BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81244_g1_i1 len=728 path=[706:0-727]

Length=728
                                                                      Score     E

ref|XP_009768673.1|  PREDICTED: putative non-specific lipid-trans...    162   2e-46   
ref|XP_009592279.1|  PREDICTED: putative non-specific lipid-trans...    161   2e-46   
gb|EPS60737.1|  hypothetical protein M569_14063                         157   5e-44   
ref|XP_011101186.1|  PREDICTED: putative non-specific lipid-trans...    156   5e-44   
gb|EYU19529.1|  hypothetical protein MIMGU_mgv1a015896mg                155   1e-43   
ref|XP_006353344.1|  PREDICTED: putative non-specific lipid-trans...    151   2e-42   
ref|XP_004234440.1|  PREDICTED: putative non-specific lipid-trans...    149   1e-41   
ref|XP_002279183.2|  PREDICTED: putative non-specific lipid-trans...    149   2e-41   Vitis vinifera
emb|CBI31823.3|  unnamed protein product                                145   4e-40   
emb|CAN82043.1|  hypothetical protein VITISV_014443                     145   6e-40   Vitis vinifera
ref|XP_002510824.1|  Nonspecific lipid-transfer protein precursor...    143   2e-39   Ricinus communis
ref|XP_007038617.1|  Bifunctional inhibitor/lipid-transfer protei...    142   2e-38   
ref|XP_010693467.1|  PREDICTED: putative non-specific lipid-trans...    140   5e-38   
gb|KDO60063.1|  hypothetical protein CISIN_1g036089mg                   137   8e-37   
ref|XP_002318820.2|  hypothetical protein POPTR_0012s13360g             135   5e-36   Populus trichocarpa [western balsam poplar]
gb|KDP22314.1|  hypothetical protein JCGZ_26145                         134   6e-36   
ref|XP_006490471.1|  PREDICTED: putative non-specific lipid-trans...    134   7e-36   
ref|XP_006421872.1|  hypothetical protein CICLE_v10006787mg             133   9e-36   
ref|XP_004496838.1|  PREDICTED: putative non-specific lipid-trans...    134   1e-35   
ref|XP_008378217.1|  PREDICTED: putative non-specific lipid-trans...    134   1e-35   
ref|XP_006606095.1|  PREDICTED: putative non-specific lipid-trans...    133   2e-35   
gb|KHN15673.1|  Putative non-specific lipid-transfer protein 14         132   4e-35   
ref|XP_011030084.1|  PREDICTED: putative non-specific lipid-trans...    132   4e-35   
ref|XP_010278616.1|  PREDICTED: putative non-specific lipid-trans...    132   6e-35   
ref|XP_007219448.1|  hypothetical protein PRUPE_ppa021109mg             130   4e-34   
gb|KCW46399.1|  hypothetical protein EUGRSUZ_K00232                     130   5e-34   
ref|XP_008234469.1|  PREDICTED: putative non-specific lipid-trans...    129   7e-34   
ref|XP_006590211.1|  PREDICTED: putative non-specific lipid-trans...    129   1e-33   
ref|XP_007143374.1|  hypothetical protein PHAVU_007G067200g             127   6e-33   
ref|XP_010107409.1|  Putative non-specific lipid-transfer protein 14    126   9e-33   
ref|XP_010483944.1|  PREDICTED: putative non-specific lipid-trans...    125   2e-32   
gb|KHN02805.1|  Putative non-specific lipid-transfer protein 14         125   2e-32   
ref|XP_010041972.1|  PREDICTED: putative non-specific lipid-trans...    125   2e-32   
ref|XP_010038430.1|  PREDICTED: putative non-specific lipid-trans...    125   2e-32   
ref|XP_002864771.1|  lipid binding protein                              124   7e-32   
ref|NP_001078780.1|  protease inhibitor/seed storage/LTP family p...    123   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857874.1|  hypothetical protein AMTR_s00069p00101310          122   3e-31   
ref|XP_008799575.1|  PREDICTED: putative non-specific lipid-trans...    121   7e-31   
ref|XP_010458204.1|  PREDICTED: putative non-specific lipid-trans...    121   7e-31   
dbj|BAB10168.1|  unnamed protein product                                120   2e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27941.1|  hypothetical protein AALP_AA8G451000                    120   2e-30   
emb|CDX86929.1|  BnaC03g51990D                                          121   2e-30   
ref|XP_004309221.1|  PREDICTED: putative non-specific lipid-trans...    118   1e-29   
ref|XP_006279518.1|  hypothetical protein CARUB_v10027812mg             118   1e-29   
ref|XP_009151329.1|  PREDICTED: putative non-specific lipid-trans...    115   1e-28   
emb|CDY00250.1|  BnaA06g21510D                                          116   2e-28   
ref|XP_006394439.1|  hypothetical protein EUTSA_v10005335mg             115   2e-28   
ref|XP_010548835.1|  PREDICTED: putative non-specific lipid-trans...    114   3e-28   
ref|XP_003592299.1|  hypothetical protein MTR_1g101320                  107   2e-25   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              72.0    1e-12   
ref|XP_002321906.1|  hypothetical protein POPTR_0015s13310g           68.9    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011095133.1|  PREDICTED: non-specific lipid-transfer prote...  68.6    2e-11   
gb|EAZ03777.1|  hypothetical protein OsI_25905                        68.6    3e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAC07024.1|  hypothetical protein                                 68.9    4e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  66.6    1e-10   
ref|XP_010229683.1|  PREDICTED: non-specific lipid-transfer prote...  65.9    2e-10   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      64.3    6e-10   Avicennia marina
gb|AAB80805.1|  PrLTP1                                                63.5    2e-09   Pinus radiata
gb|KHN40624.1|  Non-specific lipid-transfer protein 3                 66.6    2e-09   
ref|NP_001238176.1|  uncharacterized protein LOC100305883 precursor   62.8    3e-09   
gb|EPS68587.1|  non-specific lipid-transfer protein                   62.8    3e-09   
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              62.4    3e-09   
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              62.4    3e-09   
gb|AAD09107.1|  nonspecific lipid-transfer protein precursor          62.0    5e-09   Brassica napus [oilseed rape]
ref|XP_008233418.1|  PREDICTED: non-specific lipid-transfer prote...  62.0    5e-09   
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  61.6    5e-09   
ref|XP_002872988.1|  predicted protein                                61.6    7e-09   
ref|XP_007149145.1|  hypothetical protein PHAVU_005G045100g           61.2    1e-08   
ref|XP_004506487.1|  PREDICTED: non-specific lipid-transfer prote...  61.2    1e-08   
gb|ABR18323.1|  unknown                                               61.2    1e-08   Picea sitchensis
emb|CDY64020.1|  BnaCnng42980D                                        60.8    1e-08   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           60.8    2e-08   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    2e-08   
gb|AFM39014.1|  lipid transfer protein                                60.1    2e-08   
ref|XP_002459813.1|  hypothetical protein SORBIDRAFT_02g011135        60.8    2e-08   Sorghum bicolor [broomcorn]
ref|XP_004229752.1|  PREDICTED: non-specific lipid-transfer prote...  60.1    3e-08   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    59.3    3e-08   Lactuca sativa [cultivated lettuce]
gb|AHB19225.1|  non specific lipid transfer protein 1C                59.7    3e-08   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              59.7    3e-08   
gb|ABK21641.1|  unknown                                               59.7    3e-08   Picea sitchensis
ref|XP_007134705.1|  hypothetical protein PHAVU_010G069500g           59.7    4e-08   
ref|XP_010451927.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    4e-08   
ref|XP_010043178.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    4e-08   
ref|XP_007033544.1|  Non-specific lipid-transfer protein 3, putative  59.7    4e-08   
gb|ABK24295.1|  unknown                                               59.7    4e-08   Picea sitchensis
ref|XP_008463259.1|  PREDICTED: non-specific lipid-transfer prote...  59.7    4e-08   
ref|XP_007220846.1|  hypothetical protein PRUPE_ppa023612mg           59.3    5e-08   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  59.3    5e-08   
ref|XP_010424833.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    6e-08   
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   59.3    6e-08   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           58.5    7e-08   
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  58.9    7e-08   
gb|ABK22438.1|  unknown                                               58.9    7e-08   Picea sitchensis
gb|AAS13435.1|  lipid-transfer protein                                58.5    8e-08   Nicotiana attenuata
ref|XP_004151695.1|  PREDICTED: non-specific lipid-transfer prote...  58.5    9e-08   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           58.5    9e-08   
gb|ADV02775.1|  lipid transfer protein 1c isoform 2                   58.5    9e-08   
gb|ADV02776.1|  lipid transfer protein 1c isoform 3                   58.5    1e-07   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           58.2    1e-07   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
ref|XP_003579021.1|  PREDICTED: probable non-specific lipid-trans...  58.5    1e-07   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
ref|XP_004506583.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
ref|XP_004488940.1|  PREDICTED: non-specific lipid-transfer prote...  58.2    1e-07   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    1e-07   
emb|CAA42870.1|  E2                                                   57.8    2e-07   Brassica napus [oilseed rape]
gb|ABV25703.1|  E2B protein                                           57.8    2e-07   Brassica juncea [brown mustard]
ref|XP_004506582.1|  PREDICTED: non-specific lipid-transfer prote...  57.8    2e-07   
ref|NP_001289050.1|  uncharacterized protein LOC103872288 precursor   57.8    2e-07   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 57.8    2e-07   
gb|KDP20367.1|  hypothetical protein JCGZ_05250                       57.8    2e-07   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  57.0    2e-07   
gb|AAC63372.1|  lipid transfer protein                                57.4    2e-07   Brassica oleracea
ref|XP_010683517.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    2e-07   
gb|ABK96813.1|  lipid transfer protein isoform 1.1 precursor          57.4    2e-07   Lactuca sativa [cultivated lettuce]
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    3e-07   
emb|CDY18379.1|  BnaA04g22080D                                        57.4    3e-07   
gb|ABK20926.1|  unknown                                               57.4    3e-07   Picea sitchensis
gb|AAF28385.1|AF151214_1  lipid-transfer protein                      57.4    3e-07   Nicotiana glauca [glaucous tobacco]
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    3e-07   
emb|CDY38865.1|  BnaA03g13140D                                        57.0    3e-07   
ref|XP_004506581.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    3e-07   
ref|XP_006347955.1|  PREDICTED: non-specific lipid-transfer prote...  57.4    3e-07   
ref|NP_001150972.1|  nonspecific lipid-transfer protein 3 precursor   57.4    3e-07   Zea mays [maize]
ref|NP_001142300.1|  uncharacterized protein LOC100274469 precursor   57.4    3e-07   Zea mays [maize]
gb|ACZ06858.1|  lipid transfer protein                                57.4    3e-07   
ref|XP_011091599.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    3e-07   
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    3e-07   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  57.0    3e-07   
gb|AAN75627.1|  lipid transfer protein 1 precursor                    57.0    3e-07   Triticum aestivum [Canadian hard winter wheat]
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  56.6    4e-07   Triticum aestivum [Canadian hard winter wheat]
gb|ABK22649.1|  unknown                                               57.0    4e-07   Picea sitchensis
gb|AAX84944.1|  non-specific lipid transfer protein-like antimicr...  56.6    4e-07   Leonurus japonicus [Chinese motherwort]
gb|ACQ42221.1|  lipid transfer protein                                57.0    4e-07   Chimonanthus praecox [wintersweet]
gb|AAQ96338.1|  lipid transfer protein                                56.6    4e-07   Vitis aestivalis
gb|AAB33171.1|  acyl-binding/lipid-transfer protein isoform II, A...  56.2    4e-07   
ref|XP_003546844.1|  PREDICTED: LOW QUALITY PROTEIN: non-specific...  57.0    5e-07   
ref|NP_001275802.1|  lipid-transfer protein precursor                 56.6    5e-07   
ref|XP_006400973.1|  hypothetical protein EUTSA_v10015064mg           56.6    5e-07   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  56.6    5e-07   
ref|XP_006369490.1|  hypothetical protein POPTR_0001s23920g           56.2    5e-07   
gb|ADV02772.1|  lipid transfer protein 1a                             56.6    6e-07   
gb|AAT68262.1|  lipid transfer protein                                56.2    6e-07   Nicotiana glauca [glaucous tobacco]
ref|XP_002323072.2|  hypothetical protein POPTR_0016s14290g           57.0    6e-07   Populus trichocarpa [western balsam poplar]
gb|AEI83502.1|  non-specific lipid-transfer protein                   56.2    6e-07   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  56.2    6e-07   Triticum aestivum [Canadian hard winter wheat]
gb|AAL27855.1|  lipid transfer protein precursor                      56.2    7e-07   Davidia involucrata
ref|XP_004229550.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    7e-07   
ref|XP_004491899.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    7e-07   
gb|EYU42017.1|  hypothetical protein MIMGU_mgv1a016521mg              56.2    7e-07   
ref|XP_004506518.1|  PREDICTED: uncharacterized protein LOC101489329  58.5    7e-07   
ref|XP_006400974.1|  hypothetical protein EUTSA_v10014841mg           57.0    7e-07   
sp|Q39794.1|NLTP_GERHY  RecName: Full=Non-specific lipid-transfer...  55.8    7e-07   Gerbera hybrid cultivar
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    8e-07   
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    55.8    8e-07   
ref|XP_006842467.1|  hypothetical protein AMTR_s00077p00070120        56.2    8e-07   
ref|XP_004513710.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    8e-07   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               55.8    8e-07   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25565.1|  unknown                                               55.8    8e-07   Picea sitchensis
gb|ABK21376.1|  unknown                                               55.8    8e-07   Picea sitchensis
ref|XP_009613302.1|  PREDICTED: non-specific lipid-transfer prote...  56.2    8e-07   
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 55.8    8e-07   
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  55.5    8e-07   
gb|KHN21357.1|  Non-specific lipid-transfer protein 8                 56.2    8e-07   
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   55.8    8e-07   
ref|NP_001236847.1|  uncharacterized protein LOC100306055             56.2    9e-07   
gb|AGH13363.1|  lipid transfer protein                                55.5    9e-07   
emb|CBW38498.1|  lipid transfer protein                               55.5    9e-07   
ref|XP_004516321.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    9e-07   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    55.8    9e-07   
emb|CBW38501.1|  lipid transfer protein                               55.5    1e-06   
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  55.5    1e-06   
gb|AFM35695.1|  nonspecific lipid transfer protein                    55.8    1e-06   
ref|XP_009768713.1|  PREDICTED: non-specific lipid-transfer prote...  55.8    1e-06   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 55.5    1e-06   
ref|XP_009135090.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-06   
ref|XP_003623611.1|  Non-specific lipid-transfer protein              55.8    1e-06   
gb|ABK21290.1|  unknown                                               55.5    1e-06   Picea sitchensis
gb|ABK22458.1|  unknown                                               55.5    1e-06   Picea sitchensis
ref|XP_006448818.1|  hypothetical protein CICLE_v10018033mg           55.5    1e-06   
gb|AAG27707.1|AF302788_1  lipid transfer protein precursor            55.5    1e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_011002608.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-06   
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    55.5    1e-06   
gb|KHG04165.1|  Non-specific lipid-transfer A                         55.5    1e-06   
ref|XP_002884695.1|  hypothetical protein ARALYDRAFT_478179           55.5    1e-06   
gb|EYU27746.1|  hypothetical protein MIMGU_mgv1a018860mg              55.1    1e-06   
gb|ADV02774.1|  lipid transfer protein 1c isoform 1                   55.5    1e-06   
ref|XP_004513426.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-06   
gb|AEI70829.1|  non-specific lipid-transfer protein                   55.1    1e-06   
emb|CAH69188.1|  type 1 non specific lipid transfer protein precu...  55.1    1e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003522081.1|  PREDICTED: non-specific lipid-transfer prote...  55.5    1e-06   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    1e-06   
ref|NP_001235162.1|  uncharacterized protein LOC100499726 precursor   55.1    2e-06   
gb|ABK25598.1|  unknown                                               55.5    2e-06   Picea sitchensis
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            55.1    2e-06   Glycyphagus domesticus
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            55.1    2e-06   Gossypium hirsutum [American cotton]
ref|XP_010527037.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
gb|ACU24604.1|  unknown                                               55.5    2e-06   Glycine max [soybeans]
gb|ACM78613.1|  lipid transfer protein 1                              55.1    2e-06   Tamarix hispida
ref|XP_010527034.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
gb|ABP01769.1|  lipid transfer protein 2                              55.1    2e-06   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006468370.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
ref|XP_009396874.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              54.3    2e-06   
ref|XP_010043171.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
gb|ABI26087.1|  lipid transfer protein precursor                      55.1    2e-06   Ginkgo biloba [ginkgo]
pdb|1BE2|A  Chain A, Lipid Transfer Protein Complexed With Palmit...  54.3    2e-06   
emb|CBW38504.1|  lipid transfer protein                               54.7    2e-06   
ref|NP_001176316.1|  Os11g0115466                                     55.1    2e-06   
gb|KHN43734.1|  Non-specific lipid-transfer protein 3                 55.5    2e-06   
ref|XP_010054612.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
ref|NP_195807.1|  pathogenesis-related lipid transfer protein         55.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347954.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    2e-06   
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   54.7    2e-06   
emb|CBW38503.1|  lipid transfer protein                               54.7    2e-06   
gb|KHN14506.1|  Non-specific lipid-transfer protein 3                 54.7    2e-06   
gb|AAT45202.1|  lipid transfer protein 1 precursor                    55.1    2e-06   Nicotiana tabacum [American tobacco]
ref|XP_009757306.1|  PREDICTED: non-specific lipid-transfer prote...  55.1    2e-06   
ref|XP_003605293.1|  Non-specific lipid-transfer protein              54.7    2e-06   
emb|CBW38499.1|  lipid transfer protein                               54.7    2e-06   
pdb|1MID|A  Chain A, Non-Specific Lipid Transfer Protein 1 From B...  54.3    2e-06   
ref|XP_006369492.1|  hypothetical protein POPTR_0001s23940g           54.7    2e-06   
gb|ABA29446.1|  non-specific lipid transfer protein                   54.7    2e-06   Vitis vinifera
gb|AFK37572.1|  unknown                                               55.1    2e-06   
gb|ACM78614.1|  lipid transfer protein 2                              54.7    2e-06   Tamarix hispida
gb|AAB33170.1|  acyl-binding/lipid-transfer protein isoform III, ...  54.3    2e-06   
emb|CBW38502.1|  lipid transfer protein                               54.3    2e-06   
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  54.7    2e-06   Lilium longiflorum [Easter lily]
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  54.7    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009800887.1|  PREDICTED: non-specific lipid-transfer prote...  54.7    2e-06   
gb|AAY83342.1|  non-specific lipid transfer protein precursor         54.7    2e-06   Fragaria x ananassa
emb|CDX73941.1|  BnaA03g31060D                                        54.7    2e-06   
gb|ABK21288.1|  unknown                                               54.7    3e-06   Picea sitchensis
gb|EYU42244.1|  hypothetical protein MIMGU_mgv1a024175mg              54.7    3e-06   
gb|KDO77575.1|  hypothetical protein CISIN_1g045117mg                 55.1    3e-06   
emb|CDP14199.1|  unnamed protein product                              54.7    3e-06   
dbj|BAB09776.1|  lipid transfer protein-like                          54.3    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AHG99490.1|  lipid-transfer protein                                54.7    3e-06   
gb|ABF14723.1|  non-specific lipid transfer protein 1 precursor       54.7    3e-06   Triticum aestivum [Canadian hard winter wheat]
gb|ABA96286.1|  Nonspecific lipid-transfer protein 3 precursor, p...  54.7    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 54.7    3e-06   
tpg|DAA59277.1|  TPA: hypothetical protein ZEAMMB73_838830            55.1    3e-06   
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  54.3    3e-06   Triticum aestivum [Canadian hard winter wheat]
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   54.3    3e-06   
ref|XP_011095136.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-06   
gb|AFR43285.1|  lipid transfer protein precursor                      54.7    3e-06   
ref|NP_001065986.1|  Os12g0115000                                     54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006842463.1|  hypothetical protein AMTR_s00077p00066810        54.7    3e-06   
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-06   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  54.3    3e-06   Helianthus annuus
emb|CAG28937.1|  lipid transfer protein                               54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065585.1|  Os11g0116000                                     54.3    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EAY79716.1|  hypothetical protein OsI_34868                        54.3    3e-06   Oryza sativa Indica Group [Indian rice]
gb|AEI70827.1|  non-specific lipid-transfer protein                   54.3    3e-06   
gb|EPS66894.1|  hypothetical protein M569_07878                       54.3    3e-06   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           54.3    3e-06   
ref|XP_004491900.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    3e-06   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  54.3    3e-06   Brassica oleracea var. italica [asparagus broccoli]
dbj|BAF46309.1|  lipid transfer protein 3 precursor                   54.3    3e-06   Ipomoea nil [qian niu]
ref|XP_002442773.1|  hypothetical protein SORBIDRAFT_08g002660        54.3    4e-06   Sorghum bicolor [broomcorn]
ref|XP_009803045.1|  PREDICTED: non-specific lipid-transfer prote...  54.3    4e-06   
sp|P07597.1|NLTP1_HORVU  RecName: Full=Non-specific lipid-transfe...  54.3    4e-06   Hordeum vulgare [barley]
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    53.9    4e-06   
emb|CDX93316.1|  BnaC04g45800D                                        54.3    4e-06   
dbj|BAK05317.1|  predicted protein                                    53.9    4e-06   
gb|AEN70936.1|  lipid transfer protein                                54.3    4e-06   
ref|XP_009141748.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
ref|XP_006836300.1|  hypothetical protein AMTR_s00092p00021420        53.9    4e-06   
gb|AGC08424.1|  lipid transfer protein                                55.1    4e-06   
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           53.9    4e-06   
emb|CDY00655.1|  BnaC03g36390D                                        53.9    4e-06   
sp|Q42642.1|NLTPB_BRAOT  RecName: Full=Non-specific lipid-transfe...  53.9    4e-06   Brassica oleracea var. italica [asparagus broccoli]
gb|AAT68264.1|  lipid transfer protein                                53.9    4e-06   Nicotiana glauca [glaucous tobacco]
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  53.9    4e-06   Hordeum vulgare [barley]
ref|XP_006374049.1|  hypothetical protein POPTR_0016s14290g           53.9    4e-06   
emb|CDP12600.1|  unnamed protein product                              53.9    4e-06   
sp|Q42615.1|NLTP2_BRANA  RecName: Full=Non-specific lipid-transfe...  53.9    4e-06   
ref|XP_009141746.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
ref|XP_002442777.1|  hypothetical protein SORBIDRAFT_08g002700        54.3    4e-06   
ref|NP_001065988.1|  Os12g0115300                                     53.9    4e-06   
gb|KHG21711.1|  Non-specific lipid-transfer                           53.9    4e-06   
ref|XP_004513427.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
ref|NP_001274465.1|  non-specific lipid-transfer protein 3-like p...  53.9    4e-06   
gb|EYU42011.1|  hypothetical protein MIMGU_mgv1a016819mg              53.5    4e-06   
ref|XP_009346911.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    4e-06   
gb|EAY79718.1|  hypothetical protein OsI_34870                        53.9    4e-06   
ref|XP_010537417.1|  PREDICTED: non-specific lipid-transfer prote...  53.9    5e-06   
ref|XP_011005034.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    5e-06   
ref|XP_007134701.1|  hypothetical protein PHAVU_010G069100g           53.9    5e-06   
emb|CBW38497.1|  lipid transfer protein                               53.5    5e-06   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 53.9    5e-06   
gb|AEI70830.1|  non-specific lipid-transfer protein                   53.9    5e-06   
ref|NP_001268074.1|  lipid transfer protein precursor                 53.9    5e-06   
gb|AAA74624.1|  lipid transfer protein precursor                      53.9    5e-06   
gb|AFR43292.1|  lipid transfer protein precursor                      53.9    5e-06   
dbj|BAJ91878.1|  predicted protein                                    53.5    5e-06   
gb|AGC08428.1|  lipid transfer protein                                53.9    5e-06   
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    53.5    5e-06   
gb|AET05733.1|  lipid transfer protein isoform d                      53.1    5e-06   
ref|XP_002323667.1|  putative lipid transfer family protein           53.5    5e-06   
emb|CDP07650.1|  unnamed protein product                              53.5    6e-06   
gb|KDO78394.1|  hypothetical protein CISIN_1g047114mg                 53.5    6e-06   
sp|Q42614.1|NLTP1_BRANA  RecName: Full=Non-specific lipid-transfe...  53.5    6e-06   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  53.5    6e-06   
ref|WP_039311159.1|  hypothetical protein                             53.1    6e-06   
ref|XP_008376137.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    6e-06   
ref|NP_187489.1|  lipid-transfer protein 6                            53.5    6e-06   
gb|KDP21874.1|  hypothetical protein JCGZ_00661                       53.5    6e-06   
gb|EPS66897.1|  hypothetical protein M569_07881                       53.5    6e-06   
ref|XP_010257636.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    7e-06   
gb|AEN70919.1|  lipid transfer protein                                53.5    7e-06   
gb|AEV23221.1|  stigma/stylar cysteine-rich adhesin                   53.5    7e-06   
emb|CAA65680.1|  lipid transfer protein 7a2b                          53.5    7e-06   
gb|AEC04836.1|  lipid transfer protein                                53.1    7e-06   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    7e-06   
ref|XP_011091596.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    7e-06   
ref|XP_006358720.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    7e-06   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    8e-06   
gb|ADP37976.1|  lipid transfer protein                                53.1    8e-06   
gb|ADR66942.1|  non-specific lipid transfer protein                   53.1    8e-06   
ref|XP_002445003.1|  hypothetical protein SORBIDRAFT_07g002600        53.5    8e-06   
ref|XP_004978533.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    8e-06   
ref|XP_007022999.1|  Non-specific lipid-transfer protein C, cotyl...  53.1    8e-06   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  53.1    8e-06   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  53.1    8e-06   
gb|KFK34403.1|  hypothetical protein AALP_AA5G140600                  53.1    8e-06   
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    53.1    8e-06   
gb|AFR43288.1|  lipid transfer protein precursor                      53.1    8e-06   
gb|ABX75045.1|  LTP isoallergen 2                                     52.8    9e-06   
gb|AAY43800.1|  FSLTP2                                                53.1    9e-06   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  53.1    9e-06   
ref|XP_009598623.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    9e-06   
ref|XP_006367904.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    9e-06   
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    9e-06   
ref|XP_006836299.1|  hypothetical protein AMTR_s00092p00020690        53.1    9e-06   
ref|XP_009397716.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    9e-06   
ref|NP_001065586.1|  Os11g0116200                                     53.1    9e-06   
ref|XP_006836298.1|  hypothetical protein AMTR_s00092p00019850        53.1    9e-06   
ref|XP_011095135.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    9e-06   
gb|AAL73541.1|AF466200_20  putative lipid transfer protein            53.5    9e-06   
gb|ABG27026.1|  phosophlipid protein                                  53.1    9e-06   
gb|ABK21262.1|  unknown                                               53.1    1e-05   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           53.1    1e-05   
gb|ADR66953.1|  non-specific lipid transfer protein                   52.8    1e-05   
ref|XP_006292062.1|  hypothetical protein CARUB_v10018257mg           52.8    1e-05   
ref|XP_008370253.1|  PREDICTED: non-specific lipid-transfer prote...  53.1    1e-05   
ref|NP_001268120.1|  lipid transfer protein precursor                 52.8    1e-05   
gb|KDP34869.1|  hypothetical protein JCGZ_09157                       52.8    1e-05   
gb|ABK94706.1|  unknown                                               52.8    1e-05   
ref|XP_003521806.1|  PREDICTED: probable non-specific lipid-trans...  52.8    1e-05   
ref|XP_010931358.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
gb|ABK23363.1|  unknown                                               52.8    1e-05   
emb|CAA42832.1|  LTP 1                                                53.1    1e-05   
gb|AFI61838.1|  harmalin                                              52.8    1e-05   
gb|KHL91133.1|  hypothetical protein QW71_36410                       52.8    1e-05   
gb|EYU37388.1|  hypothetical protein MIMGU_mgv1a018287mg              52.8    1e-05   
emb|CDY32650.1|  BnaA02g07120D                                        52.8    1e-05   
ref|XP_011091590.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
ref|XP_004492552.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           52.8    1e-05   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  52.8    1e-05   
ref|NP_001189842.1|  lipid-transfer protein 6                         52.8    1e-05   
gb|KHG09722.1|  Non-specific lipid-transfer                           52.8    1e-05   
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  52.4    1e-05   
emb|CDM80995.1|  unnamed protein product                              52.8    1e-05   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
gb|ADR66950.1|  non-specific lipid transfer protein                   52.8    1e-05   
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            52.8    1e-05   
gb|EPS73761.1|  non-specific lipid-transfer protein                   52.8    1e-05   
ref|XP_002305878.2|  lipid transfer family protein                    52.8    1e-05   
ref|XP_006353709.1|  PREDICTED: non-specific lipid-transfer prote...  53.5    1e-05   
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
emb|CCJ09772.1|  putative non-specific lipid transfer protein         52.0    1e-05   
ref|XP_006357913.1|  PREDICTED: putative non-specific lipid-trans...  51.2    1e-05   
ref|XP_006482792.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
ref|XP_008244927.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
gb|ACN11576.1|  lipid transfer protein 3 precursor                    52.8    1e-05   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    1e-05   
ref|XP_003623608.1|  Non-specific lipid-transfer protein              52.8    1e-05   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           52.8    1e-05   
ref|NP_001147136.1|  LOC100280743 precursor                           52.8    1e-05   
gb|ABF74563.1|  lipid transfer protein                                52.4    1e-05   
gb|KDP24100.1|  hypothetical protein JCGZ_25757                       52.4    1e-05   
ref|XP_006449828.1|  hypothetical protein CICLE_v10018268mg           52.4    1e-05   
ref|XP_008244911.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    1e-05   
ref|XP_003623593.1|  Non-specific lipid-transfer protein              52.4    1e-05   
ref|XP_006438990.1|  hypothetical protein CICLE_v10033098mg           52.4    1e-05   
ref|XP_006842465.1|  hypothetical protein AMTR_s00077p00067510        52.8    1e-05   
gb|EYU42014.1|  hypothetical protein MIMGU_mgv1a016509mg              52.4    2e-05   
gb|ACP30545.1|  lipid transfer protein precursor                      52.4    2e-05   
gb|AAB70539.1|  lipid transfer protein LPT II                         52.4    2e-05   
emb|CDX71121.1|  BnaC03g12050D                                        52.4    2e-05   
gb|KFK34405.1|  non-specific lipid transfer protein                   52.4    2e-05   
gb|AAM22767.2|  lipid transfer protein 2 precursor                    52.4    2e-05   
gb|AFR43291.1|  lipid transfer protein precursor                      52.4    2e-05   
gb|ABK96515.1|  unknown                                               52.4    2e-05   
emb|CAH69199.1|  type 1 non specific lipid transfer protein precu...  52.4    2e-05   
gb|AFR43293.1|  lipid transfer protein precursor                      52.4    2e-05   
ref|XP_008778991.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    2e-05   
gb|ACM78619.1|  non-specific lipid-transfer protein type 1            52.4    2e-05   
ref|XP_004492553.1|  PREDICTED: non-specific lipid-transfer prote...  52.4    2e-05   
gb|ADR66943.1|  non-specific lipid transfer protein                   52.4    2e-05   
gb|AFK45186.1|  unknown                                               52.0    2e-05   
gb|ABA33849.1|  phospholipid transfer protein 1                       52.0    2e-05   
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    52.0    2e-05   
gb|ABA33850.1|  phospholipid transfer protein 1                       52.0    2e-05   
gb|EYU41036.1|  hypothetical protein MIMGU_mgv1a016508mg              52.0    2e-05   
emb|CDY32649.1|  BnaA02g07110D                                        52.0    2e-05   
sp|P10975.2|NLTPC_RICCO  RecName: Full=Non-specific lipid-transfe...  52.0    2e-05   
gb|AFX65219.1|  lipid transfer precursor protein                      52.0    2e-05   
ref|XP_010252072.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
emb|CDY02883.1|  BnaC02g10060D                                        52.0    2e-05   
gb|ABU95411.1|  Sin a 3 allergen                                      51.6    2e-05   
ref|XP_002533769.1|  Nonspecific lipid-transfer protein C, cotyle...  52.0    2e-05   
ref|XP_006411067.1|  hypothetical protein EUTSA_v10017425mg           52.0    2e-05   
ref|NP_001065989.2|  Os12g0115500                                     51.6    2e-05   
gb|ADR66949.1|  non-specific lipid transfer protein                   52.0    2e-05   
gb|KHG09723.1|  Non-specific lipid-transfer                           52.0    2e-05   
gb|ABA33847.1|  phospholipid transfer protein 1                       52.0    2e-05   
dbj|BAK05751.1|  predicted protein                                    52.0    2e-05   
ref|XP_002276372.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
gb|ABA33858.1|  phospholipid transfer protein 1                       52.0    2e-05   
ref|XP_010655785.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
gb|AFR43289.1|  lipid transfer protein precursor                      52.0    2e-05   
ref|XP_004513715.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
ref|XP_009598622.1|  PREDICTED: non-specific lipid-transfer prote...  52.8    2e-05   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
gb|ABA33846.1|  phospholipid transfer protein 1                       52.0    2e-05   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
emb|CAH04987.1|  type 1 non-specific lipid transfer protein precu...  52.0    2e-05   
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
gb|AAM64220.1|AF517548_1  lipid transfer protein                      51.6    2e-05   
gb|AFD32278.1|  stigma/style cysteine-rich adhesin                    52.0    2e-05   
gb|KDP45156.1|  hypothetical protein JCGZ_15021                       52.0    2e-05   
ref|XP_006296741.1|  hypothetical protein CARUB_v10014964mg           52.0    2e-05   
ref|XP_011095132.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    2e-05   
ref|XP_007147300.1|  hypothetical protein PHAVU_006G112300g           52.0    3e-05   
gb|ABA33866.1|  phospholipid transfer protein 1                       51.6    3e-05   
gb|ABA33860.1|  phospholipid transfer protein 1                       51.6    3e-05   
ref|XP_002533768.1|  Nonspecific lipid-transfer protein D, cotyle...  51.6    3e-05   
gb|AGH27866.1|  lipid transfer protein precursor                      52.0    3e-05   
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    3e-05   
ref|XP_010486423.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
gb|AEN70918.1|  lipid transfer protein                                52.0    3e-05   
ref|XP_004513713.1|  PREDICTED: non-specific lipid-transfer prote...  52.0    3e-05   
gb|ABA33857.1|  phospholipid transfer protein 1                       51.6    3e-05   
gb|AES79822.2|  Lipid transfer protein                                52.4    3e-05   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       51.6    3e-05   
gb|ABA33853.1|  phospholipid transfer protein 1                       51.6    3e-05   
gb|KHN40623.1|  Non-specific lipid-transfer protein                   51.6    3e-05   
gb|ABA33848.1|  phospholipid transfer protein 1                       51.6    3e-05   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        51.6    3e-05   
emb|CAB96876.2|  pru p 1                                              51.2    3e-05   
ref|XP_007134821.1|  hypothetical protein PHAVU_010G079000g           51.6    3e-05   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  51.6    3e-05   
ref|XP_009615065.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
ref|XP_004513711.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               51.6    3e-05   
gb|AEN70933.1|  lipid transfer protein                                51.6    3e-05   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  51.2    3e-05   
dbj|BAP11218.1|  hypothetical protein                                 51.2    3e-05   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        51.6    3e-05   
dbj|BAP11221.1|  hypothetical protein                                 51.2    3e-05   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  51.2    3e-05   
gb|ABA33854.1|  phospholipid transfer protein 1                       51.6    3e-05   
emb|CAB53447.1|  non-specific lipid transfer protein                  51.6    3e-05   
ref|XP_006407743.1|  hypothetical protein EUTSA_v10021759mg           51.6    3e-05   
ref|XP_006429571.1|  hypothetical protein CICLE_v10013114mg           51.6    3e-05   
emb|CAC86258.1|  lipid transfer protein                               51.6    3e-05   
dbj|BAP11220.1|  hypothetical protein                                 51.2    3e-05   
ref|XP_011091591.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    3e-05   
gb|AEN70915.1|  lipid transfer protein                                51.6    4e-05   
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  51.6    4e-05   
gb|ABA33856.1|  phospholipid transfer protein 1                       51.2    4e-05   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    51.6    4e-05   
dbj|BAP11219.1|  hypothetical protein                                 51.2    4e-05   
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-05   
ref|XP_004513712.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-05   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   51.2    4e-05   
gb|AFK38461.1|  unknown                                               51.2    4e-05   
emb|CBI18665.3|  unnamed protein product                              50.4    4e-05   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           51.2    4e-05   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               51.2    4e-05   
ref|NP_001236518.1|  uncharacterized protein LOC100306032 precursor   51.2    4e-05   
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-05   
sp|Q84N29.1|NLTP3_WHEAT  RecName: Full=Probable non-specific lipi...  51.2    4e-05   
ref|XP_006663744.1|  PREDICTED: probable non-specific lipid-trans...  51.2    4e-05   
gb|ABA33862.1|  phospholipid transfer protein 1                       51.2    4e-05   
ref|XP_006289652.1|  hypothetical protein CARUB_v10003210mg           51.2    4e-05   
dbj|BAP11226.1|  hypothetical protein                                 50.8    4e-05   
gb|AAM64852.1|  lipid transfer protein-like protein                   51.2    4e-05   
ref|XP_009365066.1|  PREDICTED: non-specific lipid-transfer prote...  51.2    4e-05   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            51.2    5e-05   
gb|AEN70917.1|  lipid transfer protein                                51.2    5e-05   
sp|Q42616.1|NLTP3_BRANA  RecName: Full=Non-specific lipid-transfe...  51.2    5e-05   



>ref|XP_009768673.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Nicotiana 
sylvestris]
Length=119

 Score =   162 bits (409),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = +3

Query  78   AVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVA  257
            +VM MV++L  +    G  ++ E      C+TV ALV+ACSSFV YG+PDP PG+PCCVA
Sbjct  6    SVMCMVMVLGVALIIQGTGAAEE------CSTVTALVAACSSFVNYGTPDPTPGAPCCVA  59

Query  258  MLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            M +LSN+A ST+ RQ VCRCVMDLITTYNPNAT+IATLPGFCGVSLGF IDPNTDCEY+
Sbjct  60   MTTLSNIASSTEMRQAVCRCVMDLITTYNPNATAIATLPGFCGVSLGFTIDPNTDCEYV  118



>ref|XP_009592279.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Nicotiana 
tomentosiformis]
Length=119

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 95/119 (80%), Gaps = 6/119 (5%)
 Frame = +3

Query  78   AVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVA  257
            +VM MV++L  +    G  ++ E      C+TV ALV+ACSSFV YG+PDP PG+PCCVA
Sbjct  6    SVMCMVMVLGVAIIIQGTGTAEE------CSTVTALVAACSSFVNYGTPDPTPGAPCCVA  59

Query  258  MLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            M +LSN+A ST+ RQ VCRCVMDLITTYNPNAT+IATLPGFCGVSLGF IDPNTDCEY+
Sbjct  60   MTTLSNIASSTEMRQAVCRCVMDLITTYNPNATAIATLPGFCGVSLGFTIDPNTDCEYV  118



>gb|EPS60737.1| hypothetical protein M569_14063 [Genlisea aurea]
Length=155

 Score =   157 bits (396),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTY  341
            DC TV  L+SACS+FV YGSPDPI GSPCC AM SL++LADS DNR+ VCRCVMD+I+TY
Sbjct  57   DCTTVTGLISACSTFVTYGSPDPILGSPCCSAMTSLNDLADSGDNRRTVCRCVMDMISTY  116

Query  342  NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            NPNAT+IATLPGFCGVSLGF IDPNTDCEY+
Sbjct  117  NPNATAIATLPGFCGVSLGFTIDPNTDCEYV  147



>ref|XP_011101186.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Sesamum 
indicum]
Length=128

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTY  341
            DCATV  LVS+CSSFV YGSPDPIPGSPCC AM SL+NLADS DNR+ VCRC+MDLI  Y
Sbjct  30   DCATVTELVSSCSSFVTYGSPDPIPGSPCCAAMTSLNNLADSGDNRRDVCRCLMDLIAAY  89

Query  342  NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            N +AT+IATLPGFCGVSLGF IDPNTDCEY+
Sbjct  90   NHHATAIATLPGFCGVSLGFTIDPNTDCEYV  120



>gb|EYU19529.1| hypothetical protein MIMGU_mgv1a015896mg [Erythranthe guttata]
Length=141

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 95/134 (71%), Gaps = 13/134 (10%)
 Frame = +3

Query  36   KLEEIVSLKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMY  215
            K  E+V + Y G   +++     + S              G DC+TV ALVS CS+FVMY
Sbjct  4    KFHEMVRISYIGVTVLILFWRFPAAS------------AAGEDCSTVTALVSTCSNFVMY  51

Query  216  GSPDPIPGSPCCVAMLSLSNLADSTD-NRQIVCRCVMDLITTYNPNATSIATLPGFCGVS  392
            GSPDPIPGSPCC AM SL+NLADS   NR+ VC+C+MDLI TY+ NAT+IATLPGFCGVS
Sbjct  52   GSPDPIPGSPCCTAMTSLNNLADSGGGNRRTVCQCLMDLINTYSSNATAIATLPGFCGVS  111

Query  393  LGFIIDPNTDCEYI  434
            LGF+IDPNTDC+Y+
Sbjct  112  LGFVIDPNTDCDYV  125



>ref|XP_006353344.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Solanum tuberosum]
Length=115

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 4/100 (4%)
 Frame = +3

Query  147  QQGGID--CATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADST--DNRQIVCR  314
             + G D  C+TV ALVSAC+SFV YG+PDPIPG+PCCVAM +LS +A ST    RQ VCR
Sbjct  15   HEAGADDECSTVTALVSACASFVNYGTPDPIPGAPCCVAMTTLSTVASSTGVQTRQSVCR  74

Query  315  CVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C+M+LITTYNPNAT+IATLPGFCGVSLGF IDPNTDCEY+
Sbjct  75   CMMELITTYNPNATAIATLPGFCGVSLGFTIDPNTDCEYV  114



>ref|XP_004234440.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Solanum 
lycopersicum]
Length=118

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 93/122 (76%), Gaps = 10/122 (8%)
 Frame = +3

Query  78   AVMMMVILLSTSRRRIGVESSSEQQGGID-CATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            +V  MV++L       GV     + G  D C+TV ALVSAC+SFV YG+PDP+PG+PCC+
Sbjct  3    SVFWMVVVL-------GVALVIHEAGAEDECSTVTALVSACASFVNYGTPDPVPGAPCCI  55

Query  255  AMLSLSNLADST--DNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            AM +LS +A ST    RQ VCRC+M+LITTYNPNAT+IATLPGFCGVSLGF I+PNTDCE
Sbjct  56   AMTTLSTVASSTGVQTRQSVCRCMMELITTYNPNATAIATLPGFCGVSLGFTIEPNTDCE  115

Query  429  YI  434
            ++
Sbjct  116  FV  117



>ref|XP_002279183.2| PREDICTED: putative non-specific lipid-transfer protein 14 [Vitis 
vinifera]
Length=124

 Score =   149 bits (375),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 7/122 (6%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
            G  AV +M IL+  S  +            IDC+TV ALVSACS+F+ YG+PDPIPGSPC
Sbjct  3    GQKAVKVMGILMVLSWAQ-------TTMAAIDCSTVTALVSACSTFITYGAPDPIPGSPC  55

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            C A++ L+++ADS DNR+ VCRC+M LI TYNPNAT+IATLPGFCG+SLGF +DPNTDC 
Sbjct  56   CDAVVGLNSIADSIDNRRSVCRCLMGLIATYNPNATAIATLPGFCGISLGFNLDPNTDCN  115

Query  429  YI  434
             +
Sbjct  116  LV  117



>emb|CBI31823.3| unnamed protein product [Vitis vinifera]
Length=102

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            IDC+TV ALVSACS+F+ YG+PDPIPGSPCC A++ L+++ADS DNR+ VCRC+M LI T
Sbjct  4    IDCSTVTALVSACSTFITYGAPDPIPGSPCCDAVVGLNSIADSIDNRRSVCRCLMGLIAT  63

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YNPNAT+IATLPGFCG+SLGF +DPNTDC  +
Sbjct  64   YNPNATAIATLPGFCGISLGFNLDPNTDCNLV  95



>emb|CAN82043.1| hypothetical protein VITISV_014443 [Vitis vinifera]
Length=130

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (72%), Gaps = 7/128 (5%)
 Frame = +3

Query  51   VSLKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDP  230
            +S +  G  AV +M IL+  S  +            IDC+ V ALVSACS+F+ YG+P P
Sbjct  3    ISHEMGGQKAVKVMGILMVLSWAQ-------TTMAAIDCSXVTALVSACSTFITYGAPXP  55

Query  231  IPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIID  410
            IPGSPCC A++ L+++ADS DNR+ VCRC+M LI TYNPNAT+IATLPGFCG+SLGF +D
Sbjct  56   IPGSPCCDAVVGLNSIADSIDNRRSVCRCLMGLIATYNPNATAIATLPGFCGISLGFNLD  115

Query  411  PNTDCEYI  434
            PNTDC  +
Sbjct  116  PNTDCNLV  123



>ref|XP_002510824.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
 gb|EEF51426.1| Nonspecific lipid-transfer protein precursor, putative [Ricinus 
communis]
Length=118

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 88/117 (75%), Gaps = 4/117 (3%)
 Frame = +3

Query  87   MMVILLSTSRRRIGV----ESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            M +  +   + +IGV      ++     +DC TV  L+SACS+F+ YGSPDP+PGSPCC 
Sbjct  1    MKLHKMGAQKVKIGVLVFLSWAAIVAADVDCTTVAGLLSACSTFINYGSPDPLPGSPCCD  60

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            AM SL+++A+S +NR  VCRC M LITTYNPNAT+IATLPGFCG+SLGF++DPNTDC
Sbjct  61   AMTSLNSVAESGNNRSSVCRCFMGLITTYNPNATAIATLPGFCGISLGFVLDPNTDC  117



>ref|XP_007038617.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY23118.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=158

 Score =   142 bits (359),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DC TV  L+S CS+F+ YGSPDP PGSPCC A+++L+ +ADSTDNR+ VC C+M LITT
Sbjct  24   VDCTTVTGLLSTCSAFITYGSPDPYPGSPCCDAVMNLNLIADSTDNRKSVCGCLMGLITT  83

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCE-YIG*TI*SSSLASFNMHELRG  491
            YNPN+T+IATLPGFCGV+LGF IDPNTDC  YI       SL   + H ++G
Sbjct  84   YNPNSTAIATLPGFCGVALGFTIDPNTDCNLYI-----LQSLPKNHRHGMQG  130



>ref|XP_010693467.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Beta 
vulgaris subsp. vulgaris]
Length=125

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 91/127 (72%), Gaps = 9/127 (7%)
 Frame = +3

Query  54   SLKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPI  233
            SLK    V +++  ILLS+S  +       E    +DC TV  L++ CS F+ YGSPDP+
Sbjct  7    SLKLLAMVDILL--ILLSSSTWQ-------EVGATVDCPTVTQLLNTCSVFITYGSPDPL  57

Query  234  PGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDP  413
            PGSPCC A++ LSNL DS ++R+ VCRC+M LI  Y+P+ATSIATLPGFCGVSLGFIIDP
Sbjct  58   PGSPCCDAVMGLSNLGDSIESRRSVCRCMMGLIAAYSPDATSIATLPGFCGVSLGFIIDP  117

Query  414  NTDCEYI  434
            NTDC  +
Sbjct  118  NTDCTLV  124



>gb|KDO60063.1| hypothetical protein CISIN_1g036089mg [Citrus sinensis]
Length=118

 Score =   137 bits (344),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DC TV  LVS+CSSF+ +G PDP+PGSPCC  + SL+ +AD+T+N+Q VC C+MDLI+T
Sbjct  29   VDCTTVTTLVSSCSSFIEHGFPDPMPGSPCCEGVNSLNVIADTTENKQSVCSCLMDLIST  88

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            YN NAT+IATLPGFCGV+LGF+IDPNTDC
Sbjct  89   YNTNATAIATLPGFCGVALGFVIDPNTDC  117



>ref|XP_002318820.2| hypothetical protein POPTR_0012s13360g [Populus trichocarpa]
 gb|EEE97040.2| hypothetical protein POPTR_0012s13360g [Populus trichocarpa]
Length=118

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DC TV   ++ACS+F+ YG+PDP+PGSPCC +M+SL  +A+S ++R+ +C C+M LITT
Sbjct  26   VDCTTVTGFLTACSTFITYGTPDPLPGSPCCDSMMSLKLIAESGNDRRSICLCLMGLITT  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YNPNAT+IATLPGFCG+SLGFI+DPNTDC  +
Sbjct  86   YNPNATAIATLPGFCGLSLGFILDPNTDCSSV  117



>gb|KDP22314.1| hypothetical protein JCGZ_26145 [Jatropha curcas]
Length=114

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  147  QQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMD  326
            +   IDCATV A +SACS+F+ YGSPDP+PGSPCC +M SL+ +A S DN++ VCRC M 
Sbjct  20   EATNIDCATVTAFLSACSTFISYGSPDPLPGSPCCESMTSLNLIAQSGDNKRSVCRCFMG  79

Query  327  LITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            LI  YNP AT+IATLPGFCG+SLGFI+ PN DC
Sbjct  80   LIAAYNPFATTIATLPGFCGISLGFIVGPNADC  112



>ref|XP_006490471.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Citrus sinensis]
Length=118

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DC TV  LVS+CSSF+ +G PDP+P SPCC  + SL+ +AD+T+N+Q VC C+MDLI+T
Sbjct  29   VDCTTVTTLVSSCSSFIEHGFPDPMPSSPCCEGVNSLNVIADTTENKQSVCSCLMDLIST  88

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            YN NAT+IATLPGFCGV+LGF+IDPNTDC
Sbjct  89   YNTNATAIATLPGFCGVALGFVIDPNTDC  117



>ref|XP_006421872.1| hypothetical protein CICLE_v10006787mg [Citrus clementina]
 gb|ESR35112.1| hypothetical protein CICLE_v10006787mg [Citrus clementina]
Length=93

 Score =   133 bits (335),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT  335
            G +C TV  LVS+CSSF+ +G PDP+PGSPCC  + SL+ +AD+T+N+Q VC C+MDLI+
Sbjct  3    GRNCTTVTTLVSSCSSFIEHGFPDPMPGSPCCEGVNSLNVIADTTENKQSVCSCLMDLIS  62

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            TYN NAT+IATLPGFCGV+LGF+IDPNTDC
Sbjct  63   TYNTNATAIATLPGFCGVALGFVIDPNTDC  92



>ref|XP_004496838.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Cicer arietinum]
Length=126

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I+C+TV  L S+CS F+ YG+PDPIPGSPCC AM  LS +++S DN+Q VCRC+M LI T
Sbjct  26   IECSTVSQLFSSCSIFITYGTPDPIPGSPCCDAMSGLSIISNSGDNKQSVCRCIMGLIQT  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
            YNPNAT+I TLPG CG+SLGFI+DPN DC   G
Sbjct  86   YNPNATAIGTLPGLCGISLGFILDPNVDCSLYG  118



>ref|XP_008378217.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Malus 
domestica]
Length=119

 Score =   134 bits (336),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 5/122 (4%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
            GS  +MM+   L+     + + SS+E+     CA+V +LV+ C +F+ YG+PDP PGSPC
Sbjct  2    GSRTLMMIGTTLTLLFSSVTLVSSTEE-----CASVTSLVTTCYTFITYGTPDPFPGSPC  56

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            C AM +L  +AD+ +NR+  CRC+M LI TYNPNA +IATLP FC VSLGF IDPNTDC 
Sbjct  57   CNAMANLKVIADTIENRRFACRCLMGLIATYNPNAYAIATLPDFCQVSLGFNIDPNTDCN  116

Query  429  YI  434
            +I
Sbjct  117  FI  118



>ref|XP_006606095.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Glycine max]
Length=122

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (73%), Gaps = 9/121 (7%)
 Frame = +3

Query  72   SVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCC  251
            S+ ++++++LLS         S+      I+C+T+    SACS  ++YGSPDPIPGSPCC
Sbjct  10   SLRIIVLLMLLS---------SAPFVSAFIECSTITQFFSACSISIIYGSPDPIPGSPCC  60

Query  252  VAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEY  431
             AM  L+N+A++ DNR  VCRC+M LI TY+PNAT+IATLPG CGVSLGFIIDPNTDC  
Sbjct  61   DAMSGLNNIANTGDNRPYVCRCLMGLIDTYSPNATAIATLPGLCGVSLGFIIDPNTDCSL  120

Query  432  I  434
            +
Sbjct  121  V  121



>gb|KHN15673.1| Putative non-specific lipid-transfer protein 14, partial [Glycine 
soja]
Length=122

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 6/120 (5%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
            GS   + +++LL      + + S+      I+C+T+    SACS  ++YGSPDPIPGSPC
Sbjct  9    GSYKSLRIIVLL------MLLSSAPFVSAFIECSTITQFFSACSISIIYGSPDPIPGSPC  62

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            C AM  L+N+A++ DNR  VCRC+M LI TY+PNAT+IATLPG CGVSLGFIIDPNTDC 
Sbjct  63   CDAMSGLNNIANTGDNRPYVCRCLMGLIDTYSPNATAIATLPGLCGVSLGFIIDPNTDCS  122



>ref|XP_011030084.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Populus 
euphratica]
Length=117

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DC TV   ++ACS+F+ YG+PDP+PGSPCC +M+SL  +A+S ++R I C+C+M LITT
Sbjct  26   VDCTTVTGFLTACSTFITYGTPDPLPGSPCCDSMMSLGVIAESGNDRSI-CQCLMGLITT  84

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YNPNAT+IATLPGFCG+SLGFI+DPNTDC  +
Sbjct  85   YNPNATAIATLPGFCGLSLGFILDPNTDCSSV  116



>ref|XP_010278616.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Nelumbo 
nucifera]
Length=121

 Score =   132 bits (332),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 76/93 (82%), Gaps = 1/93 (1%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADS-TDNRQIVCRCVMDL  329
            G IDC  V  LVS C++F+ YGSPDP PGSPCC ++L+L ++ADS T+NRQ VCRC+M L
Sbjct  29   GTIDCGIVTTLVSTCTNFITYGSPDPFPGSPCCDSILALDHMADSSTNNRQSVCRCLMSL  88

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            I+ YNPN+T+IATLPG CG+SLGF IDPNT+C 
Sbjct  89   ISPYNPNSTAIATLPGLCGISLGFTIDPNTNCN  121



>ref|XP_007219448.1| hypothetical protein PRUPE_ppa021109mg [Prunus persica]
 gb|EMJ20647.1| hypothetical protein PRUPE_ppa021109mg [Prunus persica]
Length=116

 Score =   130 bits (326),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 6/120 (5%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
            GS  +M+ V +++     I V S+      I+C+ V ALVS C +F+ YGSPDP PGSPC
Sbjct  2    GSRKLMIGVTIMALLSTAILVSST------IECSAVTALVSTCYTFITYGSPDPFPGSPC  55

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            C AM +L  +AD+ +NR+  CRC++ LI+TYNPNA +IATLP FC VSLGF IDPNTDC 
Sbjct  56   CNAMANLKVIADTIENRRFACRCLLGLISTYNPNAYAIATLPDFCQVSLGFNIDPNTDCN  115



>gb|KCW46399.1| hypothetical protein EUGRSUZ_K00232 [Eucalyptus grandis]
Length=128

 Score =   130 bits (326),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DCATV+ALVS CS+F+ YG+PDP PG+PCC AM +L+ +A+  ++R+ VC C+M LI  
Sbjct  37   VDCATVRALVSTCSAFIAYGTPDPYPGTPCCDAMTTLNMVAEPLEDRRAVCSCLMGLINA  96

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y+PNAT+IATL GFCGVSLGF I PNTDC YI
Sbjct  97   YSPNATAIATLAGFCGVSLGFSISPNTDCNYI  128



>ref|XP_008234469.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Prunus 
mume]
Length=106

 Score =   129 bits (323),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I+C+ V ALVS C +F+ YGSPDP PGSPCC AM +L  +AD+ +NR+  CRC++ LI+T
Sbjct  14   IECSAVTALVSTCYTFITYGSPDPFPGSPCCNAMANLKVIADTIENRRFACRCLLGLIST  73

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YNPNA +IATLP FC VSLGF IDPNTDC  I
Sbjct  74   YNPNAYAIATLPDFCQVSLGFNIDPNTDCNLI  105



>ref|XP_006590211.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Glycine max]
Length=110

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 71/89 (80%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+T+  L SACS F+ YGS DPIPGSPCC AM  L+N+A+  DNR  VCRC++ LI T
Sbjct  14   IHCSTITQLFSACSIFITYGSSDPIPGSPCCDAMFGLNNIANIGDNRPYVCRCLLGLIET  73

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            Y+PN+T+IA LPG CGVSLGFIIDPNTDC
Sbjct  74   YSPNSTAIAILPGLCGVSLGFIIDPNTDC  102



>ref|XP_007143374.1| hypothetical protein PHAVU_007G067200g [Phaseolus vulgaris]
 gb|ESW15368.1| hypothetical protein PHAVU_007G067200g [Phaseolus vulgaris]
Length=120

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I+C+T+  L SACS F+  GSPDPIPGSPCC AM  ++N+A++ DNRQ VCRC+MDLI T
Sbjct  30   IECSTITQLFSACSMFITNGSPDPIPGSPCCDAMFGVNNIANTADNRQYVCRCLMDLIDT  89

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            ++ NA++I  LPG CG+SLGF +DPNTDC 
Sbjct  90   FSSNASAIGILPGLCGISLGFKMDPNTDCS  119



>ref|XP_010107409.1| Putative non-specific lipid-transfer protein 14 [Morus notabilis]
 gb|EXC15947.1| Putative non-specific lipid-transfer protein 14 [Morus notabilis]
Length=114

 Score =   126 bits (316),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSN--LADSTDNRQIVCRCVMDLIT  335
            +C+TV  L SACS+F+ YGSPDP PGSPCC AM SL+   +ADS + R+ VC C+MDLI 
Sbjct  23   ECSTVTELFSACSTFITYGSPDPFPGSPCCHAMNSLNFDVIADSIEQRRFVCHCLMDLIM  82

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
             YN NA++IA LPGFCG+SLGF IDPNTDC 
Sbjct  83   AYNSNASTIAALPGFCGISLGFTIDPNTDCN  113



>ref|XP_010483944.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Camelina 
sativa]
Length=120

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 77/118 (65%), Gaps = 6/118 (5%)
 Frame = +3

Query  81   VMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAM  260
            VM + +LL      +    S+  Q   DCA V  LVS+C+ FV YG PDPIPGS CC AM
Sbjct  8    VMSLFLLL------LSATCSATVQNAADCAAVGTLVSSCTKFVNYGYPDPIPGSSCCDAM  61

Query  261  LSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +   +DS+D R+ +C C M+LI  YN NAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  62   TVIGTYSDSSDKRKWLCNCFMELINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFI  119



>gb|KHN02805.1| Putative non-specific lipid-transfer protein 14, partial [Glycine 
soja]
Length=105

 Score =   125 bits (313),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+T+  L SACS F+ YGS DPIPGSPCC AM  L+N+A+  DN   VCRC++ LI T
Sbjct  15   IHCSTITQLFSACSIFITYGSSDPIPGSPCCDAMFGLNNIANIGDNGPYVCRCLLGLIET  74

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            Y+PN+T+IA LPG CGVSLGFIIDPNTDC
Sbjct  75   YSPNSTAIAILPGLCGVSLGFIIDPNTDC  103



>ref|XP_010041972.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Eucalyptus 
grandis]
Length=126

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DCATV+ALVS CS+F+ YG+PDP PG+PCC AM +L+ +A+  ++R+ VC C+M LI  
Sbjct  37   VDCATVRALVSTCSAFIAYGTPDPYPGTPCCDAMTTLNMVAEPLEDRRAVCSCLMGLINA  96

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            Y+PNAT+IATL GFCGVSLGF I PNTDC 
Sbjct  97   YSPNATAIATLAGFCGVSLGFSISPNTDCN  126



>ref|XP_010038430.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Eucalyptus 
grandis]
Length=126

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            +DCATV+ALVS CS+F+ YG+PDP PG+PCC AM +L+ +A+  ++R+ VC C+M LI  
Sbjct  37   VDCATVRALVSTCSAFIAYGTPDPYPGTPCCDAMTTLNMVAEPLEDRRAVCSCLMGLINA  96

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            Y+PNAT+IATL GFCGVSLGF I PNTDC 
Sbjct  97   YSPNATAIATLAGFCGVSLGFSISPNTDCN  126



>ref|XP_002864771.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41030.1| lipid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=120

 Score =   124 bits (311),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DCA V  L+S+C+ FV YG PDPIPGS CC AM  +   +DS + R+ +C C
Sbjct  21   SATVENAADCAAVGTLISSCTEFVNYGYPDPIPGSRCCDAMTVIGTYSDSLEKRKWLCNC  80

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             MDLI  YNPNAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  81   FMDLINVYNPNATAISTLSGFCGVVLGFTIDPNTDCNFI  119



>ref|NP_001078780.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
 sp|Q9FIT2.2|NLTPE_ARATH RecName: Full=Putative non-specific lipid-transfer protein 14; 
Short=LTP 14; Flags: Precursor [Arabidopsis thaliana]
 gb|AED97557.1| protease inhibitor/seed storage/LTP family protein [Arabidopsis 
thaliana]
Length=120

 Score =   123 bits (309),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DCA V  L+S+C+ FV YG PDPIPGS CC AM  +   +DS++ R+ +C C
Sbjct  21   SATVENAADCAAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTVIGTYSDSSEKRKWLCNC  80

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             MDLI  YN NAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  81   FMDLINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFI  119



>ref|XP_006857874.1| hypothetical protein AMTR_s00069p00101310 [Amborella trichopoda]
 gb|ERN19341.1| hypothetical protein AMTR_s00069p00101310 [Amborella trichopoda]
Length=114

 Score =   122 bits (306),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            S     IDC TV +L+SAC+SF+  G+P+P  GSPCC +++SL+NL DS +NR+ VC C+
Sbjct  18   SSAMAAIDCTTVTSLISACASFITNGTPEPSTGSPCCNSVMSLNNLGDSLENRRSVCTCL  77

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            ++L+ TYNPN TS+A LPG CG+SLGF + PNTDC 
Sbjct  78   VNLMATYNPNVTSMANLPGLCGISLGFTMGPNTDCS  113



>ref|XP_008799575.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Phoenix 
dactylifera]
Length=118

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLAD-STDNRQIVCR  314
            ++   G  DC+TV +L+S CS+FV YG+PDP  G+PCC  ++SL N+A  STD+R+  C 
Sbjct  20   ATAVAGLTDCSTVTSLISGCSNFVAYGTPDPTLGTPCCDGVVSLYNIASGSTDDRRSACS  79

Query  315  CVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            C+M LITTY PNAT+IA LPG CGVSLGFIIDP+TDC
Sbjct  80   CLMALITTYGPNATAIAHLPGLCGVSLGFIIDPSTDC  116



>ref|XP_010458204.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Camelina 
sativa]
Length=122

 Score =   121 bits (304),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 74/112 (66%), Gaps = 0/112 (0%)
 Frame = +3

Query  99   LLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNL  278
            ++S     +    S+  +   DCA V  LV++C+ FV YG PDPIPGS CC AM  +   
Sbjct  10   MMSLFLLLLSATCSATVENAADCAAVGTLVTSCTEFVNYGYPDPIPGSSCCDAMTVIGTY  69

Query  279  ADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +DS++ R+ +C C M+LI  YN NAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  70   SDSSEKRKWLCNCFMELINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFI  121



>dbj|BAB10168.1| unnamed protein product [Arabidopsis thaliana]
Length=118

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DCA V  L+S+C+ FV YG PDPIPGS CC AM  +   +DS++ R+ +C C
Sbjct  21   SATVENAADCAAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTVIGTYSDSSEKRKWLCNC  80

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
             MDLI  YN NAT+I+TL GFCGV LGF IDPNTDC 
Sbjct  81   FMDLINVYNSNATAISTLSGFCGVVLGFTIDPNTDCN  117



>gb|KFK27941.1| hypothetical protein AALP_AA8G451000 [Arabis alpina]
Length=121

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  Q   DCA V  L+S+C+ FV YG+PDPIPGS CC +M  L   + S++ R+ +C C
Sbjct  22   SATVQNEADCAAVGTLISSCAEFVNYGNPDPIPGSSCCDSMTILGTYSASSEKRRWLCDC  81

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             MDLI  YN NAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  82   FMDLINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFI  120



>emb|CDX86929.1| BnaC03g51990D [Brassica napus]
Length=145

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 68/100 (68%), Gaps = 0/100 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DC  V  L+S+C+ FV YG PDPIPGS CC AM  L   +DS+D R  +C C
Sbjct  21   SATVENAADCVAVGMLISSCTEFVNYGYPDPIPGSSCCDAMTVLGTYSDSSDKRMWLCNC  80

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
             +DLI  YN NAT+I+TL GFCG+ LGF IDPNTDC + G
Sbjct  81   FIDLINVYNSNATAISTLSGFCGIVLGFTIDPNTDCNFEG  120



>ref|XP_004309221.1| PREDICTED: putative non-specific lipid-transfer protein 14-like 
[Fragaria vesca subsp. vesca]
Length=119

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 1/91 (1%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADST-DNRQIVCRCVMDLIT  335
            ++C+ VKAL+SAC  F+ YG PDP PGSPCC +M+S+  + D+T +NR+  CRC+M L +
Sbjct  28   VECSGVKALLSACYYFITYGFPDPSPGSPCCNSMISIKMVCDNTVENRRFTCRCLMSLFS  87

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            TY PN  ++ATLP FC VSLGFI+DPNTDC 
Sbjct  88   TYTPNGYALATLPDFCQVSLGFIVDPNTDCN  118



>ref|XP_006279518.1| hypothetical protein CARUB_v10027812mg [Capsella rubella]
 gb|EOA12416.1| hypothetical protein CARUB_v10027812mg [Capsella rubella]
Length=122

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +3

Query  81   VMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAM  260
            V+ + +LL ++     VE++ E      CA V  LVS+C+ FV YG PDPIPGS CC AM
Sbjct  10   VIYLFLLLLSAICSATVENAGE------CAAVGTLVSSCTEFVNYGYPDPIPGSSCCDAM  63

Query  261  LSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +   +DS++ R+ +C C MDLI   N NAT+I+TL GFCGV LGF IDPNTDC +I
Sbjct  64   TVIGTYSDSSEKRKWLCNCFMDLINVNNSNATAISTLSGFCGVVLGFTIDPNTDCNFI  121



>ref|XP_009151329.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Brassica 
rapa]
Length=119

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 65/95 (68%), Gaps = 0/95 (0%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +   DC  V  L+S+C+ FV YG PDPIPGS CC AM  L   +DS+  R  +C C +DL
Sbjct  24   ENAADCVAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTLLGTYSDSSVKRMWLCNCFIDL  83

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            I  YN NAT+I+TL GFCG+ LGF IDPNTDC +I
Sbjct  84   INVYNSNATAISTLSGFCGIVLGFTIDPNTDCNFI  118



>emb|CDY00250.1| BnaA06g21510D [Brassica napus]
Length=148

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DC  V  L+S+C+ FV YG PDPIPGS CC AM  L   +DS+  R  +C C
Sbjct  20   SATVENAADCVAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTLLGTYSDSSVKRMWLCNC  79

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
             +DLI  YN NAT+I+TL GFCG+ LGF IDPNTDC + G
Sbjct  80   FIDLINVYNSNATAISTLSGFCGIVLGFTIDPNTDCNFEG  119



>ref|XP_006394439.1| hypothetical protein EUTSA_v10005335mg [Eutrema salsugineum]
 gb|ESQ31725.1| hypothetical protein EUTSA_v10005335mg [Eutrema salsugineum]
Length=121

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+  +   DCA V  L+S+C+ FV YG PDPIPGS CC AM  L   +DS++ R+ +C C
Sbjct  21   SATIENAADCAAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTVLGTYSDSSEKRRWLCNC  80

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
             M LI  Y+ NAT+I+TL GFCGV LGF IDPNTDC 
Sbjct  81   FMALINVYSSNATAISTLSGFCGVVLGFTIDPNTDCN  117



>ref|XP_010548835.1| PREDICTED: putative non-specific lipid-transfer protein 14 [Tarenaya 
hassleriana]
Length=122

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLA-DSTDNRQIVCRCVMDLI  332
            G+DC  V  L++ C+ +V YG PDPIPGS CC +M  LS  + DST +++ +C C + LI
Sbjct  28   GMDCGAVGTLIATCTEYVNYGYPDPIPGSRCCDSMNVLSMYSSDSTASKRWLCHCFIHLI  87

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            T YNPNAT+IATL GFCGV LGF +DPNTDC +I
Sbjct  88   TLYNPNATAIATLSGFCGVVLGFTVDPNTDCNFI  121



>ref|XP_003592299.1| hypothetical protein MTR_1g101320 [Medicago truncatula]
 gb|AES62550.1| Lipid transfer protein [Medicago truncatula]
Length=124

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 1/90 (1%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTD-NRQIVCRCVMDLIT  335
            I+C+TV  L S+CS F+ YG+PDP PGS CC AM  LS +A+S   N+Q VCRCVM LI 
Sbjct  31   IECSTVSQLFSSCSVFINYGTPDPSPGSRCCDAMSGLSIIANSGGGNKQSVCRCVMSLIQ  90

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
             Y  NAT+I TLPG CG+SLGF I PN++C
Sbjct  91   NYIQNATAIGTLPGLCGISLGFTIIPNSNC  120



>gb|EYU42013.1| hypothetical protein MIMGU_mgv1a016621mg [Erythranthe guttata]
Length=114

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 58/98 (59%), Gaps = 3/98 (3%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            + +  I C TV + +S C +FV+YG P P P S CC  + +L N A +T +RQ VC C+ 
Sbjct  18   QAEAAISCGTVASTLSPCINFVLYGGPTP-PTS-CCEGIKTLYNEATATADRQAVCSCLK  75

Query  324  DLITTYNPNATS-IATLPGFCGVSLGFIIDPNTDCEYI  434
             + ++  P   S  A LPG CGVS+ + I P+TDC  +
Sbjct  76   SVASSATPAIISNAAALPGKCGVSIPYKISPSTDCSSV  113



>ref|XP_002321906.1| hypothetical protein POPTR_0015s13310g [Populus trichocarpa]
 gb|EEF06033.1| hypothetical protein POPTR_0015s13310g [Populus trichocarpa]
Length=104

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQI  305
            G +DC T+   ++ACS+F+ YG+PDP+PGSPCC +M+SL+ +A+S +NR +
Sbjct  24   GDVDCTTLAGFLTACSTFITYGTPDPLPGSPCCDSMMSLNVIAESGNNRSV  74



>ref|XP_011095133.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
 gb|ABQ53931.1| lipid transfer protein [Sesamum indicum]
Length=119

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (52%), Gaps = 12/124 (10%)
 Frame = +3

Query  66   CGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSP  245
            C  +AV M+V+ L+            + +  I C TV   +S C ++VMYG     P  P
Sbjct  6    CLVLAVTMVVVALA----------PPQAEAAISCGTVANDLSPCINYVMYGGAG-TPPVP  54

Query  246  CCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNAT-SIATLPGFCGVSLGFIIDPNTD  422
            CC  + +L N A ST +RQ VC C+  +    +P    + A LPG CGVS+ + I P+TD
Sbjct  55   CCTGIKTLYNQASSTADRQAVCGCLKSVAGQASPAIIGTAAALPGKCGVSIPYEISPSTD  114

Query  423  CEYI  434
            C  +
Sbjct  115  CSKV  118



>gb|EAZ03777.1| hypothetical protein OsI_25905 [Oryza sativa Indica Group]
 gb|EAZ39716.1| hypothetical protein OsJ_24154 [Oryza sativa Japonica Group]
Length=134

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMY---GSPDPIPGSPCCVAMLSLSNLA-DSTDNRQIVCRCVMD  326
            + C TV +L+S C++FV     G+  P PG+PCC  +  L  +A DS DN + VCRC+  
Sbjct  32   LHCGTVTSLLSGCAAFVRGHGGGAQLPSPGTPCCDGVAGLYAVAADSADNWRAVCRCMAR  91

Query  327  LITTYNPNATSIATLPGFCGV  389
            L+  ++ NA++IA LPG CGV
Sbjct  92   LVRRHSSNASAIALLPGVCGV  112



>dbj|BAC07024.1| hypothetical protein [Oryza sativa Japonica Group]
Length=164

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 4/81 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMY---GSPDPIPGSPCCVAMLSLSNLA-DSTDNRQIVCRCVMD  326
            + C TV +L+S C++FV     G+  P PG+PCC  +  L  +A DS DN + VCRC+  
Sbjct  32   LHCGTVTSLLSGCAAFVRGHGGGAQLPSPGTPCCDGVAGLYAVAADSADNWRAVCRCMAR  91

Query  327  LITTYNPNATSIATLPGFCGV  389
            L+  ++ NA++IA LPG CGV
Sbjct  92   LVRRHSSNASAIALLPGVCGV  112



>ref|XP_010025406.1| PREDICTED: non-specific lipid-transfer protein 8-like [Eucalyptus 
grandis]
 gb|KCW62060.1| hypothetical protein EUGRSUZ_H04731 [Eucalyptus grandis]
Length=119

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 10/121 (8%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            VA  + + LLST   R+ V  S+     I C+ V   +  C S++  GS +P P + CC 
Sbjct  9    VAFFIALFLLST---RVPVSESA-----ISCSDVVKDLRPCVSYLKSGSGNP-PAA-CCA  58

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + SL+N A S+ +++  C C+ +     NPNA     LP  CGV+L   + PN DC  I
Sbjct  59   GVTSLANAATSSADKKAACACLKNAAQKMNPNAQLAQALPSKCGVTLPVAVSPNVDCSKI  118

Query  435  G  437
            G
Sbjct  119  G  119



>ref|XP_010229683.1| PREDICTED: non-specific lipid-transfer protein Cw18-like [Brachypodium 
distachyon]
Length=137

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 8/85 (9%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPD------PIPGSPCCVAMLSLSNLA-DSTDNRQIVCRC  317
            +DC TV ++++ C +FV  G P+      P PG+ CC  +  L  +A DS DN + VCRC
Sbjct  40   LDCGTVTSVLTGCGAFVRRG-PNAAAGLWPGPGTACCEGVAGLYAVAADSADNWRSVCRC  98

Query  318  VMDLITTYNPNATSIATLPGFCGVS  392
            + +L+  Y  NA++IA LPG C VS
Sbjct  99   MAELVREYWSNASAIALLPGLCAVS  123



>gb|AAK01293.1|AF331710_1 lipid transfer protein [Avicennia marina]
Length=117

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
              +  I C TV + ++ C  +V   +  P+ G  CC  + SL  LA +T +RQ VC C+ 
Sbjct  24   HGEAAISCGTVASKLAPCIPYVT--NRGPLGG--CCGGVKSLYGLARTTPDRQSVCGCLK  79

Query  324  DLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             L ++YN N    A LPG CGV++ + I P+TDC  +
Sbjct  80   SLASSYNVNLGKAAGLPGQCGVNIPYKISPSTDCSKV  116



>gb|AAB80805.1| PrLTP1 [Pinus radiata]
Length=127

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 51/94 (54%), Gaps = 0/94 (0%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              +DC T+   +++C++++  G+P P   S CC  + SL   A +T+  Q +C C+ +  
Sbjct  32   AALDCNTIIQQITSCATYLTTGTPVPQEESSCCQGVQSLYGDATTTEEIQQICTCLKNEA  91

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              YN N  ++ +LP  CG+ L F I  + DC  I
Sbjct  92   INYNLNDRALQSLPSNCGLQLSFTITRDIDCSSI  125



>gb|KHN40624.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=408

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            Q  + C  V + ++ C S+V+ G    +PG PCC  + +L NLA ST +RQ VC+C+ + 
Sbjct  29   QAAVTCNQVVSNLTPCISYVLNGG-KAVPG-PCCNGIKTLFNLAHSTPDRQTVCKCIKNA  86

Query  330  ITTYN---PNATSIATLPGFCGVSLGFIIDPNTDC  425
            ++ ++    N    A LP  CGV++ + I P+TDC
Sbjct  87   VSAFHYGKSNVDRAAALPKQCGVNIPYQISPSTDC  121



>ref|NP_001238176.1| uncharacterized protein LOC100305883 precursor [Glycine max]
 gb|ACU13784.1| unknown [Glycine max]
Length=125

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 59/100 (59%), Gaps = 5/100 (5%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            + Q  + C  V + ++ C S+V+ G    +PG PCC  + +L NLA ST +RQ VC+C+ 
Sbjct  27   KAQAAVTCNQVVSNLTPCISYVLNGG-KTVPG-PCCNGIKTLFNLAHSTPDRQTVCKCIK  84

Query  324  DLITTYNPNATSI---ATLPGFCGVSLGFIIDPNTDCEYI  434
            + ++ ++   +++   A LP  CGV++   I P+TDC  +
Sbjct  85   NAVSAFHYGKSNVDRAAALPKQCGVNIPCQISPSTDCTRV  124



>gb|EPS68587.1| non-specific lipid-transfer protein [Genlisea aurea]
Length=121

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 0/64 (0%)
 Frame = +3

Query  243  PCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTD  422
            PCC  +  L N A ST ++Q VC C+ +L   Y   A   A LPG CGV +G+ IDP+TD
Sbjct  57   PCCGGVSGLYNAARSTPDKQTVCNCLKNLAQAYPSIAGRAAGLPGQCGVQIGYSIDPHTD  116

Query  423  CEYI  434
            C  +
Sbjct  117  CRTV  120



>gb|EYU34081.1| hypothetical protein MIMGU_mgv1a024111mg, partial [Erythranthe 
guttata]
Length=109

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  +++ ++ C S++  G     P   CC  + S S    ST +RQ  C C+    +T
Sbjct  23   VSCGELQSSLAPCLSYLTGGGE---PSESCCGGLRSASGSIQSTQDRQTACYCMKSAAST  79

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            YN    + A+LPG CGVS+G  + PN DC
Sbjct  80   YNVPTDAAASLPGKCGVSVGMTVSPNVDC  108



>gb|EYU34080.1| hypothetical protein MIMGU_mgv1a026469mg, partial [Erythranthe 
guttata]
Length=112

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 46/89 (52%), Gaps = 2/89 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  +++ +S C S++  G  +P     CC  + S++    ST +RQ  C C+    ++
Sbjct  25   VSCGELQSSLSPCLSYLQAGGGEP--SESCCGGVRSVTGSIQSTQDRQTACNCLKSAASS  82

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            YN      A LPG CG S+G  I PN DC
Sbjct  83   YNVRTDVAANLPGKCGASIGMTISPNVDC  111



>gb|AAD09107.1| nonspecific lipid-transfer protein precursor [Brassica napus]
 emb|CDY64022.1| BnaCnng42990D [Brassica napus]
Length=112

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C+ ++M G P P   +PCC  +  L+++A +T +RQ  C+C+    
Sbjct  23   AAISCGTVTSNLAPCAVYLMKGGPVP---APCCAGVSKLNSMAKTTPDRQQACKCLKTAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               NP+  S  +LPG CGVS+ + I  +T+C+ +
Sbjct  80   KNVNPSLAS--SLPGKCGVSIPYPISMSTNCDTV  111



>ref|XP_008233418.1| PREDICTED: non-specific lipid-transfer protein 3-like [Prunus 
mume]
Length=119

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 54/95 (57%), Gaps = 7/95 (7%)
 Frame = +3

Query  165  CATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT--  338
            C TV   V+ C SFV  GS D  P   CC  +  LS  A+S  +R+ VC+C+  ++++  
Sbjct  22   CPTVTQQVAPCLSFVKGGS-DTKPSEECCKGVKELSVNANSRPDREAVCKCLKQMLSSVG  80

Query  339  -YNPNATSIATLPGFCGVSLGF-IIDPNTDCEYIG  437
             YNP+  S+  LP  CG+SL    ID NTDC  +G
Sbjct  81   NYNPSQVSL--LPKKCGLSLNLPPIDKNTDCSKVG  113



>gb|KFK27462.1| hypothetical protein AALP_AA8G386200 [Arabis alpina]
Length=112

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C++++  G   P+P   CCV +  L+ +A +T +RQ  CRC+    
Sbjct  23   AAITCGTVASSLAPCANYLTKGGAVPVP---CCVGVKKLNGMAQTTPDRQQACRCLQSAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + NP+  S   LPG CGVS+ + I  +T+C  I
Sbjct  80   KSVNPSLAS--GLPGKCGVSIPYPISTSTNCNTI  111



>ref|XP_002872988.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49247.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 52/101 (51%), Gaps = 12/101 (12%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C  V+A +  C ++V+ G   P     CC  +  L   A S  +RQ VCRC+   
Sbjct  21   EAAVSCNAVQADLYPCLAYVVQGGNIP---QSCCTGIKMLKQQAKSASDRQAVCRCIKSA  77

Query  330  I------TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +      +TY  NA   ATLPG CGV L + IDP+T+C  I
Sbjct  78   VGRVSYSSTYLKNA---ATLPGKCGVKLPYKIDPSTNCNSI  115



>ref|XP_007149145.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
 gb|ESW21139.1| hypothetical protein PHAVU_005G045100g [Phaseolus vulgaris]
Length=115

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 63/120 (53%), Gaps = 14/120 (12%)
 Frame = +3

Query  78   AVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVA  257
            A++++++L+STS            +G I C+ V   +  C S+++ GS  P P + CC  
Sbjct  10   ALVILILLVSTS------------EGAISCSDVIKDLRPCVSYLVSGSGQP-PAA-CCSG  55

Query  258  MLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
              +L++ A +T++++  C C+     + N N+     LPG CG++L   I PN DC   G
Sbjct  56   AKALASAASTTEDKKAACNCIKSTSKSININSQLAQALPGNCGITLPVAISPNADCSKFG  115



>ref|XP_004506487.1| PREDICTED: non-specific lipid-transfer protein 3-like [Cicer 
arietinum]
Length=124

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (59%), Gaps = 7/102 (7%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            + +G + C  V   +++C S++MYG  + +P   CC  + +L+ +A +T +R+ VC C+ 
Sbjct  24   KAEGAVTCGQVVNNLTSCVSYIMYGG-NTVPAQ-CCNGVRNLNAMAQTTPDRRAVCSCIK  81

Query  324  DLIT----TY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            + ++    TY N N    A+LP  CGV++ + I PNTDC  +
Sbjct  82   NAVSSSGFTYSNTNLNLAASLPRRCGVNIPYQISPNTDCNSV  123



>gb|ABR18323.1| unknown [Picea sitchensis]
Length=127

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + +  C  ++  G   P P   CC  +  L+ LA +T  R+ VC C+    + 
Sbjct  36   ISCGTVTSDLIQCVGYLTSGQGKPNPN--CCGGVKKLAGLATTTPARRTVCNCLKKAYSQ  93

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            + N N+ +++ LPG CGV+L F I P TDC  I
Sbjct  94   FPNVNSAAVSNLPGSCGVNLPFKISPQTDCSTI  126



>emb|CDY64020.1| BnaCnng42980D [Brassica napus]
Length=110

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C+S++  G P P   +PCC  +  L+++A +T +RQ  C+C+    
Sbjct  23   AAISCGTVTSNLAPCASYLTKGGPVP---APCCAGVSKLNSMAKTTPDRQQACKCLKTAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
               NP+  S  +LPG CGVS+ + I  +T+C+
Sbjct  80   KNVNPSLAS--SLPGKCGVSIPYPISMSTNCD  109



>ref|XP_006281283.1| hypothetical protein CARUB_v10027331mg [Capsella rubella]
 gb|EOA14181.1| hypothetical protein CARUB_v10027331mg [Capsella rubella]
Length=143

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 50/94 (53%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C  ++  G   P   +PCC  +  L+ LA +T +RQ  CRC+    
Sbjct  54   AAISCGTVASSLAPCGGYLSKGGAVP---APCCAGVKKLNGLAQTTPDRQQACRCLQSAA  110

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  111  KGINPSLAS--SLPGKCGVSIPYPISTSTNCATI  142



>ref|XP_010443684.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
 ref|XP_010483550.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G P P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVVSSLAPCGGYLSKGGPVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   INPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>gb|AFM39014.1| lipid transfer protein [Sinapis alba]
 gb|AGU28434.1| lipid transfer protein 1 [Sinapis alba]
Length=118

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV   V+ C  ++  G+P  +PG+ CC  + SL+NLA ST +RQ  CRC++     
Sbjct  27   LSCGTVSGYVAPCIGYLAQGAPA-LPGA-CCSGVTSLNNLARSTPDRQQACRCLVGAANA  84

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA   A LP  CGV++ + I   T+C  +
Sbjct  85   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>ref|XP_002459813.1| hypothetical protein SORBIDRAFT_02g011135 [Sorghum bicolor]
 gb|EER96334.1| hypothetical protein SORBIDRAFT_02g011135 [Sorghum bicolor]
Length=152

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 6/83 (7%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYG----SPD-PIPGSPCCVAMLSLSNLA-DSTDNRQIVCRCV  320
            +DCATV +L++ C +FV  G    SP  P PG+ CC  +  L  +A DS DN + VC C+
Sbjct  51   LDCATVTSLLAGCKAFVRRGVVAASPSVPAPGAACCEGVAELYAVASDSADNWRSVCGCM  110

Query  321  MDLITTYNPNATSIATLPGFCGV  389
              L+  Y  NA++IA LP  C V
Sbjct  111  AGLVRRYPSNASAIALLPVLCAV  133



>ref|XP_004229752.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=120

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            EQQGG+ C  V A ++ C S++  G     P + CC  + ++S +A STD R+  C C+ 
Sbjct  25   EQQGGVSCGQVDANMAPCISYLTQGGE---PSASCCSGVKTVSGMAQSTDERRTACNCLK  81

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 Y N    +   LP  CGVSL   I    +C+ I
Sbjct  82   AAANRYANLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>gb|ABK96812.1| lipid transfer protein isoform 1.2, partial [Lactuca sativa]
Length=91

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V   V+ C  ++  G   P    PCC  +  L N A +T +R+ +C C+    ++
Sbjct  1    VTCGQVVGAVAPCLGYLRNGGTPP---QPCCTGVRGLRNAARTTSDRKTICNCLKSASSS  57

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y   +    A+LPG CGV+L + I P+TDC  I
Sbjct  58   YRGVSGNYAASLPGKCGVNLPYKISPSTDCNRI  90



>gb|AHB19225.1| non specific lipid transfer protein 1C [Punica granatum]
Length=120

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +3

Query  135  SSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCR  314
            +S+  + GI C  V + ++ C  +       P+P   CC  + SL++ A +T +RQ  CR
Sbjct  20   ASTVAEAGITCGQVSSSLAGCIQYARGNGAGPVP-QACCNGIRSLNSAAKTTPDRQAACR  78

Query  315  CVMDLITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C+  L ++ +  N   +A  PG CGVS+ + I P+T+C+ +
Sbjct  79   CLKSLASSISGINYGLVAGAPGKCGVSIPYKIAPSTNCDNV  119



>gb|EYU40720.1| hypothetical protein MIMGU_mgv1a025606mg [Erythranthe guttata]
Length=115

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            + C  +++ ++ C S++  G     P   CC  + S S    ST +RQ  C C+    + 
Sbjct  25   VSCGELQSSLAPCLSYLTGGGE---PSESCCGGLRSASGSIQSTQDRQTACYCMKSAASC  81

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            TYN    + A+LPG CGVS+G  I PN DC  I
Sbjct  82   TYNVPTDAAASLPGKCGVSVGMTISPNVDCSQI  114



>gb|ABK21641.1| unknown [Picea sitchensis]
 gb|ABK23085.1| unknown [Picea sitchensis]
Length=126

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 59/115 (51%), Gaps = 9/115 (8%)
 Frame = +3

Query  93   VILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLS  272
            + LLS     +  ES+      I C TV + ++ C  ++  G   P P   CC  +  L+
Sbjct  19   IFLLSMEMMVMHAESA------ISCGTVTSDLTPCVGYLTSGKGKPTPN--CCGGVKKLA  70

Query  273  NLADSTDNRQIVCRCVMDLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             LA++T  R+ VC C+    + + N N+ +++ LPG CGV+L F I   T+C  I
Sbjct  71   GLANTTPARRAVCGCLKQAYSQFPNANSAAVSGLPGACGVNLPFKISLQTNCNTI  125



>ref|XP_007134705.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
 gb|ESW06699.1| hypothetical protein PHAVU_010G069500g [Phaseolus vulgaris]
Length=125

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 7/109 (6%)
 Frame = +3

Query  123  IGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQ  302
            +G  +S + Q  + C  V   +S C S+VMYG  + +P   CC  + +L   A +  +RQ
Sbjct  18   LGATTSPKAQAQMTCGQVVNNLSPCISYVMYGGVN-VPAQ-CCNGIKNLYGQAQTKTDRQ  75

Query  303  IVCRCVMDLITT--YN---PNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +C C+ + ++   +N    N  + A LP  CGV++ + I PNTDC  +
Sbjct  76   AICSCIKNAVSNSGFNYSRSNLNNAANLPKKCGVNIPYQISPNTDCNSV  124



>ref|XP_010451927.1| PREDICTED: non-specific lipid-transfer protein 10 [Camelina sativa]
Length=116

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S   +  + C  V A +  C+ +V  G    IPGS CC  +  L+  A S  +RQ VCRC
Sbjct  17   SRGSEAAVSCNAVVANLYPCAVYVAQG--GTIPGS-CCTGIRMLNGQAKSASDRQGVCRC  73

Query  318  V---MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   +  ++  + N  + ATLP  CGV L + IDP+T+C  I
Sbjct  74   IKSALGGVSYSSKNLKNAATLPAKCGVKLPYKIDPSTNCNSI  115



>ref|XP_010043178.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88337.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V++ V+ C  ++  G   P   S CC  + SL+N A +T +R+  CRCV   
Sbjct  23   ESAITCGQVRSWVAPCLGYLRAGGKIP---SACCSGIRSLNNAARTTHDRRTTCRCVQSA  79

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N   ++ LPG CGV + + I P+TDC  +
Sbjct  80   AGNIQGLNLGLVSALPGKCGVRIPYKISPSTDCSRV  115



>ref|XP_007033544.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
 gb|EOY04470.1| Non-specific lipid-transfer protein 3, putative [Theobroma cacao]
Length=122

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 6/105 (6%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            V ++ + +  + C  V   ++ C S+V YG P P     CC  + +L   A ++ +RQ V
Sbjct  20   VSATLQARAAVTCGDVVRTLTPCISYVQYGGPLP---DNCCNGVKTLYGEAQTSADRQNV  76

Query  309  CRCVMDLITTY---NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C+C+   +  +   N N    A LPG CG+ L + I P+TDC  +
Sbjct  77   CKCIKSAVNGFSYSNFNLGLAAGLPGKCGLHLPYTISPSTDCNKV  121



>gb|ABK24295.1| unknown [Picea sitchensis]
Length=126

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
              +  I C TV + ++ C  ++  G   P P   CC  +  L+ LA++T  R+ VC C+ 
Sbjct  30   HAESAISCGTVTSDMTPCVGYLTSGKGKPTPN--CCGGVKKLAGLANTTPARRAVCGCLK  87

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               + + N N+ +++ LPG CGV+L F I   T+C  I
Sbjct  88   QAYSQFPNANSAAVSGLPGACGVNLPFKISLQTNCNTI  125



>ref|XP_008463259.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=125

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 6/95 (6%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            + C  V + +S C S+V  G     P   CC  +  L+  A +T +RQ VCRC+  LI  
Sbjct  32   VTCNQVVSNLSPCISYVTGGGS---PSFNCCSGVRQLNKAAQTTPDRQDVCRCLKSLING  88

Query  336  -TYN-PNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             TYN  N  + A LP  CGV+L + I+PN DC  I
Sbjct  89   VTYNGQNVANAAALPTKCGVNLPYTINPNADCSTI  123



>ref|XP_007220846.1| hypothetical protein PRUPE_ppa023612mg [Prunus persica]
 gb|EMJ22045.1| hypothetical protein PRUPE_ppa023612mg [Prunus persica]
Length=113

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 54/100 (54%), Gaps = 7/100 (7%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            SS       C TV   V+ C SFV  GS D  P   CC  +  LS  A+S  +R+ VC+C
Sbjct  15   SSSANSAPSCPTVTQQVAPCLSFVKGGS-DTKPSEECCKGVKELSVNANSRPDREAVCKC  73

Query  318  VMDLITT---YNPNATSIATLPGFCGVSLGF-IIDPNTDC  425
            +  ++++   YNP+  S+  LP  CG+SL    ID NTDC
Sbjct  74   LKQVLSSVGNYNPSQVSL--LPKKCGLSLNLPPIDKNTDC  111



>gb|KFK26695.1| hypothetical protein AALP_AA8G281200 [Arabis alpina]
Length=112

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C++++  G   P+P   CC  +  L+ +A +T +RQ  CRC+    
Sbjct  23   AAITCGTVASSLAPCANYLTKGGAVPVP---CCAGVKKLNGMAQTTPDRQQACRCLQSAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + NP+  S   LPG CGVS+ + I  +T+C  +
Sbjct  80   KSVNPSLAS--GLPGKCGVSIPYPISMSTNCNTV  111



>ref|XP_010424833.1| PREDICTED: non-specific lipid-transfer protein 10-like [Camelina 
sativa]
Length=98

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 6/95 (6%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV---MDL  329
            + C  V A++  C+ +V  G    IPGS CC  +  L+  A S  NRQ VCRC+   +  
Sbjct  6    VSCNAVVAILYQCAMYVAQG--GTIPGS-CCTGIRMLNGQAKSASNRQGVCRCIKSALGG  62

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            ++  + N  + ATLP  CGV L + ID +T+C  I
Sbjct  63   VSYSSKNLKNAATLPAKCGVKLPYQIDLSTNCNSI  97



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 62/131 (47%), Gaps = 14/131 (11%)
 Frame = +3

Query  48   IVSLKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPD  227
            + S K    VA+M MV+ +S +            Q  I C  V   VS C S++  G   
Sbjct  2    MTSFKVACVVAMMCMVVAMSVT---------PMAQAAITCGQVAGDVSPCLSYLRSGGK-  51

Query  228  PIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNP--NATSIATLPGFCGVSLGF  401
              P   CC  + SLS  A +T +RQ  C C+ +L        NA + A+LPG CGV++ +
Sbjct  52   --PSDACCNGVKSLSGAAKTTADRQAACNCLKNLANNMGQSLNAGNAASLPGKCGVNIPY  109

Query  402  IIDPNTDCEYI  434
             I  +T+C  I
Sbjct  110  KISTSTNCATI  120



>ref|XP_006281350.1| hypothetical protein CARUB_v10027406mg [Capsella rubella]
 gb|EOA14248.1| hypothetical protein CARUB_v10027406mg [Capsella rubella]
Length=112

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 50/92 (54%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G   P   +PCC  +  L+ +A ST +RQ  C+C+      
Sbjct  25   ISCGTVASSLAPCGGYLSKGGAVP---APCCAGVKKLNGMAKSTPDRQQACKCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   INPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV + V+ C  ++  G   P+PG+ CC  +  L+++A +T +RQ  CRC+    + 
Sbjct  27   LTCGTVNSNVAPCIGYITQG--GPLPGA-CCTGVSKLNSMARTTPDRQQACRCLKTAASA  83

Query  339  YNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              P  NA   A +P  CGVS+ F I  NT+C  +
Sbjct  84   LGPSLNAGRAAGIPKACGVSVPFPISTNTNCNSV  117



>gb|ABK22438.1| unknown [Picea sitchensis]
 gb|ACN41159.1| unknown [Picea sitchensis]
Length=126

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 52/98 (53%), Gaps = 3/98 (3%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
              +  I C TV + ++ C  ++  G   P P   CC  +  L++LA +T  R+ VC C+ 
Sbjct  30   HAESAISCGTVTSDLTQCVGYLTSGKGKPTPS--CCGGVKKLADLASTTPARRAVCGCLK  87

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               + + N N+ +++ LPG CGV+L F I   T+C  I
Sbjct  88   QAYSQFPNVNSAAVSGLPGACGVNLPFKISLQTNCNTI  125



>gb|AAS13435.1| lipid-transfer protein [Nicotiana attenuata]
Length=117

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 49/98 (50%), Gaps = 4/98 (4%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
                 I C  V A +S C S+V  G   P   +PCC  + SL+N A ST +RQ  C C+ 
Sbjct  22   HADAAISCGQVVASLSPCISYVRQGGAIP---APCCSGIKSLNNQATSTPDRQTACNCIK  78

Query  324  DLITTYNPNATSIA-TLPGFCGVSLGFIIDPNTDCEYI  434
                  N    S+A +LP  CGV+L + I P+ DC  +
Sbjct  79   SAAAAINGINYSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>ref|XP_004151695.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 ref|XP_004167529.1| PREDICTED: non-specific lipid-transfer protein 3-like isoform 
1 [Cucumis sativus]
 gb|KGN54448.1| Non-specific lipid-transfer protein [Cucumis sativus]
Length=125

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 49/95 (52%), Gaps = 6/95 (6%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            + C  V   +  C S+V  G     P S CC  +  LS  A +T +RQ VCRC+  L+  
Sbjct  32   VSCNQVITNLRPCVSYVTGGG---YPSSNCCSGVKQLSTAARTTPDRQAVCRCLKSLVNG  88

Query  336  -TYN-PNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              YN  N  + A LP  CGV+L + I+PN DC  I
Sbjct  89   VKYNGQNVANAAALPTKCGVTLPYSINPNVDCNTI  123



>ref|XP_006411069.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
 gb|ESQ52522.1| hypothetical protein EUTSA_v10017438mg [Eutrema salsugineum]
Length=118

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (56%), Gaps = 5/97 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C TV + V+AC  ++  G   P+PG+ CC  + +L+++A +T +RQ  CRC+   
Sbjct  24   KAALTCGTVTSNVAACIGYITQG--GPVPGA-CCSGIKNLNSMARTTPDRQQACRCLKTA  80

Query  330  ITTYNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 P  NA   A LP  CGV++ F I  +T+C  +
Sbjct  81   ANALGPNLNAGRAAGLPKACGVNVPFPISTSTNCNSV  117



>gb|ADV02775.1| lipid transfer protein 1c isoform 2 [Ipomoea batatas]
Length=117

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            +S  +  + CA V   V+ C  ++  G   PIP + CC    S+     +T NRQ  CRC
Sbjct  20   ASHAEAAVSCAGVLNSVAPCIVYLNGGGIGPIPPT-CCAGARSVELQTRTTPNRQAACRC  78

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +  ++ +  PN ++++T+   CGV+L F I P+ DC  I
Sbjct  79   LKPILNSL-PNPSAVSTIAPKCGVNLSFKITPSMDCAAI  116



>gb|ADV02776.1| lipid transfer protein 1c isoform 3 [Ipomoea batatas]
Length=117

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (54%), Gaps = 2/99 (2%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            +S  +  + C  V   V+ C  ++  G   PIP + CC    S+     +T NRQ  CRC
Sbjct  20   ASHAEAAVSCTGVLNSVAPCIVYLNGGGIGPIPPT-CCAGARSVELQTRTTPNRQAACRC  78

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +  ++ ++ PN ++++T+   CGV+L F I P+ DC  I
Sbjct  79   LKPILNSF-PNPSAVSTIAPKCGVNLSFKITPSMDCAAI  116



>ref|XP_010443683.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVASSLAPCGGYLAKGGAVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   INPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_002866326.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42585.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + +S C S++  G   P    PCC  +  L+ LA +T +RQ  CRC+      
Sbjct  25   ITCGTVASSLSPCLSYLSKGGVVP---PPCCAGVKKLNGLAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S   LPG CGVS+ + I  +T+C  I
Sbjct  82   VNPSLAS--GLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_010483549.1| PREDICTED: non-specific lipid-transfer protein 4 [Camelina sativa]
Length=112

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVASSLAPCGGYLAKGGAVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   INPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_003579021.1| PREDICTED: probable non-specific lipid-transfer protein 3 [Brachypodium 
distachyon]
Length=123

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C ++V   +    PG  CC  +  L+N+A +T +RQ  CRC+  +  +
Sbjct  32   VTCGQVGSSIAPCVAYVTGKAAAVSPG--CCSGIRGLNNMARTTADRQAACRCLKSMAGS  89

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                N   +A +PG CGV++GF I  +TDC  +
Sbjct  90   IKALNMGKVAGVPGKCGVNVGFPISMSTDCNKV  122



>ref|XP_011098616.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Sesamum 
indicum]
Length=114

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 48/92 (52%), Gaps = 3/92 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V+  ++ C +++  G     P S CC  + SL+    S  +RQ  C C+    ++
Sbjct  25   ISCGDVQGSLAPCLAYLTGGGE---PSSSCCGGVRSLAGSLQSQQDRQTACYCMKSAASS  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +N  + + + LPG CGVS+G  + P+ DC  +
Sbjct  82   FNVRSDAASNLPGKCGVSIGMTVTPDIDCSKV  113



>ref|XP_004506583.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=121

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC C+
Sbjct  26   ARQIDDISCSEAIVLLVPCVPF-LTGLGQPTPSTSCCEGAQNLNQKADTTQVRRDVCECL  84

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
                  +  N+     LP  C +SL F +DPN DC
Sbjct  85   KGASMKFGVNSDKTKQLPQLCNISLSFTLDPNIDC  119



>ref|XP_004488940.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
 ref|XP_004516747.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=121

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC C+
Sbjct  26   ARQIDDISCSEAIVLLVPCVPF-LTGLGQPTPSTSCCEGAQNLNQKADTTQVRRDVCECL  84

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
                  +  N+     LP  C +SL F +DPN DC
Sbjct  85   KGASMKFGVNSDKTKQLPQLCNISLSFTLDPNIDC  119



>ref|XP_009132605.1| PREDICTED: non-specific lipid-transfer protein 3-like [Brassica 
rapa]
Length=112

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 53/94 (56%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + +  C+ ++M G P P   + CC  +  L+++A +T +RQ  C+C+    
Sbjct  23   AAISCGTVTSNLVPCAGYLMKGGPVP---ASCCAGVSKLNSMAKTTPDRQQACKCLKTAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + NP+  S  +LPG CGVS+ + I  +T+C  +
Sbjct  80   KSVNPSLAS--SLPGKCGVSIPYPISMSTNCNTV  111



>emb|CAA42870.1| E2 [Brassica napus]
 prf||1905428A phospholipid transfer protein
Length=119

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV + ++ C S++  G P P   S CCVA+ SL+ +A +T +R+ VC C+   
Sbjct  23   ESHITCGTVTSTMTQCISYLTNGGPLP---SSCCVAVKSLNQMAQTTPDRRQVCECLKSA  79

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N   +A LP  CGVSL + I  NT+C+ I
Sbjct  80   GKEIKGLNIDLVAALPTTCGVSLSYPIGFNTNCDSI  115



>gb|ABV25703.1| E2B protein [Brassica juncea]
Length=119

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV + ++ C S++  G P P   S CCVA+ SL+ +A +T +R+ VC C+   
Sbjct  23   ESHITCGTVTSTMTQCISYLTNGGPLP---SSCCVAVKSLNQMAQTTPDRRQVCECLKSA  79

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N   +A LP  CGVSL + I  NT+C+ I
Sbjct  80   GKEIKGLNIDLVAALPTTCGVSLSYPIGFNTNCDSI  115



>ref|XP_004506582.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=121

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (48%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC+C+
Sbjct  26   ARQIDDISCSEAIVLLMPCVPF-LTGLGQPTPSTSCCEGAQNLNQNADTTQVRRDVCQCL  84

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
                  +  N+     LP  C +SL F +DPN DC 
Sbjct  85   KGASMKFGVNSDKTKQLPQLCNISLSFTLDPNIDCN  120



>ref|NP_001289050.1| uncharacterized protein LOC103872288 precursor [Brassica rapa]
 gb|AAA91050.1| similar to lipid transfer protein [Brassica rapa]
 emb|CDY33269.1| BnaA01g19360D [Brassica napus]
Length=119

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV + ++ C S++  G P P   S CCVA+ SL+ +A +T +R+ VC C+   
Sbjct  23   ESHITCGTVTSTMTQCISYLTNGGPLP---SSCCVAVKSLNQMAQTTPDRRQVCECLKSA  79

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N   +A LP  CGVSL + I  NT+C+ I
Sbjct  80   GKEIKGLNIDLVAALPTTCGVSLSYPIGFNTNCDSI  115



>gb|KHN40180.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=115

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            S  +  I C+ V   +  C S+++ GS  P P + CC    SL++ A ++++++  C C+
Sbjct  19   STSEAAISCSDVIKDLRPCVSYLVSGSGQP-PAA-CCSGAKSLASAATTSEDKKAACNCI  76

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
                 + N N+     LPG CG++L   I PN DC  +G
Sbjct  77   KSTSKSININSQLAQALPGNCGITLPVAISPNADCSKVG  115



>gb|KDP20367.1| hypothetical protein JCGZ_05250 [Jatropha curcas]
Length=113

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C+ V   +  C ++++ GS   IP + CC    +LS++A +T +++  C C+   
Sbjct  20   EAAIACSDVIKDLRPCVNYLVKGSG--IPPAACCAGAKALSSVATTTADKRAACACIKSA  77

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
                NPN+     LP  CG+S  + + PN DC  I 
Sbjct  78   AQNINPNSQLAQALPSNCGISFPYTVSPNVDCSQIN  113



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            IDC  V +LV  C S+V  G   P P   CC  + +L N A S  +RQ  C C+  +   
Sbjct  1    IDCGHVDSLVRPCLSYVQGG---PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARG  57

Query  339  -YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  +  ++P  CGV+L + I  N DC  +
Sbjct  58   IHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV + V+ C  ++  G P P     CC  +  L+++A +T +RQ  CRC+    + 
Sbjct  27   LTCGTVNSNVAPCIGYITQGGPLP---RACCTGVSKLNSMARTTPDRQQACRCLKTAASA  83

Query  339  YNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              P  NA   A +P  CGVS+ F I  NT+C  +
Sbjct  84   LGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>ref|XP_010683517.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=123

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            + +  + C TV   ++ C +++  G+   +PG  CC  + +L+  A ST +RQ+VC+C+ 
Sbjct  26   QAKATVTCGTVATSLTPCLNYLQAGASGAVPGG-CCTGIKTLNGAAQSTPDRQMVCQCLK  84

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N N    +++P  CGV++ + +DP+TDC  +
Sbjct  85   SAAKAMPNVNVGLASSIPPKCGVNIPYKLDPSTDCSSV  122



>gb|ABK96813.1| lipid transfer protein isoform 1.1 precursor [Lactuca sativa]
Length=114

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 54/95 (57%), Gaps = 5/95 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V + +S C+S++  G   P     CC  + SL++ A +T +RQ VC C+   
Sbjct  24   EAAITCGQVVSSLSQCASYLRNGGAVP---PACCSGVKSLNSAARTTPDRQTVCGCLKR-  79

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +   NA++ A+LPG CGV++ + I P+TDC  +
Sbjct  80   -ASGGVNASNAASLPGKCGVNIPYKISPSTDCSKV  113



>ref|XP_004302622.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 63/129 (49%), Gaps = 11/129 (9%)
 Frame = +3

Query  57   LKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIP  236
            + + G   V+ +V+L   +   IG   ++     + C  V   +  C S+V  G     P
Sbjct  1    MAFSGVQKVVFLVVLSMAAALSIGGAEAA-----LTCGQVVNKLMPCVSYVQNGG---TP  52

Query  237  GSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTY---NPNATSIATLPGFCGVSLGFII  407
             + CC  + +L  +A +T +RQ VC C+   I        NA   A LPG CGV++ + I
Sbjct  53   AANCCGGIRALYGMAQTTPDRQSVCNCLKQAIAGIPYTGANAGLAAGLPGKCGVNIPYKI  112

Query  408  DPNTDCEYI  434
            +P+TDC+ I
Sbjct  113  NPSTDCKSI  121



>emb|CDY18379.1| BnaA04g22080D [Brassica napus]
Length=119

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV + V+ C  ++  G   P+PG+ CC  +  L+++A +T +RQ  CRC+    + 
Sbjct  27   LTCGTVNSNVAPCIGYITQG--GPLPGA-CCTGVSKLNSMARTTPDRQQACRCLKTAASA  83

Query  339  YNP--NATSIATLPGFCGVSLGFIIDPNTDCE  428
              P  NA   A +P  CGVS+ F I  NT+C 
Sbjct  84   LGPNLNAGRAAGIPKACGVSVPFPISTNTNCN  115



>gb|ABK20926.1| unknown [Picea sitchensis]
Length=123

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 61/123 (50%), Gaps = 6/123 (5%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
            G V  + +V L+ T     GV  +   +G I C  V + ++ C+ +++  +  P P   C
Sbjct  5    GMVKAVFLVGLVVTVMTAWGVVRT---EGAISCNQVVSALTPCAGYLIGNAATPAPA--C  59

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVS-LGFIIDPNTDC  425
            C A+  L +   +T +RQ VC C+ +  T++       A LPG C V+ +   ++PN DC
Sbjct  60   CPAIKGLDSQVKATPDRQAVCNCLKNQATSFGVKLGKAANLPGLCKVTDINVPVNPNVDC  119

Query  426  EYI  434
              I
Sbjct  120  SKI  122



>gb|AAF28385.1|AF151214_1 lipid-transfer protein [Nicotiana glauca]
Length=117

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 52/98 (53%), Gaps = 4/98 (4%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            +    I C  V + ++ C S+V  G   P   +PCC  + SL+N A ST +RQ  C C+ 
Sbjct  22   QADAAISCGQVVSSLTPCISYVTKGGAIP---APCCSGIKSLNNQATSTPDRQTACNCIK  78

Query  324  DLITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              + + +  N    ++LPG CGV+L + I P+ DC  +
Sbjct  79   SAVGSISGINFGLASSLPGKCGVNLPYKISPSIDCSTV  116



>ref|XP_009773021.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
sylvestris]
Length=111

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +G I C TV + +  C S++      P    PCC A  SL +   +T +RQ  C C+ + 
Sbjct  18   EGAISCGTVISTIKPCFSYLQGTGGKP--PQPCCTACQSLQSATSTTPDRQAACTCLKNA  75

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                N NA     LP  CG+SL F I  + DC  I
Sbjct  76   AQKVNINAQLAKGLPQSCGISLSFPISTSVDCTKI  110



>emb|CDY38865.1| BnaA03g13140D [Brassica napus]
Length=110

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + +  C+ ++M G P P   + CC  +  L+++A +T +RQ  C+C+    
Sbjct  23   AAISCGTVTSNLVPCAGYLMKGGPVP---ASCCAGVSKLNSMAKTTPDRQQACKCLKTAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
             + NP+  S  +LPG CGVS+ + I  +T+C 
Sbjct  80   KSVNPSLAS--SLPGKCGVSIPYPISMSTNCN  109



>ref|XP_004506581.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
 ref|XP_004506584.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=121

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC C+
Sbjct  26   ARQIDDISCSEAIVLLVPCVPF-LTGLGQPTPSTSCCEGAQNLNQKADTTQVRRDVCECL  84

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
                  +  N      LP  C +SL F +DPN DC
Sbjct  85   KGASMKFGVNPDKTKQLPQLCNISLSFTLDPNIDC  119



>ref|XP_006347955.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=120

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 48/98 (49%), Gaps = 4/98 (4%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            EQQGG+ C  V A ++ C S++  G     P + CC  + +++ +A S D R+  C C+ 
Sbjct  25   EQQGGVTCGQVDANMTPCISYLTQGGE---PNAACCSGVKTVNGMAQSADERKTACNCLK  81

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 Y N    +   LP  CGVSL   I    +C+ I
Sbjct  82   AAANRYANLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>ref|NP_001150972.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
 gb|ACG41114.1| nonspecific lipid-transfer protein 3 precursor [Zea mays]
Length=122

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + ++ C  +   G    +P S CC  + SL++ A ++ +RQ  CRC+  L  +
Sbjct  31   ITCGQVGSSLAPCIPYAT-GRASALPAS-CCSGVKSLNSAARTSADRQAACRCLKSLANS  88

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                N  ++AT+PG CGVS+GF I  +TDC  I
Sbjct  89   VKSVNMGTVATIPGKCGVSVGFPISMSTDCNKI  121



>ref|NP_001142300.1| uncharacterized protein LOC100274469 precursor [Zea mays]
 gb|ACF79347.1| unknown [Zea mays]
 gb|ACF86436.1| unknown [Zea mays]
 gb|ACF88133.1| unknown [Zea mays]
 gb|ACR36788.1| unknown [Zea mays]
 tpg|DAA59276.1| TPA: non-specific lipid-transfer protein [Zea mays]
Length=123

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + ++ C  +   G    +P S CC  + SL++ A ++ +RQ  CRC+  L  +
Sbjct  32   ITCGQVGSSLAPCIPYAT-GRASALPAS-CCSGVKSLNSAARTSADRQAACRCLKSLANS  89

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                N  ++AT+PG CGVS+GF I  +TDC  I
Sbjct  90   VKSVNMGTVATIPGKCGVSVGFPISMSTDCNKI  122



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 50/97 (52%), Gaps = 5/97 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            Q  I C  V   +S C S++  G     P   CC  + SLS+ A +T +RQ  C C+ +L
Sbjct  27   QAAITCGQVAGDMSPCFSYLRSGGK---PSQACCNGVKSLSSAAKTTADRQGACSCLKNL  83

Query  330  ITTYNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                    NA + A+LPG CGVS+ + I  +T+C  I
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVSIPYKISTSTNCATI  120



>ref|XP_011091599.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=118

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
            E +  I C TV + +S C  +V       + G  CC  +  L +LA ST +RQ VC C+ 
Sbjct  24   EGEAAIGCGTVVSKLSPCIPYVT--GKGALGG--CCKGIKGLYDLAKSTGDRQSVCNCLK  79

Query  324  DLI-TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             L  +T   N    A LPG CGVS+ + I P+TDC  +
Sbjct  80   FLAASTSGVNLGKAAALPGQCGVSIPYKISPSTDCSKV  117



>ref|XP_010454869.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVVSSLAPCGGYLSKGGAVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   VNPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_010454858.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 49/92 (53%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVVSSLAPCGGYLSKGGAVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S  +LPG CGVS+ + I  +T+C  I
Sbjct  82   INPSLAS--SLPGKCGVSIPYPISTSTNCATI  111



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            IDC  V +LV  C S+V  G   P P   CC  + +L N A S  +RQ  C C+  +   
Sbjct  27   IDCGHVDSLVRPCLSYVQGG---PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARG  83

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  +  ++P  CGV+L + I  N DC  +
Sbjct  84   IHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            IDC  V +LV  C S+V  G   P P   CC  + +L N A S  +RQ  C C+  +   
Sbjct  24   IDCGHVDSLVRPCLSYVQGG---PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARG  80

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  +  ++P  CGV+L + I  N DC  +
Sbjct  81   IHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>gb|ABK22649.1| unknown [Picea sitchensis]
 gb|ABK25515.1| unknown [Picea sitchensis]
 gb|ACN40466.1| unknown [Picea sitchensis]
Length=118

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+TV A +  C S+V   +  P P + CC  + +L+  A +T +RQ  C+C+     +
Sbjct  28   ISCSTVIADLVPCLSYVTGSAASP-PAA-CCNGVKTLNAAAQTTPDRQAACKCIKSAAAS  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y+ N+     +P  CGV++G  I P+T C+ I
Sbjct  86   YHYNSAKADKIPALCGVNIGIPISPSTSCDTI  117



>gb|AAX84944.1| non-specific lipid transfer protein-like antimicrobial protein 
[Leonurus japonicus]
Length=115

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 5/96 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV + ++ C  +V      P+ G  CC  +  L + A +T +RQ VC C+  L
Sbjct  23   EAAIGCNTVASKMAPCLPYVT--GKGPLGG--CCGGVKGLIDAARTTPDRQAVCNCLKTL  78

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +Y+  N  + A LPG CGVS+ + I PNTDC  +
Sbjct  79   AKSYSGINLGNAAGLPGKCGVSIPYQISPNTDCSKV  114



>gb|ACQ42221.1| lipid transfer protein [Chimonanthus praecox]
Length=119

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C TV + +S C ++V  G   P   + CC  + +L++ A +T +RQ  C C+   
Sbjct  26   EAALTCGTVTSALSPCITYVRNGGSVP---ASCCQGVAALNSAAKTTADRQAACSCLKSA  82

Query  330  ITTYNPNATSIAT-LPGFCGVSLGFIIDPNTDCEYI  434
            +++ +    S+A+ LPG CGVS+ + I P+TDC  +
Sbjct  83   LSSVSGIQPSLASSLPGKCGVSIPYQISPSTDCSKV  118



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +S C S++  G   P     CC  + SL++ A +T +RQ  C+C+ +  +T
Sbjct  29   ITCGQVASALSPCISYLQKGGAVP---PACCSGIKSLNSSAKTTADRQAACKCLKNFSST  85

Query  339  YNPNATSIAT-LPGFCGVSLGFIIDPNTDCEYI  434
             +    S+A+ LPG CGVS+ + I P+TDC  +
Sbjct  86   VSGINLSLASGLPGKCGVSVPYKISPSTDCTKV  118



>gb|AAB33171.1| acyl-binding/lipid-transfer protein isoform II, AB/LTP II [rape, 
seedlings, Peptide, 93 aa]
 prf||2107184B acyl-binding/lipid transfer protein:ISOTYPE=II
Length=93

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV   V+ C  ++  G+P  +P + CC  + SL+NLA +T +RQ  CRC++     
Sbjct  2    LSCGTVSGYVAPCIGYLAQGAPA-LPRA-CCSGVTSLNNLARTTPDRQQACRCLVGAANA  59

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA   A LP  CGV++ + I   T+C  +
Sbjct  60   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  92



>ref|XP_003546844.1| PREDICTED: LOW QUALITY PROTEIN: non-specific lipid-transfer protein 
8-like [Glycine max]
Length=138

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            S  +  I C+ V   +  C S+++ GS  P P + CC    +L++ A ++++++  C C+
Sbjct  42   STSEAAISCSDVIKDLRPCVSYLVSGSGQP-PAA-CCSGAKALASAATTSEDKKAACNCI  99

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
                 + N N+     LPG CG++L   I PN DC  +G
Sbjct  100  KSTSKSININSQLAQALPGNCGITLPVAISPNADCSKVG  138



>ref|NP_001275802.1| lipid-transfer protein precursor [Citrus sinensis]
 gb|AAM21292.1|AF369931_1 lipid-transfer protein [Citrus sinensis]
Length=115

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V   ++ C  F+  G P P+P   CC  + SL+  A +T +RQ  C C+     +
Sbjct  25   ITCGQVSGSLAPCIGFLRSGGPIPMP---CCNGVRSLNAAARTTPDRQTACNCLKQAAGS  81

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              N N  + A LPG CGVS+ + I  +TDC  +
Sbjct  82   IPNLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>ref|XP_006400973.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
 gb|AAM19702.1|AF499715_1 lipid transfer protein 4-like protein [Eutrema halophilum]
 gb|ESQ42426.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
Length=112

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + ++ C+ ++  G   P   +PCC  +  L+ +A +T +RQ  C+C+     +
Sbjct  25   ISCGTVASSLAPCAGYLTKGGAVP---APCCAGVSKLNGMAKTTPDRQQACKCLKAAAQS  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S   LPG CGVS+ + I  +T+C+ +
Sbjct  82   INPSLAS--GLPGKCGVSIPYPISMSTNCDNV  111



>ref|XP_010683514.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 3/103 (3%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            V ++   +  ++C  V + V+ C S++M  +  P  G  CC  +  L N+A +  +R+  
Sbjct  18   VVAAPHAEAAMNCGMVASNVAPCLSYLMGSAKQPPSG--CCAGIKKLKNMASTPMDRRTA  75

Query  309  CRCVMDLITT-YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C C+    T   N N    A LP  CGVS+ + I P TDC  +
Sbjct  76   CGCLKSAATAMKNMNYGKAAGLPKQCGVSIPYAISPKTDCSRV  118



>ref|XP_006369490.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
 gb|ERP66059.1| hypothetical protein POPTR_0001s23920g [Populus trichocarpa]
Length=108

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 56/120 (47%), Gaps = 13/120 (11%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            +A +MM +LL+              +  I C+ V   +  C S++M G+  P P + CC 
Sbjct  1    MAALMMFLLLTP-----------PSEAAISCSDVIKDLRPCVSYLMNGTGKP-PAA-CCS  47

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + ++   A +T ++Q  C C+       NP+      LP  CG++L F + PN DC  I
Sbjct  48   GISAIQASASTTADKQAACNCIKSASKQINPSPQLAQALPANCGITLPFTVSPNVDCSKI  107



>gb|ADV02772.1| lipid transfer protein 1a [Ipomoea batatas]
Length=120

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            V ++   +  I C ++ A +S+C S+V  G     P + CC A+ S++++A +T +RQ  
Sbjct  18   VVAAPSAEAAITCGSMVAKLSSCLSYVQ-GKVTGGPPAACCGAIKSINSVATTTPDRQAA  76

Query  309  CRCVMDLITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C+C+  +  +Y+  N   +++LP  CGV++G+ I  + DC  +
Sbjct  77   CKCLKQMAGSYSSVNMGVVSSLPSKCGVNIGYPISTSVDCAKV  119



>gb|AAT68262.1| lipid transfer protein [Nicotiana glauca]
Length=117

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 9/123 (7%)
 Frame = +3

Query  69   GSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPC  248
              VA++++V + + S     V  +      I C  V + ++ C S+V  G   P   +PC
Sbjct  2    AKVALLVVVCMAAVS-----VMLTPHADAAISCGQVVSSLTPCISYVTKGGAIP---APC  53

Query  249  CVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIA-TLPGFCGVSLGFIIDPNTDC  425
            C  + SL+N A ST +RQ  C C+     +      S+A +LPG CGV+L + I P+ DC
Sbjct  54   CNGIESLNNQATSTPDRQTACNCIKSAAASIKGINFSLAGSLPGKCGVNLPYKISPSIDC  113

Query  426  EYI  434
              +
Sbjct  114  STV  116



>ref|XP_002323072.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
 gb|EEF04833.2| hypothetical protein POPTR_0016s14290g [Populus trichocarpa]
Length=150

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  123  IGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQ  302
            I V ++S  +  I C  V   ++ C S+V+      + G+ CC A+  L++ A +T +RQ
Sbjct  46   IMVMTASTTKAAISCNQVINTLTPCISYVVGNGA--LTGN-CCNAIRGLNSAARTTPDRQ  102

Query  303  IVCRCVMDLITTYNPNATSIAT---LPGFCGVSLGFIIDPNTDCEYI  434
             VC C+ +  + ++ N+ ++A    LPG CGV L + IDP+TDC+ +
Sbjct  103  SVCTCLKNTASQFSYNSRNVALAAGLPGKCGVKLPYKIDPSTDCKSV  149



>gb|AEI83502.1| non-specific lipid-transfer protein [Wolffia arrhiza]
Length=119

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL--I  332
            I C  V   V  C  +V  G     P +PCC  + +L++ A ST +RQ  CRC+  L  +
Sbjct  26   ITCQEVAGSVLGCVPYVRSGGAVKPP-APCCNGIRALNSKAVSTLDRQTACRCLKSLAGV  84

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               + N  ++++LP  CGVS+ + I+P+TDC  I
Sbjct  85   LGRSMNLGAVSSLPSACGVSVPYPINPSTDCSRI  118



>emb|CAH69190.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69209.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/95 (32%), Positives = 52/95 (55%), Gaps = 3/95 (3%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
            G + C  V + ++ C S+    +  P  G  CC  + +L+  A ++ +RQ  CRC+ +L 
Sbjct  24   GAVTCGDVTSAIAPCMSYATGKASAPSAG--CCSGVRTLNGKASTSADRQAACRCLKNLA  81

Query  333  TTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             ++   +  + AT+PG CGVS+ F I+ N +C  I
Sbjct  82   GSFKGISMGNAATIPGKCGVSVSFPINTNVNCNNI  116



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 4/103 (4%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            V S+   +  I C TV   ++ C +++  G P P     CC  + SL+  A +T +RQ  
Sbjct  20   VVSAPHAEAAITCGTVTVSLAPCLNYLKKGGPVP---PACCNGIKSLNAAAKTTADRQAA  76

Query  309  CRCVMDLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C C+    T+    N +  ++LPG CGV++ + I P+TDC  +
Sbjct  77   CNCLKTASTSIAGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>ref|XP_004229550.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=120

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 46/99 (46%), Gaps = 1/99 (1%)
 Frame = +3

Query  132  ESSSEQQGGIDCATVKALVSACSSFVMYGSP-DPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            ++ + Q   I C  ++  +  C  F   GS    IP   CC   L+LS +A++T NR  V
Sbjct  20   QTYNSQADNIKCDNIERALRPCMVFFKGGSGVTGIPPYACCAGALTLSQIANNTANRSAV  79

Query  309  CRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            CRCV   I     +  +   LP  CG++L F   P   C
Sbjct  80   CRCVQSAIKDLRISDATAKALPHRCGITLPFTFSPYVKC  118



>ref|XP_004491899.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=120

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC C+
Sbjct  25   ARQIDDISCSEAIVLLVPCVPF-LTGLGQPTPSTSCCEGAQNLNQKADTTQVRRDVCECL  83

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
                  +  N+     LP  C +SL F IDP+ DC
Sbjct  84   KGASMKFGVNSDKTKQLPQLCNISLSFSIDPSIDC  118



>gb|EYU42017.1| hypothetical protein MIMGU_mgv1a016521mg [Erythranthe guttata]
Length=118

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT  335
            GI C TV   +  C++++  G   P   S CC  + S+++ A +T +R+  C C+     
Sbjct  28   GITCQTVVKGLMPCTNYLRKGGAIP---SACCRGVRSINSAAKTTADRRTACECIKVAAK  84

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             Y  N  + A LP  C V++G+ I  +TDC+ +
Sbjct  85   AYKVNVRNAAVLPRQCKVNIGYAISYSTDCKKV  117



>ref|XP_004506518.1| PREDICTED: uncharacterized protein LOC101489329 [Cicer arietinum]
Length=281

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 3/94 (3%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT  335
             + C+ V+  ++ C ++V  GS   +P  PCC  + +L+N A +T +RQ  CRC+  L  
Sbjct  189  ALTCSQVERKLTPCVAYVT-GSGGAVP-QPCCEGVRALNNQAVTTSDRQATCRCIKTLAK  246

Query  336  TYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 N  ++A LP  CGV+L + + P+TDC  I
Sbjct  247  ELRGLNLDTLAELPSKCGVNLPYTLGPSTDCNKI  280



>ref|XP_006400974.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
 gb|ESQ42427.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
Length=170

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 52/94 (55%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C+ ++  G   P   +PCC  +  L+ +A +T +RQ  C+C+    
Sbjct  81   AAISCGTVASSLAPCAGYLTKGGAVP---APCCAGVSKLNGMAKTTPDRQQACKCLKAAA  137

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             + NP+  S   LPG CGVS+ + I  +T+C+ +
Sbjct  138  QSINPSLAS--GLPGKCGVSIPYPISMSTNCDNV  169



>sp|Q39794.1|NLTP_GERHY RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Gerbera hybrid cultivar]
 emb|CAA83459.1| lipid transfer protein [Gerbera hybrid cultivar]
Length=116

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 4/100 (4%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            S+     I C  V + +  C  ++  G P P     CC  +  L+N A +T +RQ  C C
Sbjct  19   SASYADAISCGQVTSGLVPCFGYLAAGGPVP---PACCNGVRGLNNAAKTTPDRQTACGC  75

Query  318  VMDLITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +  ++      N  +  +LPG CG+S+G+ I PN DC  I
Sbjct  76   LKGILAANTRINLNNANSLPGKCGISIGYKITPNIDCSKI  115



>ref|XP_009143379.1| PREDICTED: non-specific lipid-transfer protein D [Brassica rapa]
 gb|ABM69132.1| lipid transfer protein precursor [Brassica rapa subsp. pekinensis]
 emb|CDY68529.1| BnaAnng27610D [Brassica napus]
Length=118

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV   V+ C  ++  G+P  +P + CC  + SL+NLA +T +RQ  CRC++     
Sbjct  27   LSCGTVSGYVAPCIGYLAQGAPA-LPRA-CCSGVTSLNNLARTTPDRQQACRCLVGAANA  84

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA   A LP  CGV++ + I   T+C  +
Sbjct  85   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>gb|AFD32275.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=114

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C ++   G   P PG  CC  + +L+NLA +T +RQ  C C+  L+  
Sbjct  24   ITCGQVDSDLTSCLAYARNGGQIP-PG--CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  80

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGV++ + I   TDC  +
Sbjct  81   SLGLNANIVAGIPGKCGVNIPYPISMQTDCNKV  113



>ref|XP_006842467.1| hypothetical protein AMTR_s00077p00070120 [Amborella trichopoda]
 gb|ERN04142.1| hypothetical protein AMTR_s00077p00070120 [Amborella trichopoda]
Length=130

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
            G + C TV + +  C +++  G   P    PCC  + S++ +A +T ++Q VC C+    
Sbjct  22   GAVSCGTVDSSLIPCINYLTSGGTVP---PPCCNGVRSVNGMAQTTPDKQAVCGCLKQAT  78

Query  333  TTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
            TT N  N   + +LPG CGV + F I  +TDC   G
Sbjct  79   TTINGINNNRLQSLPGDCGVDIPFTISVSTDCTKYG  114



>ref|XP_004513710.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
 ref|XP_004517041.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=120

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 5/117 (4%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            +A +M+V++L    R +     + Q   I C      + +C+ F + G   P P + CC 
Sbjct  7    IAFVMLVMVLGMQVRTL----DAHQIDDISCFEAIISLVSCAPF-LTGVGQPAPSTTCCE  61

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
               +L   AD+T  R+ +C+C+      +  N+     LP  C + L F IDP+ DC
Sbjct  62   GAHNLFQKADTTQVRRDICQCLKGASIKFGVNSDKAKQLPQLCNIGLSFSIDPSIDC  118



>ref|NP_568904.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
 sp|Q9LLR6.1|NLTP4_ARATH RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76930.1| lipid transfer protein 4 [Arabidopsis thaliana]
 gb|AAK59520.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAK74002.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15407.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15187.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM65751.1| nonspecific lipid-transfer protein precursor-like [Arabidopsis 
thaliana]
 gb|AAO00757.1| nonspecific lipid-transfer protein precursor - like [Arabidopsis 
thaliana]
 gb|AAP21322.1| At5g59310 [Arabidopsis thaliana]
 gb|AED97170.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
Length=112

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 48/92 (52%), Gaps = 5/92 (5%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + +S C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVASSLSPCLGYLSKGGVVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP+  S   LPG CGVS+ + I  +T+C  I
Sbjct  82   VNPSLAS--GLPGKCGVSIPYPISTSTNCATI  111



>gb|ABK25565.1| unknown [Picea sitchensis]
Length=118

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+TV + +  C S+V   +  P   + CC  + +L+  A +T +RQ  C+C+     +
Sbjct  28   ISCSTVISDLVPCLSYVTGSAASPT--AACCNGVKALNAAAQTTPDRQAACKCIKSAAAS  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y+ N+     +P  CGV++G  I P+T C+ I
Sbjct  86   YHYNSAKADKIPALCGVNIGIPISPSTTCDKI  117



>gb|ABK21376.1| unknown [Picea sitchensis]
Length=118

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+TV + +  C S+V   +  P   + CC  + +L+  A +T +RQ  C+C+     +
Sbjct  28   ISCSTVISDLVPCLSYVTGSAASPT--AACCNGVKALNAAAQTTPDRQAACKCIKSAAAS  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y+ N+     +P  CGV++G  I P+T C+ I
Sbjct  86   YHYNSAKADKIPALCGVNIGIPISPSTTCDKI  117



>ref|XP_009613302.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=141

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (46%), Gaps = 11/118 (9%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSP-DPIPGSPCC  251
            + ++MM  L         + S+ E +  I C+ V   V  C  F   GS    +P + CC
Sbjct  32   ILILMMFFLFP-------ITSNGETR--IQCSNVVGAVRPCVVFFRGGSGVTGMPPAACC  82

Query  252  VAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
              + +LS +A +  NRQ VCRCV   I        ++  LP  CGV+L F   PN  C
Sbjct  83   AGVSTLSKMA-AAKNRQAVCRCVQSAIKNLRATDATVKALPRRCGVTLPFTFSPNVKC  139



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V   ++ C +F+  G   P P  PCC  + SL+  A +T +RQ  C C+     +
Sbjct  24   ITCGQVTGSLAPCIAFLRTGGRFPPP--PCCNGVRSLNGAARTTPDRQAACNCLKQAYRS  81

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                NA   A LP  CGVS+ + I PNTDC  +
Sbjct  82   IPGINANVAAGLPRQCGVSIPYKISPNTDCSRV  114



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 46/92 (50%), Gaps = 4/92 (4%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT-  338
            DC  V +LV  C S+V  G   P P   CC  + +L N A S  +RQ  C C+  +    
Sbjct  2    DCGHVDSLVRPCLSYVQGG---PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGI  58

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +N N  +  ++P  CGV+L + I  N DC  +
Sbjct  59   HNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|KHN21357.1| Non-specific lipid-transfer protein 8 [Glycine soja]
Length=139

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C+ V   +  C S+++ GS  P P + CC    +L++ A ++++++  C C+   
Sbjct  46   EAAISCSDVIKDLRPCVSYLVSGSGQP-PAA-CCSGAKALASAATTSEDKKAACNCIKST  103

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
              + N N+     LPG CG++L   I PN DC  +G
Sbjct  104  SKSININSQLAQALPGNCGITLPVAISPNADCSKVG  139



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (52%), Gaps = 5/97 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            Q  I C  V   +S C S++  G     P   CC  + SLS+ A +T +RQ  C C+ +L
Sbjct  27   QAAITCGQVAGDMSPCFSYLRSGGK---PSQACCNGVKSLSSAAKTTADRQGACSCLKNL  83

Query  330  ITTYNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                    NA + A+LPG CGV++ + I  +T+C  I
Sbjct  84   ANNMGQSLNAGNAASLPGKCGVNIPYKISTSTNCATI  120



>ref|NP_001236847.1| uncharacterized protein LOC100306055 [Glycine max]
 gb|ACU14045.1| unknown [Glycine max]
Length=139

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 2/96 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C+ V   +  C S+++ GS  P P + CC    +L++ A ++++++  C C+   
Sbjct  46   EAAISCSDVIKDLRPCVSYLVSGSGQP-PAA-CCSGAKALASAATTSEDKKAACNCIKST  103

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
              + N N+     LPG CG++L   I PN DC  +G
Sbjct  104  SKSININSQLAQALPGNCGITLPVAISPNADCSKVG  139



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C S++  G   P     CC  + SL++ A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCISYLTKGGAVP---PACCSGVKSLNSAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C S++  G   P     CC  + SL++ A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCISYLTKGGAVP---PACCSGVKSLNSAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGVNAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_004516321.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=121

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 45/95 (47%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            + Q   I C+    L+  C  F + G   P P + CC    +L+  AD+T  R+ VC C+
Sbjct  26   ARQIDDISCSEAIVLLVPCVPF-LTGLGQPTPSTSCCEGAQNLNQKADTTQVRRDVCECL  84

Query  321  MDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
                  +  N+     LP  C +SL F IDP+ DC
Sbjct  85   KGASMKFGVNSDRTKQLPQLCNISLSFSIDPSIDC  119



>gb|AFD32274.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C  +   G   P PG  CC  + +L+NLA +T +RQ  C C+  L+  
Sbjct  23   ITCGQVDSDLTSCLGYARKGGEIP-PG--CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGV++ + I   TDC  +
Sbjct  80   SLGLNANIVAGIPGKCGVNIPYPISMQTDCNKV  112



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C S++  G   P     CC  + SL++ A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCISYLTKGGAVP---PACCSGVKSLNSAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|KFK26696.1| hypothetical protein AALP_AA8G281300 [Arabis alpina]
Length=112

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 5/94 (5%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C TV + ++ C++++  G   P    PCC  +  L+++A +T +RQ  CRC+    
Sbjct  23   AAISCGTVASSLAPCATYLSNGGAVP---DPCCEGVKELNSMAQTTPDRQQACRCLQSAA  79

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               NP+  S   LPG CGVS+ + I  +T+C  I
Sbjct  80   KGLNPSLAS--GLPGKCGVSIPYPISMSTNCNDI  111



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 54/96 (56%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V + +S C +++  G P P PG  CC  + +L++ A +T +RQ  C+C+  L
Sbjct  26   EAAITCGQVTSSLSPCLNYLKSGGPVP-PG--CCSGIKNLNSAAQTTADRQTACKCLKSL  82

Query  330  ITTYNPNATSIAT-LPGFCGVSLGFIIDPNTDCEYI  434
              +       +A+ LPG CGVS+ + I P+TDC  +
Sbjct  83   SGSIPGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_009768713.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=121

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 45/97 (46%), Gaps = 3/97 (3%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSP-DPIPGSPCCVAMLSLSNLADSTDNRQIVCR  314
            +S  +  I C+ V   V  C  F   GS    +P + CC  + +LS +A    NRQ VCR
Sbjct  25   TSNGETRIQCSNVVGAVRPCVVFFRGGSGVTGMPPAACCAGISTLSKMA--AKNRQAVCR  82

Query  315  CVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            CV   I        ++  LP  CGV+L F   PN  C
Sbjct  83   CVQSAIKNLRATDATVKALPRRCGVTLPFTFSPNVKC  119



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT  335
             I C  V   ++ C +F+  G   P P  PCC  + SL+  A +T +RQ  C C+     
Sbjct  23   AITCGQVTGSLAPCIAFLRTGGRFPPP--PCCNGVRSLNGAARTTPDRQAACNCLKQAYR  80

Query  336  TY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +    NA   A LP  CGVS+ + I PNTDC  I
Sbjct  81   SIPGINANVAAGLPRQCGVSIPYKISPNTDCSRI  114



>ref|XP_009135090.1| PREDICTED: non-specific lipid-transfer protein 6-like [Brassica 
rapa]
Length=115

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 53/98 (54%), Gaps = 5/98 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C  V   +  C S+VM G   P   + CC  + +L++ A +T +RQ VCRC+ + 
Sbjct  19   EAAVTCNNVVGDLYPCLSYVMQGGNSP--STNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  330  I---TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            I   +  + N  +  +LP  CGV+L F I P+T+C  I
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCNSI  114



>ref|XP_003623611.1| Non-specific lipid-transfer protein [Medicago truncatula]
 gb|AES79829.1| Lipid transfer protein [Medicago truncatula]
Length=127

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 52/92 (57%), Gaps = 5/92 (5%)
 Frame = +3

Query  165  CATVKALVSACSSFVMYGS-PDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTY  341
            C  V+  ++ C   ++Y + P   P  PCC  + +L   + +  +R+ VC C+  ++T  
Sbjct  30   CPAVQQTLTTC---LLYATNPHGPPPEPCCNGIKTLHGQSQTPLDRRDVCGCLKSMMTNL  86

Query  342  NPNATSIATLPGFCGVSLGFIIDPNTDC-EYI  434
              N  ++ATLP  CGV LG++I P+ DC +Y+
Sbjct  87   KLNLPAVATLPKECGVDLGYVISPDMDCSKYV  118



>gb|ABK21290.1| unknown [Picea sitchensis]
 gb|ABK26772.1| unknown [Picea sitchensis]
Length=118

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+TV + +  C S+V   + +P   + CC  + +L+  A +T +RQ  C+C+     +
Sbjct  28   ISCSTVISDLVPCLSYVAGSAANPT--AACCNGVKALNAAAKTTPDRQAACKCIKSAAAS  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y  N+     +PG CGVS+ F I  + +C  I
Sbjct  86   YKYNSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>gb|ABK22458.1| unknown [Picea sitchensis]
 gb|ACN40889.1| unknown [Picea sitchensis]
Length=118

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C+TV + +  C S+V   + +P   + CC  + +L+  A +T +RQ  C+C+     +
Sbjct  28   ISCSTVISDLVPCLSYVAGSAANPT--AACCNGVKALNAAAKTTPDRQAACKCIKSAAAS  85

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y  N+     +PG CGVS+ F I  + +C  I
Sbjct  86   YKYNSGKAGKIPGLCGVSVSFPISASVNCNAI  117



>ref|XP_006448818.1| hypothetical protein CICLE_v10018033mg [Citrus clementina]
 gb|ESR62058.1| hypothetical protein CICLE_v10018033mg [Citrus clementina]
Length=116

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV A  +AC  F    +P P   S CC  +  LS    + D+++ +CRC+   
Sbjct  23   EAAIACGTVDAKAAACFGFATGKAPTPT--SACCSGLQQLSQSVKTVDDKKAICRCLKAG  80

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +       ++ +P  CG+ +GF +   T+CE I
Sbjct  81   ARSLGVQDRFLSKIPSACGIKVGFPVSTATNCETI  115



>gb|AAG27707.1|AF302788_1 lipid transfer protein precursor [Triticum aestivum]
 gb|AAS84745.1| lipid transfer protein [Triticum aestivum]
 gb|AAV65513.1| lipid transfer protein [Triticum aestivum]
 gb|EMT15838.1| Non-specific lipid-transfer protein 4.3 [Aegilops tauschii]
Length=115

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +++C S+       P PG+ CC  +  L+ LA ST ++Q  CRC+      
Sbjct  27   ISCGQVNSALASCVSYAKGSGASP-PGA-CCSGVRRLAGLARSTADKQAACRCIKSAAGG  84

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP     A++P  CGVS+ + I  + DC  I
Sbjct  85   LNPGKA--ASIPSKCGVSIPYSISASVDCSKI  114



>ref|XP_011002608.1| PREDICTED: non-specific lipid-transfer protein 1 [Populus euphratica]
Length=120

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 62/107 (58%), Gaps = 6/107 (6%)
 Frame = +3

Query  123  IGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQ  302
            I V ++S  +  I C  V   ++ C S+V+      + G+ CC A+  +++ A +T +RQ
Sbjct  16   IMVMTASTTKAAISCNQVINTLTPCISYVVGNGA--LTGN-CCNAIRGINSAARTTPDRQ  72

Query  303  IVCRCVMDLITTYNPNATSIAT---LPGFCGVSLGFIIDPNTDCEYI  434
             VC C+ +  + ++ N+ ++A    LPG CGV L + IDP+TDC+ +
Sbjct  73   SVCTCLKNTASQFSYNSRNVALAAGLPGKCGVKLPYKIDPSTDCKSV  119



>gb|AFD32272.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C  +   G   P PG  CC  + +L+NLA +T +R+  C C+  L+  
Sbjct  23   ITCGQVVSSLTSCLGYARKGGEIP-PG--CCAGVRTLNNLAKTTPDRKTACNCLKSLVNP  79

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGVS+ + I   TDC  +
Sbjct  80   SLGLNANIVAGIPGKCGVSIPYPISMQTDCNKV  112



>gb|KHG04165.1| Non-specific lipid-transfer A [Gossypium arboreum]
Length=117

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 49/101 (49%), Gaps = 8/101 (8%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
             + Q  + C  V   ++AC  ++  G    +P +PCC  +  L N A++T +RQ  C CV
Sbjct  21   KQGQAAVTCKQVDDALAACVPYLTNGG---VPSTPCCNGVGELRNSAETTADRQAACNCV  77

Query  321  MDL---ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                  I T   +    ATLP  C V + F I  NT+CE I
Sbjct  78   KQAAARIPTIKED--DAATLPAKCHVQVDFPISKNTNCEDI  116



>ref|XP_002884695.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60954.1| hypothetical protein ARALYDRAFT_478179 [Arabidopsis lyrata subsp. 
lyrata]
Length=113

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 6/98 (6%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C TV A +  C S+V  G P P   S CC  + +L++ A ++ +RQ VCRC+   
Sbjct  18   EAAVSCNTVIADLYPCLSYVTQGGPVP---SLCCNGLTTLNSQAQTSADRQGVCRCIKSA  74

Query  330  IT--TYNPNATSIA-TLPGFCGVSLGFIIDPNTDCEYI  434
            I   T +P     A +LP  CG++L +   P+T+CE I
Sbjct  75   IGGLTLSPGTIDNALSLPSKCGINLPYKFSPSTNCESI  112



>gb|EYU27746.1| hypothetical protein MIMGU_mgv1a018860mg, partial [Erythranthe 
guttata]
Length=95

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 3/90 (3%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLAD-STDNRQIVCRCVMDLIT  335
            I C    A V  C +F++ G  D  P + CC A+ SL   A  S  +R+ +C C  D+  
Sbjct  6    IQCNDAVARVLPCEAFLLSG--DSTPSAACCSAVQSLDQTATASAGDRRAICECFKDVAK  63

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            ++  N      LP  C V++G  IDP+ DC
Sbjct  64   SFPINLAKAQLLPELCHVTVGVKIDPDVDC  93



>gb|ADV02774.1| lipid transfer protein 1c isoform 1 [Ipomoea batatas]
Length=117

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 2/99 (2%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            +S  +  + C  V   V+ C  ++      PIP + CC    S+     +T NRQ  CRC
Sbjct  20   ASHAEAAVSCTGVLNSVAPCIVYLNGDGIGPIPPT-CCAGARSVELQTRTTPNRQAACRC  78

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +  ++ ++ PN ++++T+   CGV+L F I P+ DC  I
Sbjct  79   LKPILNSF-PNPSAVSTIAPKCGVNLSFKITPSMDCAAI  116



>ref|XP_004513426.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Cicer 
arietinum]
Length=120

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 5/117 (4%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            +A +M+V++L    R +     + Q   I C      + +C+ F + G   P P + CC 
Sbjct  7    IAFLMLVMVLGMQVRTL----DAHQIDDISCFEAIISLVSCAPF-LTGVGQPAPSTTCCE  61

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
               +L   AD+T  R+ +C+C+      +  N+     LP  C + L F  DP+ DC
Sbjct  62   GAHNLFQKADTTQVRRDICQCLKGASIKFGVNSDKAKQLPQLCNIGLSFSFDPSIDC  118



>gb|AEI70829.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 13/124 (10%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            +A M M++L +     + V   +E    + C  V + ++ C  ++  G   P     CC 
Sbjct  1    MAKMAMMVLCAVVTCMVVVAPYAEA---LSCGQVSSSLAPCIGYLTKGGAVP---PACCN  54

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNP----NATSIATLPGFCGVSLGFIIDPNTD  422
             +  L+N A +T +RQ  C C   L + YN     NA + A+LPG CGVS+ + I P TD
Sbjct  55   GVKGLNNAAKTTPDRQAACGC---LKSAYNSISGINAGNAASLPGKCGVSIPYKISPGTD  111

Query  423  CEYI  434
            C  +
Sbjct  112  CSKV  115



>emb|CAH69188.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 53/95 (56%), Gaps = 3/95 (3%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
            G + C  V + ++ C S+    +  P  G  CC  + +L+  A ++ +RQ  CRC+ +L 
Sbjct  24   GAVTCGDVTSAIAPCMSYATGQASSPSAG--CCSGVRTLNGKASTSADRQAACRCLKNLA  81

Query  333  TTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             ++   +  ++A +PG CGVS+ F I+ N +C+ +
Sbjct  82   GSFKGISMGNVANIPGECGVSVSFPINNNVNCDTL  116



>ref|XP_003522081.1| PREDICTED: non-specific lipid-transfer protein 3-like [Glycine 
max]
Length=130

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG + C  V + ++ C S+V+YG    +P   CC  + +L  +A +  +RQ VC C+ + 
Sbjct  32   QGEVSCGQVVSNLTPCISYVLYGGAT-VPAQ-CCNGIRNLYGMAQTKPDRQAVCNCIKNA  89

Query  330  I-----TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +     T  + N    A LP  CGV++ + I P+TDC  +
Sbjct  90   VRNSGFTYSHFNLNLAANLPKNCGVNIPYQISPDTDCTRV  129



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 13/120 (11%)
 Frame = +3

Query  75   VAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCV  254
            ++ M++++LL+ +            +  I C TV + +  C S++      P    PCC 
Sbjct  4    ISFMLLILLLAPAS-----------ESAITCGTVISTIRPCLSYLQGTGGKP--PQPCCT  50

Query  255  AMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            A  SL++   +T +RQ  C C+ +     N NA     LP  CG+SL F I  + DC  I
Sbjct  51   ACQSLASATSTTPDRQAACTCLKNAAQKININAQLAQGLPQSCGISLSFPISTSVDCTKI  110



>ref|NP_001235162.1| uncharacterized protein LOC100499726 precursor [Glycine max]
 gb|ACU13384.1| unknown [Glycine max]
Length=122

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG + C  V + ++ C S+V+YG  + +P   CC  + +L  +A +  +RQ VC C+ + 
Sbjct  24   QGEMTCGQVVSNLTPCISYVVYGGTN-VP-EQCCNGIRNLYGMAQTKPDRQAVCNCIKNG  81

Query  330  ITTYNPNATSI-----ATLPGFCGVSLGFIIDPNTDCEYI  434
            +     N +       A LP  CGV++ + I PNTDC  +
Sbjct  82   VRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDCTRV  121



>gb|ABK25598.1| unknown [Picea sitchensis]
Length=126

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
              +  I C TV + ++ C  ++  G   P P   CC  +  L+ LA +T  R+ VC C+ 
Sbjct  30   HAESAISCGTVISDMTPCVGYLTSGKGKPAPN--CCGGVKKLAGLATTTPTRRAVCGCLK  87

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               +   N N+ +++ LPG CGV+L F I   T+C  I
Sbjct  88   QAYSQVPNVNSAAVSGLPGACGVNLPFKISLQTNCNTI  125



>gb|AAQ54611.1| Gly d Mal d 3-like protein [Glycyphagus domesticus]
 gb|EMT27039.1| putative Non-specific lipid-transfer protein [Aegilops tauschii]
Length=116

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 46/93 (49%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            IDC  V +LV  C S+V  G   P P   CC  + SL N A S  +RQ  C C+  +   
Sbjct  27   IDCGHVDSLVRPCLSYVQGG---PSPSGQCCGGVQSLHNQAQSKSDRQAACNCLKGIARG  83

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  +  +L   CGV+L + I  + DC  +
Sbjct  84   IHNLNEDNARSLAPKCGVNLPYHISLDIDCNSV  116



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG I C  + + ++ C +++        P + CC  + SL++ A +T +RQ  C C+   
Sbjct  25   QGAISCGQITSALAPCIAYLKGNGAGSAPPA-CCNGIRSLNSAAKTTPDRQAACSCIKSA  83

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             T  +  N ++ A LPG CG+++ + I P+TDC+ I
Sbjct  84   ATGISGINYSTAAGLPGKCGINIPYKISPSTDCKSI  119



>ref|XP_010527037.1| PREDICTED: non-specific lipid-transfer protein 1-like [Tarenaya 
hassleriana]
Length=115

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 10/102 (10%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            SE+   I C  V++ +  C+ +++ G     P S CC  + SL  +A    +RQ  CRC+
Sbjct  19   SERGNAITCQAVESTLMPCAGYIVKGG---TPSSKCCAGLKSLKAMARKKADRQAACRCL  75

Query  321  MDLITTY----NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             D+ + Y    + NA+    LP  CGV  G      T+C  +
Sbjct  76   KDVASRYPGVKDDNASR---LPKKCGVDFGVPFTRKTNCNSV  114



>gb|ACU24604.1| unknown [Glycine max]
Length=130

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 7/100 (7%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG + C  V + ++ C S+V+YG    +P   CC  + +L  +A +  +RQ VC C+ + 
Sbjct  32   QGEVSCGQVVSNLTPCISYVLYGGAT-VPAQ-CCNGIRNLYGMAQTKPDRQAVCNCIKNA  89

Query  330  I-----TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +     T  + N    A LP  CGV++ + I P+TDC  +
Sbjct  90   VRNSGFTYSHFNFNLAANLPKNCGVNIPYQISPDTDCTRV  129



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V   ++ C +F+  G P   P + CC A+ SL+++  ST +R+  C C+   
Sbjct  25   EAAITCGMVTQKLAPCLTFLQRGGP---PAAGCCGAIKSLNSMVRSTPDRKAACGCLKSA  81

Query  330  ITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              ++   N  + A LPG CGV++G+ I  + DC  +
Sbjct  82   AKSFPGINMGNAAALPGKCGVNIGYPISTSVDCSRV  117



>ref|XP_010527034.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
 ref|XP_010527036.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
Length=115

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 6/100 (6%)
 Frame = +3

Query  141  SEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV  320
            +E+   I C+     ++ C S++M G     P + CC  M +L       D+RQ VCRC+
Sbjct  19   AEEGKAITCSQANLSMAPCLSYLMNGG---NPSALCCKGMKNLKKATPEKDDRQTVCRCL  75

Query  321  MDLITTYNPNAT--SIATLPGFCGVSLGFIIDPNTDCEYI  434
             D   T NP     + + LPG CGV  G      T+C+ +
Sbjct  76   KD-TATKNPKIKDDNASQLPGKCGVDFGVPFSTGTNCDSV  114



>ref|XP_004308147.1| PREDICTED: non-specific lipid-transfer protein 3-like [Fragaria 
vesca subsp. vesca]
Length=122

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 11/129 (9%)
 Frame = +3

Query  57   LKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIP  236
            + + G   V+ +V+L   +    G   ++     + C  V   ++ C+S++  G     P
Sbjct  1    MAFSGVQKVVFLVMLSMAAALSFGGAEAA-----LTCGQVVNKLTPCASYIQNGG---TP  52

Query  237  GSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTY---NPNATSIATLPGFCGVSLGFII  407
             + CC  + +L  +A +T +RQ VC C+   I         A   A LPG CGV++ + I
Sbjct  53   AANCCGGIRALYGMAQTTPDRQSVCNCLKQAIAGIPYTGAKAGLAAGLPGKCGVNIPYKI  112

Query  408  DPNTDCEYI  434
            +P+TDC+ I
Sbjct  113  NPSTDCKSI  121



>gb|ABP01769.1| lipid transfer protein 2 [Salvia miltiorrhiza]
Length=114

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 5/96 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V + ++ C  +V   +  P+ G  CC  +  L   A +T +RQ VC C+  L
Sbjct  22   EAAIGCGAVVSYLNPCLPYVT--NKGPLGG--CCGGIKGLYGAAKTTPDRQSVCNCLKTL  77

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             ++Y   N    A LPG CGVS+ + I P+TDC  +
Sbjct  78   ASSYKGVNLGKAAGLPGQCGVSIPYKISPSTDCSKV  113



>ref|XP_006468370.1| PREDICTED: non-specific lipid-transfer protein D, cotyledon-specific 
isoform-like [Citrus sinensis]
Length=116

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV A  +AC  F    +P P   S CC  +  L+    + D+++ +CRC+   
Sbjct  23   EAAIACGTVDAKAAACVGFATGKAPTPT--SACCSGLQQLAQSVKTVDDKKAICRCLKAG  80

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +       ++ +P  CG+ +GF +   T+CE I
Sbjct  81   AKSLGVQDRFLSKIPSACGIKVGFPVSTATNCETI  115



>ref|XP_009396874.1| PREDICTED: non-specific lipid-transfer protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=117

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +S+C S+     P     + CC  + SL++ A +T +R+  C C+   ++ 
Sbjct  27   ITCGQVTSALSSCISYATGKGPLS---TACCSGVKSLNSAAKTTADRKTACTCIKSTVSR  83

Query  339  YN-PNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +   A +IA +PG CGVS+G+ I  +TDC  +
Sbjct  84   LSGAQAGAIAGIPGKCGVSIGYPISASTDCSKV  116



>gb|AAA03283.1| CW18=non-specific lipid transfer protein [barley, cv. Bomi, leaves, 
Peptide, 90 aa]
Length=90

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 45/92 (49%), Gaps = 4/92 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +  C+++       P  G  CC  +  L+ LA ST ++Q  CRC+  +   
Sbjct  2    ITCGQVSSALGPCAAYAKGSGTSPSAG--CCSGVKRLAGLARSTADKQATCRCLKSVAGA  59

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            Y  NA   A +P  CGVS+ + I  + DC  I
Sbjct  60   Y--NAGRAAGIPSRCGVSVPYTISASVDCSKI  89



>ref|XP_010043171.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88335.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
 gb|KCW88336.1| hypothetical protein EUGRSUZ_A00724 [Eucalyptus grandis]
Length=116

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 4/96 (4%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C  V + V+ C  ++  G   P   S CC  + SL++ A +T +RQ  CRC+   
Sbjct  23   ESAVTCGQVASCVAPCLGYLRAGGTLP---SACCSGIRSLNSAARTTPDRQTACRCLQSA  79

Query  330  ITTYNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                   N   ++ LPG CGVS+ + I P+TDC  +
Sbjct  80   AGNIRGLNLGLVSALPGKCGVSVPYKISPSTDCSRV  115



>gb|ABI26087.1| lipid transfer protein precursor [Ginkgo biloba]
Length=119

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 48/90 (53%), Gaps = 2/90 (2%)
 Frame = +3

Query  165  CATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYN  344
            C TV   ++ C S++  G+ +P     CC  + +L+  A +T++R+ +C C+        
Sbjct  31   CDTVDTDLAPCISYLQTGTGNPT--VQCCSGVKTLAGTAQTTEDRKAICECIKTAAIRVK  88

Query  345  PNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            P A ++ +LPG C V+L F I   TDC  I
Sbjct  89   PVANAVKSLPGLCSVTLPFPISIATDCNKI  118



>pdb|1BE2|A Chain A, Lipid Transfer Protein Complexed With Palmitate, Nmr, 
10 Structures
 pdb|1JTB|A Chain A, Lipid Transfer Protein Complexed With Palmitoyl Coenzyme 
A, Nmr, 16 Structures
 pdb|1LIP|A Chain A, Barley Lipid Transfer Protein (Nmr, 4 Structures)
Length=91

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            ++C  V + +  C ++V  G   P P   CC  +  L N A S+ +RQ VC C+  +   
Sbjct  1    LNCGQVDSKMKPCLTYVQGG---PGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARG  57

Query  339  -YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  + A++P  C V++ + I P+ DC  I
Sbjct  58   IHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C  ++  G   P     CC  +  L+N A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCIGYLTKGGAVP---PACCNGVKGLNNAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + VS C S+   GS    P + CC  + SL++ A +T +R+  C C+ ++  +
Sbjct  28   ISCGQVNSAVSPCLSYARGGSG---PSAACCSGVRSLNSAASTTADRRTACNCLKNVAGS  84

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +  NA + A++P  CGVS+ + I P+ DC  +
Sbjct  85   ISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>gb|KHN43734.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=155

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG + C  V + ++ C S+V+YG    +P + CC  + +L  +A +  +RQ VC C+ + 
Sbjct  28   QGEVSCGQVVSNLTPCISYVLYGGAT-VP-AQCCNGIRNLYGMAQTKPDRQAVCNCIKNA  85

Query  330  I-----TTYNPNATSIATLPGFCGVSLGFIIDPNTDC  425
            +     T  + N    A LP  CGV++ + I P+TDC
Sbjct  86   VRNSGFTYSHFNLNLAANLPKNCGVNIPYQISPDTDC  122



>ref|XP_010054612.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Eucalyptus 
grandis]
 gb|KCW77033.1| hypothetical protein EUGRSUZ_D01379 [Eucalyptus grandis]
Length=136

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 57/137 (42%), Gaps = 11/137 (8%)
 Frame = +3

Query  24   MKIVKLEEIVSLKYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSS  203
            M   ++E + S  Y  S+  +++  +     + I           + C+     +  C  
Sbjct  1    MAKPQVELVFSFLYIASLTFLLVTCIARNEPQPID---------DVSCSDALKTMMPCQP  51

Query  204  FVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFC  383
            + + GS +P P  PCC+A+  +  LA+ST   Q +C C          +      LPG C
Sbjct  52   Y-LNGS-EPKPAGPCCLAVEKVKELANSTQGPQDLCECFKKAAPDLGVDPERAKALPGLC  109

Query  384  GVSLGFIIDPNTDCEYI  434
             V L   IDPN DC  I
Sbjct  110  HVQLPVPIDPNIDCSKI  126



>ref|NP_195807.1| pathogenesis-related lipid transfer protein  [Arabidopsis thaliana]
 sp|Q9LZV9.1|NLTPA_ARATH RecName: Full=Non-specific lipid-transfer protein 10; Short=LTP 
10; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB82757.1| lipid-transfer protein-like [Arabidopsis thaliana]
 gb|AAO44017.1| At5g01870 [Arabidopsis thaliana]
 dbj|BAE99954.1| lipid-transfer protein-like [Arabidopsis thaliana]
 gb|AED90403.1| pathogenesis-related lipid transfer protein [Arabidopsis thaliana]
Length=116

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C  V+A +  C  +V+ G   P     CC  +  LS  A S  ++Q VCRC+  +
Sbjct  21   EAAISCNAVQANLYPCVVYVVQGGAIPYS---CCNGIRMLSKQATSASDKQGVCRCIKSV  77

Query  330  ITTYNPNATSI---ATLPGFCGVSLGFIIDPNTDCEYI  434
            +   + ++  +   A LPG CGV L + IDP+T+C  I
Sbjct  78   VGRVSYSSIYLKKAAALPGKCGVKLPYKIDPSTNCNSI  115



>ref|XP_006347954.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
tuberosum]
Length=115

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 6/97 (6%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +G I C  V A ++ C SF+  G     PG+ CC  + +L+  A S+D+R+  C CV   
Sbjct  22   RGAITCGQVDANLAPCVSFLTQGGE---PGAACCSGVKTLNGNAQSSDDRKTACNCVKAA  78

Query  330  ITTYNPNATSIA--TLPGFCGVSLGFIIDPNTDCEYI  434
            +  Y PN    A  +LP  CG+S+   I    +C+ I
Sbjct  79   VNRY-PNLKDDAAQSLPSKCGISVNVPISRTVNCDTI  114



>gb|AEV12221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C  +   G   P PG  CC  + +L+NLA +T +RQ  C C+  L+  
Sbjct  23   ITCGQVDSDLTSCLGYARKGGVIP-PG--CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGV++ + I   TDC  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNIPYPISMQTDCNKV  112



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C  ++  G   P     CC  +  L+N A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCIGYLTKGGAVP---PACCNGVKGLNNAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|KHN14506.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 52/97 (54%), Gaps = 7/97 (7%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            QG + C  V + ++ C S+V+YG  + +P   CC  + +L  +A +  +RQ VC C+ + 
Sbjct  13   QGEMTCGQVVSNLTPCISYVVYGGTN-VP-EQCCNGIRNLYGMAQTKPDRQAVCNCIKNG  70

Query  330  ITTYNPNATSI-----ATLPGFCGVSLGFIIDPNTDC  425
            +     N +       A LP  CGV++ + I PNTDC
Sbjct  71   VRNSGFNYSDFNLNLAANLPKKCGVNIPYQISPNTDC  107



>gb|AAT45202.1| lipid transfer protein 1 precursor [Nicotiana tabacum]
Length=124

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V A +S C S+V  G   P   +PCC  + SL+N A ST +RQ  C C+      
Sbjct  34   ISCGQVVASLSPCISYVRQGGAIP---APCCSGINSLNNQATSTPDRQTACNCIKSAAAG  90

Query  339  YNPNATSIA-TLPGFCGVSLGFIIDPNTDCEYI  434
             +    S+A +LP  CGV+L + I P+ DC  +
Sbjct  91   ISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  123



>ref|XP_009757306.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
Length=125

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 3/102 (3%)
 Frame = +3

Query  135  SSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCR  314
            SS   +  I C+TV + ++ C S+++ GS   +P   CC  + SL   A +T +RQ VC 
Sbjct  24   SSPHAEAAISCSTVYSNLAPCLSYLIGGSKQAVPAG-CCSGIQSLYTAASTTVDRQSVCS  82

Query  315  CVMDLITTYNP--NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C+     +     +A   ATL   CGV++ + I PN DC  +
Sbjct  83   CLKAGAASLGSSIDANKAATLLNKCGVTVPYKISPNIDCSKV  124



>ref|XP_003605293.1| Non-specific lipid-transfer protein [Medicago truncatula]
Length=121

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT-  338
             C  V   +  C S++M G  + +P + CC  + +L+ +A +T++R+ VC C+ + ++  
Sbjct  26   SCGPVVTSLYPCVSYIMNGG-NTVPAAQCCNGIRNLNTMAQTTNDRRAVCTCIKNAVSQS  84

Query  339  ----YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 N N    A LP  CGV++ + I PNTDC  +
Sbjct  85   GFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  120



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V + ++ C  ++  G   P     CC  +  L+N A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSSSLAPCIGYLTKGGAVP---PACCNGVKGLNNAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>pdb|1MID|A Chain A, Non-Specific Lipid Transfer Protein 1 From Barley In 
Complex With L-Alfa-Lysophosphatidylcholine, Laudoyl
 pdb|3GSH|A Chain A, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
 pdb|3GSH|B Chain B, Three-Dimensional Structure Of A Post Translational 
Modified Barley Ltp1
Length=91

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            ++C  V + +  C ++V  G   P P   CC  +  L N A S+ +RQ VC C+  +   
Sbjct  1    LNCGQVDSKMKPCLTYVQGG---PGPSGECCNGVRDLHNQAQSSGDRQTVCNCLKGIARG  57

Query  339  -YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  + A++P  C V++ + I P+ DC  I
Sbjct  58   IHNLNLNNAASIPSKCNVNVPYTISPDIDCSRI  90



>ref|XP_006369492.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
 gb|ERP66061.1| hypothetical protein POPTR_0001s23940g [Populus trichocarpa]
Length=118

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/94 (31%), Positives = 45/94 (48%), Gaps = 2/94 (2%)
 Frame = +3

Query  153  GGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLI  332
              I C+ V   +  C  ++M G+  P P + CC  + ++   A +T ++Q  C C+    
Sbjct  26   AAISCSDVIKDLRPCVKYLMNGTGKP-PAA-CCSGISAIQATASTTADKQAACNCIKSAS  83

Query  333  TTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               NPN      LP  CG++L F + PN DC  I
Sbjct  84   KQINPNPQLAQALPANCGITLPFAVSPNVDCSKI  117



>gb|ABA29446.1| non-specific lipid transfer protein [Vitis vinifera]
Length=119

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +S C +++  G   P PG  CC  + SL++ A +T +RQ  C+C+    ++
Sbjct  29   ITCGQVASSLSQCINYLQKGGAVP-PG--CCSGIKSLNSAAKTTGDRQTACKCLKTFSSS  85

Query  339  YNPNATSIAT-LPGFCGVSLGFIIDPNTDCEYI  434
             +     +A+ LPG CGVS+ + I P+TDC  +
Sbjct  86   ISGINFGLASGLPGKCGVSVPYKISPSTDCSKV  118



>gb|AFK37572.1| unknown [Medicago truncatula]
 gb|AES87490.2| Lipid transfer protein [Medicago truncatula]
Length=126

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +3

Query  162  DCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT-  338
             C  V   +  C S++M G  + +P + CC  + +L+ +A +T++R+ VC C+ + ++  
Sbjct  31   SCGPVVTSLYPCVSYIMNGG-NTVPAAQCCNGIRNLNTMAQTTNDRRAVCTCIKNAVSQS  89

Query  339  ----YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                 N N    A LP  CGV++ + I PNTDC  +
Sbjct  90   GFSYTNLNLNLAAGLPRKCGVNIPYQISPNTDCNSV  125



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 7/103 (7%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYG-SPDPIPGSPCCVAMLSLSNLADSTDNRQI  305
            + S+   +  I C TV + ++ C  F+  G SP P     CC  + +L ++A ST +RQ 
Sbjct  19   IVSAPHAEAAISCGTVVSKLAPCLGFLRGGGSPPPA----CCSGIRNLQSMARSTPDRQA  74

Query  306  VCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             C C+     +   N  + A LPG CGV++G+ I  + DC  +
Sbjct  75   ACGCLKS--ASAGVNMRNAAALPGKCGVNIGYPISRSVDCSRV  115



>gb|AAB33170.1| acyl-binding/lipid-transfer protein isoform III, AB/LTP III [rape, 
seedlings, Peptide, 92 aa]
 prf||2107184A acyl-binding/lipid transfer protein:ISOTYPE=III
Length=92

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C TV   ++AC  ++    P P     CC  + +L+N+A +T +RQ  CRC++    +
Sbjct  2    LSCGTVSGNLAACIGYLTQNGPLP---RGCCTGVTNLNNMARTTPDRQQACRCLVGAANS  58

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA   A LP  CGV++ + I  +T+C  +
Sbjct  59   FPTLNAARAAGLPKACGVNIPYKISKSTNCNSV  91



>emb|CBW38502.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 51/96 (53%), Gaps = 10/96 (10%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            + C  V   ++ C S++  G   P     CC  + SL++ A +T +RQ  C C   L + 
Sbjct  12   LSCGQVSFSLAPCISYLTKGGAVP---PACCSGVKSLNSAAKTTPDRQAACGC---LKSA  65

Query  339  YNP----NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            YN     NA + A+LPG CGVS+ + I P+TDC  +
Sbjct  66   YNSISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>sp|Q9SW93.1|SCA_LILLO RecName: Full=Stigma/stylar cysteine-rich adhesin; AltName: Full=Lipid 
transfer protein; Flags: Precursor [Lilium longiflorum]
 gb|AAD46683.1|AF171094_1 lipid transfer protein precursor [Lilium longiflorum]
Length=113

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C  +   G   P PG  CC  + +L+NLA +T +RQ  C C+  L+  
Sbjct  23   ITCGQVDSDLTSCLGYARKGGVIP-PG--CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGV++ + I   TDC  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKV  112



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + VS C S+   GS    P + CC  + SL++ A +T +R+  C C+ ++  +
Sbjct  27   ISCGQVNSAVSPCLSYARGGSG---PSAACCSGVRSLNSAATTTADRRTACNCLKNVAGS  83

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +  NA + A++P  CGVS+ + I P+ DC  +
Sbjct  84   ISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  116



>ref|XP_009800887.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
sylvestris]
 dbj|BAK19152.1| lipid transfer protein [Nicotiana tabacum]
Length=117

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 49/93 (53%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V A +S C S+V  G   P   +PCC  + SL+N A ST +RQ  C C+      
Sbjct  27   ISCGQVVASLSPCISYVRQGGAIP---APCCSGINSLNNQATSTPDRQTACNCIKSAAAG  83

Query  339  YNPNATSIA-TLPGFCGVSLGFIIDPNTDCEYI  434
             +    S+A +LP  CGV+L + I P+ DC  +
Sbjct  84   ISGINFSLAGSLPSKCGVNLPYKISPSIDCSTV  116



>gb|AAY83342.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 49/95 (52%), Gaps = 8/95 (8%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL---  329
            I C  V + +S C ++V  G   P   +PCC  + +L+ +A +T +RQ  C C+      
Sbjct  27   ITCGQVASNISPCVTYVKSGGAVP---APCCSGIRNLNGMAKTTADRQATCNCLKQAAGG  83

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            I   NPN    A LPG CGVS+ + I   T+C  +
Sbjct  84   IKGLNPNLA--AGLPGKCGVSVPYKISTTTNCAAV  116



>emb|CDX73941.1| BnaA03g31060D [Brassica napus]
 emb|CDX73942.1| BnaA03g31050D [Brassica napus]
Length=113

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 5/96 (5%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  + C  V   +  C S+VM G   P   + CC  + +L++ A +T +RQ VCRC+ + 
Sbjct  19   EAAVTCNNVVGDLYPCLSYVMQGGNSP--STNCCSGVRTLNSQAQTTADRQSVCRCIKNA  76

Query  330  I---TTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            I   +  + N  +  +LP  CGV+L F I P+T+C 
Sbjct  77   IGGASYSSSNLKNALSLPAKCGVNLPFSISPSTNCN  112



>gb|ABK21288.1| unknown [Picea sitchensis]
Length=126

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = +3

Query  144  EQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVM  323
              +  + C TV + ++ C  ++  G   P P   CC  +  L+ LA +T  R+ VC C+ 
Sbjct  30   HAESAVSCGTVISDMTPCVGYLTSGKGKPAPN--CCGGVKKLAGLATTTPTRRAVCGCLK  87

Query  324  DLITTY-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               +   N N+ +++ LPG CGV+L F I   T+C  I
Sbjct  88   QAYSQVPNVNSAAVSGLPGACGVNLPFKISLQTNCNTI  125



>gb|EYU42244.1| hypothetical protein MIMGU_mgv1a024175mg [Erythranthe guttata]
Length=119

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 46/97 (47%), Gaps = 0/97 (0%)
 Frame = +3

Query  138  SSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRC  317
            ++     I C+ V   +  C +++  GS    P SPCC    +L+  A +T ++Q  C C
Sbjct  22   AAPSSSSITCSDVIKDLRPCINYLRGGSGAAPPPSPCCAGASNLATSATTTADKQTACAC  81

Query  318  VMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            + +  T  N N      LP  CG+SL F I P  DC 
Sbjct  82   LKNAATNINLNPDLAKALPSKCGISLSFQISPTVDCS  118



>gb|KDO77575.1| hypothetical protein CISIN_1g045117mg, partial [Citrus sinensis]
Length=143

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 45/95 (47%), Gaps = 2/95 (2%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +  I C TV A  +AC  F       P P S CC  +  L+    + D+++ +CRC+   
Sbjct  50   EAAIACGTVDAKAAACVGFAT--GKAPTPTSACCSGLQQLAQSVKTVDDKKAICRCLKAG  107

Query  330  ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              +       ++ +P  CG+ +GF +   T+CE I
Sbjct  108  AKSLGVQDRFLSKIPSACGIKVGFPVSTATNCETI  142



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 60/125 (48%), Gaps = 11/125 (9%)
 Frame = +3

Query  60   KYCGSVAVMMMVILLSTSRRRIGVESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPG  239
            K+ G   +++M +L++ S         +     I C TV   + AC  ++  G   P   
Sbjct  3    KFAGVACLVLMCMLVAVSL--------APHAEAITCNTVAGDLGACLGYLQKGGAVP---  51

Query  240  SPCCVAMLSLSNLADSTDNRQIVCRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNT  419
            + CC  + SL++ A +T +R+  C C+  L      N    A LPG CGV++G+ I  +T
Sbjct  52   AGCCTGIRSLNSQAKTTVDRRTACSCLKSLAGRVRVNQGLAAGLPGKCGVNVGYPISTST  111

Query  420  DCEYI  434
            +C  +
Sbjct  112  NCNSV  116



>dbj|BAB09776.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=110

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 47/90 (52%), Gaps = 5/90 (6%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C TV + +S C  ++  G   P    PCC  +  L+ +A +T +RQ  CRC+      
Sbjct  25   ITCGTVASSLSPCLGYLSKGGVVP---PPCCAGVKKLNGMAQTTPDRQQACRCLQSAAKG  81

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCE  428
             NP+  S   LPG CGVS+ + I  +T+C 
Sbjct  82   VNPSLAS--GLPGKCGVSIPYPISTSTNCA  109



>gb|AHG99490.1| lipid-transfer protein [Citrus suavissima]
Length=115

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (52%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V   ++ C  F+  G P P+P   CC  + SL+  A +T +RQ  C C+     +
Sbjct  25   ITCGQVSGSLAPCIGFLRSGGPIPMP---CCNGVRSLNAAARTTPDRQTACNCLKQAARS  81

Query  339  Y-NPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
              + N  + A LPG CGVS+ + I  +TDC  +
Sbjct  82   IPSLNLNNAAGLPGACGVSIPYKISTSTDCSKV  114



>gb|ABF14723.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 4/92 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + +++C S+       P PG+ CC  +  L+ LA ST ++Q  CRC+      
Sbjct  27   IPCGQVNSALASCVSYAKGSGASP-PGA-CCSGVRRLAGLARSTADKQAACRCIKSAAGG  84

Query  339  YNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             NP     A++P  CGVS+ + I  + DC  I
Sbjct  85   LNPG--KAASIPSKCGVSIPYSISASVDCSKI  114



>gb|ABA96286.1| Nonspecific lipid-transfer protein 3 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY82041.1| hypothetical protein OsI_37228 [Oryza sativa Indica Group]
 gb|EAZ19437.1| hypothetical protein OsJ_34998 [Oryza sativa Japonica Group]
Length=118

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 50/93 (54%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + ++ C S+V  G      G  CC  +  L+N A +T +RQ  CRC+  L  +
Sbjct  28   ITCGQVGSAIAPCISYVT-GRSGLTQG--CCNGVKGLNNAARTTADRQAACRCLKSLAGS  84

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
                N  ++A +PG CGV++GF I  +TDC  +
Sbjct  85   IKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKV  117



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +3

Query  156  GIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT  335
             I C  V   ++ C +F+  G   P P  PCC  + SL+  A +T +RQ  C C+     
Sbjct  23   AITCGQVTGSLAPCIAFLRTGGRFPPP--PCCNGVRSLNGAARTTPDRQAACNCLKQAYR  80

Query  336  TY-NPNATSIATLPGFCGVSLGFIIDPNTDCE  428
            +    NA   A LP  CGVS+ + I PNTDC 
Sbjct  81   SIPGINANVAAGLPRQCGVSIPYKISPNTDCS  112



>tpg|DAA59277.1| TPA: hypothetical protein ZEAMMB73_838830 [Zea mays]
Length=157

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 54/94 (57%), Gaps = 4/94 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + ++ C  +   G    +P S CC  + SL++ A ++ +RQ  CRC+  L  +
Sbjct  32   ITCGQVGSSLAPCIPYAT-GRASALPAS-CCSGVKSLNSAARTSADRQAACRCLKSLANS  89

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDC-EYI  434
                N  ++AT+PG CGVS+GF I  +TDC +Y+
Sbjct  90   VKSVNMGTVATIPGKCGVSVGFPISMSTDCNKYV  123



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 45/93 (48%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            IDC  V +LV  C S+V  G   P P   CC  + +L N A S  +RQ  C C+  +   
Sbjct  27   IDCGHVDSLVRPCLSYVQGG---PGPSGQCCDGVKNLHNQARSQSDRQSACNCLRGIARG  83

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +N N  +    P  CGV+L + I  N DC  +
Sbjct  84   IHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>gb|AEV23220.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLIT-  335
            I C  V + +++C  +   G   P PG  CC  + +L+NLA +T +RQ  C C+  L+  
Sbjct  23   ITCGQVDSDLTSCLGYARKGGVIP-PG--CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  336  TYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            +   NA  +A +PG CGV++ + I   TDC  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNILYPISMQTDCNKV  112



>ref|XP_011095136.1| PREDICTED: non-specific lipid-transfer protein-like [Sesamum 
indicum]
Length=118

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 3/102 (3%)
 Frame = +3

Query  129  VESSSEQQGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIV  308
            V ++   +  I CA+V   +S C S++  G   P     CC    SL++ A +T + Q V
Sbjct  18   VVTAPHAEAAISCASVMTKLSPCLSYIKSGGGLP---PACCSGAKSLNDAASTTPDLQAV  74

Query  309  CRCVMDLITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
            C C+  L+ +   N   I ++P  CGV+L +   P+ DC  +
Sbjct  75   CGCIKILVPSLRANPAYINSIPAKCGVNLPYKYSPSLDCSKV  116



>gb|AFR43285.1| lipid transfer protein precursor [Gossypium herbaceum subsp. 
africanum]
 gb|AFR43286.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43287.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDL  329
            +G I C  V + ++ C  +V       +P +PCC  + SL+  A ST  RQ  C CV  L
Sbjct  25   EGAISCGQVISALAPCIPYVRNNGAGGVP-APCCNGIRSLNAAAQSTPERQSACSCVKAL  83

Query  330  ---ITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYI  434
               I+  N + T+   LPG CGV   F I P+T+C+ +
Sbjct  84   AASISGINYDLTN--KLPGMCGVHSPFKISPSTNCKSV  119



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 52/93 (56%), Gaps = 4/93 (4%)
 Frame = +3

Query  159  IDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCVMDLITT  338
            I C  V + VS C S+   GS    P + CC  + SL++ A +T +R+  C C+ ++  +
Sbjct  20   ISCGQVNSAVSPCLSYARGGSG---PSAACCSGVRSLNSAATTTADRRTACNCLKNVAGS  76

Query  339  YNP-NATSIATLPGFCGVSLGFIIDPNTDCEYI  434
             +  NA + A++P  CGVS+ + I P+ DC  +
Sbjct  77   ISGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  109



>ref|XP_006842463.1| hypothetical protein AMTR_s00077p00066810 [Amborella trichopoda]
 gb|ERN04138.1| hypothetical protein AMTR_s00077p00066810 [Amborella trichopoda]
Length=139

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 50/97 (52%), Gaps = 3/97 (3%)
 Frame = +3

Query  150  QGGIDCATVKALVSACSSFVMYGSPDPIPGSPCCVAMLSLSNLADSTDNRQIVCRCV-MD  326
            +G I C+TV A +S C ++ M    + +P  PCC AM +L  L+ +T ++Q VC C+   
Sbjct  21   EGAISCSTVTATLSPCLNY-MRNEGNTVP-PPCCNAMRTLKGLSPTTADKQAVCGCLKWA  78

Query  327  LITTYNPNATSIATLPGFCGVSLGFIIDPNTDCEYIG  437
             +     N   +  LP  CGV L +I    TDC   G
Sbjct  79   AMAIKRINDNLVRGLPNACGVKLTYIFSAKTDCSKYG  115



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1226452362339