (53%), Positives = 858/1180 (73%), Gaps = 24/1180 (2%)
 Frame = -2

Query  3832  SSIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisng  3653
             SS + +F +AD  D+ LM LG LGA+GDG+ST  +LL  S +FN LG          S  
Sbjct  18    SSFMTVFMHADAADVALMVLGLLGAMGDGISTPVMLLITSRIFNDLG----------SGA  67

Query  3652  NLMREVE-KCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFD  3476
             ++++E   K ++   LLG  ++  G +EGYCW++T+ERQ  ++R +YL A+LRQ+V +FD
Sbjct  68    DIVKEFSSKVNVEPRLLGRRLLGDGVLEGYCWARTAERQASRMRARYLRAVLRQDVEYFD  127

Query  3475  SQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTI  3296
              ++ +T+E+  S+S D+ ++Q+VLSEKVP F+M+ ++F           WRL+LVA P++
Sbjct  128   LKKGSTAEVITSVSNDSLVVQDVLSEKVPNFVMNAAMFAGSYAVGFALLWRLTLVALPSV  187

Query  3295  ViliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILD  3116
             V+LIIPG +YG+ L+ L+++  ++Y++   I  QA+SS +T+YSF AER+ + ++S+ L+
Sbjct  188   VLLIIPGFMYGRILVGLARRIREQYTRPGAIAEQAVSSARTVYSFVAERTTMAQFSAALE  247

Query  3115  RTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
              + +LG+K G+AKG+AVGS G++FAIWAF  WYGSRL+M+ G  GG ++A   + V+GGL
Sbjct  248   ESARLGLKQGLAKGIAVGSNGITFAIWAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGL  307

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
             +LG  L  VKYF+EAS AA RI   I RVPKID E  +G  L  + GE+EF+NV+F YPS
Sbjct  308   ALGSGLSNVKYFSEASSAAERILEVIRRVPKIDSESDTGEELANVTGEVEFRNVEFCYPS  367

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RPES +    NL+V AG+TVALVG SGSGKST IALL+RFYD  +G + +DGV+I  L++
Sbjct  368   RPESPIFVSFNLRVPAGRTVALVGGSGSGKSTVIALLERFYDPLAGEVTVDGVDIRRLRL  427

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETK  2396
             KWLR QMGLVSQE ALF TSIRENI+ GK   + EEVVAAA  ANAH+FI QLPQGY+T+
Sbjct  428   KWLRAQMGLVSQEPALFATSIRENILFGKEEATAEEVVAAAKAANAHNFISQLPQGYDTQ  487

Query  2395  VGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTL  2216
             VGERG  +SGGQKQRIAIARAI+K+P ILLLDEATSALD+ESE++VQ+ALD AS GRTT+
Sbjct  488   VGERGVQMSGGQKQRIAIARAILKSPKILLLDEATSALDTESERVVQEALDLASMGRTTI  547

Query  2215  VVAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQDQ--S  2045
             V+AH+LSTIRNAD+IAV+  G + E G H EL+   NG Y+ + +LQ+     + D+   
Sbjct  548   VIAHRLSTIRNADIIAVMQSGEVKELGPHDELIANDNGLYSSLVRLQQTRDSNEIDEIGV  607

Query  2044  FAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQ-----PSPSFSRLLGLNLTE  1880
                +S  G+ S+   S    A+S      +     D  +      P PSF RLL LN  E
Sbjct  608   TGSTSAVGQSSSHSMSRRFSAASRSSSARSLSDARDDDNTEKPKLPVPSFRRLLMLNAPE  667

Query  1879  WKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsit  1700
             WKQ L+GS SA+ FG +QP YA  +G MIS +F   H E++ + + + L+F  L +LS  
Sbjct  668   WKQALMGSFSAVVFGGIQPAYAYAMGSMISVYFLTDHAEIKDKTRTYALIFVGLAVLSFL  727

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             +N+ QHY F  MGE+LT+RIR +ML KILTFE  WFD + NSSGA+C++L+ +A +V+SL
Sbjct  728   INIGQHYNFGAMGEYLTKRIREQMLAKILTFEIGWFDRDENSSGAICSQLAKDANVVRSL  787

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             V DR++L++Q  S+V IA  MGLV+AW+LALVMIAVQPL I+CFY R+VLL +++ K + 
Sbjct  788   VGDRMALVIQTISAVLIACTMGLVIAWRLALVMIAVQPLIIVCFYARRVLLKSMSKKSIH  847

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
             AQ  S+++A EAV N R +T+F S  ++L +F+ +QD PRKE+ ++SW AG+G+G++  L
Sbjct  848   AQAESSKLAAEAVSNLRTITAFSSQERILHLFEQSQDGPRKESIRQSWFAGLGLGTSMSL  907

Query  1159  TFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASI  980
                 WALDFWYGG+L++   IS+ ++F+TF ILVSTG+VIADAGSMT+DLAKG+ AVAS+
Sbjct  908   MTCTWALDFWYGGRLMAEHHISAKELFQTFMILVSTGRVIADAGSMTTDLAKGADAVASV  967

Query  979   FAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAG  800
             FA+LDR + I  P N +    G   EKL G+++I+ V+FAYPSRP+  I + F L ++ G
Sbjct  968   FAVLDRETEI-DPDNPQ----GYKPEKLKGEVDIRGVDFAYPSRPDVIIFKGFTLSIQPG  1022

Query  799   SSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIY  620
              S  LVG+SGSGKSTI+ LIERFYD   GS+++DG D++++++   RR + LVSQEP ++
Sbjct  1023  KSTALVGQSGSGKSTIIGLIERFYDPIRGSVKIDGRDIKAYNLRALRRHIGLVSQEPTLF  1082

Query  619   SGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQria  440
             +GTIR+NI++G   ASE EI +AA++ANAH FIS+LK GYDT CGERGVQLSGGQKQRIA
Sbjct  1083  AGTIRENIVYGTETASEVEIEDAARSANAHDFISNLKDGYDTWCGERGVQLSGGQKQRIA  1142

Query  439   iaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGR  320
             IARAI++NP ILLLDEATSALD +SE+VVQEALD +   R
Sbjct  1143  IARAILKNPAILLLDEATSALDSQSEKVVQEALDRVRTRR  1182


 Score =   338 bits (866),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 205/491 (42%), Positives = 296/491 (60%), Gaps = 6/491 (1%)
 Frame = -2

Query  1687  QHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADR  1508
             + YC+A   E    R+R R L  +L  +  +FD +  S+  +   +SN++ +V+ +++++
Sbjct  95    EGYCWARTAERQASRMRARYLRAVLRQDVEYFDLKKGSTAEVITSVSNDSLVVQDVLSEK  154

Query  1507  LSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNS  1328
             +   V  A+    +  +G  + W+L LV +    L I+  +    +L  +  +  +    
Sbjct  155   VPNFVMNAAMFAGSYAVGFALLWRLTLVALPSVVLLIIPGFMYGRILVGLARRIREQYTR  214

Query  1327  STQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMC  1148
                IA +AV + R V SF +    +  F  A +E  +   K+    GI +GS  G+TF  
Sbjct  215   PGAIAEQAVSSARTVYSFVAERTTMAQFSAALEESARLGLKQGLAKGIAVGS-NGITFAI  273

Query  1147  WALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAIL  968
             WA + WYG +LV       G VF     +V  G  +    S     ++ S+A   I  ++
Sbjct  274   WAFNVWYGSRLVMYHGYQGGTVFAVSAAIVVGGLALGSGLSNVKYFSEASSAAERILEVI  333

Query  967   DRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIG  788
              R   I S       + G  L  ++G++E + V F YPSRPE+PI   F L V AG ++ 
Sbjct  334   RRVPKIDSE-----SDTGEELANVTGEVEFRNVEFCYPSRPESPIFVSFNLRVPAGRTVA  388

Query  787   LVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTI  608
             LVG SGSGKST++AL+ERFYD   G + VDGVD+R   + W R QM LVSQEP +++ +I
Sbjct  389   LVGGSGSGKSTVIALLERFYDPLAGEVTVDGVDIRRLRLKWLRAQMGLVSQEPALFATSI  448

Query  607   RDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             R+NILFGK +A+  E++ AAKAANAH FIS L +GYDT+ GERGVQ+SGGQKQRIAIARA
Sbjct  449   RENILFGKEEATAEEVVAAAKAANAHNFISQLPQGYDTQVGERGVQMSGGQKQRIAIARA  508

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I+++P ILLLDEATSALD ESE+VVQEALD   +GRTT+V+AHRL+TI+N D IA++  G
Sbjct  509   ILKSPKILLLDEATSALDTESERVVQEALDLASMGRTTIVIAHRLSTIRNADIIAVMQSG  568

Query  247   KVVEHGTYSQL  215
             +V E G + +L
Sbjct  569   EVKELGPHDEL  579



>gb|KHN10916.1| ABC transporter B family member 15 [Glycine soja]
Length=1249

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/1209 (52%), Positives = 858/1209 (71%), Gaps = 19/1209 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD  D+FLM LGT+GA+G+G++T  +L   S + N +G     S S +     +  
Sbjct  20    IFMHADGKDLFLMVLGTIGAVGEGLATPLVLYISSRMMNNIG-----SSSNMDGNTFIHS  74

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++ ++ L  A   + F+EGYCW++TSERQ  ++R +YL+A+LRQ+V +FD    +T
Sbjct  75    INKNAVSWLYLAGASFAVCFLEGYCWTRTSERQAARMRCRYLKAVLRQDVEYFDLHVTST  134

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI  S+S D+ +IQ+VLSEKVP FLM+ S+F+     +    WRL++V +P +V+L+IP
Sbjct  135   SEIITSVSSDSLVIQDVLSEKVPNFLMNMSLFVGSYIAAFAMLWRLAIVGFPFVVLLVIP  194

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGK L+ LS K  +EY++A  +  Q +SSI+T++SF  E   +  +S+ L  T+KLG
Sbjct  195   GLIYGKTLIGLSSKLREEYNQAGTVAEQTISSIRTVFSFVGESKTMNAFSNALQGTVKLG  254

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLAVGS G+ F IW+F+ +YGSRL+++ G  GG ++A G +  +GGL+LG  L
Sbjct  255   LKQGLAKGLAVGSNGVVFGIWSFMCYYGSRLVIYHGVKGGTVFAVGAAIAVGGLALGAGL  314

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               V+YF+EA  AA RI   I RVPKID ++K G +L+ I GE+EF  V+FAYPSRPES +
Sbjct  315   SNVRYFSEAGAAAERIKEVIKRVPKIDSDNKEGEILENIYGEVEFDRVEFAYPSRPESAI  374

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LK LNL+V AGK VALVG SGSGKST IALLQRFYD   G + +DGV I  LQ+KWLR  
Sbjct  375   LKGLNLRVPAGKRVALVGESGSGKSTVIALLQRFYDPCGGEVRVDGVGIQKLQLKWLRSC  434

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI++NI+ GK   + ++VV AA  A+AH+FI  LP GY T+VGERG 
Sbjct  435   MGLVSQEPALFATSIKDNILFGKEDATQDQVVEAAKAAHAHNFISLLPHGYHTQVGERGI  494

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE+LVQ+ALD A+ G TT+++AH+L
Sbjct  495   QMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERLVQEALDNAAVGCTTIIIAHRL  554

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKN-GHYAQMAKLQRQFSCADQDQSFAPSSNAG  2021
             STI+NADLIAVV GG IIE GSH EL++ + G YA   +LQ+Q      ++S   +   G
Sbjct  555   STIQNADLIAVVGGGKIIEMGSHDELIKNDTGAYASAFRLQQQMGKDKVEESTEKTVIPG  614

Query  2020  R-QSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
                ST ++    L S    I        D +   +PSF RL+ L+  EWK G+ G ++A+
Sbjct  615   TVLSTTETQDMGLTSVGPTISGG----CDDNMATAPSFWRLMALSYPEWKHGVFGCLNAM  670

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              FGAVQP YA T+G  I  +F+  HEE+  R + +   F  L ++S+  N+ QHYCF YM
Sbjct  671   VFGAVQPVYAFTMGSTILLYFNSDHEEIMRRTRFYSFTFLGLFVVSLLSNIGQHYCFGYM  730

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GE+LT+R+R  +L KILTFE  WFD + NS+ ++C+RL+ +A++V+SLV DR++LLVQ  
Sbjct  731   GEYLTKRVRETVLAKILTFEVGWFDLDQNSTASICSRLAKDASVVRSLVGDRMALLVQTF  790

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S+V  A  MGL+++W+L++VMIAVQP+ I CFYTR+VLL +++ K +KAQ  S+ IA EA
Sbjct  791   SAVITAYTMGLIISWRLSIVMIAVQPIIIACFYTRRVLLKSMSNKSMKAQQQSSNIASEA  850

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             V N R VT+F S +++L + + AQ  P  E  ++SW AGIG+G +QGL    WALDFWYG
Sbjct  851   VSNLRTVTAFSSQDRILKMLEEAQQRPSLENIRQSWFAGIGLGCSQGLASCIWALDFWYG  910

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             GKL+S G I++   F++F +LVSTG++IADAGSMT+DLA+G+  V  IF I+DR + I  
Sbjct  911   GKLISYGYITTKTFFESFMVLVSTGRIIADAGSMTTDLARGADVVGDIFGIIDRCTKIEP  970

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
                   D  G   E+L G+IE  +V+FAYP+RP   I   F ++++AG S  +VG+SGSG
Sbjct  971   D-----DPNGYIPERLIGEIEFHEVHFAYPARPNVAIFENFSMKIEAGKSTAMVGQSGSG  1025

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KSTI+ LIERFYD   G + +DG+D++S+++   R+ +ALVSQEP ++ GTIR+NI +G+
Sbjct  1026  KSTIIGLIERFYDPLKGMVTIDGMDIKSYNLKSLRKHIALVSQEPTLFGGTIRENIAYGR  1085

Query  583   LDaseneii---eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNP  413
              ++   +     EAA+AANAH FI+SLK+GY+T CG++GVQLSGGQKQRIAIARAI++NP
Sbjct  1086  CESERVDESEIIEAARAANAHDFIASLKEGYETWCGDKGVQLSGGQKQRIAIARAILKNP  1145

Query  412   TILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEH  233
              +LLLDEATSALD  SE+VVQ+ L  +M GRT +VVAHRL+TI N D I ++ +G+VVE 
Sbjct  1146  KVLLLDEATSALDGPSEKVVQDTLMRVMRGRTGVVVAHRLSTIHNCDVIGVLEKGRVVEI  1205

Query  232   GTYSQLKNK  206
             GT+S L  K
Sbjct  1206  GTHSSLLAK  1214



>ref|XP_003530842.1| PREDICTED: ABC transporter B family member 15-like [Glycine max]
Length=1259

 Score =  1139 bits (2945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/1209 (52%), Positives = 858/1209 (71%), Gaps = 19/1209 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD  D+FLM LGT+GA+G+G++T  +L   S + N +G     S S +     +  
Sbjct  30    IFMHADGKDLFLMVLGTIGAVGEGLTTPLVLYISSRMMNNIG-----SSSNMDGNTFIHS  84

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++ ++ L  A   + F+EGYCW++TSERQ  ++R +YL+A+LRQ+V +FD    +T
Sbjct  85    INKNAVSWLYLAGASFAVCFLEGYCWTRTSERQAARMRCRYLKAVLRQDVEYFDLHVTST  144

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SEI  S+S D+ +IQ+VLSEKVP FLM+ S+F+     +    WRL++V +P +V+L+IP
Sbjct  145   SEIITSVSSDSLVIQDVLSEKVPNFLMNMSLFVGSYIAAFAMLWRLAIVGFPFVVLLVIP  204

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GLIYGK L+ LS K  +EY++A  +  Q +SSI+T++SF  E   +  +S+ L  T+KLG
Sbjct  205   GLIYGKTLIGLSSKLREEYNQAGTVAEQTISSIRTVFSFVGESKTMNAFSNALQGTVKLG  264

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             +K G+AKGLAVGS G+ F IW+F+ +YGSRL+++ G  GG ++A G +  +GGL+LG  L
Sbjct  265   LKQGLAKGLAVGSNGVVFGIWSFMCYYGSRLVIYHGVKGGTVFAVGAAIAVGGLALGAGL  324

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               V+YF+EA  AA RI   I RVPKID ++K G +L+ I GE+EF  V+FAYPSRPES +
Sbjct  325   SNVRYFSEAGAAAERIKEVIKRVPKIDSDNKEGEILENIYGEVEFDRVEFAYPSRPESAI  384

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             LK LNL+V AGK VALVG SGSGKST IALLQRFYD   G + +DGV I  LQ+KWLR  
Sbjct  385   LKGLNLRVPAGKRVALVGESGSGKSTVIALLQRFYDPCGGEVRVDGVGIQKLQLKWLRSC  444

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI++NI+ GK   + ++VV AA  A+AH+FI  LP GY T+VGERG 
Sbjct  445   MGLVSQEPALFATSIKDNILFGKEDATQDQVVEAAKAAHAHNFISLLPHGYHTQVGERGI  504

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK P ILLLDEATSALDSESE+LVQ+ALD A+ G TT+++AH+L
Sbjct  505   QMSGGQKQRIAIARAIIKKPRILLLDEATSALDSESERLVQEALDNAAVGCTTIIIAHRL  564

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKN-GHYAQMAKLQRQFSCADQDQSFAPSSNAG  2021
             STI+NADLIAVV GG IIE GSH EL++ + G YA   +LQ+Q      ++S   +   G
Sbjct  565   STIQNADLIAVVGGGKIIEMGSHDELIKNDTGAYASAFRLQQQMGKDKVEESTEKTVIPG  624

Query  2020  R-QSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLIGSISAI  1844
                ST ++    L S    I        D +   +PSF RL+ L+  EWK G+ G ++A+
Sbjct  625   TVLSTTETQDMGLTSVGPTISGG----CDDNMATAPSFWRLMALSYPEWKHGVFGCLNAM  680

Query  1843  AFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQHYCFAYM  1664
              FGAVQP YA T+G  I  +F+  HEE+  R + +   F  L ++S+  N+ QHYCF YM
Sbjct  681   VFGAVQPVYAFTMGSTILLYFNSDHEEIMRRTRFYSFTFLGLFVVSLLSNIGQHYCFGYM  740

Query  1663  GEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLSLLVQAA  1484
             GE+LT+R+R  +L KILTFE  WFD + NS+ ++C+RL+ +A++V+SLV DR++LLVQ  
Sbjct  741   GEYLTKRVRETVLAKILTFEVGWFDLDQNSTASICSRLAKDASVVRSLVGDRMALLVQTF  800

Query  1483  SSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSSTQIAVEA  1304
             S+V  A  MGL+++W+L++VMIAVQP+ I CFYTR+VLL +++ K +KAQ  S+ IA EA
Sbjct  801   SAVITAYTMGLIISWRLSIVMIAVQPIIIACFYTRRVLLKSMSNKSMKAQQQSSNIASEA  860

Query  1303  VYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWALDFWYG  1124
             V N R VT+F S +++L + + AQ  P  E  ++SW AGIG+G +QGL    WALDFWYG
Sbjct  861   VSNLRTVTAFSSQDRILKMLEEAQQRPSLENIRQSWFAGIGLGCSQGLASCIWALDFWYG  920

Query  1123  GKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDRPSIITS  944
             GKL+S G I++   F++F +LVSTG++IADAGSMT+DLA+G+  V  IF I+DR + I  
Sbjct  921   GKLISYGYITTKTFFESFMVLVSTGRIIADAGSMTTDLARGADVVGDIFGIIDRCTKIEP  980

Query  943   PYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLVGKSGSG  764
                   D  G   E+L G+IE  +V+FAYP+RP   I   F ++++AG S  +VG+SGSG
Sbjct  981   D-----DPNGYIPERLIGEIEFHEVHFAYPARPNVAIFENFSMKIEAGKSTAMVGQSGSG  1035

Query  763   KSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRDNILFGK  584
             KSTI+ LIERFYD   G + +DG+D++S+++   R+ +ALVSQEP ++ GTIR+NI +G+
Sbjct  1036  KSTIIGLIERFYDPLKGMVTIDGMDIKSYNLKSLRKHIALVSQEPTLFGGTIRENIAYGR  1095

Query  583   LDaseneii---eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiaraiiRNP  413
              ++   +     EAA+AANAH FI+SLK+GY+T CG++GVQLSGGQKQRIAIARAI++NP
Sbjct  1096  CESERVDESEIIEAARAANAHDFIASLKEGYETWCGDKGVQLSGGQKQRIAIARAILKNP  1155

Query  412   TILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEGKVVEH  233
              +LLLDEATSALD  SE+VVQ+ L  +M GRT +VVAHRL+TI N D I ++ +G+VVE 
Sbjct  1156  KVLLLDEATSALDGPSEKVVQDTLMRVMRGRTGVVVAHRLSTIHNCDVIGVLEKGRVVEI  1215

Query  232   GTYSQLKNK  206
             GT+S L  K
Sbjct  1216  GTHSSLLAK  1224



>ref|NP_189477.4| ABC transporter B family member 16 [Arabidopsis thaliana]
 sp|Q9LSJ8.1|AB16B_ARATH RecName: Full=ABC transporter B family member 16; Short=ABC transporter 
ABCB.16; Short=AtABCB16; AltName: Full=Multidrug 
resistance protein 18; AltName: Full=P-glycoprotein 16 [Arabidopsis 
thaliana]
 dbj|BAB02852.1| multidrug resistance p-glycoprotein; ABC transporter-like protein 
[Arabidopsis thaliana]
 gb|AEE77437.1| ABC transporter B family member 16 [Arabidopsis thaliana]
Length=1228

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/1214 (50%), Positives = 850/1214 (70%), Gaps = 24/1214 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D  LM LG +GA+GDG  T  L    + L N  G          ++   M+ 
Sbjct  10    IFMHADGVDWMLMGLGLIGAVGDGFITPILFFITAMLLNDFG------SFSFNDETFMQP  63

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K +L  + +  A  V+ F+EGYCW++T ERQ  K+R +YL A+LRQ+VG+FD    +T
Sbjct  64    ISKNALAMLYVACASWVICFLEGYCWTRTGERQAAKMRERYLRAVLRQDVGYFDLHVTST  123

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S+I  S+S D+ +IQ+ LSEK+P  LM+ S F+          WRL++V +P I++L+IP
Sbjct  124   SDIITSVSSDSLVIQDFLSEKLPNILMNASAFVGSYIVGFMLLWRLTIVGFPFIILLLIP  183

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ +S+K  +EY++A  I  QA+SS++T+Y+F +E+ ++E++S  L  ++KLG
Sbjct  184   GLMYGRALIGISRKIREEYNEAGSIAEQAISSVRTVYAFVSEKKMIEKFSDALQGSVKLG  243

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS G+ +AIW FL WYGSR++M+ G  GG +    +    GG +LG AL
Sbjct  244   LRQGLAKGIAIGSNGIVYAIWGFLTWYGSRMVMNYGYKGGTVSTVTVCVTFGGTALGQAL  303

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA VA  RI   I RVP ID ++ +G +L+TIRGE+EF NVK  YPSRPE+L+
Sbjct  304   SNLKYFSEAFVAGERIQKMIKRVPDIDSDNLNGHILETIRGEVEFNNVKCKYPSRPETLI  363

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               DL LK+ +GKTVALVG SGSGKST I+LLQRFYD N G I ID V IN +QVKWLR Q
Sbjct  364   FDDLCLKIPSGKTVALVGGSGSGKSTVISLLQRFYDPNEGDILIDSVSINNMQVKWLRSQ  423

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MG+VSQE +LF TSI+ENI+ GK   S +EVV AA  +NAH+FI Q P GY+T+VGERG 
Sbjct  424   MGMVSQEPSLFATSIKENILFGKEDASFDEVVEAAKASNAHNFISQFPHGYQTQVGERGV  483

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARA+IK+P+ILLLDEATSALD ESE++VQ+ALD AS GRTT+V+AH+L
Sbjct  484   HMSGGQKQRIAIARALIKSPIILLLDEATSALDLESERVVQEALDNASVGRTTIVIAHRL  543

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFAPSSNAGR  2018
             STIRNAD+I V+  GCI+E GSH +LME +G Y  + +LQ Q    +   + +     GR
Sbjct  544   STIRNADIICVLHNGCIVETGSHDKLMEIDGKYTSLVRLQ-QMKNEESCDNTSVGVKEGR  602

Query  2017  QST-------EKsspavlassplLIETAQKVPTDHHHQP-SPSFSRLLGLNLTEWKQGLI  1862
              S+            A   SS ++   +  +P D   +P  PSF RL+ +N  EWK  L 
Sbjct  603   VSSLRNDLDYNPRDLAHSMSSSIVTNLSDSIPQD--KKPLVPSFKRLMAMNRPEWKHALC  660

Query  1861  GSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQH  1682
             G +SA   GAVQP YA + G MIS FF  +HE+++   + + L+F  L L +   ++ Q 
Sbjct  661   GCLSASLGGAVQPIYAYSSGLMISVFFLTNHEQIKENTRIYVLLFFGLALFTFFTSISQQ  720

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             Y F+YMGE+LT+RIR +ML KILTFE  WFDEE NSSGA+C+RL+ +A +V+SLV +R+S
Sbjct  721   YSFSYMGEYLTKRIREQMLSKILTFEVNWFDEEENSSGAICSRLAKDANVVRSLVGERMS  780

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
             LLVQ  S+V +A  +GLV+AW+  +VMI+VQP+ I+C+Y ++VLL  ++ K + AQ+ S+
Sbjct  781   LLVQTISTVMVACTIGLVIAWRFTIVMISVQPVIIVCYYIQRVLLKNMSKKAIIAQDESS  840

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
             ++A EAV N R +T+F S  +++ + +  Q+ PR+E+ ++SWLAGI +G+ Q L     A
Sbjct  841   KLAAEAVSNIRTITTFSSQERIMKLLERVQEGPRRESARQSWLAGIMLGTTQSLITCTSA  900

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
             L+FWYGGKL+++G++ S   F+ F I  +TG+ IA+AG+MT+DLAKGS +V S+F +LDR
Sbjct  901   LNFWYGGKLIADGKMVSKAFFELFLIFKTTGRAIAEAGTMTTDLAKGSNSVDSVFTVLDR  960

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
              + I  P N      G  LEK+ G+I    V+FAYP+RP   I   F +E+  G S  +V
Sbjct  961   RTTI-EPENPD----GYILEKIKGQITFLNVDFAYPTRPNMVIFNNFSIEIHEGKSTAIV  1015

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             G S SGKST++ LIERFYD   G +++DG D+RS+ +   R+ M+LVSQEP +++GTIR+
Sbjct  1016  GPSRSGKSTVIGLIERFYDPLQGIVKIDGRDIRSYHLRSLRQHMSLVSQEPTLFAGTIRE  1075

Query  601   NILFGKLDaseneiieaak--aanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             NI++G+     +E         ANAH+FI+SL  GYDT CG+RGVQLSGGQKQRIAIAR 
Sbjct  1076  NIMYGRASNKIDESEIIEAGKTANAHEFITSLSDGYDTYCGDRGVQLSGGQKQRIAIART  1135

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             I++NP+ILLLDEATSALD +SE+VVQ+AL+ +M+G+T++V+AHRL+TI+N D+IA++ +G
Sbjct  1136  ILKNPSILLLDEATSALDSQSERVVQDALEHVMVGKTSVVIAHRLSTIQNCDTIAVLDKG  1195

Query  247   KVVEHGTYSQLKNK  206
             KVVE GT++ L  K
Sbjct  1196  KVVESGTHASLLAK  1209



>ref|XP_009111595.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter B family member 
22-like [Brassica rapa]
Length=1235

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/1235 (51%), Positives = 866/1235 (70%), Gaps = 57/1235 (5%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D  LM LG +G+IGDG  T  +      L N LG          ++GN M+ 
Sbjct  10    IFMHADGVDWMLMGLGLIGSIGDGFVTPIIFFITGLLLNDLG-------GSFNDGNFMKA  62

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             V K ++  + +  A  V+ F+EGYCW++T ERQ  K+R KYL+A+LRQ+VG+FD    +T
Sbjct  63    VSKNAVALLYMASASWVVCFLEGYCWTRTGERQAAKMREKYLKAVLRQDVGYFDLHVTST  122

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S D+ +IQ+VLSEK+P FLM+ S F++    +    WRL++V +P +V+L+IP
Sbjct  123   SDVITSVSSDSLVIQDVLSEKLPNFLMNASAFVASYIVAFIMLWRLTIVGFPFVVLLLIP  182

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+YG+ L+ +S+K  +EY++A  I  QA+S ++T+Y+F +E  ++ ++S  L  ++KLG
Sbjct  183   GLMYGRALISISRKIREEYNEAGSIAEQAISLVRTVYAFGSETKLIAKFSLALQGSVKLG  242

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+ KG+++GS G+ +AIWAFL WYGSR++M+ G  GG I+A  I    GG SLG  L
Sbjct  243   VRQGLVKGISIGSNGIIYAIWAFLTWYGSRMVMYHGAKGGTIFAVIICLTFGGTSLGRGL  302

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KYF+EA VA  RI   I+RVP+ID ++  G  L+ I+GE+EFK+VKF YPSR E+ +
Sbjct  303   SNLKYFSEAVVAGERIMEVIERVPEIDSDNLEGQTLEKIKGEVEFKHVKFMYPSRLETPI  362

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               D  L+V +GKTVALVG SGSGKST +ALLQRFYD  +G I +DGV IN LQV WLR Q
Sbjct  363   FDDFCLRVPSGKTVALVGGSGSGKSTVLALLQRFYDPVAGEILLDGVSINKLQVNWLRLQ  422

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF T+I ENI+ GK   SM+EVV AA  +NAH+FI Q PQGY+T+VGERG 
Sbjct  423   MGLVSQEPALFATTIEENILFGKEDASMDEVVEAAKASNAHNFISQFPQGYKTQVGERGV  482

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD AS GRTT+V+AH+L
Sbjct  483   QMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALDNASLGRTTIVIAHRL  542

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR-----------------Q  2072
             STIR+AD+I VV  G I+E GSH  LME  +G Y  + +LQ+                 Q
Sbjct  543   STIRDADVICVVHEGRIVEAGSHEALMENLDGKYTSLVRLQQMDNQESDGNVSVRVQGSQ  602

Query  2071  FSCADQDQSFAP--SSNAGRQSTEKsspavlassplLIETAQKVPTDH---HHQPSPSFS  1907
              S   +D ++ P  SS +G              +   IE+   +P+        P PSF 
Sbjct  603   LSILSKDLTYGPKLSSESGSN----------MLTSSSIES--NLPSSDPKGKKPPVPSFK  650

Query  1906  RLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVF  1727
             RL+ +N  EWK  L G +SA  FGAVQPT A   G M+S +F  SH+E++ + + F L F
Sbjct  651   RLMAMNRPEWKHALYGCLSAALFGAVQPTSAFVSGSMVSVYFLTSHDEIKEKTRIFVLFF  710

Query  1726  AllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLS  1547
               L + S  LN+ QHY FAYMGE+LT+RIR +ML+KILTFE  WFDEE NSSGA+C+RL+
Sbjct  711   VGLAVFSFLLNIIQHYSFAYMGEYLTKRIREKMLKKILTFEVNWFDEEENSSGAICSRLA  770

Query  1546  NEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLL  1367
              EA +V+SLV +R+SLLVQ  ++V +A  +GLV+AW+LA+VM+A QP+ ++CFYT+++LL
Sbjct  771   KEANLVRSLVGERVSLLVQTIAAVAVACTVGLVIAWRLAIVMMAAQPVVVVCFYTQRILL  830

Query  1366  STITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAG  1187
              TI+ K +KAQ+ S+++A EAV N R +TSF S   +L +    Q+ PRKE+ ++SWLAG
Sbjct  831   KTISKKAIKAQDESSKLAAEAVSNIRTITSFSSQEHILKLLKRIQEGPRKESVRQSWLAG  890

Query  1186  IGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLA  1007
               + +++ L      L+FWYGG+L+++G+I +   F+ F + VSTG+VIADAGSMT+DLA
Sbjct  891   TVLATSRSLITCTSVLNFWYGGRLITDGKIVAKQFFEIFTVFVSTGRVIADAGSMTTDLA  950

Query  1006  KGSAAVASIFAILDRPSII--TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYP----SRP  845
             KGS AV S+FA+LDR + I   SP NG V       EK+ G+I    VNFAY     +RP
Sbjct  951   KGSDAVGSVFAVLDRSTTIEPESP-NGYVT------EKIKGQISFVNVNFAYDFSYLTRP  1003

Query  844   ETPILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGW  665
                I +   +E+  G S  +VG SGSGKSTI++LIERFYD   G +++DG D++S+ +  
Sbjct  1004  NVAIFKNLSIEIDQGKSTAIVGPSGSGKSTIISLIERFYDPLKGCVKIDGRDLKSYHLRT  1063

Query  664   YRRQMALVSQEPVIYSGTIRDNILFG--KLDaseneiieaakaanAHQFISSLKKGYDTE  491
              R+ +AL SQEP +++GTIR+NI++G   ++  E+EIIEAAKAANAH FI+SL  GYDT 
Sbjct  1064  LRQHIALFSQEPALFAGTIRENIMYGGASVNIDESEIIEAAKAANAHDFITSLTNGYDTN  1123

Query  490   CGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTM  311
             CG+RGV LSGGQKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++
Sbjct  1124  CGDRGVFLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDALERVMVGRTSV  1183

Query  310   VVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             V+AHRL+TI+N D IA++ +GKVVE G +S L  K
Sbjct  1184  VIAHRLSTIQNCDVIAVLDKGKVVECGNHSSLLAK  1218



>ref|XP_002323866.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEF03999.1| ABC transporter family protein [Populus trichocarpa]
Length=1238

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/1211 (51%), Positives = 859/1211 (71%), Gaps = 29/1211 (2%)
 Frame = -2

Query  3796  IDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMREVEKCSLY  3617
             +D FLM LG +G+IG+G S+  +    S L N L        +  ++      + K +L 
Sbjct  10    LDCFLMVLGLIGSIGEGFSSPLIFFVSSKLLNNLA------GADSASDVFSDSINKNALA  63

Query  3616  FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATTSEITNSI  3437
                L     ++ F+EGYCW++T ERQ +++R +YL+A+LRQ+VG+FD    +T+EI   +
Sbjct  64    LCYLACGQWLVCFIEGYCWTRTGERQAMRMRTRYLKAVLRQDVGYFDLHVTSTAEIITGV  123

Query  3436  SKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliipgliygky  3257
             S D+ +IQ+VLSEKVP FLM+ S F+     +    WRL++V +P I++L+IPG++YGK 
Sbjct  124   SNDSFVIQDVLSEKVPNFLMNVSTFIGCYIMAFILLWRLTIVMFPFILLLVIPGVMYGKI  183

Query  3256  llylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLGMKIGIAK  3077
             L+ +S+K  +EY+KA  I  QA+SS +TIY+F  E   +  YS  L   +KLG++ G+AK
Sbjct  184   LMGISRKIKREYTKAETIAEQAISSTRTIYAFVGETKAIAAYSEALQLPLKLGLRQGMAK  243

Query  3076  GLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMALPEVKYFT  2897
             GLAVGS  + FA+W+F+++YGSR++M+ G  GG ++ AG   ++GGL+ G  L  +KYF 
Sbjct  244   GLAVGSNAVIFAVWSFMSYYGSRMVMYHGCRGGTVFNAGACVMVGGLAFGAGLSNMKYFA  303

Query  2896  EASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLVLKDLNLK  2717
             +A  A  RI   I RVPKID ++  G +LD  RGE+EF+ VKFAYPSRPES++ +D  L+
Sbjct  304   DACSAGERIMEVIRRVPKIDLDNMEGEILDNFRGEVEFRQVKFAYPSRPESIIFEDFCLQ  363

Query  2716  VEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQMGLVSQE  2537
             + AGK+VALVG SGSGKSTAIALL+RFYD   G I +DG+ I+ LQ+KWLR Q+GLVSQE
Sbjct  364   IPAGKSVALVGGSGSGKSTAIALLKRFYDPLGGEILLDGIAIDKLQLKWLRSQIGLVSQE  423

Query  2536  HALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGALLSGGQK  2357
              ALF T+I+ENI+ GK   +M+EVV AA  +NAH+FI Q P GY T+VGERG  LSGGQK
Sbjct  424   PALFATTIKENILFGKETATMDEVVEAAKASNAHNFISQFPHGYSTQVGERGVQLSGGQK  483

Query  2356  QriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKLSTIRNAD  2177
             QRIAIARA+IK+P ILLLDEATSALD+ESE++VQ+ALD+A+ GRTT+++AH+LSTIRN D
Sbjct  484   QRIAIARAVIKSPRILLLDEATSALDTESERIVQEALDRAAVGRTTIIIAHRLSTIRNVD  543

Query  2176  LIAVVSGGCIIEQGSHSELMEKN-GHYAQMAKLQR---QFSCADQDQ-----SFAPSSNA  2024
             +IAVV  G + E GSH+EL+E   G Y  + +LQ+   +  C +  +     S  P    
Sbjct  544   IIAVVQDGRVTEIGSHNELIENEYGMYTSLVRLQQTRTEKPCENVTKTSVSSSAIPVMKT  603

Query  2023  GRQSTEKs------spavlassplLIETAQKVPTDHHHQPSPSFSRLLGLNLTEWKQGLI  1862
              R S++ S      S   +A S + I   + V  +     +PSF RLL LNL EWKQ   
Sbjct  604   NRTSSDTSSRRLSHSANSVAPSKVSISAEENVAMEEQKFSAPSFLRLLALNLPEWKQASF  663

Query  1861  GSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQH  1682
             G + AI FG VQP YA  +G MIS FF   H E++ +I+ + L F  L   S+ +N+ QH
Sbjct  664   GCLGAILFGGVQPVYAFVLGSMISVFFLKDHNEIKEKIKIYSLFFLGLTFFSLIINVIQH  723

Query  1681  YCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRLS  1502
             Y FAYMGEHLT+RIR RML KILTFE  WFD++ NSSGA+C+RL+ +A  V+S+V DR++
Sbjct  724   YNFAYMGEHLTKRIRERMLSKILTFEVGWFDQDENSSGAICSRLTKDADAVRSVVGDRIA  783

Query  1501  LLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSST  1322
             L+VQ  S+VTIA  MGLV+AW+LA+VMIAVQP+ I C+YTR VLL +++ K +KAQ+ S+
Sbjct  784   LVVQTMSAVTIAWTMGLVIAWRLAIVMIAVQPIIIACYYTRSVLLKSMSRKAIKAQDESS  843

Query  1321  QIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCWA  1142
             ++A +AV N R +T+F S  ++L + +  Q+ PR+E  ++S  AGIG+ +++ +     A
Sbjct  844   KLAADAVSNLRTITAFSSQERILKMLEKVQEGPRRENIRQSLFAGIGLSTSRSIMSCTLA  903

Query  1141  LDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILDR  962
             LD+WYGGKL++ G ++   +F+TF ILVSTG+VIADAGSMT DLAKGS ++ S+FA+LDR
Sbjct  904   LDYWYGGKLIAQGYMTYKAMFETFLILVSTGRVIADAGSMTMDLAKGSDSIRSVFAVLDR  963

Query  961   PSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGLV  782
              + I        D  G   EK++G +E++ V+FAYP+RP   + ++F + ++AG S  LV
Sbjct  964   CTKIEPE-----DPDGYRPEKITGHVELQDVDFAYPARPNVMVFKDFSINIEAGKSTALV  1018

Query  781   GKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIRD  602
             G+SGSGKSTI+ LIER+YD   G++R+DG D++S+++   R+ +ALVSQEP +++GTI++
Sbjct  1019  GQSGSGKSTIIGLIERYYDPLKGTVRIDGRDIKSYNLRSLRKCIALVSQEPTLFAGTIKE  1078

Query  601   NILFGKLDaseneii--eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaiara  428
             NI++G      NE    EAAKAANAH FIS LK GY+T CG+RGVQLSGGQKQRIAIARA
Sbjct  1079  NIIYGASSDKINESEIIEAAKAANAHDFISGLKDGYETWCGDRGVQLSGGQKQRIAIARA  1138

Query  427   iiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVSEG  248
             +++NP ILLLDEATSALD +SE+VVQEA++ +M+GRT++VVAHRL+ I++ D IA++ +G
Sbjct  1139  MLKNPAILLLDEATSALDSQSEKVVQEAIEHVMVGRTSVVVAHRLSAIQSCDLIAVLDKG  1198

Query  247   KVVEHGTYSQL  215
             K VE GT+S L
Sbjct  1199  K-VEMGTHSSL  1208



>ref|XP_006361363.1| PREDICTED: ABC transporter B family member 15-like [Solanum tuberosum]
Length=1216

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/1217 (51%), Positives = 852/1217 (70%), Gaps = 27/1217 (2%)
 Frame = -2

Query  3826  IIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNL  3647
             I  IF +AD +DI LM LG LGA+GDG S   +L+ ++ L N +G       +  +  N 
Sbjct  2     ITTIFMHADGVDILLMTLGFLGAVGDGASFPVMLIAIAKLMNIIG-----GLNTSNVLNF  56

Query  3646  MREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQE  3467
                + +  +  + +  A  +  F+EG+CW++T+ERQ  ++R +YL+A+LRQ+VG+FD   
Sbjct  57    RHNINENVMLLIYVACAKWIACFLEGFCWTRTAERQASRLRIRYLKAVLRQDVGYFDLHV  116

Query  3466  ATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVil  3287
             A+T+ +  S+S D+ +IQ+ +SEKVP+FL   S F+          WRL+L+A+P + +L
Sbjct  117   ASTANVIASVSGDSLVIQDCISEKVPLFLRDVSTFIGAYVVGFLMIWRLALIAFPMVFLL  176

Query  3286  iipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTI  3107
             +IP +IYG+ L+ +S+K   EYSKA  IV Q +SSI+T+YSF  ER  +E Y   LD  +
Sbjct  177   MIPSMIYGRALMRISRKMRDEYSKAGSIVEQVISSIRTVYSFVGERKSIEDYCVALDGCV  236

Query  3106  KLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
             +LG+K G+AKGL +GS G  FAI A +++YGSRL+M+ G  GG ++   ++  LGG+SL 
Sbjct  237   ELGVKQGLAKGLFIGSNGFGFAIRALMSYYGSRLVMYNGAHGGNVFMVTLAISLGGISLS  296

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
               L  +K F EA VA  R+   I RVPKID E+  G  LD + GE+EFK+++FAYPSRPE
Sbjct  297   SGLSNIKDFAEAKVANERVMEIIKRVPKIDSENMEGQTLDKMTGEIEFKHIEFAYPSRPE  356

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
             S+VLKD NLK+  GKTVALVG SGSGKST IALLQRFYD  +G I +DGV IN LQ KWL
Sbjct  357   SIVLKDFNLKIPRGKTVALVGGSGSGKSTVIALLQRFYDPLAGEILLDGVVINRLQPKWL  416

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGE  2387
             R QMGLVSQE ALF T+I+ENI+ GK   SME+V+ AA  +NAH+FI QLPQGY TKVGE
Sbjct  417   RSQMGLVSQEPALFATTIKENILFGKEDASMEQVIEAAKASNAHNFICQLPQGYYTKVGE  476

Query  2386  RGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVA  2207
             RG  +SGGQKQRIAIARAIIK+P ILLLDEATSALD+ SE +VQ+ALD AS GRTT++VA
Sbjct  477   RGIQMSGGQKQRIAIARAIIKSPRILLLDEATSALDTASEIVVQEALDNASIGRTTIIVA  536

Query  2206  HKLSTIRNADLIAVVSGGCIIEQGSHSELM--EKNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             H+LSTIRNADLIA+V  G + E GSH+EL+  ++N  YA + +LQ+       ++    +
Sbjct  537   HRLSTIRNADLIALVQNGQVKEIGSHNELIKNQENRLYASLVRLQQ------TEKPAGAT  590

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSP----SFSRLLGLNLTEWKQGL  1865
               + +QS  +      +     IE    V   +   PS     SF RLL +NL EWKQ  
Sbjct  591   IVSAQQSANRDDSKHTSIPCFSIEAKSTV--KNAAVPSTSGEGSFKRLLAMNLPEWKQAT  648

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
             +G I AI  G VQP Y+  +G MIS +FSPSH+E++ + + + L F  +  +++ LN+ Q
Sbjct  649   LGCIGAILVGGVQPVYSFVMGAMISVYFSPSHDEIKKKTKIYTLAFLGMTFITLVLNVLQ  708

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FA MGE L +R+R RML KILTFE  W+D+E NS+ A+C+RL++EA++V+SLV DR+
Sbjct  709   HYNFAVMGERLNKRVRERMLSKILTFEVGWYDKEQNSTAAICSRLADEASVVRSLVGDRM  768

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SL +Q  + +TIA ++GLV+AW+++LV+  VQP+ ILC Y ++VLL +++ K +KAQ  S
Sbjct  769   SLFIQTIAGMTIACMVGLVIAWRMSLVLFTVQPVIILCLYCKRVLLKSMSEKSIKAQEES  828

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             +++A EAV N R VT+F S  ++L +   AQ+ P +E+ ++SW AGI +G+   L    W
Sbjct  829   SKLAAEAVTNLRTVTAFSSQARILQMLKEAQEGPLRESIRQSWFAGIVLGTTNSLQSCTW  888

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             AL FWYGG L++ G I +  +F+TF +L S G VIAD G+MT DLA+G+ AV+S+FA LD
Sbjct  889   ALFFWYGGYLMAEGNIGAQALFQTFVLLSSNGLVIADLGTMTKDLARGTDAVSSVFATLD  948

Query  964   RPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIGL  785
             R S+I        D+ G    K++G IE+ +V+FAYP+RP   I + F + + AG S  L
Sbjct  949   RYSLIEPE-----DSDGYKPRKITGHIEMCEVDFAYPARPSVIIFKGFSITIDAGKSTAL  1003

Query  784   VGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTIR  605
             VG+SGSGKSTI+ LIERFYD   G I +DG D+RS+ +   R+ +ALVSQEP ++SGTIR
Sbjct  1004  VGQSGSGKSTIIGLIERFYDPLSGVINIDGRDIRSYHLKSLRKHIALVSQEPTLFSGTIR  1063

Query  604   DNILFGKL---DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             +NI +G L   +  E+EIIEAAKAAN H F+S+LK GYDT CG+RG+QLSGGQKQRIAIA
Sbjct  1064  ENIAYGVLASEEVDESEIIEAAKAANVHSFVSALKDGYDTWCGDRGLQLSGGQKQRIAIA  1123

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP +LLLDEATSALD +SE++VQ+AL+ +M+ RT++VVAHRL TI+N D+I ++ 
Sbjct  1124  RAILKNPGVLLLDEATSALDSQSEKLVQDALERVMVRRTSVVVAHRLCTIQNCDAIVVLD  1183

Query  253   EGKVVEHGTYSQLKNKR  203
             +GKVVE GT+S L   R
Sbjct  1184  KGKVVEKGTHSSLLANR  1200



>ref|XP_010425615.1| PREDICTED: ABC transporter B family member 18-like isoform X1 
[Camelina sativa]
Length=1226

 Score =  1133 bits (2931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/1213 (50%), Positives = 853/1213 (70%), Gaps = 22/1213 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GAIGDG  T  +    S L N  G         + +  
Sbjct  8     SIRSIFIHADGVDCILMALGLIGAIGDGFVTPMIFFVCSKLLNDFG------DFSVIDVT  61

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K +L  + +  A +V+ F+EGYCW++T ERQ  K+R KYL+A+LRQ+VG+FD  
Sbjct  62    FMQTISKNALVLLYVACASLVICFLEGYCWTRTGERQAAKLREKYLKAVLRQDVGYFDLH  121

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  S+S D+ +IQ+ +SEK+P FLM+TS F+          WRL++V +P IV+
Sbjct  122   VTSTSDVITSVSSDSLVIQDFISEKLPNFLMNTSAFVGSYIVGFVLLWRLTIVGFPFIVL  181

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+YG  L+ +S++  +EY+ A  I  QA+SS++T+Y+F +E+ ++ ++S+ L  +
Sbjct  182   LLIPGLMYGGALINISRRIREEYNGAGSIAEQAISSVRTVYAFGSEKKMIAKFSNALQGS  241

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G+++AIW F+ WYGSRL+M+ G  GG +         GG+SL
Sbjct  242   VKLGLRQGLAKGITIGSNGITYAIWGFMTWYGSRLVMNYGSKGGTVSTVTACVTFGGISL  301

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L  +K F+EA VA  R+   I R+P ID ++  G +L+T RGE++F +VKF YPSRP
Sbjct  302   GQSLLNLKTFSEAFVAGERMIKVIKRIPDIDSDNVEGQILETTRGEIDFNHVKFTYPSRP  361

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
              + + +D  L++ +GKTVALVG SGSGKST I+LLQRFYD  +G I +DGV I+ LQV W
Sbjct  362   LTPIFEDFCLRIPSGKTVALVGGSGSGKSTMISLLQRFYDPVAGEILLDGVPIHKLQVNW  421

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE  LF TSI ENI+  K   S+ EVV AA  +NAH FI Q   GY+T+VG
Sbjct  422   LRSQMGLVSQEPVLFATSITENILFSKEDASINEVVEAAKASNAHSFISQFTDGYKTQVG  481

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  LSGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD AS GRTT+++
Sbjct  482   ERGVQLSGGQKQRIAIARAIIKSPKILLLDEATSALDSESERVVQEALDNASVGRTTIII  541

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD+I VV  G I E GSH EL+EK +GHY  + +LQ Q    + D++   S
Sbjct  542   AHRLSTIRNADIICVVKNGRITETGSHDELLEKVDGHYTSLIRLQ-QKENKESDRNINVS  600

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTD----HHHQPSPSFSRLLGLNLTEWKQGL  1865
                G Q T  S     +    +  T+  + TD     +    PSF RL+ +N  EWK  L
Sbjct  601   VKEG-QVTSLSKDLKYSPKEFIRSTSSSIVTDLIPKDNRSRVPSFKRLMAMNRPEWKHAL  659

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitlnLCQ  1685
              G + A  FGAVQP YA + G M+S FF  SHEEM+ + + + LVF  L L +   N+ Q
Sbjct  660   SGCVGAGLFGAVQPIYAFSTGSMVSVFFLTSHEEMKEKTRIYALVFVGLALFTFLTNISQ  719

Query  1684  HYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVADRL  1505
             HY FAYMGE+LT+RIR  ML KILTFE  WFDE+ NSSGA+C+RL+N+A +V+SLV DR+
Sbjct  720   HYSFAYMGEYLTKRIREHMLGKILTFEVNWFDEDENSSGAVCSRLANDANVVRSLVGDRM  779

Query  1504  SLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQNSS  1325
             SLLVQ  SSV+I  ++GLV++W+ A+VMI+VQPL ++ FYT++VLL  ++   + AQ+ S
Sbjct  780   SLLVQTISSVSITCIIGLVISWRFAIVMISVQPLIVVSFYTKRVLLKRMSKNAINAQDES  839

Query  1324  TQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFMCW  1145
             T++A EAV N R +T+F S  +++ +F  AQ+ PR+E+ ++SWLAGI +G++Q L     
Sbjct  840   TKLAAEAVSNIRTITAFSSQERIIKLFKRAQEGPRRESVRQSWLAGIMLGTSQSLITGVS  899

Query  1144  ALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFAILD  965
             AL+FWYGG+LV++G++ S    + F I  STG++IA+AG+MT DLAKGS AV S+FA+LD
Sbjct  900   ALNFWYGGRLVADGKMVSKAFLELFLIFSSTGRIIAEAGTMTKDLAKGSDAVVSVFAVLD  959

Query  964   RPSII-TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSSIG  788
             R + I     +G V       +K+ G+I    V+FAYP+RP+  I + F ++++ G S  
Sbjct  960   RCTTIEPESLDGYVP------KKIKGQIRFLNVDFAYPTRPDVIIFKNFSIKIEEGKSTA  1013

Query  787   LVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSGTI  608
             +VG SGSGKSTI++LIERFYD   G +++D  D+RS+ +   R+ +ALVSQEP +++GTI
Sbjct  1014  IVGPSGSGKSTIISLIERFYDPLKGIVKIDDRDIRSYHLRSLRQHIALVSQEPTLFAGTI  1073

Query  607   RDNILFGKLDaseneii--eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             R+NI++G      NE    EAAKAANAH FI+ L  GYDT CG+RGVQLSGGQKQRIAIA
Sbjct  1074  RENIMYGGASNKINESEIIEAAKAANAHDFITLLSDGYDTYCGDRGVQLSGGQKQRIAIA  1133

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D+I ++ 
Sbjct  1134  RAVLKNPSVLLLDEATSALDSQSERVVQDALERLMVGRTSIVIAHRLSTIQNCDTITVLE  1193

Query  253   EGKVVEHGTYSQL  215
             +G+++E GT+S L
Sbjct  1194  KGEIIESGTHSSL  1206


 Score =   322 bits (825),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 214/560 (38%), Positives = 319/560 (57%), Gaps = 18/560 (3%)
 Frame = -2

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAF--FSPSHEEMQARIQKFCLVFAllcllsitlnL  1691
             +G I AI  G V P        +++ F  FS         I K  LV   +   S+ +  
Sbjct  26    LGLIGAIGDGFVTPMIFFVCSKLLNDFGDFSVIDVTFMQTISKNALVLLYVACASLVICF  85

Query  1690  CQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVAD  1511
              + YC+   GE    ++R + L+ +L  +  +FD    S+  +   +S+++ +++  +++
Sbjct  86    LEGYCWTRTGERQAAKLREKYLKAVLRQDVGYFDLHVTSTSDVITSVSSDSLVIQDFISE  145

Query  1510  RLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQN  1331
             +L   +   S+   + ++G V+ W+L +V      L ++        L  I+ +  +  N
Sbjct  146   KLPNFLMNTSAFVGSYIVGFVLLWRLTIVGFPFIVLLLIPGLMYGGALINISRRIREEYN  205

Query  1330  SSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTFM  1151
              +  IA +A+ + R V +FGS  K++  F NA     K   ++    GI IGS  G+T+ 
Sbjct  206   GAGSIAEQAISSVRTVYAFGSEKKMIAKFSNALQGSVKLGLRQGLAKGITIGS-NGITYA  264

Query  1150  CWALDFWYGGKLVSN-----GEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              W    WYG +LV N     G +S+     TF   +S G+ + +  + +     G   + 
Sbjct  265   IWGFMTWYGSRLVMNYGSKGGTVSTVTACVTFG-GISLGQSLLNLKTFSEAFVAGERMIK  323

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
              I  I   P I +    G++      LE   G+I+   V F YPSRP TPI  +FCL + 
Sbjct  324   VIKRI---PDIDSDNVEGQI------LETTRGEIDFNHVKFTYPSRPLTPIFEDFCLRIP  374

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
             +G ++ LVG SGSGKST+++L++RFYD   G I +DGV +    + W R QM LVSQEPV
Sbjct  375   SGKTVALVGGSGSGKSTMISLLQRFYDPVAGEILLDGVPIHKLQVNWLRSQMGLVSQEPV  434

Query  625   IYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             +++ +I +NILF K DAS NE++EAAKA+NAH FIS    GY T+ GERGVQLSGGQKQR
Sbjct  435   LFATSITENILFSKEDASINEVVEAAKASNAHSFISQFTDGYKTQVGERGVQLSGGQKQR  494

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSI  266
             IAIARAII++P ILLLDEATSALD ESE+VVQEALD   +GRTT+++AHRL+TI+N D I
Sbjct  495   IAIARAIIKSPKILLLDEATSALDSESERVVQEALDNASVGRTTIIIAHRLSTIRNADII  554

Query  265   ALVSEGKVVEHGTYSQLKNK  206
              +V  G++ E G++ +L  K
Sbjct  555   CVVKNGRITETGSHDELLEK  574


 Score =   300 bits (769),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 194/539 (36%), Positives = 303/539 (56%), Gaps = 30/539 (6%)
 Frame = -2

Query  3634  EKCSLY---FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y   FV L L   +    + Y ++   E    +IR   L  IL  EV +FD  E 
Sbjct  696   EKTRIYALVFVGLALFTFLTNISQHYSFAYMGEYLTKRIREHMLGKILTFEVNWFDEDEN  755

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  + + ++ D ++++ ++ +++ + +   S            SWR ++V      +++
Sbjct  756   SSGAVCSRLANDANVVRSLVGDRMSLLVQTISSVSITCIIGLVISWRFAIVMISVQPLIV  815

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSI------  3122
             +        L  +SK +     ++  +  +A+S+I+TI +F+++  I++ +         
Sbjct  816   VSFYTKRVLLKRMSKNAINAQDESTKLAAEAVSNIRTITAFSSQERIIKLFKRAQEGPRR  875

Query  3121  --LDRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYV  2948
               + ++   G+ +G ++ L  G + L+F       WYG RL+      G  +  A +   
Sbjct  876   ESVRQSWLAGIMLGTSQSLITGVSALNF-------WYGGRLV----ADGKMVSKAFLELF  924

Query  2947  LGGLSLGMALPE----VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFK  2780
             L   S G  + E     K   + S A   +F+ +DR   I+ E   G V   I+G++ F 
Sbjct  925   LIFSSTGRIIAEAGTMTKDLAKGSDAVVSVFAVLDRCTTIEPESLDGYVPKKIKGQIRFL  984

Query  2779  NVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDG  2600
             NV FAYP+RP+ ++ K+ ++K+E GK+ A+VG SGSGKST I+L++RFYD   G + ID 
Sbjct  985   NVDFAYPTRPDVIIFKNFSIKIEEGKSTAIVGPSGSGKSTIISLIERFYDPLKGIVKIDD  1044

Query  2599  VEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFI  2426
              +I +  ++ LR  + LVSQE  LF  +IRENIM G     + E  ++ AA  ANAHDFI
Sbjct  1045  RDIRSYHLRSLRQHIALVSQEPTLFAGTIRENIMYGGASNKINESEIIEAAKAANAHDFI  1104

Query  2425  RQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDAL  2246
               L  GY+T  G+RG  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE++VQDAL
Sbjct  1105  TLLSDGYDTYCGDRGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDAL  1164

Query  2245  DQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKN--GHYAQMAKLQR  2075
             ++   GRT++V+AH+LSTI+N D I V+  G IIE G+HS L+     G Y  +  LQR
Sbjct  1165  ERLMVGRTSIVIAHRLSTIQNCDTITVLEKGEIIESGTHSSLLANGPVGAYFSLVSLQR  1223



>ref|XP_003622707.1| ABC transporter B family member [Medicago truncatula]
 gb|AES78925.1| ABC transporter B family protein [Medicago truncatula]
Length=1241

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/1220 (51%), Positives = 870/1220 (71%), Gaps = 23/1220 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD  D FLM LGT+GAIG+G +   +L   SH+ N +G     S S +    
Sbjct  16    SIRSIFMHADGEDWFLMILGTIGAIGEGFNAPLILYICSHMINNIG-----SSSTMDVDT  70

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              +  + K +L ++ L  A  ++ F+EGYCW++TS RQ  ++RYKYL+A+LRQEV +FD Q
Sbjct  71    FIHNINKNALVWLYLACATFLVCFLEGYCWTRTSGRQAARMRYKYLKAVLRQEVAYFDLQ  130

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TSEI  S+S DT +IQ+VLSEKVP FLM+ S+F+     +    WR+++VA+P++++
Sbjct  131   VTSTSEIITSVSNDTIVIQDVLSEKVPNFLMNISLFIGSYIVAFTMLWRMAIVAFPSVIL  190

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPG+IYGK L+ LS K  +EY++A  I  Q +S+I+T+YSF  E   +  +S+ L   
Sbjct  191   LVIPGIIYGKVLMGLSCKIREEYNQAGTIAEQTISTIRTVYSFVGENKSMFAFSNALQGI  250

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             + LG+K G+AKGLA+GS G+ FAIW+F+ +YGS+L+M+ G  GG ++A G S  +GGL L
Sbjct  251   VNLGLKQGLAKGLAIGSNGVVFAIWSFMCYYGSKLVMYHGAKGGTVFAVGASITVGGLGL  310

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L  +KYF+EA  A  RI   I+RVPKID  +  G +L+ + GE+EF +V+FAYP+RP
Sbjct  311   GASLLNIKYFSEACSAGERIKRVIERVPKIDSNNTKGEILNNVFGEVEFDHVEFAYPTRP  370

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+++LK+L LK+ AGKT+ALVG SGSGKST I+LLQRFYD   G I +DGV I  LQ+KW
Sbjct  371   ETIILKNLCLKIPAGKTMALVGESGSGKSTVISLLQRFYDPIGGEIRLDGVAIRNLQIKW  430

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR  MGLVSQE ALF TSI+ENI+ GK   + +E+V AA   NAHDFI  LPQGY T+VG
Sbjct  431   LRSMMGLVSQEPALFATSIKENIIFGKEDATEDEIVEAAKICNAHDFISLLPQGYNTQVG  490

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  LSGGQKQRIAIARAIIK P I LLDEATSALD+ESEK+VQ AL+ A+ G T +++
Sbjct  491   ERGIQLSGGQKQRIAIARAIIKKPRIFLLDEATSALDTESEKMVQQALENATNGCTAIII  550

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELME-KNGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTI+NAD++AVV  G + E GS  EL+E +NG Y+ + +LQ+      Q      +
Sbjct  551   AHRLSTIQNADIVAVVDDGRVNEIGSQDELLENENGIYSSLVRLQQTNKSKTQSDETVTA  610

Query  2032  SNAGRQSTEKsspavlassplLIETAQKVPTDHHHQP------SP-SFSRLLGLNLTEWK  1874
             +     +         +S+   I   Q   +++ ++       +P SF RLL LN  EWK
Sbjct  611   TFTNVDTDITCLVDPTSSAEDHISVHQASTSNNKNEEDVKQLNNPVSFWRLLLLNAPEWK  670

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
             Q ++G +SA+ FGAVQP YA  +G MIS +F   +EE++ +I+ + L F  L L+S+ +N
Sbjct  671   QAVLGCLSAMVFGAVQPVYAFAMGSMISVYFQTDYEELKNKIKIYSLCFLCLSLISLVVN  730

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY FAYMGE+LT+R+R  M  K+LTFE  WFD E NSSGA+C+RL+N+A +V+SLV 
Sbjct  731   VGQHYNFAYMGEYLTKRVRESMFSKMLTFEVGWFDREENSSGAICSRLANDANVVRSLVG  790

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++LLVQA S+V  A  MGL+++W+L LVMIA+QP+ I CFYTR VLL ++++K +KAQ
Sbjct  791   DRMALLVQAFSAVATAYTMGLIISWRLNLVMIAIQPIIIACFYTRSVLLKSMSSKSMKAQ  850

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
               S++IA EAV NHR +T+F S +++L + + +Q +P +E  ++SW AGIG+G +Q L  
Sbjct  851   QQSSKIAAEAVSNHRTITAFSSQDRILKMLETSQQDPIQENFRQSWFAGIGLGFSQFLLS  910

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               WA+++WYG KLV++G I+   +F++F ++VSTG+VI DAGSMT DLAKG   V+SIFA
Sbjct  911   CSWAMNYWYGAKLVADGNITRKALFESFMVVVSTGRVIGDAGSMTKDLAKGVDVVSSIFA  970

Query  973   ILDRPSIITSPYNGKVDN-GGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             ILDR + I      K DN  G   + L G IE+  V+FAYP+RP   I + F ++++AG 
Sbjct  971   ILDRSTKI------KPDNPNGFKPDTLMGHIELYDVHFAYPARPNVAIFQGFSIKIEAGK  1024

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  LVG+SGSGKSTI+ LIERFYD   G++ +DG +++S+++   R+ +ALVSQEP + +
Sbjct  1025  STALVGQSGSGKSTIIGLIERFYDPIKGNVTIDGTNIKSYNLKSLRKHIALVSQEPTLIN  1084

Query  616   GTIRDNILFGKL---DaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQr  446
             GTIRDNI +G     +  E EIIEA++ ANAH FI+SLK GY+T CG++GVQLSGGQKQR
Sbjct  1085  GTIRDNIAYGTTTCDNIDETEIIEASRVANAHDFIASLKDGYETWCGDKGVQLSGGQKQR  1144

Query  445   iaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSI  266
             IAIARA+++NP +LLLDEATSALD  SE+VVQ+AL+ +M+GRT++VVAHRL+TI N D I
Sbjct  1145  IAIARAMLKNPKVLLLDEATSALDNNSEKVVQDALNKVMVGRTSVVVAHRLSTIHNCDVI  1204

Query  265   ALVSEGKVVEHGTYSQLKNK  206
             A++ +GK+VE GT+  L +K
Sbjct  1205  AVLEKGKMVEIGTHKALLDK  1224



>gb|KHG27894.1| ABC transporter B family member 15 [Gossypium arboreum]
Length=1246

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/1226 (52%), Positives = 852/1226 (69%), Gaps = 48/1226 (4%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D+ LM +G +GA+ DG     ++     +FN++G     +    S G 
Sbjct  31    SISSIFMHADGVDMCLMVVGFIGAVADGTVGPLIIYLTGRMFNSVG----GANEASSVGI  86

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
             L+ +V + +LY VL      V  F+EG+CW++T ERQ  ++R +YL+A+LRQ+VG+FD  
Sbjct  87    LVHDVREVALYVVLSACGGWVGSFLEGFCWTRTGERQATRMRTRYLKAVLRQDVGYFDLN  146

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFS-WRLSLVAYPTIV  3293
               +T+E+  S+S D+ +IQEV+SEKVP  +   S F+ G   + + + WRL+LV +P++ 
Sbjct  147   VTSTAEVVTSVSNDSLIIQEVISEKVPNLIARGSTFI-GTYIAAFLTLWRLALVIFPSVF  205

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             +L++P LIYGK LL L++K   EY+KA+ IV QA++SI+T+Y+F  E      +S  L  
Sbjct  206   LLVVPSLIYGKILLSLARKIRVEYNKASTIVEQAIASIRTVYAFVGENKTTTEFSEALQG  265

Query  3112  TIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLS  2933
             ++KLG++ G+AKGLA+GS G++FAIWAF+ +YGSR++M+ G  GG I+  G     GG  
Sbjct  266   SLKLGLRQGLAKGLAIGSNGITFAIWAFITYYGSRMVMYHGAQGGTIFIVGTCIATGGQQ  325

Query  2932  LGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSR  2753
             LG +L  +K  +EA  AA RI   I R PKID ++  G +LD I GE+EFK V+FAYPSR
Sbjct  326   LGTSLSNLKPLSEACSAAERINEVIRRTPKIDVDNMEGEILDNILGEIEFKQVEFAYPSR  385

Query  2752  PESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVK  2573
             PES++ K+  LK+ AGKTVALVG+SGSGKST I+LL+RFYD   G I +DGV IN LQ+K
Sbjct  386   PESIIFKNFCLKIPAGKTVALVGSSGSGKSTVISLLERFYDPLGGEILVDGVSINKLQLK  445

Query  2572  WLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKV  2393
             WLR QMGLVSQE  LF T+I+ENI+ GK    MEEV+ AA  +NAH+FI QLPQGY+T+V
Sbjct  446   WLRSQMGLVSQEPTLFATTIKENILFGKEDAGMEEVIEAAKASNAHNFISQLPQGYDTQV  505

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             GERG  +SGGQKQRIAIARA+IK P ILLLDEATSALDSESE++VQ AL++AS GRTT++
Sbjct  506   GERGVQMSGGQKQRIAIARAMIKAPKILLLDEATSALDSESERIVQQALNEASVGRTTII  565

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELM-EKNGHYAQMAKLQRQFSCADQD---QS  2045
             VAH+LSTIR+ADLI VV  G ++E GSH ELM  +NG Y  + +LQ+      QD   + 
Sbjct  566   VAHRLSTIRHADLIVVVKDGQVMEMGSHDELMVNENGFYPMLVQLQQTEQVKVQDKGNKD  625

Query  2044  FAPSSNAGRQSTE-KsspavlassplLIETAQKVPTDH-----------HHQPSPSFSRL  1901
              + +++A   +TE   + +   S P    +A  V  DH               +PSF RL
Sbjct  626   LSTNNSAYITNTEINITSSRRLSLPSRTSSANSVAPDHASLVGEMNVENKKTSAPSFRRL  685

Query  1900  LGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAl  1721
             L L L EWKQ  +G +SAI FGAVQP  A T+  MIS FF   H E++ +I         
Sbjct  686   LALTLPEWKQATLGCLSAILFGAVQPLSAFTMASMISIFFLTDHGEIKEKI---------  736

Query  1720  lcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNE  1541
                        +HY F+YMGEHLT+RIR +ML K+LTFE  WFD++ NSSG +CARL  +
Sbjct  737   -----------KHYNFSYMGEHLTKRIREKMLSKVLTFEVGWFDQDENSSGTVCARLEKD  785

Query  1540  AAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLST  1361
             A +V+SL  D +SLLVQ  S VTIA  MG+ +AW+LA+VMI VQPL IL  YT+ V+L  
Sbjct  786   ATVVRSLFGDVVSLLVQTISGVTIACAMGIFIAWRLAIVMIVVQPLIILSMYTKMVILKK  845

Query  1360  ITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIG  1181
             ++ K  KAQ  S+++A EAV NHR +T+F S ++++ +   AQ+ PRKE  ++SW AG+G
Sbjct  846   MSVKARKAQQESSKLAAEAVSNHRTITAFSSQDQIMKMLQAAQEVPRKENVRQSWFAGLG  905

Query  1180  IGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKG  1001
             +GSAQ LT    A DFWYGGKL+S G I++  + +TF ILVSTG VIA A SMTSD+AK 
Sbjct  906   LGSAQLLTACIMAFDFWYGGKLISQGYITAKALIETFLILVSTGVVIAQAASMTSDMAKS  965

Query  1000  SAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREF  821
             +  V S+FAILDR + I        ++ G   ++++G +EI  V FAYP+RP   IL++F
Sbjct  966   AEVVRSLFAILDRCTRIEPD-----ESSGYLAQEITGCVEICDVEFAYPARPNVSILKDF  1020

Query  820   CLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALV  641
              + ++AG S  LVG+SGSGKST+++LIERFYD   G +++DG D++S+++   R+ +ALV
Sbjct  1021  SISIEAGKSTALVGQSGSGKSTVISLIERFYDPVKGVVKIDGRDIKSYNLRSLRKHIALV  1080

Query  640   SQEPVIYSGTIRDNILFGKLDas-eneiieaakaanAHQFISSLKKGYDTECGERGVQLS  464
             SQEP ++S TIR+NIL+G  D   E+EIIEAAKAANAH FI+ L  GYDT CG+RG+QLS
Sbjct  1081  SQEPTLFSSTIRENILYGAPDKIDESEIIEAAKAANAHDFIAGLVDGYDTWCGDRGLQLS  1140

Query  463   GGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTI  284
             GGQKQRIAIARAI+RNP +LLLDEATSALD +SE+VVQEAL+ +M+GRT++VVAHRL+TI
Sbjct  1141  GGQKQRIAIARAILRNPAMLLLDEATSALDSKSEKVVQEALERVMVGRTSVVVAHRLSTI  1200

Query  283   KNLDSIALVSEGKVVEHGTYSQLKNK  206
             KN D I ++ +GKVVE G +S L  K
Sbjct  1201  KNCDLIVVLDKGKVVEKGNHSSLLAK  1226



>ref|XP_006292607.1| hypothetical protein CARUB_v10018848mg [Capsella rubella]
 gb|EOA25505.1| hypothetical protein CARUB_v10018848mg [Capsella rubella]
Length=1232

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/1226 (50%), Positives = 862/1226 (70%), Gaps = 42/1226 (3%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+ LM LG +GAI DG  T         L N +G       S++ +   M  
Sbjct  8     IFMHADGVDLVLMGLGLIGAIADGFITPITFFITGLLLNNIG------GSKVGDEKFMHA  61

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + +  A +V+ F+EGYCW++T ERQ  ++R +YL A+LRQ+VG+FD    +T
Sbjct  62    IMKNAVALLYVAGASLVICFVEGYCWTRTGERQASRMRERYLRAVLRQDVGYFDLHVTST  121

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S DT +IQ+VLSEK+P FLM+ S F++      +  WRL++V +P  ++L+IP
Sbjct  122   SDVITSVSSDTLVIQDVLSEKLPNFLMNASAFVASYIVGFFMLWRLAIVGFPFFILLLIP  181

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+ G+ L+ +S+K  +EY+ A  I  QA+S ++T+Y+F +E+ ++ ++S+ L   +KLG
Sbjct  182   GLMCGRVLISISRKIREEYNVAGSIAEQAISLVRTVYAFGSEKKMISKFSAALQGLVKLG  241

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS G+ FAIW F+ WYGSR++M+ G  GG I+A  I    GG S G  L
Sbjct  242   LRQGLAKGIAIGSNGIVFAIWGFMTWYGSRMVMYHGAKGGTIFAVIICITFGGTSFGRGL  301

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +KY +EA VA  +I   I RVP ID ++  G +L  ++GE+EFK+VKF YPSRPE+ +
Sbjct  302   SNLKYLSEAVVAGEKIIKVIKRVPNIDSDNTDGKILQNVKGEVEFKHVKFMYPSRPETSI  361

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               D  LK+ +GKTVALVGASGSGKS+ I+LLQRFYD   G I IDGV I+ LQVKWLR Q
Sbjct  362   FDDFCLKIPSGKTVALVGASGSGKSSVISLLQRFYDPIGGDILIDGVSISKLQVKWLRSQ  421

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF TSI ENI+ GK   SM+EVV AA ++NAHDFI   P GY+T+VGERG 
Sbjct  422   MGLVSQEPALFATSIEENILFGKEDASMDEVVEAAKSSNAHDFISHFPFGYKTQVGERGV  481

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDS+SE++VQ+ALD AS GRTT+V+ H+L
Sbjct  482   QMSGGQKQRIAIARAIIKSPTILLLDEATSALDSKSERVVQEALDNASIGRTTIVITHRL  541

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQ-----------------RQ  2072
             STIRN D+I V   G I+E GSH +LME   G Y+ + +LQ                  Q
Sbjct  542   STIRNVDVICVFHNGRIVESGSHEDLMENLEGQYSSLVRLQLIENEELDDNNKVSLQRDQ  601

Query  2071  FSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQPSPSFSRLLGL  1892
              S + +D  ++P      + + ++   +  SS         +P D      PSF RL+ +
Sbjct  602   LSISSKDLKYSP------RISNQNLSNLFMSSSTDTNLCASIPKDKK-TLVPSFKRLMAM  654

Query  1891  NLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcl  1712
             N  EWK  L G +SA  +GA+QPTY+   G M+S +F  SH+E++   + + L+F  L +
Sbjct  655   NKPEWKHALYGCLSAALYGAIQPTYSYVSGSMVSVYFLKSHDEIKENTRIYVLLFFGLSM  714

Query  1711  lsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAM  1532
              S  +++ QHY FAYMGE+LT+RIR  +L K+LTFE +WFDEE NSSG +C+RL+ +A +
Sbjct  715   FSFVISIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEEENSSGVICSRLAKDANV  774

Query  1531  VKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITT  1352
             V+SLV +R+SLLVQ  S+V+IA  +G+V+AWK A+VMIAVQP+ +LCFY ++++L +++ 
Sbjct  775   VRSLVGERVSLLVQTISAVSIACTLGMVIAWKFAIVMIAVQPVVVLCFYGQRIVLKSLSI  834

Query  1351  KFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGS  1172
             K ++AQ+ S+++A EAV N R +T+F S  ++L + +  QD PR+E  ++SWLAGI +G+
Sbjct  835   KAIEAQDESSKLAAEAVSNIRTITAFSSQERILKLLERVQDGPRRENIRQSWLAGIVLGT  894

Query  1171  AQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAA  992
             ++ L      L+FWYG +L+++G+I+S   F+ F + VSTG+VIA+AG+MT+DLAKGS A
Sbjct  895   SRCLMTSISVLNFWYGSRLIADGKITSKAFFELFIVFVSTGRVIAEAGAMTTDLAKGSDA  954

Query  991   VASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLE  812
             VAS+FA+LDR + I  P N      G+  E + G+I    V+FAYP+RP+  IL+   +E
Sbjct  955   VASVFAVLDRCTTI-EPENPD----GSQPENIKGQISFVNVDFAYPTRPDVMILKNISME  1009

Query  811   VKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQE  632
             +  G S  +VG SGSGKSTI+ LIERFYD   GS+++DG D+RS+++   R+ +ALVSQE
Sbjct  1010  INEGKSTAIVGPSGSGKSTIIGLIERFYDPLKGSVKIDGRDIRSYNLRLLRQHIALVSQE  1069

Query  631   PVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLS  464
             PV+++GTIR+NI+FG    K+D  E E+IEAAKAANAH FI SL  GY+T CG+RG+QLS
Sbjct  1070  PVLFAGTIRENIIFGGTSDKID--ETEVIEAAKAANAHSFILSLSNGYETYCGDRGIQLS  1127

Query  463   GGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTI  284
             GGQKQRIAIARA+++NP++LLLDEATSALD +SE++VQ+AL+ +M+GRT++V+AHRL+TI
Sbjct  1128  GGQKQRIAIARAVLKNPSVLLLDEATSALDNQSERIVQDALERLMVGRTSVVIAHRLSTI  1187

Query  283   KNLDSIALVSEGKVVEHGTYSQLKNK  206
             +  D I+++ +G+VVE GT++ L  K
Sbjct  1188  QKCDMISVLDKGEVVECGTHASLIGK  1213


 Score =   305 bits (780),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 189/530 (36%), Positives = 314/530 (59%), Gaps = 7/530 (1%)
 Frame = -2

Query  3640  EVEKCSLYFVLL--GLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDS  3473
             E+++ +  +VLL  GL++   V+  ++ Y ++   E    +IR   L  +L  EV +FD 
Sbjct  697   EIKENTRIYVLLFFGLSMFSFVISIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDE  756

Query  3472  QEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIV  3293
             +E ++  I + ++KD ++++ ++ E+V + +   S            +W+ ++V      
Sbjct  757   EENSSGVICSRLAKDANVVRSLVGERVSLLVQTISAVSIACTLGMVIAWKFAIVMIAVQP  816

Query  3292  iliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDR  3113
             ++++        L  LS K+ +   +++ +  +A+S+I+TI +F+++  IL+    + D 
Sbjct  817   VVVLCFYGQRIVLKSLSIKAIEAQDESSKLAAEAVSNIRTITAFSSQERILKLLERVQDG  876

Query  3112  TIKLGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGL  2936
               +  ++     G+ +G S  L  +I     WYGSRLI     +    +   I +V  G 
Sbjct  877   PRRENIRQSWLAGIVLGTSRCLMTSISVLNFWYGSRLIADGKITSKAFFELFIVFVSTGR  936

Query  2935  SLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPS  2756
              +  A        + S A + +F+ +DR   I+ E+  G   + I+G++ F NV FAYP+
Sbjct  937   VIAEAGAMTTDLAKGSDAVASVFAVLDRCTTIEPENPDGSQPENIKGQISFVNVDFAYPT  996

Query  2755  RPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQV  2576
             RP+ ++LK++++++  GK+ A+VG SGSGKST I L++RFYD   GS+ IDG +I +  +
Sbjct  997   RPDVMILKNISMEINEGKSTAIVGPSGSGKSTIIGLIERFYDPLKGSVKIDGRDIRSYNL  1056

Query  2575  KWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFIRQLPQGYE  2402
             + LR  + LVSQE  LF  +IRENI+ G     ++E  V+ AA  ANAH FI  L  GYE
Sbjct  1057  RLLRQHIALVSQEPVLFAGTIRENIIFGGTSDKIDETEVIEAAKAANAHSFILSLSNGYE  1116

Query  2401  TKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRT  2222
             T  G+RG  LSGGQKQRIAIARA++KNP +LLLDEATSALD++SE++VQDAL++   GRT
Sbjct  1117  TYCGDRGIQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDNQSERIVQDALERLMVGRT  1176

Query  2221  TLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQ  2072
             ++V+AH+LSTI+  D+I+V+  G ++E G+H+ L+ K       + + RQ
Sbjct  1177  SVVIAHRLSTIQKCDMISVLDKGEVVECGTHASLIGKGSTGIYFSLVSRQ  1226



>ref|XP_010514540.1| PREDICTED: ABC transporter B family member 22-like isoform X1 
[Camelina sativa]
Length=1232

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/1224 (49%), Positives = 860/1224 (70%), Gaps = 30/1224 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D+ LM LG+LGAI DG  T         L N +G       S +++  
Sbjct  6     SIRSIFMHADSVDLMLMGLGSLGAIADGFITPITFFITGLLLNNIG------GSSVADET  59

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M  + K  +  + +  A +V+ F+EGYCW++T ERQ  ++R +YL A+LRQ+VG+FD  
Sbjct  60    FMHSIMKNVVALLYVASASLVICFVEGYCWTRTGERQSSRMRKRYLRAVLRQDVGYFDLH  119

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
              A+TS++  S+S DT +IQ+VLSEK+P FLM+ S F++         WRL++V +P  ++
Sbjct  120   VASTSDVITSVSSDTLVIQDVLSEKLPNFLMNASAFVASYIVGFIMLWRLTIVGFPFFIV  179

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L+IPGL+ G+ L+ +S+K  +EY++A  I  QA+S ++T+Y+F +ER +  ++S+ L  +
Sbjct  180   LLIPGLVCGRALISISRKIREEYNEAGTIAEQAISLVRTVYAFGSERKMKSKFSAALQGS  239

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G+ +AIW F+ WYGSR++M+ G  GG I+A  I    GG SL
Sbjct  240   VKLGLQQGLAKGITIGSNGIVYAIWGFMTWYGSRMVMYHGAKGGTIFATIICITYGGSSL  299

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G  L  +KYF+EA+VA  RI   I RVP ID ++K G +L  ++GE+EFK+VKF YPSRP
Sbjct  300   GRGLLNLKYFSEAAVAGERIIKVIKRVPNIDSDNKDGQILHKVKGEVEFKHVKFMYPSRP  359

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  D  LKV +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKW
Sbjct  360   ETSICDDFCLKVPSGKTVALVGGSGSGKSTVISLLQRFYDPVAGDILIDGVSISKLQVKW  419

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE ALF TSI+ENI+ GK   SM+EVV AA  +NAH+FI Q P  Y+T+VG
Sbjct  420   LRSQMGLVSQEPALFATSIQENILFGKEDASMDEVVEAAKASNAHNFISQFPHAYKTQVG  479

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P +LLLDEATSALDSESE++VQ+ALD AS GRTT+V+
Sbjct  480   ERGIQMSGGQKQRIAIARAIIKSPTLLLLDEATSALDSESERVVQEALDNASIGRTTIVI  539

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSFAPS  2033
             AH+LSTIRNAD I VV  GCI+E GSH EL++  +G YA +  LQ Q    +++ +   S
Sbjct  540   AHRLSTIRNADFICVVHNGCIVETGSHEELVKNLDGQYAFLTSLQ-QLGNEERNDNINVS  598

Query  2032  SNAGRQS--------TEKsspavlassplLIETAQKVP---TDHHHQPSPSFSRLLGLNL  1886
             +  G+ S        + K S    ++      T   +P           PSF RL+ +N 
Sbjct  599   TQGGQVSILNQDLKYSPKISIQSRSNLFSTSSTDTNLPGLTLKDKKTLKPSFKRLMAMNK  658

Query  1885  TEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllclls  1706
              EWK  L G +SA  +GA+QP Y+   G M+S +F  SH+E++ + + + L+F  L + S
Sbjct  659   PEWKHALYGCLSAALYGAIQPLYSYVSGSMVSVYFLTSHDEIKEKARVYVLLFLGLAIFS  718

Query  1705  itlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVK  1526
               +++ QHY FAYMGE+LT+R+R  ++ K+LTFE +WFDEE NSSG +C+RL+ +A +V+
Sbjct  719   FVISIIQHYSFAYMGEYLTKRVRENIISKLLTFEVSWFDEEENSSGVICSRLAKDANVVR  778

Query  1525  SLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKF  1346
             SLV +R+SLLVQ  S+V+IA  +G+V+AWK A+VMIAVQP+ +LCFY  +++L +++ K 
Sbjct  779   SLVGERVSLLVQTISAVSIACTLGMVIAWKFAIVMIAVQPVVVLCFYGHRIILKSLSQKA  838

Query  1345  VKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQ  1166
             ++AQ+ S+++A EAV N R +TSF S  +++ + +  Q+ PR+E  ++SWLAGI + +++
Sbjct  839   IEAQDESSKLAAEAVSNIRTITSFSSQERIIKLLERVQEGPRRENIRQSWLAGIVLAASR  898

Query  1165  GLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVA  986
              +      L+FWYG +L+++G+I S + F+ F + VSTG+VIADAG+MT+DLAKGS AV 
Sbjct  899   SVMTCISVLNFWYGSRLIADGKIMSKEFFELFIVFVSTGRVIADAGAMTTDLAKGSDAVM  958

Query  985   SIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVK  806
             S+FA+LDR + I  P N      G   EK+ G+I    V+FAYP+RP+  I + F +E+ 
Sbjct  959   SVFAVLDRCTTI-EPEN----TDGYLPEKMKGQIRFVNVDFAYPTRPDVIIFKNFSIEIN  1013

Query  805   AGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPV  626
              G S  +VG SGSGKST+++LIERFYD   G +++DG D++S+ +   R+ +ALVSQEPV
Sbjct  1014  EGKSTAIVGTSGSGKSTVISLIERFYDPLNGIVKIDGRDIKSYHLRSLRQHIALVSQEPV  1073

Query  625   IYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGG  458
             +++GTIR+NI++G    K+D SE  +   A  A+   FI SL  GYDT CG+RG+QLSGG
Sbjct  1074  LFAGTIRENIMYGGISDKIDESEVIVAAKAANAH--AFILSLSNGYDTYCGDRGIQLSGG  1131

Query  457   QKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKN  278
             QKQRIAIARA++RNP++LLLDEATSALD +SE++VQ+AL+ +++GRT++V+AHRL+TI+N
Sbjct  1132  QKQRIAIARAVLRNPSVLLLDEATSALDNQSERIVQDALECLLVGRTSVVIAHRLSTIQN  1191

Query  277   LDSIALVSEGKVVEHGTYSQLKNK  206
              D I ++ +G+VVE GT+S L  K
Sbjct  1192  CDMITVLDKGEVVESGTHSSLLGK  1215



>ref|XP_010425616.1| PREDICTED: ABC transporter B family member 18-like isoform X2 
[Camelina sativa]
Length=1229

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/1216 (50%), Positives = 853/1216 (70%), Gaps = 25/1216 (2%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GAIGDG  T  +    S L N  G         + +  
Sbjct  8     SIRSIFIHADGVDCILMALGLIGAIGDGFVTPMIFFVCSKLLNDFG------DFSVIDVT  61

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFM---EGYCWSKTSERQVLKIRYKYLEAILRQEVGFF  3479
              M+ + K +L  + +  A +V+ F+   EGYCW++T ERQ  K+R KYL+A+LRQ+VG+F
Sbjct  62    FMQTISKNALVLLYVACASLVICFLGKSEGYCWTRTGERQAAKLREKYLKAVLRQDVGYF  121

Query  3478  DSQEATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPT  3299
             D    +TS++  S+S D+ +IQ+ +SEK+P FLM+TS F+          WRL++V +P 
Sbjct  122   DLHVTSTSDVITSVSSDSLVIQDFISEKLPNFLMNTSAFVGSYIVGFVLLWRLTIVGFPF  181

Query  3298  IViliipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSIL  3119
             IV+L+IPGL+YG  L+ +S++  +EY+ A  I  QA+SS++T+Y+F +E+ ++ ++S+ L
Sbjct  182   IVLLLIPGLMYGGALINISRRIREEYNGAGSIAEQAISSVRTVYAFGSEKKMIAKFSNAL  241

Query  3118  DRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGG  2939
               ++KLG++ G+AKG+ +GS G+++AIW F+ WYGSRL+M+ G  GG +         GG
Sbjct  242   QGSVKLGLRQGLAKGITIGSNGITYAIWGFMTWYGSRLVMNYGSKGGTVSTVTACVTFGG  301

Query  2938  LSLGMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYP  2759
             +SLG +L  +K F+EA VA  R+   I R+P ID ++  G +L+T RGE++F +VKF YP
Sbjct  302   ISLGQSLLNLKTFSEAFVAGERMIKVIKRIPDIDSDNVEGQILETTRGEIDFNHVKFTYP  361

Query  2758  SRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQ  2579
             SRP + + +D  L++ +GKTVALVG SGSGKST I+LLQRFYD  +G I +DGV I+ LQ
Sbjct  362   SRPLTPIFEDFCLRIPSGKTVALVGGSGSGKSTMISLLQRFYDPVAGEILLDGVPIHKLQ  421

Query  2578  VKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYET  2399
             V WLR QMGLVSQE  LF TSI ENI+  K   S+ EVV AA  +NAH FI Q   GY+T
Sbjct  422   VNWLRSQMGLVSQEPVLFATSITENILFSKEDASINEVVEAAKASNAHSFISQFTDGYKT  481

Query  2398  KVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTT  2219
             +VGERG  LSGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD AS GRTT
Sbjct  482   QVGERGVQLSGGQKQRIAIARAIIKSPKILLLDEATSALDSESERVVQEALDNASVGRTT  541

Query  2218  LVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQRQFSCADQDQSF  2042
             +++AH+LSTIRNAD+I VV  G I E GSH EL+EK +GHY  + +LQ Q    + D++ 
Sbjct  542   IIIAHRLSTIRNADIICVVKNGRITETGSHDELLEKVDGHYTSLIRLQ-QKENKESDRNI  600

Query  2041  APSSNAGRQSTEKsspavlassplLIETAQKVPTD----HHHQPSPSFSRLLGLNLTEWK  1874
               S   G Q T  S     +    +  T+  + TD     +    PSF RL+ +N  EWK
Sbjct  601   NVSVKEG-QVTSLSKDLKYSPKEFIRSTSSSIVTDLIPKDNRSRVPSFKRLMAMNRPEWK  659

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
               L G + A  FGAVQP YA + G M+S FF  SHEEM+ + + + LVF  L L +   N
Sbjct  660   HALSGCVGAGLFGAVQPIYAFSTGSMVSVFFLTSHEEMKEKTRIYALVFVGLALFTFLTN  719

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY FAYMGE+LT+RIR  ML KILTFE  WFDE+ NSSGA+C+RL+N+A +V+SLV 
Sbjct  720   ISQHYSFAYMGEYLTKRIREHMLGKILTFEVNWFDEDENSSGAVCSRLANDANVVRSLVG  779

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR+SLLVQ  SSV+I  ++GLV++W+ A+VMI+VQPL ++ FYT++VLL  ++   + AQ
Sbjct  780   DRMSLLVQTISSVSITCIIGLVISWRFAIVMISVQPLIVVSFYTKRVLLKRMSKNAINAQ  839

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + ST++A EAV N R +T+F S  +++ +F  AQ+ PR+E+ ++SWLAGI +G++Q L  
Sbjct  840   DESTKLAAEAVSNIRTITAFSSQERIIKLFKRAQEGPRRESVRQSWLAGIMLGTSQSLIT  899

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
                AL+FWYGG+LV++G++ S    + F I  STG++IA+AG+MT DLAKGS AV S+FA
Sbjct  900   GVSALNFWYGGRLVADGKMVSKAFLELFLIFSSTGRIIAEAGTMTKDLAKGSDAVVSVFA  959

Query  973   ILDRPSII-TSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGS  797
             +LDR + I     +G V       +K+ G+I    V+FAYP+RP+  I + F ++++ G 
Sbjct  960   VLDRCTTIEPESLDGYVP------KKIKGQIRFLNVDFAYPTRPDVIIFKNFSIKIEEGK  1013

Query  796   SIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYS  617
             S  +VG SGSGKSTI++LIERFYD   G +++D  D+RS+ +   R+ +ALVSQEP +++
Sbjct  1014  STAIVGPSGSGKSTIISLIERFYDPLKGIVKIDDRDIRSYHLRSLRQHIALVSQEPTLFA  1073

Query  616   GTIRDNILFGKLDaseneii--eaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQri  443
             GTIR+NI++G      NE    EAAKAANAH FI+ L  GYDT CG+RGVQLSGGQKQRI
Sbjct  1074  GTIRENIMYGGASNKINESEIIEAAKAANAHDFITLLSDGYDTYCGDRGVQLSGGQKQRI  1133

Query  442   aiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIA  263
             AIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++V+AHRL+TI+N D+I 
Sbjct  1134  AIARAVLKNPSVLLLDEATSALDSQSERVVQDALERLMVGRTSIVIAHRLSTIQNCDTIT  1193

Query  262   LVSEGKVVEHGTYSQL  215
             ++ +G+++E GT+S L
Sbjct  1194  VLEKGEIIESGTHSSL  1209


 Score =   318 bits (816),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 216/563 (38%), Positives = 319/563 (57%), Gaps = 21/563 (4%)
 Frame = -2

Query  1864  IGSISAIAFGAVQPTYALTIGGMISAF--FSPSHEEMQARIQKFCLVF---Allcllsit  1700
             +G I AI  G V P        +++ F  FS         I K  LV    A   L+   
Sbjct  26    LGLIGAIGDGFVTPMIFFVCSKLLNDFGDFSVIDVTFMQTISKNALVLLYVACASLVICF  85

Query  1699  lnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSL  1520
             L   + YC+   GE    ++R + L+ +L  +  +FD    S+  +   +S+++ +++  
Sbjct  86    LGKSEGYCWTRTGERQAAKLREKYLKAVLRQDVGYFDLHVTSTSDVITSVSSDSLVIQDF  145

Query  1519  VADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVK  1340
             ++++L   +   S+   + ++G V+ W+L +V      L ++        L  I+ +  +
Sbjct  146   ISEKLPNFLMNTSAFVGSYIVGFVLLWRLTIVGFPFIVLLLIPGLMYGGALINISRRIRE  205

Query  1339  AQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGL  1160
               N +  IA +A+ + R V +FGS  K++  F NA     K   ++    GI IGS  G+
Sbjct  206   EYNGAGSIAEQAISSVRTVYAFGSEKKMIAKFSNALQGSVKLGLRQGLAKGITIGS-NGI  264

Query  1159  TFMCWALDFWYGGKLVSN-----GEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSA  995
             T+  W    WYG +LV N     G +S+     TF   +S G+ + +  + +     G  
Sbjct  265   TYAIWGFMTWYGSRLVMNYGSKGGTVSTVTACVTFG-GISLGQSLLNLKTFSEAFVAGER  323

Query  994   AVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCL  815
              +  I  I   P I +    G++      LE   G+I+   V F YPSRP TPI  +FCL
Sbjct  324   MIKVIKRI---PDIDSDNVEGQI------LETTRGEIDFNHVKFTYPSRPLTPIFEDFCL  374

Query  814   EVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQ  635
              + +G ++ LVG SGSGKST+++L++RFYD   G I +DGV +    + W R QM LVSQ
Sbjct  375   RIPSGKTVALVGGSGSGKSTMISLLQRFYDPVAGEILLDGVPIHKLQVNWLRSQMGLVSQ  434

Query  634   EPVIYSGTIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQ  455
             EPV+++ +I +NILF K DAS NE++EAAKA+NAH FIS    GY T+ GERGVQLSGGQ
Sbjct  435   EPVLFATSITENILFSKEDASINEVVEAAKASNAHSFISQFTDGYKTQVGERGVQLSGGQ  494

Query  454   KQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNL  275
             KQRIAIARAII++P ILLLDEATSALD ESE+VVQEALD   +GRTT+++AHRL+TI+N 
Sbjct  495   KQRIAIARAIIKSPKILLLDEATSALDSESERVVQEALDNASVGRTTIIIAHRLSTIRNA  554

Query  274   DSIALVSEGKVVEHGTYSQLKNK  206
             D I +V  G++ E G++ +L  K
Sbjct  555   DIICVVKNGRITETGSHDELLEK  577


 Score =   300 bits (769),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 194/539 (36%), Positives = 303/539 (56%), Gaps = 30/539 (6%)
 Frame = -2

Query  3634  EKCSLY---FVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y   FV L L   +    + Y ++   E    +IR   L  IL  EV +FD  E 
Sbjct  699   EKTRIYALVFVGLALFTFLTNISQHYSFAYMGEYLTKRIREHMLGKILTFEVNWFDEDEN  758

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  + + ++ D ++++ ++ +++ + +   S            SWR ++V      +++
Sbjct  759   SSGAVCSRLANDANVVRSLVGDRMSLLVQTISSVSITCIIGLVISWRFAIVMISVQPLIV  818

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSI------  3122
             +        L  +SK +     ++  +  +A+S+I+TI +F+++  I++ +         
Sbjct  819   VSFYTKRVLLKRMSKNAINAQDESTKLAAEAVSNIRTITAFSSQERIIKLFKRAQEGPRR  878

Query  3121  --LDRTIKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYV  2948
               + ++   G+ +G ++ L  G + L+F       WYG RL+      G  +  A +   
Sbjct  879   ESVRQSWLAGIMLGTSQSLITGVSALNF-------WYGGRLV----ADGKMVSKAFLELF  927

Query  2947  LGGLSLGMALPE----VKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFK  2780
             L   S G  + E     K   + S A   +F+ +DR   I+ E   G V   I+G++ F 
Sbjct  928   LIFSSTGRIIAEAGTMTKDLAKGSDAVVSVFAVLDRCTTIEPESLDGYVPKKIKGQIRFL  987

Query  2779  NVKFAYPSRPESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDG  2600
             NV FAYP+RP+ ++ K+ ++K+E GK+ A+VG SGSGKST I+L++RFYD   G + ID 
Sbjct  988   NVDFAYPTRPDVIIFKNFSIKIEEGKSTAIVGPSGSGKSTIISLIERFYDPLKGIVKIDD  1047

Query  2599  VEINALQVKWLRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFI  2426
              +I +  ++ LR  + LVSQE  LF  +IRENIM G     + E  ++ AA  ANAHDFI
Sbjct  1048  RDIRSYHLRSLRQHIALVSQEPTLFAGTIRENIMYGGASNKINESEIIEAAKAANAHDFI  1107

Query  2425  RQLPQGYETKVGERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDAL  2246
               L  GY+T  G+RG  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE++VQDAL
Sbjct  1108  TLLSDGYDTYCGDRGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERVVQDAL  1167

Query  2245  DQASAGRTTLVVAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEKN--GHYAQMAKLQR  2075
             ++   GRT++V+AH+LSTI+N D I V+  G IIE G+HS L+     G Y  +  LQR
Sbjct  1168  ERLMVGRTSIVIAHRLSTIQNCDTITVLEKGEIIESGTHSSLLANGPVGAYFSLVSLQR  1226



>ref|XP_010514543.1| PREDICTED: ABC transporter B family member 22-like [Camelina 
sativa]
Length=1231

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 613/1230 (50%), Positives = 855/1230 (70%), Gaps = 51/1230 (4%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+ LM LG  GAIGDG+ T  +   +  L N +G           N   M  
Sbjct  10    IFMHADGVDLILMGLGLFGAIGDGLITPTIFFIIGLLLNDIG-------GSSGNETFMHG  62

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + +  A  V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+V +FD    +T
Sbjct  63    IIKKAVALLYVACASWVICFVEGYCWTRTGERQASRMRGKYLRAVLRQDVSYFDLNVTST  122

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S DT LIQ+VLSEK+P FLM+ S F++    S    WRL++V +P  +IL+IP
Sbjct  123   SDVITSVSSDTLLIQDVLSEKLPNFLMNASAFVASYIVSFLMLWRLTIVGFPFFIILLIP  182

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+ G+ L+ +S+K  +EY+ A  I  QA+S ++T+Y+F +ER ++ ++S+ L  ++ LG
Sbjct  183   GLMCGRALISISRKIREEYTDAGSIAEQAISLVRTVYAFGSERKMVAKFSAALQGSVNLG  242

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS+G+++AIW F+ WYGS+++M+ G  GG I+A  I    GG SLG  L
Sbjct  243   LRQGLAKGIAIGSSGINYAIWGFMTWYGSQMVMYHGAKGGTIFAVIICITSGGTSLGRGL  302

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +K F+EA VA  RI   I+RVP ID E+  G +L+ I+GE++FKNVKF YPSRPE+ +
Sbjct  303   SNLKEFSEAVVAVERIVKVINRVPDIDSENLEGQILEKIKGEVQFKNVKFMYPSRPETPI  362

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               DL L + +GKTVALVG SGSGKST I+LLQRFYD  +  I  DGV I+ LQVKWLR Q
Sbjct  363   FNDLCLMIPSGKTVALVGGSGSGKSTVISLLQRFYDPAAAEILFDGVSIDKLQVKWLRSQ  422

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE  LF TSI ENI+ GK   SM+EVV AA ++NAHDFI Q P GY+T+VGERG 
Sbjct  423   MGLVSQEPTLFATSIEENILFGKEDASMDEVVEAAKSSNAHDFISQFPLGYKTQVGERGV  482

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE+ VQ+ALD AS GRTT+V+AH+L
Sbjct  483   QMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERAVQEALDNASIGRTTIVIAHRL  542

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQ-----------------RQ  2072
             STIRN D+I V   G I+E GSH +LME  +G Y  + +LQ                  Q
Sbjct  543   STIRNVDVICVFHNGHIVEAGSHEDLMENLDGQYTSLVRLQMIENEQSDDNVSLGMGDSQ  602

Query  2071  FSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQ--KVPTDHHHQPSPSFSRLL  1898
             FS   +D   +P  +   QS           +   ++T     +P D     +PSF RL+
Sbjct  603   FSTLSKDVKHSPRFSIQSQSN--------LLTASSVDTNDLGTIPKDKKKH-APSFKRLM  653

Query  1897  GLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAll  1718
              +N  EWK  L G ISA+ +GA+ P YA   G M+S +F  SH+EM+ + + + L+F  L
Sbjct  654   AMNKPEWKHTLYGCISAVLYGALHPVYAYASGSMVSVYFLTSHDEMKEKTRIYVLLFVGL  713

Query  1717  cllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEA  1538
              +L    ++ QHY FAYMGE+LT+RIR  +L K+LTFE +WFDE+ NSSGA+C+RL+ +A
Sbjct  714   AVLCFLTSIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEDENSSGAICSRLATDA  773

Query  1537  AMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTI  1358
              +V+S+V +R+SLLVQ  S+V+IA  +GLV+AWKLA+VMIAVQP+ + CFYT++++L +I
Sbjct  774   NVVRSVVGERISLLVQTISAVSIACTLGLVIAWKLAIVMIAVQPVVVACFYTQRIVLKSI  833

Query  1357  TTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGI  1178
             + K +KAQ  S+++A EAV N R +T+F S  ++L +    Q+ P++E  ++SWLAGI +
Sbjct  834   SKKAIKAQEESSKLAAEAVSNIRTITAFSSQERILKLLKKVQEAPQRENIRQSWLAGIVL  893

Query  1177  GSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGS  998
              ++QGL      L +WYGG+L+++GEI S   F+ F + VSTG+VIADAG+MT+DLAKGS
Sbjct  894   ATSQGLMTCTSVLGYWYGGRLIADGEIMSKAFFELFILFVSTGRVIADAGAMTTDLAKGS  953

Query  997   AAVASIFAILDRPSIIT--SPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILRE  824
              AV S+FA+LDR + I   SP        G   + + G+I    V+F YP+RP+  I + 
Sbjct  954   DAVGSVFAVLDRCTNIDPESP-------DGFIPQNIKGQIRFANVDFVYPTRPDVFIFKN  1006

Query  823   FCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMAL  644
             F +E+    S  ++G SGSGKSTI++LIERFYD   G++ +DG D+RS+ +   R+ +AL
Sbjct  1007  FSVEINEEKSTAVLGPSGSGKSTIISLIERFYDPLKGTLEIDGRDIRSYHLRSLRQHIAL  1066

Query  643   VSQEPVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERG  476
             VSQEP +++GTIR+NI++G    K+D  E+EI EAAKAANAH FI+SL  GYDT CG++G
Sbjct  1067  VSQEPTLFAGTIRENIMYGGASDKID--ESEITEAAKAANAHDFITSLSNGYDTYCGDKG  1124

Query  475   VQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHR  296
             +QLSGGQKQRIAIARA+++NP++LLLDEATSALD +SE++VQ+AL+ +M+GRT++V+AHR
Sbjct  1125  IQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALERLMVGRTSVVIAHR  1184

Query  295   LNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             L+TI+N D I ++ +G+V E GT+S L  K
Sbjct  1185  LSTIQNCDMIIVLDKGEVAECGTHSSLLGK  1214


 Score =   299 bits (765),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 189/528 (36%), Positives = 301/528 (57%), Gaps = 8/528 (2%)
 Frame = -2

Query  3634  EKCSLYFVL-LGLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y +L +GLAV+  +   ++ Y ++   E    +IR   L  +L  EV +FD  E 
Sbjct  701   EKTRIYVLLFVGLAVLCFLTSIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEDEN  760

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++ D ++++ V+ E++ + +   S            +W+L++V      +++
Sbjct  761   SSGAICSRLATDANVVRSVVGERISLLVQTISAVSIACTLGLVIAWKLAIVMIAVQPVVV  820

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
                      L  +SKK+ K   +++ +  +A+S+I+TI +F+++  IL+    + +   +
Sbjct  821   ACFYTQRIVLKSISKKAIKAQEESSKLAAEAVSNIRTITAFSSQERILKLLKKVQEAPQR  880

Query  3103  LGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
               ++     G+ +  S GL         WYG RLI          +   I +V  G  + 
Sbjct  881   ENIRQSWLAGIVLATSQGLMTCTSVLGYWYGGRLIADGEIMSKAFFELFILFVSTGRVIA  940

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + S A   +F+ +DR   ID E   G +   I+G++ F NV F YP+RP+
Sbjct  941   DAGAMTTDLAKGSDAVGSVFAVLDRCTNIDPESPDGFIPQNIKGQIRFANVDFVYPTRPD  1000

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               + K+ ++++   K+ A++G SGSGKST I+L++RFYD   G++ IDG +I +  ++ L
Sbjct  1001  VFIFKNFSVEINEEKSTAVLGPSGSGKSTIISLIERFYDPLKGTLEIDGRDIRSYHLRSL  1060

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFIRQLPQGYETKV  2393
             R  + LVSQE  LF  +IRENIM G     ++E  +  AA  ANAHDFI  L  GY+T  
Sbjct  1061  RQHIALVSQEPTLFAGTIRENIMYGGASDKIDESEITEAAKAANAHDFITSLSNGYDTYC  1120

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             G++G  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE+LVQDAL++   GRT++V
Sbjct  1121  GDKGIQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALERLMVGRTSVV  1180

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQR  2075
             +AH+LSTI+N D+I V+  G + E G+HS L+ K   G Y  +   QR
Sbjct  1181  IAHRLSTIQNCDMIIVLDKGEVAECGTHSSLLGKGPTGTYFTLVSRQR  1228



>ref|NP_189479.1| ABC transporter B family member 17 [Arabidopsis thaliana]
 sp|Q9LSJ6.1|AB17B_ARATH RecName: Full=ABC transporter B family member 17; Short=ABC transporter 
ABCB.17; Short=AtABCB17; AltName: Full=P-glycoprotein 
17; AltName: Full=Putative multidrug resistance protein 
19 [Arabidopsis thaliana]
 dbj|BAB02854.1| multidrug resistance p-glycoprotein; ABC transporter-like protein 
[Arabidopsis thaliana]
 gb|AEE77439.1| P-glycoprotein 17 [Arabidopsis thaliana]
Length=1240

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/1231 (50%), Positives = 868/1231 (71%), Gaps = 49/1231 (4%)
 Frame = -2

Query  3829  SIIVIFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngN  3650
             SI  IF +AD +D  LM LG +GA+GDG  T  ++   + L N LG       S  +N  
Sbjct  19    SIRSIFMHADGVDWILMALGLIGAVGDGFITPVVVFIFNTLLNNLG------TSSSNNKT  72

Query  3649  LMREVEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQ  3470
              M+ + K  +  + +     V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+VG+FD  
Sbjct  73    FMQTISKNVVALLYVACGSWVICFLEGYCWTRTGERQAARMREKYLRAVLRQDVGYFDLH  132

Query  3469  EATTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVi  3290
               +TS++  SIS D+ +IQ+ LSEK+P FLM+ S F++    S    WRL++V +P I++
Sbjct  133   VTSTSDVITSISSDSLVIQDFLSEKLPNFLMNASAFVASYIVSFILMWRLTIVGFPFIIL  192

Query  3289  liipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRT  3110
             L++PGL+YG+ L+ +S+K  ++Y++A  I  QA+SS++T+Y+F +E  ++ ++S+ L  +
Sbjct  193   LLVPGLMYGRALVSISRKIHEQYNEAGSIAEQAISSVRTVYAFGSENKMIGKFSTALRGS  252

Query  3109  IKLGMKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSL  2930
             +KLG++ G+AKG+ +GS G++ AIWAFL WYGSRL+M+ G  GG ++        GG+SL
Sbjct  253   VKLGLRQGLAKGITIGSNGVTHAIWAFLTWYGSRLVMNHGSKGGTVFVVISCITYGGVSL  312

Query  2929  GMALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRP  2750
             G +L  +KYF+EA VA  RI   I RVP ID   K G +L+ ++GE+EF +VKF Y SRP
Sbjct  313   GQSLSNLKYFSEAFVAWERILEVIKRVPDIDSNKKEGQILERMKGEVEFNHVKFTYLSRP  372

Query  2749  ESLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKW  2570
             E+ +  DL LK+ AGKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQV W
Sbjct  373   ETTIFDDLCLKIPAGKTVALVGGSGSGKSTVISLLQRFYDPIAGEILIDGVSIDKLQVNW  432

Query  2569  LRGQMGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVG  2390
             LR QMGLVSQE  LF TSI ENI+ GK   S++EVV AA  +NAH FI Q P GY+T+VG
Sbjct  433   LRSQMGLVSQEPVLFATSITENILFGKEDASLDEVVEAAKASNAHTFISQFPLGYKTQVG  492

Query  2389  ERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVV  2210
             ERG  +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ++LD AS GRTT+V+
Sbjct  493   ERGVQMSGGQKQRIAIARAIIKSPKILLLDEATSALDSESERVVQESLDNASIGRTTIVI  552

Query  2209  AHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQR--------------  2075
             AH+LSTIRNAD+I V+  G I+E GSH EL+++ +G Y  +  LQ+              
Sbjct  553   AHRLSTIRNADVICVIHNGQIVETGSHEELLKRIDGQYTSLVSLQQMENEESNVNINVSV  612

Query  2074  ---QFSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTDHHHQP-SPSFS  1907
                Q     +D  ++  ++ G  S+            ++   +  +P D  +QP  PSF+
Sbjct  613   TKDQVMSLSKDFKYSQHNSIGSTSSS-----------IVTNVSDLIPND--NQPLVPSFT  659

Query  1906  RLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVF  1727
             RL+ +N  EWK  L G +SA   G +QP  A + G +IS FF  SH++++ + + + L+F
Sbjct  660   RLMVMNRPEWKHALYGCLSAALVGVLQPVSAYSAGSVISVFFLTSHDQIKEKTRIYVLLF  719

Query  1726  AllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLS  1547
               L + S  +N+ QHY FAYMGE+LT+RIR +ML KILTFE  WFD + NSSGA+C+RL+
Sbjct  720   VGLAIFSFLVNISQHYGFAYMGEYLTKRIREQMLSKILTFEVNWFDIDDNSSGAICSRLA  779

Query  1546  NEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLL  1367
              +A +V+S+V DR+SLLVQ  S+V IA ++GLV+AW+LA+VMI+VQPL ++CFYT++VLL
Sbjct  780   KDANVVRSMVGDRMSLLVQTISAVIIACIIGLVIAWRLAIVMISVQPLIVVCFYTQRVLL  839

Query  1366  STITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAG  1187
              +++ K  KAQ+ S+++A EAV N R +T+F S  +++ +    Q+ PR+E+  +SWLAG
Sbjct  840   KSLSEKASKAQDESSKLAAEAVSNIRTITAFSSQERIIKLLKKVQEGPRRESVHRSWLAG  899

Query  1186  IGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLA  1007
             I +G+++ L     AL+FWYGG+L+++G+I S   F+ F I V+TG+VIADAG+MT+DLA
Sbjct  900   IVLGTSRSLITCTSALNFWYGGRLIADGKIVSKAFFEIFLIFVTTGRVIADAGTMTTDLA  959

Query  1006  KGSAAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILR  827
             +G  AV S+FA+LDR + I  P N      G   EK+ G+I    V+FAYP+RP+  I  
Sbjct  960   RGLDAVGSVFAVLDRCTTI-EPKNPD----GYVAEKIKGQITFLNVDFAYPTRPDVVIFE  1014

Query  826   EFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMA  647
              F +E+  G S  +VG SGSGKSTI+ LIERFYD   G++++DG D+RS+ +   R+ ++
Sbjct  1015  NFSIEIDEGKSTAIVGTSGSGKSTIIGLIERFYDPLKGTVKIDGRDIRSYHLRSLRKYIS  1074

Query  646   LVSQEPVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGER  479
             LVSQEP++++GTIR+NI++G    K+D  E+EIIEAAKAANAH FI+SL  GYDT CG++
Sbjct  1075  LVSQEPMLFAGTIRENIMYGGTSDKID--ESEIIEAAKAANAHDFITSLSNGYDTNCGDK  1132

Query  478   GVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAH  299
             GVQLSGGQKQRIAIARA+++NP++LLLDEATSALD +SE+VVQ+AL+ +M+GRT++++AH
Sbjct  1133  GVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSKSERVVQDALERVMVGRTSIMIAH  1192

Query  298   RLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             RL+TI+N D I ++ +GK+VE GT+S L  K
Sbjct  1193  RLSTIQNCDMIVVLGKGKIVESGTHSSLLEK  1223



>ref|XP_010502833.1| PREDICTED: ABC transporter B family member 22-like [Camelina 
sativa]
Length=1231

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/1235 (50%), Positives = 858/1235 (69%), Gaps = 61/1235 (5%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+ LM LG  GAIGDG+ T  +   +  L N +G           N   M  
Sbjct  10    IFMHADGVDLILMGLGLFGAIGDGIITPTIFFIIGLLLNDIG-------GSSGNETFMHA  62

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + +  A  V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+V +FD    +T
Sbjct  63    IIKKAVALLYVACAAWVICFVEGYCWTRTGERQASRMRGKYLRAVLRQDVSYFDLNVTST  122

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S DT LIQ+VLSEK+P FLM+ S F++    S    WRL++V +P  ++L+IP
Sbjct  123   SDVITSVSSDTLLIQDVLSEKLPNFLMNASAFVASYIVSFIMLWRLTIVCFPFFILLLIP  182

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+ G+ L+ +S+K  +EY+ A  I  QA+S ++T+Y+F +ER ++ ++S+ L  ++ LG
Sbjct  183   GLMCGRALISISRKIREEYTDAGSIAEQAISLVRTVYAFGSERKMVAKFSAALQGSVNLG  242

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS+G+++AIW F+ WYGS+++M+ G  GG I+A  I    GG SLG  L
Sbjct  243   LRQGLAKGIAIGSSGINYAIWGFMTWYGSQMVMYHGAKGGTIFAVIICISYGGTSLGRGL  302

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +K F+EA VA  RI   I+RVP ID E+  G +L+ I+GE++FKNVKF YPSR E+ +
Sbjct  303   SNLKEFSEAVVAVERIVKVINRVPDIDSENLEGQILEKIKGEVQFKNVKFMYPSRLETPI  362

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               DL L + +GKTVALVG SGSGKST I+LLQRFYD  +G I  DGV I+ LQVKWLR Q
Sbjct  363   FNDLCLMISSGKTVALVGGSGSGKSTVISLLQRFYDPAAGEILFDGVSIDKLQVKWLRSQ  422

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE  LF TSI ENI+ GK   SM+EVV AA ++NAHDFI Q P GY+T+VGERG 
Sbjct  423   MGLVSQEPTLFATSIEENILFGKEDASMDEVVEAAKSSNAHDFISQFPLGYKTQVGERGV  482

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE++VQ+ALD AS GRTT+V+AH+L
Sbjct  483   QMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERVVQEALDNASIGRTTIVIAHRL  542

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQ-----------------RQ  2072
             STIRN D+I V   G I+E GSH +LME  +G Y  + +LQ                  Q
Sbjct  543   STIRNVDVICVFHNGHIVETGSHEDLMENLDGQYTSLVRLQMMKNEESDNNISVGMGDSQ  602

Query  2071  FSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQKVPTD-------HHHQPSPS  1913
             FS   +D   +P  +   QS               + TA  V TD          +  PS
Sbjct  603   FSILSKDVKHSPRFSIQSQSN--------------LLTASSVDTDDLGAIPKDKKKHVPS  648

Query  1912  FSRLLGLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCL  1733
             F RL+ +N  EWK  L G ISA+ +GA+QP YA   G M+S +F  SH+EM+ + + + L
Sbjct  649   FRRLMAMNKPEWKHTLYGCISAVLYGALQPVYAYASGSMVSVYFLTSHDEMKEKTRIYVL  708

Query  1732  VFAllcllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCAR  1553
             +F  L +L    ++ QHY FAYMGE+LT+RIR  +L K+LTFE +WFDE+ NSSGA+C+R
Sbjct  709   LFVGLAVLCFLTSIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEDQNSSGAICSR  768

Query  1552  LSNEAAMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKV  1373
             L+ +A +V+S+V +R+SLLVQ  S+V++A  +GLV+AWKLA+VMIAVQP+ + CFYT+++
Sbjct  769   LATDAKVVRSVVGERVSLLVQTISAVSVACTLGLVIAWKLAIVMIAVQPVVVACFYTQRI  828

Query  1372  LLSTITTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWL  1193
             +L +I+ K +KAQ  S+++A EAV N R +T+F S  ++L +    Q+ P++E  ++SWL
Sbjct  829   VLKSISKKAIKAQEESSKLAAEAVSNIRTITAFSSQERILKLLKKVQEAPQRENIRQSWL  888

Query  1192  AGIGIGSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSD  1013
             AGI + ++QGL      L +WYGG+L+++GEI S   F+ F + VSTG+VIADAG+MT+D
Sbjct  889   AGIVLATSQGLMTCTSVLGYWYGGRLIADGEIMSKAFFELFILFVSTGRVIADAGAMTTD  948

Query  1012  LAKGSAAVASIFAILDRPSIIT--SPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPET  839
             LAKGS AV S+FA+LDR + I   SP        G   + + G+I    V+F YP+RP+ 
Sbjct  949   LAKGSDAVGSVFAVLDRRTNIDPESP-------DGFIPQNIKGQIRFANVDFVYPTRPDV  1001

Query  838   PILREFCLEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYR  659
              I + F +E+    S  ++G SGSGKSTI++LIERFYD   G++ +DG D+RS+ +   R
Sbjct  1002  FIFKNFSVEINEEKSTAVLGPSGSGKSTIISLIERFYDPLKGTVEIDGRDIRSYHLRSLR  1061

Query  658   RQMALVSQEPVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTE  491
             + +ALVSQEP +++GTIR+NI++G    K+D  E+EIIEAAKAANAH FI+SL +GYDT 
Sbjct  1062  QNIALVSQEPTLFAGTIRENIMYGEASDKID--ESEIIEAAKAANAHDFITSLSRGYDTN  1119

Query  490   CGERGVQLSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTM  311
             CG++GVQLSGGQKQRIAIARA+++NP++LLLDEATSALD +SE++VQ+AL+ +M+GRT++
Sbjct  1120  CGDKGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALEHLMVGRTSV  1179

Query  310   VVAHRLNTIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             V+AHRL+TI+N D I ++ +G+V E GT+S L  K
Sbjct  1180  VIAHRLSTIQNCDMIIVLDKGEVAECGTHSSLLGK  1214


 Score =   301 bits (770),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 189/528 (36%), Positives = 302/528 (57%), Gaps = 8/528 (2%)
 Frame = -2

Query  3634  EKCSLYFVL-LGLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y +L +GLAV+  +   ++ Y ++   E    +IR   L  +L  EV +FD  + 
Sbjct  701   EKTRIYVLLFVGLAVLCFLTSIIQHYSFAYMGEYLTKRIRENILSKLLTFEVSWFDEDQN  760

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++ D  +++ V+ E+V + +   S            +W+L++V      +++
Sbjct  761   SSGAICSRLATDAKVVRSVVGERVSLLVQTISAVSVACTLGLVIAWKLAIVMIAVQPVVV  820

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
                      L  +SKK+ K   +++ +  +A+S+I+TI +F+++  IL+    + +   +
Sbjct  821   ACFYTQRIVLKSISKKAIKAQEESSKLAAEAVSNIRTITAFSSQERILKLLKKVQEAPQR  880

Query  3103  LGMKIGIAKGLAVG-STGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
               ++     G+ +  S GL         WYG RLI          +   I +V  G  + 
Sbjct  881   ENIRQSWLAGIVLATSQGLMTCTSVLGYWYGGRLIADGEIMSKAFFELFILFVSTGRVIA  940

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + S A   +F+ +DR   ID E   G +   I+G++ F NV F YP+RP+
Sbjct  941   DAGAMTTDLAKGSDAVGSVFAVLDRRTNIDPESPDGFIPQNIKGQIRFANVDFVYPTRPD  1000

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               + K+ ++++   K+ A++G SGSGKST I+L++RFYD   G++ IDG +I +  ++ L
Sbjct  1001  VFIFKNFSVEINEEKSTAVLGPSGSGKSTIISLIERFYDPLKGTVEIDGRDIRSYHLRSL  1060

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFIRQLPQGYETKV  2393
             R  + LVSQE  LF  +IRENIM G+    ++E  ++ AA  ANAHDFI  L +GY+T  
Sbjct  1061  RQNIALVSQEPTLFAGTIRENIMYGEASDKIDESEIIEAAKAANAHDFITSLSRGYDTNC  1120

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             G++G  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE+LVQDAL+    GRT++V
Sbjct  1121  GDKGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALEHLMVGRTSVV  1180

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQR  2075
             +AH+LSTI+N D+I V+  G + E G+HS L+ K   G Y  +   QR
Sbjct  1181  IAHRLSTIQNCDMIIVLDKGEVAECGTHSSLLGKGPTGTYFTLVSRQR  1228



>ref|XP_010425617.1| PREDICTED: ABC transporter B family member 22 [Camelina sativa]
Length=1231

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/1228 (50%), Positives = 853/1228 (69%), Gaps = 47/1228 (4%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             IF +AD +D+ LM  G LGAIGDG+ T  +   +  L N +G           N   M  
Sbjct  10    IFMHADGVDLILMGRGLLGAIGDGVITPIIFFIIGLLLNDIG-------GSSGNETFMHA  62

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             + K ++  + +  A  V+ F+EGYCW++T ERQ  ++R KYL A+LRQ+V +FD    +T
Sbjct  63    IIKNAVALLYVACASWVICFVEGYCWTRTGERQASRMRGKYLRAVLRQDVSYFDLNVTST  122

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             S++  S+S DT LIQ+VLSEK+P FLM+ S F++    S    WRL++V  P  ++L+IP
Sbjct  123   SDVITSVSSDTLLIQDVLSEKLPNFLMNASAFVASYIVSFIMLWRLTIVGLPFFILLVIP  182

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             GL+ G+ L+ +S+K  +EY++A  I  QA+S ++T+Y+F +ER ++ ++S+ L  ++KLG
Sbjct  183   GLMCGRALISISRKIREEYTEAGSIAEQAISLVRTVYAFGSERKMVAKFSAALQGSLKLG  242

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+GS G+S+AIW F+ WYGSR++M+ G  GG I+A  I    GG SLG  L
Sbjct  243   LRQGLAKGIAIGSNGISYAIWGFMTWYGSRMVMYHGAKGGTIFAVTICITYGGTSLGRGL  302

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               +K F+EA VA  RI   I+RVP ID ++  G +L+ I+GE++FKNVKF YPSRPE+ +
Sbjct  303   SNLKEFSEAVVAVERIVKVINRVPDIDSQNLEGQILEKIKGEVQFKNVKFMYPSRPETPI  362

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
               D  L+V +GKTVALVG SGSGKST I+LLQRFYD  +G I IDGV I+ LQVKWLR Q
Sbjct  363   FNDFCLRVPSGKTVALVGGSGSGKSTVISLLQRFYDPIAGEILIDGVSIDKLQVKWLRSQ  422

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE  LF TS+ ENI+ GK   SM+EVV AA ++NAHDFI Q P GY+T+VGERG 
Sbjct  423   MGLVSQEPTLFATSVEENILFGKEDASMDEVVEAAKSSNAHDFISQFPLGYKTQVGERGV  482

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAIIK+P ILLLDEATSALDSESE+ VQ+ALD AS GRTT+V+AH+L
Sbjct  483   QMSGGQKQRIAIARAIIKSPTILLLDEATSALDSESERAVQEALDNASIGRTTIVIAHRL  542

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEK-NGHYAQMAKLQ-----------------RQ  2072
             STIRN D+I V   G I+E GSH +LME  +G Y  + +LQ                   
Sbjct  543   STIRNVDVICVFHNGHIVETGSHEDLMENLDGQYTSLVRLQMIENEESDDNISVGMGDSP  602

Query  2071  FSCADQDQSFAPSSNAGRQSTEKsspavlassplLIETAQ--KVPTDHHHQPSPSFSRLL  1898
             FS   +D  ++P  +   QS               I+T    ++P D      PSF RL+
Sbjct  603   FSILSKDVKYSPRLSIQSQSN--------LFLTSSIDTNDPGEIPKDKKKH-VPSFKRLM  653

Query  1897  GLNLTEWKQGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAll  1718
              +N  EWK  L G ISA+ +GA+QP YA   G M+S +F  SH+EM+ + + + L+F  L
Sbjct  654   AMNKPEWKHTLYGCISAVLYGALQPVYAYASGSMVSVYFLTSHDEMKEKTRIYVLLFVGL  713

Query  1717  cllsitlnLCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEA  1538
              +L    ++ QHY F YMGE+LT+RIR  +L K+LTFE +WFDE+ NSSGA+C+RL+ +A
Sbjct  714   AVLCFLTSIIQHYSFGYMGEYLTKRIRENILSKLLTFEVSWFDEDENSSGAICSRLATDA  773

Query  1537  AMVKSLVADRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTI  1358
              +V+S+V +R+SLLVQ  S+V+IA  +GLV+AWKLA+V IAVQP+ + CFYT++++L +I
Sbjct  774   NVVRSVVGERVSLLVQTTSAVSIACTLGLVIAWKLAIVNIAVQPVVVACFYTQRIVLKSI  833

Query  1357  TTKFVKAQNSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGI  1178
             + K +KAQ  S+++A EAV N R +T+F S  ++L +    Q+ P +E  ++SWLAGI +
Sbjct  834   SKKAIKAQEGSSKLAAEAVSNIRTITAFSSQERILKLLKKVQESPHRENIRQSWLAGIVL  893

Query  1177  GSAQGLTFMCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGS  998
              +++ L      L++WYGG+L+++GEI S   F+ F + VSTG+VIADAG+MT+DLAKGS
Sbjct  894   ATSRSLMTCTSVLNYWYGGRLIADGEIKSKAFFELFILFVSTGRVIADAGAMTTDLAKGS  953

Query  997   AAVASIFAILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFC  818
              A+ S+FA+LDR + I  P N      G   + + G+I    V+  YP+RP+  I +   
Sbjct  954   DAIGSVFAVLDRYTNI-DPENPD----GFVPQNIKGQIRFANVDLVYPTRPDVFIFKNLS  1008

Query  817   LEVKAGSSIGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVS  638
             +E+    S  ++G SGSGKSTI++LIERFYD   G++ +DG D+RS+ +   R+ +ALVS
Sbjct  1009  IEINEEKSTAILGPSGSGKSTIISLIERFYDPLKGTVEIDGRDIRSYHLRSLRQHIALVS  1068

Query  637   QEPVIYSGTIRDNILFG----KLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQ  470
             QEP +++GTIR+NI++G    K+D  E+EIIEAAKAANAH FI+SL  GYDT CG++GVQ
Sbjct  1069  QEPTLFAGTIRENIMYGEASDKID--ESEIIEAAKAANAHDFITSLSNGYDTYCGDKGVQ  1126

Query  469   LSGGQKQriaiaraiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLN  290
             LSGGQKQRIAIARA+++NP++LLLDEATSALD +SE++VQ+AL+ +M+GRT++V+AHRL+
Sbjct  1127  LSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALERLMVGRTSVVIAHRLS  1186

Query  289   TIKNLDSIALVSEGKVVEHGTYSQLKNK  206
             T++N D I ++ +G+V E GT+S L  K
Sbjct  1187  TVQNCDMIIVLDKGEVAECGTHSSLLGK  1214


 Score =   302 bits (773),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 189/528 (36%), Positives = 304/528 (58%), Gaps = 8/528 (2%)
 Frame = -2

Query  3634  EKCSLYFVL-LGLAVM--VMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEA  3464
             EK  +Y +L +GLAV+  +   ++ Y +    E    +IR   L  +L  EV +FD  E 
Sbjct  701   EKTRIYVLLFVGLAVLCFLTSIIQHYSFGYMGEYLTKRIRENILSKLLTFEVSWFDEDEN  760

Query  3463  TTSEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIVili  3284
             ++  I + ++ D ++++ V+ E+V + +  TS            +W+L++V      +++
Sbjct  761   SSGAICSRLATDANVVRSVVGERVSLLVQTTSAVSIACTLGLVIAWKLAIVNIAVQPVVV  820

Query  3283  ipgliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIK  3104
                      L  +SKK+ K    ++ +  +A+S+I+TI +F+++  IL+    + +   +
Sbjct  821   ACFYTQRIVLKSISKKAIKAQEGSSKLAAEAVSNIRTITAFSSQERILKLLKKVQESPHR  880

Query  3103  LGMKIGIAKGLAVGSTGLSFAIWAFLA-WYGSRLIMHKGESGGRIYAAGISYVLGGLSLG  2927
               ++     G+ + ++       + L  WYG RLI          +   I +V  G  + 
Sbjct  881   ENIRQSWLAGIVLATSRSLMTCTSVLNYWYGGRLIADGEIKSKAFFELFILFVSTGRVIA  940

Query  2926  MALPEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPE  2747
              A        + S A   +F+ +DR   ID E+  G V   I+G++ F NV   YP+RP+
Sbjct  941   DAGAMTTDLAKGSDAIGSVFAVLDRYTNIDPENPDGFVPQNIKGQIRFANVDLVYPTRPD  1000

Query  2746  SLVLKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWL  2567
               + K+L++++   K+ A++G SGSGKST I+L++RFYD   G++ IDG +I +  ++ L
Sbjct  1001  VFIFKNLSIEINEEKSTAILGPSGSGKSTIISLIERFYDPLKGTVEIDGRDIRSYHLRSL  1060

Query  2566  RGQMGLVSQEHALFGTSIRENIMLGKLGGSMEE--VVAAAMTANAHDFIRQLPQGYETKV  2393
             R  + LVSQE  LF  +IRENIM G+    ++E  ++ AA  ANAHDFI  L  GY+T  
Sbjct  1061  RQHIALVSQEPTLFAGTIRENIMYGEASDKIDESEIIEAAKAANAHDFITSLSNGYDTYC  1120

Query  2392  GERGALLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLV  2213
             G++G  LSGGQKQRIAIARA++KNP +LLLDEATSALDS+SE+LVQDAL++   GRT++V
Sbjct  1121  GDKGVQLSGGQKQRIAIARAVLKNPSVLLLDEATSALDSQSERLVQDALERLMVGRTSVV  1180

Query  2212  VAHKLSTIRNADLIAVVSGGCIIEQGSHSELMEK--NGHYAQMAKLQR  2075
             +AH+LST++N D+I V+  G + E G+HS L+ K   G Y  +   QR
Sbjct  1181  IAHRLSTVQNCDMIIVLDKGEVAECGTHSSLLGKGPTGTYFTLVSRQR  1228



>ref|XP_008645788.1| PREDICTED: putative multidrug resistance protein [Zea mays]
Length=1247

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/1213 (52%), Positives = 855/1213 (70%), Gaps = 23/1213 (2%)
 Frame = -2

Query  3817  IFRYADWIDIFLMCLGTLGAIGDGMSTNCLLLYVSHLFNTLGYgsnnsqsqisngNLMRE  3638
             +F +AD +D+ LM LG +GAIGDGM+T   LL  S + N LG             +    
Sbjct  24    VFVHADTVDVALMVLGLVGAIGDGMATPLRLLVASRIANDLG------SGPDHLHHFTSR  77

Query  3637  VEKCSLYFVLLGLAVMVMGFMEGYCWSKTSERQVLKIRYKYLEAILRQEVGFFDSQEATT  3458
             +    +  +L+  A  VM F+EGYCW++T+ERQ  ++R +YL+A+LRQ+V FFD +  +T
Sbjct  78    INANVIRIILIACASWVMAFLEGYCWARTAERQASRMRARYLQAVLRQDVEFFDLKPGST  137

Query  3457  SEITNSISKDTSLIQEVLSEKVPIFLMHTSVFLSGLGFSTYFSWRLSLVAYPTIViliip  3278
             SE+  S+S D+ ++Q+ LSEKVP F M+ + F           WRL+LV  P+ ++LIIP
Sbjct  138   SEVVTSVSNDSLVVQDALSEKVPNFAMYVTTFAGSYAVGFALLWRLTLVTLPSALLLIIP  197

Query  3277  gliygkyllylskksfkeysKANGIVGQALSSIKTIYSFTAERSILERYSSILDRTIKLG  3098
             G+ YG+ L  L+++  + Y+    +  QA+SS++T+YSF AER+ + R+SS L+ + +LG
Sbjct  198   GVSYGRVLTGLARRIRERYALPGAVAQQAVSSVRTVYSFGAERATMARFSSALEESARLG  257

Query  3097  MKIGIAKGLAVGSTGLSFAIWAFLAWYGSRLIMHKGESGGRIYAAGISYVLGGLSLGMAL  2918
             ++ G+AKG+A+G+ G++FAI+AF  WYG RL+M+ G  GG ++      V+GG+SLG AL
Sbjct  258   LRQGLAKGVALGTNGIAFAIYAFNIWYGGRLVMYHGYPGGTVFVVSSLIVIGGVSLGSAL  317

Query  2917  PEVKYFTEASVAASRIFSRIDRVPKIDGEDKSGMVLDTIRGELEFKNVKFAYPSRPESLV  2738
               VKYF+EA+ AA RI   I RVPKID E  +G  L  + GE+EF+NV F YPSRPES V
Sbjct  318   SNVKYFSEATAAADRILEMIRRVPKIDSESAAGEELPNVAGEVEFRNVDFCYPSRPESPV  377

Query  2737  LKDLNLKVEAGKTVALVGASGSGKSTAIALLQRFYDANSGSICIDGVEINALQVKWLRGQ  2558
             L D +L+V AG TVALVG SGSGKSTAI LL+RFYD ++G + +DGV+I  L++KWLR Q
Sbjct  378   LVDFSLRVPAGHTVALVGPSGSGKSTAITLLERFYDPSAGEVALDGVDIRRLRLKWLRAQ  437

Query  2557  MGLVSQEHALFGTSIRENIMLGKLGGSMEEVVAAAMTANAHDFIRQLPQGYETKVGERGA  2378
             MGLVSQE ALF  S+RENI+ G+   + EEVVAAAM ANAH FI QLPQGY+T VGERGA
Sbjct  438   MGLVSQEPALFAMSLRENILFGEEDATEEEVVAAAMAANAHSFISQLPQGYDTLVGERGA  497

Query  2377  LLSGGQKQriaiaraiIKNPVILLLDEATSALDSESEKLVQDALDQASAGRTTLVVAHKL  2198
              +SGGQKQRIAIARAI+++P ILLLDEATSALD+ESE++VQ+ALD AS GRTT++VAH+L
Sbjct  498   QMSGGQKQRIAIARAILRSPKILLLDEATSALDTESERVVQEALDVASVGRTTILVAHRL  557

Query  2197  STIRNADLIAVVSGGCIIEQGSHSELMEKNGHYAQMAKLQRQFSCADQDQSFA----PSS  2030
             ST+RNAD IAV+  G + E GSHSEL+ KNG Y+ +  LQ+    ++     A     S 
Sbjct  558   STVRNADSIAVMQSGAVQELGSHSELIAKNGLYSSLVHLQQNRDSSEDTGEAAGTRRASP  617

Query  2029  NAGRQSTEKsspavlassplLI-------ETAQKVPTDHHHQPS-PSFSRLLGLNLTEWK  1874
             +AG+ S++ S  A  AS            +      TD   +P  PSF RLL LN  EWK
Sbjct  618   SAGQCSSDDSKMAPSASCRSSSARSIIGDDARDGENTDEKPRPPVPSFGRLLLLNAPEWK  677

Query  1873  QGLIGSISAIAFGAVQPTYALTIGGMISAFFSPSHEEMQARIQKFCLVFAllcllsitln  1694
               L+GS  A+  GA+QP +A  +G   S ++S  HEE++ + +K+  VF  L  +S  LN
Sbjct  678   HALVGSSCAVLSGAIQPIFAYGMGCTFSIYYSRDHEEIKDKTEKYAFVFLALVGISFLLN  737

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
             + QHY F  MGE LT+RIR +ML KILTFE  WFD + NS+G +C++L+ +A +V+SLV 
Sbjct  738   IGQHYSFGAMGECLTKRIRKQMLAKILTFEIGWFDHDDNSTGNICSQLAKDANIVRSLVG  797

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             DR++LL+Q AS V IA  +GLV++W+LALVMIA+QP  I C Y R+VLL  ++TK ++AQ
Sbjct  798   DRMALLIQTASMVVIAFTVGLVISWRLALVMIAMQPFIIACSYARRVLLKNMSTKSIQAQ  857

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
             + ++++A +AV N R VT+F S  +VL +F  AQD P +E+ ++SW AG+G+ ++  LT 
Sbjct  858   SETSKLAADAVSNLRTVTAFSSQGRVLRLFGQAQDGPHRESVRQSWFAGLGLSASVSLTI  917

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               WAL++WY GKL++   I+   VF+   ILV+TG+VIADA SMT+D+AKG+ AV+S+FA
Sbjct  918   FSWALNYWYSGKLMAERLITVEAVFQATMILVTTGRVIADACSMTTDIAKGAEAVSSVFA  977

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ILDR + I  P + +    G   EKL G++E   V+FAYPSRP+  I R F L + AG S
Sbjct  978   ILDRQTKI-DPDSPE----GYKPEKLIGEVEAVGVDFAYPSRPDVIIFRGFSLSMVAGKS  1032

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
               LVG+SGSGKSTI+ALIERFYD   G + +DG D++++++   RR + LVSQEP +++G
Sbjct  1033  TALVGQSGSGKSTIIALIERFYDPLKGVVNIDGRDIKAYNLQALRRHIGLVSQEPTLFAG  1092

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             TI++NI+     ASE E+ EAA++ANAH FIS+LK GYDT CG+RGVQLSGGQKQR+AIA
Sbjct  1093  TIKENIMLEAEAASEAEVEEAARSANAHGFISNLKDGYDTWCGDRGVQLSGGQKQRVAIA  1152

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI++NP ILLLDEATSALD +SE+ VQEALD +M+GRT++VVAHRL+TI+  D+IA++ 
Sbjct  1153  RAILKNPAILLLDEATSALDSQSEKAVQEALDRVMVGRTSVVVAHRLSTIQGCDTIAVLD  1212

Query  253   EGKVVEHGTYSQL  215
              G VVE GT++ L
Sbjct  1213  RGVVVEKGTHTSL  1225


 Score =   333 bits (855),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 213/558 (38%), Positives = 324/558 (58%), Gaps = 8/558 (1%)
 Frame = -2

Query  1867  LIGSISAIAFGAVQPTYALTIGGMISAFFS-PSH-EEMQARIQKFCLVFAllcllsitln  1694
             ++G + AI  G   P   L    + +   S P H     +RI    +   L+   S  + 
Sbjct  37    VLGLVGAIGDGMATPLRLLVASRIANDLGSGPDHLHHFTSRINANVIRIILIACASWVMA  96

Query  1693  LCQHYCFAYMGEHLTRRIRLRMLEKILTFETAWFDEEHNSSGALCARLSNEAAMVKSLVA  1514
               + YC+A   E    R+R R L+ +L  +  +FD +  S+  +   +SN++ +V+  ++
Sbjct  97    FLEGYCWARTAERQASRMRARYLQAVLRQDVEFFDLKPGSTSEVVTSVSNDSLVVQDALS  156

Query  1513  DRLSLLVQAASSVTIAMVMGLVVAWKLALVMIAVQPLTILCFYTRKVLLSTITTKFVKAQ  1334
             +++       ++   +  +G  + W+L LV +    L I+   +   +L+ +  +  +  
Sbjct  157   EKVPNFAMYVTTFAGSYAVGFALLWRLTLVTLPSALLLIIPGVSYGRVLTGLARRIRERY  216

Query  1333  NSSTQIAVEAVYNHRIVTSFGSINKVLDIFDNAQDEPRKEAQKKSWLAGIGIGSAQGLTF  1154
                  +A +AV + R V SFG+    +  F +A +E  +   ++    G+ +G+  G+ F
Sbjct  217   ALPGAVAQQAVSSVRTVYSFGAERATMARFSSALEESARLGLRQGLAKGVALGT-NGIAF  275

Query  1153  MCWALDFWYGGKLVSNGEISSGDVFKTFFILVSTGKVIADAGSMTSDLAKGSAAVASIFA  974
               +A + WYGG+LV       G VF    ++V  G  +  A S     ++ +AA   I  
Sbjct  276   AIYAFNIWYGGRLVMYHGYPGGTVFVVSSLIVIGGVSLGSALSNVKYFSEATAAADRILE  335

Query  973   ILDRPSIITSPYNGKVDNGGTNLEKLSGKIEIKKVNFAYPSRPETPILREFCLEVKAGSS  794
             ++ R   I S         G  L  ++G++E + V+F YPSRPE+P+L +F L V AG +
Sbjct  336   MIRRVPKIDSE-----SAAGEELPNVAGEVEFRNVDFCYPSRPESPVLVDFSLRVPAGHT  390

Query  793   IGLVGKSGSGKSTIVALIERFYDVDGGSIRVDGVDVRSFDIGWYRRQMALVSQEPVIYSG  614
             + LVG SGSGKST + L+ERFYD   G + +DGVD+R   + W R QM LVSQEP +++ 
Sbjct  391   VALVGPSGSGKSTAITLLERFYDPSAGEVALDGVDIRRLRLKWLRAQMGLVSQEPALFAM  450

Query  613   TIRDNILFGKLDaseneiieaakaanAHQFISSLKKGYDTECGERGVQLSGGQKQriaia  434
             ++R+NILFG+ DA+E E++ AA AANAH FIS L +GYDT  GERG Q+SGGQKQRIAIA
Sbjct  451   SLRENILFGEEDATEEEVVAAAMAANAHSFISQLPQGYDTLVGERGAQMSGGQKQRIAIA  510

Query  433   raiiRNPTILLLDEATSALDVESEQVVQEALDGIMIGRTTMVVAHRLNTIKNLDSIALVS  254
             RAI+R+P ILLLDEATSALD ESE+VVQEALD   +GRTT++VAHRL+T++N DSIA++ 
Sbjct  511   RAILRSPKILLLDEATSALDTESERVVQEALDVASVGRTTILVAHRLSTVRNADSIAVMQ  570

Query  253   EGKVVEHG