BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81212_g1_i1 len=2157 path=[1:0-2156]

Length=2157
                                                                      Score     E

ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       879   0.0      
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    871   0.0      
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    852   0.0      
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    850   0.0      
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       843   0.0      
emb|CDP05875.1|  unnamed protein product                                837   0.0      
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         831   0.0      Ricinus communis
gb|KDP27016.1|  hypothetical protein JCGZ_20951                         828   0.0      
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       823   0.0      Vitis vinifera
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    813   0.0      
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       812   0.0      
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             808   0.0      
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    804   0.0      
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    802   0.0      
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       794   0.0      
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       795   0.0      
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             793   0.0      
ref|XP_002316916.1|  ABC transporter family protein                     785   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    784   0.0      
gb|KHG01243.1|  ABC transporter G family member 9                       783   0.0      
emb|CAN62144.1|  hypothetical protein VITISV_007841                     780   0.0      Vitis vinifera
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9...    780   0.0      
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    777   0.0      
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    777   0.0      
gb|EYU26406.1|  hypothetical protein MIMGU_mgv1a004006mg                770   0.0      
emb|CBI20349.3|  unnamed protein product                                770   0.0      
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    761   0.0      
ref|XP_007021331.1|  White-brown-complex ABC transporter family         760   0.0      
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      759   0.0      
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       759   0.0      
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    757   0.0      
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    757   0.0      
emb|CDX92829.1|  BnaC07g40870D                                          756   0.0      
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    755   0.0      
emb|CDY29837.1|  BnaA03g48580D                                          754   0.0      
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    753   0.0      
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             750   0.0      
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    765   0.0      
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    749   0.0      
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       749   0.0      
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    741   0.0      
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       739   0.0      
emb|CDY29304.1|  BnaC01g19560D                                          739   0.0      
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             739   0.0      
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     735   0.0      
ref|XP_004134251.1|  PREDICTED: ABC transporter G family member 9...    734   0.0      
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    733   0.0      
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             731   0.0      
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       728   0.0      
ref|NP_194472.3|  ABC transporter G family member 9                     728   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    726   0.0      
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       726   0.0      
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             721   0.0      
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg             713   0.0      
ref|XP_002867504.1|  abc transporter family protein                     713   0.0      
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    712   0.0      
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             710   0.0      
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...    710   0.0      
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...    723   0.0      
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    710   0.0      
ref|XP_008452359.1|  PREDICTED: ABC transporter G family member 9...    706   0.0      
emb|CDP08055.1|  unnamed protein product                                705   0.0      
gb|KHN36795.1|  ABC transporter G family member 9                       697   0.0      
gb|EPS69022.1|  hypothetical protein M569_05746                         694   0.0      
ref|XP_006855537.1|  hypothetical protein AMTR_s00057p00214480          697   0.0      
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    696   0.0      
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    692   0.0      
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    692   0.0      
gb|KHN08925.1|  ABC transporter G family member 9                       690   0.0      
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      689   0.0      
emb|CAB43874.1|  putative protei                                        687   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9       686   0.0      
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    679   0.0      
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    672   0.0      
gb|KDP27020.1|  hypothetical protein JCGZ_20955                         670   0.0      
ref|XP_006447786.1|  hypothetical protein CICLE_v10017645mg             662   0.0      
gb|KGN56224.1|  hypothetical protein Csa_3G102320                       660   0.0      
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      660   0.0      
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             657   0.0      
ref|XP_006385164.1|  ABC transporter family protein                     657   0.0      
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    656   0.0      
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         655   0.0      Ricinus communis
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    654   0.0      
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    652   0.0      
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             652   0.0      
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      652   0.0      Vitis vinifera
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    652   0.0      
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      650   0.0      
ref|XP_007040852.1|  ATP-binding cassette 14                            652   0.0      
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    650   0.0      
gb|KHN28317.1|  ABC transporter G family member 14                      650   0.0      
gb|KHG16348.1|  ABC transporter G family member 14                      650   0.0      
gb|KHG20314.1|  ABC transporter G family member 14                      649   0.0      
emb|CDY47690.1|  BnaCnng15320D                                          647   0.0      
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      647   0.0      
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      647   0.0      
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    646   0.0      
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    645   0.0      
gb|AES95438.2|  white-brown-complex ABC transporter family protein      645   0.0      
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 1...    645   0.0      
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         645   0.0      
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             645   0.0      
gb|KDP29341.1|  hypothetical protein JCGZ_18262                         645   0.0      
emb|CAN70956.1|  hypothetical protein VITISV_028138                     644   0.0      Vitis vinifera
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             643   0.0      
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      642   0.0      
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    642   0.0      
emb|CDY46506.1|  BnaA02g27560D                                          642   0.0      
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    641   0.0      
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 1...    641   0.0      
ref|XP_004164431.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    641   0.0      
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      642   0.0      
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...    641   0.0      
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   640   0.0      
ref|XP_002893685.1|  abc transporter family protein                     640   0.0      
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             640   0.0      
gb|AIU41651.1|  ABC transporter family protein                          641   0.0      
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             640   0.0      
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    644   0.0      
ref|NP_564383.1|  ABC transporter G family member 14                    639   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      639   0.0      
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      639   0.0      
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    637   0.0      
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      638   0.0      
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg             638   0.0      
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      637   0.0      
emb|CDY12299.1|  BnaA09g24990D                                          639   0.0      
ref|XP_003612480.1|  ABC transporter-like protein                       636   0.0      
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...    637   0.0      
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg             637   0.0      
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...    634   0.0      
emb|CDX99764.1|  BnaC02g35560D                                          636   0.0      
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...    635   0.0      
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727             634   0.0      
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...    634   0.0      
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                    633   0.0      
ref|XP_006878615.1|  hypothetical protein AMTR_s00011p00258490          632   0.0      
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21      632   0.0      
ref|XP_007046353.1|  ABC-2 type transporter family protein              632   0.0      
emb|CAN62390.1|  hypothetical protein VITISV_039480                     632   0.0      Vitis vinifera
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                630   0.0      
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    630   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      631   0.0      
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...    631   0.0      
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    630   0.0      
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...    629   0.0      
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    630   0.0      
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      628   0.0      
ref|XP_006441201.1|  hypothetical protein CICLE_v10023692mg             627   0.0      
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...    628   0.0      
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             628   0.0      
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    628   0.0      
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg             628   0.0      
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    627   0.0      
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             627   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    630   0.0      
emb|CDY51602.1|  BnaCnng21050D                                          627   0.0      
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                   627   0.0      
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      627   0.0      
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...    627   0.0      
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    626   0.0      
emb|CDY48079.1|  BnaA06g33490D                                          626   0.0      
emb|CDP00551.1|  unnamed protein product                                625   0.0      
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      625   0.0      
ref|NP_001189973.1|  ABC transporter G family member 21                 625   0.0      
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...    625   0.0      
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...    624   0.0      
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    625   0.0      
gb|KGN61520.1|  hypothetical protein Csa_2G153580                       624   0.0      
ref|XP_004170842.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    624   0.0      
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    623   0.0      
gb|KHN46331.1|  ABC transporter G family member 9                       619   0.0      
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    620   0.0      
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...    621   0.0      
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    619   0.0      
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21      620   0.0      
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             621   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 2...    621   0.0      
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                620   0.0      
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...    620   0.0      
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...    620   0.0      
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    618   0.0      
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...    619   0.0      
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             619   0.0      
ref|XP_003591854.1|  ABC transporter G family member                    618   0.0      
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...    617   0.0      
emb|CDP07185.1|  unnamed protein product                                616   0.0      
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...    617   0.0      
gb|KHN07718.1|  ABC transporter G family member 21                      613   0.0      
ref|XP_002524381.1|  ATP-binding cassette transporter, putative         617   0.0      Ricinus communis
ref|XP_010111780.1|  ABC transporter G family member 14                 615   0.0      
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...    615   0.0      
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      613   0.0      
gb|KHN16959.1|  ABC transporter G family member 14                      610   0.0      
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21      612   0.0      
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    611   0.0      
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             611   0.0      
gb|KDO40886.1|  hypothetical protein CISIN_1g046786mg                   606   0.0      
ref|XP_004139018.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    607   0.0      
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...    607   0.0      
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...    605   0.0      
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...    604   0.0      
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      604   0.0      
gb|KHN07535.1|  ABC transporter G family member 21                      596   0.0      
gb|EPS63929.1|  hypothetical protein M569_10851                         598   0.0      
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    598   0.0      
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    597   0.0      
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...    597   0.0      
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...    595   0.0      
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    595   0.0      
gb|KHN00888.1|  ABC transporter G family member 21                      595   0.0      
ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    594   0.0      
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    592   0.0      
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...    589   0.0      
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...    590   0.0      
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21      588   0.0      
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...    583   0.0      
gb|KHN37813.1|  ABC transporter G family member 21                      582   0.0      
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    581   0.0      
emb|CBI18157.3|  unnamed protein product                                579   0.0      
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    575   0.0      
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      578   0.0      Vitis vinifera
ref|XP_006841289.1|  hypothetical protein AMTR_s00134p00069640          577   0.0      
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      577   0.0      
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    572   0.0      
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...    573   0.0      
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...    573   0.0      
ref|XP_010910172.1|  PREDICTED: ABC transporter G family member 1...    573   0.0      
gb|ABR17189.1|  unknown                                                 578   0.0      Picea sitchensis
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    572   0.0      
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      571   0.0      
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...    570   0.0      
ref|XP_001780064.1|  ATP-binding cassette transporter, subfamily ...    566   0.0      
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    564   0.0      
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...    563   0.0      
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14      563   0.0      
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...    562   0.0      
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...    562   0.0      
gb|KEH43567.1|  white-brown-complex ABC transporter family protein      562   0.0      
gb|KHG11002.1|  ABC transporter G family member 25                      561   0.0      
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      561   0.0      
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    561   0.0      
ref|XP_007019995.1|  ATP-binding casette family G25                     560   0.0      
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    564   0.0      
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    563   0.0      
gb|KDP43365.1|  hypothetical protein JCGZ_25470                         558   0.0      
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25      556   0.0      
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    555   0.0      
ref|XP_002325552.2|  ABC transporter family protein                     556   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP16843.1|  unnamed protein product                                556   0.0      
ref|XP_004496375.1|  PREDICTED: ABC transporter G family member 2...    556   0.0      
gb|KHG09588.1|  ABC transporter G family member 25                      555   0.0      
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25      557   0.0      
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    559   0.0      
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    558   0.0      
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...    553   0.0      
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    558   0.0      
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...    553   0.0      
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      551   0.0      
gb|KGN44483.1|  hypothetical protein Csa_7G307400                       551   0.0      
ref|XP_002322764.1|  ABC transporter family protein                     555   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...    555   0.0      
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      551   0.0      
emb|CBI39105.3|  unnamed protein product                                554   0.0      
ref|XP_004139680.1|  PREDICTED: ABC transporter G family member 2...    549   0.0      
dbj|BAJ97566.1|  predicted protein                                      551   0.0      
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...    550   0.0      
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      550   0.0      
dbj|BAJ95904.1|  predicted protein                                      551   0.0      
ref|XP_010653240.1|  PREDICTED: ABC transporter G family member 2...    548   0.0      
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g             549   0.0      
ref|XP_010105155.1|  ABC transporter G family member 25                 549   0.0      
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    551   0.0      
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    546   0.0      
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    548   0.0      
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                550   0.0      
ref|XP_010248083.1|  PREDICTED: ABC transporter G family member 2...    550   0.0      
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    550   0.0      
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      550   0.0      
emb|CDY14079.1|  BnaC02g01960D                                          550   0.0      
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...    549   0.0      
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...    548   0.0      
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    545   0.0      
gb|KHG09828.1|  ABC transporter G family member 22                      543   0.0      
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    543   0.0      
ref|XP_003573439.1|  PREDICTED: ABC transporter G family member 14      546   0.0      
ref|XP_009375288.1|  PREDICTED: ABC transporter G family member 2...    541   0.0      
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    546   0.0      
emb|CDY23205.1|  BnaA04g05540D                                          546   0.0      
ref|XP_004972751.1|  PREDICTED: ABC transporter G family member 1...    546   0.0      
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...    542   1e-180   
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...    546   1e-180   
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25      543   2e-180   
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      545   2e-180   
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             545   3e-180   
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             545   5e-180   
ref|XP_001763976.1|  ATP-binding cassette transporter, subfamily ...    540   5e-180   
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    539   7e-180   
ref|XP_010521140.1|  PREDICTED: ABC transporter G family member 2...    541   7e-180   
ref|XP_010553410.1|  PREDICTED: ABC transporter G family member 2...    543   8e-180   
gb|KDP36071.1|  hypothetical protein JCGZ_08715                         544   9e-180   
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    544   1e-179   
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         543   1e-179   
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    543   1e-179   
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      543   1e-179   
emb|CDX98933.1|  BnaC09g49020D                                          543   1e-179   
ref|XP_010553412.1|  PREDICTED: ABC transporter G family member 2...    537   2e-179   
gb|EYU22839.1|  hypothetical protein MIMGU_mgv1a002620mg                539   2e-179   
ref|NP_568169.1|  ABC transporter G family member 22                    542   4e-179   
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    542   4e-179   
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25      538   5e-179   
emb|CDX70095.1|  BnaA10g24440D                                          541   5e-179   
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    542   5e-179   
emb|CDY04991.1|  BnaAnng01730D                                          541   6e-179   
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    541   9e-179   
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    541   1e-178   
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    541   1e-178   
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    541   1e-178   
ref|XP_002876135.1|  abc transporter family protein                     541   1e-178   
ref|XP_002873263.1|  abc transporter family protein                     541   1e-178   
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    540   2e-178   
ref|XP_006854611.1|  hypothetical protein AMTR_s00030p00144980          540   2e-178   
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    536   3e-178   
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    540   3e-178   
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    540   3e-178   
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    540   4e-178   
ref|XP_011074938.1|  PREDICTED: ABC transporter G family member 2...    536   4e-178   
emb|CDX95330.1|  BnaC04g28280D                                          539   4e-178   
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    539   4e-178   
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    539   4e-178   
ref|XP_002534493.1|  ATP-binding cassette transporter, putative         533   6e-178   
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                    536   7e-178   
gb|EAZ41641.1|  hypothetical protein OsJ_26175                          538   1e-177   
dbj|BAC99536.1|  putative ABC transporter AbcG1                         538   1e-177   
gb|EEC82957.1|  hypothetical protein OsI_27950                          538   1e-177   
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             537   2e-177   
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    537   3e-177   
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             538   3e-177   
ref|XP_010096709.1|  ABC transporter G family member 14                 533   3e-177   
ref|XP_007028064.1|  White-brown-complex ABC transporter family i...    539   7e-177   
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...    531   7e-177   
ref|XP_004161297.1|  PREDICTED: ABC transporter G family member 2...    531   7e-177   
ref|XP_006594328.1|  PREDICTED: ABC transporter G family member 9...    530   9e-177   
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    535   1e-176   
ref|XP_010503974.1|  PREDICTED: ABC transporter G family member 2...    530   1e-176   
gb|KEH41808.1|  white-brown-complex ABC transporter family protein      530   2e-176   
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      535   2e-176   
ref|XP_004985645.1|  PREDICTED: ABC transporter G family member 2...    535   2e-176   
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  530   2e-176   
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    536   3e-176   
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    535   3e-176   
ref|XP_007019433.1|  White-brown-complex ABC transporter family         536   4e-176   
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 2...    534   6e-176   
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...    531   1e-175   
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    533   1e-175   
gb|KEH41804.1|  white-brown-complex ABC transporter family protein      527   1e-175   
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      532   2e-175   
ref|NP_001049014.1|  Os03g0157400                                       533   2e-175   
gb|EEC74548.1|  hypothetical protein OsI_10084                          533   3e-175   
ref|XP_011096967.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    529   3e-175   
gb|ABB97034.1|  ABC transporter-like protein                            521   4e-175   
ref|XP_004985644.1|  PREDICTED: ABC transporter G family member 2...    531   6e-175   
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    531   8e-175   
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    531   1e-174   
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          531   1e-174   
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    530   1e-174   
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...    530   1e-174   
gb|EMS65761.1|  ABC transporter G family member 22                      528   1e-174   
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...    530   2e-174   
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    530   2e-174   
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    525   2e-174   
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    530   3e-174   
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             529   3e-174   
ref|XP_003562060.1|  PREDICTED: ABC transporter G family member 2...    529   6e-174   
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    528   6e-174   
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             528   7e-174   
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    528   7e-174   
ref|NP_190799.2|  ABC transporter G family member 27                    530   8e-174   
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    528   8e-174   
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...    523   9e-174   
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326             525   1e-173   
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    527   2e-173   
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             527   2e-173   
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  521   3e-173   
dbj|BAK06297.1|  predicted protein                                      528   3e-173   
ref|XP_008662280.1|  PREDICTED: hypothetical protein isoform X1         526   3e-173   
ref|NP_001147989.1|  ATPase, coupled to transmembrane movement of...    523   4e-173   
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             519   2e-172   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    521   2e-172   
ref|XP_004494278.1|  PREDICTED: ABC transporter G family member 2...    524   4e-172   
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    525   4e-172   
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                    519   6e-172   
ref|XP_004303381.1|  PREDICTED: ABC transporter G family member 2...    523   6e-172   
dbj|BAJ88390.1|  predicted protein                                      524   7e-172   
gb|KCW69055.1|  hypothetical protein EUGRSUZ_F02609                     515   9e-172   
emb|CDP10560.1|  unnamed protein product                                521   2e-171   
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...    518   4e-171   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      518   5e-171   
ref|XP_004494280.1|  PREDICTED: ABC transporter G family member 2...    515   8e-171   
ref|XP_010428049.1|  PREDICTED: ABC transporter G family member 25      517   1e-170   
gb|KEH24294.1|  white-brown-complex ABC transporter family protein      520   1e-170   
ref|XP_004978848.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    516   2e-170   
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    520   2e-170   
ref|XP_009104883.1|  PREDICTED: ABC transporter G family member 2...    516   2e-170   
ref|XP_010110448.1|  ABC transporter G family member 22                 520   2e-170   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    516   3e-170   
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...    516   3e-170   
emb|CDX68292.1|  BnaA07g23320D                                          516   3e-170   
dbj|BAJ94414.1|  predicted protein                                      515   4e-170   
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    516   5e-170   
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    518   1e-169   
gb|KEH24295.1|  white-brown-complex ABC transporter family protein      512   1e-169   
ref|XP_010677592.1|  PREDICTED: ABC transporter G family member 22      517   1e-169   
ref|XP_002309268.1|  ABC transporter family protein                     517   2e-169   
gb|AAK92745.1|  putative ABC transporter protein                        514   2e-169   
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    517   2e-169   
emb|CBI35490.3|  unnamed protein product                                518   2e-169   
ref|NP_565030.1|  ABC transporter G family member 25                    513   7e-169   
gb|KHN43592.1|  ABC transporter G family member 22                      513   1e-168   
ref|XP_006604670.1|  PREDICTED: ABC transporter G family member 2...    514   2e-168   
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    514   3e-168   
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...    513   3e-168   
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             514   3e-168   
ref|XP_002443920.1|  hypothetical protein SORBIDRAFT_07g004390          514   3e-168   
gb|KDP43029.1|  hypothetical protein JCGZ_25215                         512   4e-168   
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    513   4e-168   
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    513   8e-168   
ref|XP_010503973.1|  PREDICTED: ABC transporter G family member 2...    511   1e-167   
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...    508   2e-167   
ref|XP_002450415.1|  hypothetical protein SORBIDRAFT_05g004940          508   2e-167   
emb|CDX82199.1|  BnaC02g20910D                                          509   2e-167   
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    511   2e-167   
gb|AAX96020.1|  ABC transporter protein, putative                       506   5e-167   
ref|XP_008241115.1|  PREDICTED: ABC transporter G family member 2...    505   7e-167   
ref|XP_006604672.1|  PREDICTED: ABC transporter G family member 2...    505   1e-166   
gb|AFW57205.1|  hypothetical protein ZEAMMB73_095241                    504   1e-166   
ref|XP_006604673.1|  PREDICTED: ABC transporter G family member 2...    504   2e-166   
gb|EEC67784.1|  hypothetical protein OsI_35326                          505   4e-166   
ref|XP_011101660.1|  PREDICTED: ABC transporter G family member 2...    508   1e-165   
dbj|BAH57205.1|  AT1G71960                                              501   3e-165   
gb|AAG52231.1|AC021665_14  putative ABC transporter; 60211-54925        501   3e-165   
dbj|BAB11402.1|  ABC transporter-like protein                           499   4e-165   
ref|XP_009599779.1|  PREDICTED: ABC transporter G family member 2...    506   4e-165   
emb|CDX72849.1|  BnaC06g32970D                                          503   6e-165   
ref|XP_010320061.1|  PREDICTED: ABC transporter G family member 2...    504   9e-165   
gb|EYU37490.1|  hypothetical protein MIMGU_mgv1a026680mg                497   1e-164   
ref|XP_009405790.1|  PREDICTED: ABC transporter G family member 2...    504   1e-164   
ref|XP_007163008.1|  hypothetical protein PHAVU_001G198400g             497   3e-164   
ref|XP_010535206.1|  PREDICTED: ABC transporter G family member 2...    499   7e-164   
ref|XP_003577777.2|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    499   1e-163   
ref|NP_001031843.1|  ABC transporter G family member 22                 500   1e-163   
ref|XP_004237766.1|  PREDICTED: ABC transporter G family member 2...    501   2e-163   
ref|XP_011042541.1|  PREDICTED: ABC transporter G family member 2...    499   2e-163   
emb|CDY03668.1|  BnaA02g15690D                                          499   3e-163   
ref|XP_006362828.1|  PREDICTED: ABC transporter G family member 2...    501   3e-163   
ref|XP_010491223.1|  PREDICTED: ABC transporter G family member 2...    498   5e-163   
gb|EPS59306.1|  hypothetical protein M569_15501                         494   9e-163   
ref|XP_004244029.1|  PREDICTED: ABC transporter G family member 26      496   3e-162   
ref|XP_011047135.1|  PREDICTED: ABC transporter G family member 2...    496   4e-162   
ref|XP_007200734.1|  hypothetical protein PRUPE_ppa021401mg             494   4e-162   
ref|XP_004292538.1|  PREDICTED: ABC transporter G family member 2...    496   1e-161   
ref|XP_006346115.1|  PREDICTED: ABC transporter G family member 2...    493   4e-161   
gb|EMT07325.1|  ABC transporter G family member 22                      489   2e-160   
ref|XP_008237629.1|  PREDICTED: ABC transporter G family member 2...    494   4e-160   
gb|KDO70707.1|  hypothetical protein CISIN_1g0045372mg                  485   2e-159   
ref|XP_006588894.1|  PREDICTED: ABC transporter G family member 2...    488   8e-159   
gb|EYU17426.1|  hypothetical protein MIMGU_mgv1a002142mg                488   2e-158   
tpg|DAA43438.1|  TPA: hypothetical protein ZEAMMB73_582925              492   3e-158   
ref|XP_009628134.1|  PREDICTED: ABC transporter G family member 26      484   1e-157   
ref|XP_006452648.1|  hypothetical protein CICLE_v10010223mg             484   1e-157   
ref|XP_008356252.1|  PREDICTED: ABC transporter G family member 2...    481   2e-157   
ref|XP_006474829.1|  PREDICTED: ABC transporter G family member 2...    484   2e-157   
gb|KDP39319.1|  hypothetical protein JCGZ_01076                         484   2e-157   
ref|XP_009781518.1|  PREDICTED: ABC transporter G family member 26      484   3e-157   
ref|XP_009388615.1|  PREDICTED: ABC transporter G family member 2...    485   1e-156   
ref|XP_011095584.1|  PREDICTED: ABC transporter G family member 26      482   1e-156   
ref|XP_004494279.1|  PREDICTED: ABC transporter G family member 2...    481   2e-156   
ref|XP_009388622.1|  PREDICTED: ABC transporter G family member 2...    484   2e-156   
ref|XP_009360789.1|  PREDICTED: ABC transporter G family member 2...    484   3e-156   
ref|XP_008349497.1|  PREDICTED: ABC transporter G family member 2...    481   4e-156   
ref|XP_007028066.1|  White-brown-complex ABC transporter family i...    479   6e-156   
emb|CDP13689.1|  unnamed protein product                                479   1e-155   
gb|EYU27464.1|  hypothetical protein MIMGU_mgv1a002345mg                479   1e-155   
ref|XP_004491527.1|  PREDICTED: ABC transporter G family member 2...    477   7e-155   
ref|XP_007207412.1|  hypothetical protein PRUPE_ppa014606mg             475   5e-154   
ref|XP_009367249.1|  PREDICTED: ABC transporter G family member 26      475   7e-154   
ref|XP_007020427.1|  ABC-2 type transporter family protein              475   7e-154   
ref|XP_008218542.1|  PREDICTED: ABC transporter G family member 26      474   1e-153   
ref|XP_008797781.1|  PREDICTED: ABC transporter G family member 26      473   1e-153   
ref|XP_010676075.1|  PREDICTED: ABC transporter G family member 26      474   2e-153   
ref|XP_010942700.1|  PREDICTED: ABC transporter G family member 26      473   2e-153   
ref|XP_010542511.1|  PREDICTED: ABC transporter G family member 2...    472   1e-152   
ref|XP_004294923.1|  PREDICTED: ABC transporter G family member 2...    469   1e-151   
gb|AET00827.2|  white-brown-complex ABC transporter family protein      469   2e-151   
ref|XP_010542512.1|  PREDICTED: ABC transporter G family member 2...    469   2e-151   
gb|AIU41652.1|  ABC transporter family protein                          470   2e-151   
ref|XP_002267511.2|  PREDICTED: ABC transporter G family member 26      468   4e-151   
ref|XP_010917904.1|  PREDICTED: ABC transporter G family member 2...    467   7e-151   
gb|KHN10345.1|  ABC transporter G family member 27                      466   1e-150   
ref|XP_006373817.1|  hypothetical protein POPTR_0016s06620g             466   4e-150   



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 464/630 (74%), Positives = 536/630 (85%), Gaps = 18/630 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DI+   TQL+         SAAIFKK N PVTLKFENVVYK+KP +K+GL       
Sbjct  4     EMADIQ--ITQLE---------SAAIFKKTNLPVTLKFENVVYKIKP-KKEGLF---NSS  48

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K E EKIILKG+TGIVFPGE+LAMLGPSGSGKTTLLT LGGRL G LAG+ITYNGKPF+
Sbjct  49    SKLEEEKIILKGITGIVFPGEMLAMLGPSGSGKTTLLTGLGGRLSGRLAGSITYNGKPFT  108

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKR TGFVTQDDILYPHLTVTETL+FTALLRLP+TL+ +EK+  A+AVI+QLGLTKCK
Sbjct  109   NAMKRYTGFVTQDDILYPHLTVTETLLFTALLRLPKTLSHEEKVVHAEAVISQLGLTKCK  168

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG  LRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ+IVSTLWEL KG
Sbjct  169   DSIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELVKG  228

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+FHKVLLL EGNPLYFG+G D M YFS++GFSP VAMNPSDFL
Sbjct  229   GRTIVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSIGFSPLVAMNPSDFL  288

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG+  DD Q DQA++K+TLV+AFKTNLL+++K EL + +D+ V     + +F +W+
Sbjct  289   LDLANGVL-DDPQEDQASIKQTLVTAFKTNLLDSVKEELRKFDDQQVHGKLHKGKFSQWS  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISS  776
               WW+QFSVL +RG+K+RK+ESFSGLK+GQVLVVAFL G LWW+S D+QDQ+GL+FF S 
Sbjct  348   NTWWQQFSVLFRRGMKERKHESFSGLKIGQVLVVAFLCGLLWWQSKDIQDQIGLMFFYSG  407

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FWGF+PLFQAIFTFP+++MML KERSSGMY+LSS+F++RTVGDLPMELVLPT+FVII+YW
Sbjct  408   FWGFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYW  467

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             MAGLKP A NFFS L  +L  VLV QGLGLA+GA +MDQKSAT LGSVIML+F LAGG+Y
Sbjct  468   MAGLKPFAPNFFSTLFTLLFSVLVSQGLGLALGALVMDQKSATILGSVIMLSFTLAGGYY  527

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V HVPSFI+WIKYISI QYT+KLL+ SQ++PGETYPC   +  C VED PAIK +GLG  
Sbjct  528   VHHVPSFIAWIKYISISQYTFKLLIGSQFEPGETYPCGL-NATCYVEDFPAIKSVGLGDK  586

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              I SVVAL +ML+ YRLLAYVALMR+G TK
Sbjct  587   AI-SVVALGIMLVAYRLLAYVALMRIGVTK  615



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score =   871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 457/630 (73%), Positives = 533/630 (85%), Gaps = 18/630 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DI+   TQL+         +AAIFKK N PVTLKFENVVYK+KP +K+GL       
Sbjct  4     EMADIQ--ITQLE---------TAAIFKKTNLPVTLKFENVVYKIKP-KKEGLF---NSS  48

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K E EKIILKG+TGIVFPGE+LAMLGPSGSGKTTLLT LGGRL G +AG+ITYNGKPF+
Sbjct  49    SKPEEEKIILKGITGIVFPGEMLAMLGPSGSGKTTLLTGLGGRLNGRIAGSITYNGKPFT  108

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKR TGFVTQDDILYPHLTVTETLVFTALLRLP+TL+ +EK+  A+AVI+QLGLTKCK
Sbjct  109   NAMKRYTGFVTQDDILYPHLTVTETLVFTALLRLPKTLSHEEKVAHAEAVISQLGLTKCK  168

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG  LRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ+IVSTLWEL KG
Sbjct  169   DSIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELVKG  228

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+FHKVLLL EGNPLYFG+G D M YFS++G+SP VAMNPSDFL
Sbjct  229   GRTIVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSIGYSPLVAMNPSDFL  288

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG+  DD Q DQA+VK+TLV+AFKT+LL+++K EL + +D+ V     + +F +W+
Sbjct  289   LDLANGVL-DDPQEDQASVKQTLVTAFKTDLLDSVKEELRKFDDQQVHEKSHKGKFSQWS  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISS  776
               WW+QFSVL +RG+K+RK+ESFSGLK+GQVLVVAFL G LWW+S D+QDQ+GL+FF S 
Sbjct  348   NTWWQQFSVLFRRGMKERKHESFSGLKIGQVLVVAFLCGLLWWQSKDIQDQIGLMFFYSG  407

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FWGF+PLFQAIFTFP+++MML KERSSGMY+LSS+F++RTVGDLPMELVLPT+FVII+YW
Sbjct  408   FWGFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYW  467

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             +AGLKP A NFFS L  +L  VLV  GLGLA+GA +MDQKSAT LGSVIML+F LAGG+Y
Sbjct  468   IAGLKPFALNFFSTLFTLLFSVLVSHGLGLALGALVMDQKSATILGSVIMLSFTLAGGYY  527

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V HVPSFI+WIKYISI QYT+KLL+ SQ++ GETY C   +  C VED PAIK +G+G  
Sbjct  528   VHHVPSFIAWIKYISISQYTFKLLIGSQFEAGETYTCGINT-TCYVEDFPAIKSVGIGDK  586

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              I SVVAL +ML+ YRLLAYVALMR+G TK
Sbjct  587   AI-SVVALAIMLVAYRLLAYVALMRIGVTK  615



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score =   852 bits (2201),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/626 (72%), Positives = 522/626 (83%), Gaps = 15/626 (2%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             Q N + +   SAAIFKK+NRPVTLKFENVVYK+K   K+G      K  KSE EKIILKG
Sbjct  12    QQNLRADQSKSAAIFKKSNRPVTLKFENVVYKIKL-VKEGC----IKSSKSEEEKIILKG  66

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVT  1643
             V+GIV PGE+LA+LGPSGSGKTTLLT LGGRL        ITYN KPFSNAMKRNTGFVT
Sbjct  67    VSGIVSPGEMLAILGPSGSGKTTLLTGLGGRLVHGNLDGAITYNNKPFSNAMKRNTGFVT  126

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTVTETLVFTALLRLP TLT QEK   A+A+ITQLGLT+CK+SIIG   LRG
Sbjct  127   QDDVLYPHLTVTETLVFTALLRLPGTLTVQEKTAHAEAIITQLGLTRCKDSIIGSPLLRG  186

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTL +L KGGRTIVMTIHQP
Sbjct  187   ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLRDLVKGGRTIVMTIHQP  246

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI----  1115
             SSRLFY+F+KVLLL EGNPLYFG+G D M YFS VGFSP VAMNPSDFLLDL+NGI    
Sbjct  247   SSRLFYMFNKVLLLSEGNPLYFGRGEDAMGYFSGVGFSPLVAMNPSDFLLDLSNGILSDD  306

Query  1114  ---TGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWW  944
                T DD   D A++K+TLV+AF+TNL ENLK +L + ++  V+    +K+F +W+  WW
Sbjct  307   PRITSDDPGEDPASIKQTLVAAFRTNLAENLKEQLQQFDEHQVADKLHEKKFNQWSNTWW  366

Query  943   EQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGF  764
             +QFSVL +RG+K+RK+ESFSGLKVGQVLVV+FL G LWWKS++LQDQ+GLLFF S+FW F
Sbjct  367   QQFSVLFRRGMKERKHESFSGLKVGQVLVVSFLCGLLWWKSSNLQDQIGLLFFYSNFWEF  426

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             +P+FQAIFTFP+++MML KERSSGMY+LS++F+ARTVGDLPMELVLPT+FV+I+Y+MAGL
Sbjct  427   YPMFQAIFTFPQERMMLEKERSSGMYRLSAYFIARTVGDLPMELVLPTIFVVITYFMAGL  486

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             K +AG+FFS L A+L  VLV QGLGLAIGA +MDQKSAT LGSVIML+F LAGG++V+HV
Sbjct  487   KLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQHV  546

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             PSFI+WIKY+SI QY YKLLL SQY PGETY C   +  CLVED P+IK IGLG   I S
Sbjct  547   PSFIAWIKYVSISQYAYKLLLGSQYSPGETYTCAI-NATCLVEDFPSIKTIGLGGKGI-S  604

Query  223   VVALLLMLIGYRLLAYVALMRVGRTK  146
             VVAL +ML+GYR LAYVALMR+G TK
Sbjct  605   VVALAIMLLGYRFLAYVALMRIGVTK  630



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/626 (72%), Positives = 520/626 (83%), Gaps = 15/626 (2%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             Q N       S+AIF+K+NRPVTLKFENVVYK+K   K+G         KS  EKIILKG
Sbjct  18    QQNLHSAQSKSSAIFRKSNRPVTLKFENVVYKIKL-VKEGC----INSSKSVEEKIILKG  72

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVT  1643
             V+GIV PGE+LA+LGPSGSGKTTLLT LGGRL        ITYN KPFSNAMKRNTGFVT
Sbjct  73    VSGIVSPGEMLAILGPSGSGKTTLLTGLGGRLVHGHLDGAITYNNKPFSNAMKRNTGFVT  132

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTVTETLVFTALLRLP TLT QEK   A+A+ITQLGLT+CK+SIIGG  LRG
Sbjct  133   QDDVLYPHLTVTETLVFTALLRLPGTLTVQEKTAHAEAIITQLGLTRCKDSIIGGPLLRG  192

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTL +L+KGGRTIVMTIHQP
Sbjct  193   ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLRDLAKGGRTIVMTIHQP  252

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI----  1115
             SSRLFY+FHKVLLL EGNPLYFG+G D M YFS+VG+SP VAMNPSDFLLDL+NGI    
Sbjct  253   SSRLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSVGYSPLVAMNPSDFLLDLSNGILSDD  312

Query  1114  ---TGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWW  944
                T DD   D A++K+TLV+AFK NL ENLK +L E +D  V+    +K+F +W+  WW
Sbjct  313   PRITSDDPGEDPASIKQTLVTAFKNNLAENLKGQLQEFDDHQVADKLHEKKFNQWSNTWW  372

Query  943   EQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGF  764
             +QFSVL +RG+K+RK+ESFSGLKVGQVLVV+FL G LWWKS++LQDQ+GLLFF S+FW F
Sbjct  373   QQFSVLFRRGMKERKHESFSGLKVGQVLVVSFLCGLLWWKSSNLQDQIGLLFFYSNFWEF  432

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             +P+FQAIFTFP+++MML KERSSGMY+LS++F+ARTVGDLPMELVLPT+FV+I+Y+MAGL
Sbjct  433   YPMFQAIFTFPQERMMLEKERSSGMYRLSAYFMARTVGDLPMELVLPTIFVVITYFMAGL  492

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             K +AG+FFS L A+L  VLV QGLGLAIGA +MDQKSAT LGSVIML+F LAGG++V+HV
Sbjct  493   KLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQHV  552

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             PSFI+WIKY+SI QY YKLLL SQY PGETY C   +  CLVED P+IK IGLG   I S
Sbjct  553   PSFIAWIKYVSISQYAYKLLLGSQYSPGETYACGINT-TCLVEDFPSIKTIGLGGKGI-S  610

Query  223   VVALLLMLIGYRLLAYVALMRVGRTK  146
             V+AL +ML+GYR LAYVALMR+G TK
Sbjct  611   VLALAIMLLGYRFLAYVALMRIGVTK  636



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score =   843 bits (2179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/632 (70%), Positives = 521/632 (82%), Gaps = 17/632 (3%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M D+EA       N   + + S AIFKKAN PVTLKFE+VVYK+K +Q  G  F KT K 
Sbjct  1     MVDVEA------QNLAGDGEISPAIFKKANLPVTLKFEDVVYKIKTEQ-SGKFFKKTAKS  53

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFS  1676
             +   EK+ILKG++G+V PGE+LAMLGPSGSGKTTLLT LGGRL        ITYNGKPFS
Sbjct  54    Q---EKLILKGISGMVLPGEMLAMLGPSGSGKTTLLTGLGGRLTSGRLSGNITYNGKPFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKRNTGFVTQDD+LYPHLTVTETLV+TALLRLPRTLTK EK E A+AVI QLGL++C+
Sbjct  111   NAMKRNTGFVTQDDVLYPHLTVTETLVYTALLRLPRTLTKAEKAEHAEAVIAQLGLSRCR  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG  LRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLW+L+ G
Sbjct  171   HSIIGGPLLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWDLANG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+FHKVLLL EGNPLY+GKGS  + YFS++GFS SVAMNP+DFL
Sbjct  231   GRTIVMTIHQPSSRLFYMFHKVLLLSEGNPLYYGKGSSALDYFSSIGFSLSVAMNPADFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANGI+  DS  D A +K+TLV+++KT+LLE++  EL    D+ +  A D KQ +RW+
Sbjct  291   LDLANGISTADSMEDHAAIKQTLVASYKTHLLESVTAELAA--DDQLQMATDDKQLRRWS  348

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVL +RG+K+R++ESFSGLK+GQVL VA LTG LWW+S  + LQDQVGL FF 
Sbjct  349   NTWWDQFSVLFRRGIKERRHESFSGLKIGQVLAVAILTGLLWWQSDISHLQDQVGLFFFY  408

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGF+PLFQAIFTFP+++MML KERSSGMY+LSS+F+A T+GDLPMELVLPTVF +I+
Sbjct  409   SGFWGFYPLFQAIFTFPQERMMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFVIT  468

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLKP    FF+ L  +L  VL  QGLGLA+GA +M+QKSAT LGSVIML FLLA G
Sbjct  469   YWMAGLKPDPRCFFAGLFTLLYSVLCSQGLGLALGAAVMNQKSATILGSVIMLTFLLASG  528

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV+HVP+FISWIKYISI QYT+KLLL SQ+KPGETYPC +G   CLVED   IK +GLG
Sbjct  529   YYVQHVPAFISWIKYISISQYTFKLLLGSQFKPGETYPCGNGK-TCLVEDFGMIKPVGLG  587

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              H I +V+AL +ML+GYRL+AYVALMR+G TK
Sbjct  588   GHAI-AVIALAVMLVGYRLVAYVALMRIGVTK  618



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/633 (69%), Positives = 524/633 (83%), Gaps = 14/633 (2%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM D+EAP     A  Q     +AAIF+KANRPVTLKFE+VVYK+K  +K+G      KK
Sbjct  4     EMADVEAPQPNGSAGQQ--KSCAAAIFEKANRPVTLKFEDVVYKIKV-KKEGW----FKK  56

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
                  EK ILKG++G+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L+G+ITYNGKPFS
Sbjct  57    STESEEKTILKGISGMVLPGEMLAMLGPSGSGKTTLLTALGGRLGGSLSGSITYNGKPFS  116

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N +KRNTGFVTQDDILYPHLTV ETL+FTALLRLP +LTK+EK+ +A+AVITQLGLTKCK
Sbjct  117   NVVKRNTGFVTQDDILYPHLTVNETLIFTALLRLPNSLTKEEKVMRAEAVITQLGLTKCK  176

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NSIIG   +RG+SGGERKRVSIGQEMLINPS L LDEPTSGLDSTTAQRIVSTL EL+ G
Sbjct  177   NSIIGSRLVRGVSGGERKRVSIGQEMLINPSFLLLDEPTSGLDSTTAQRIVSTLGELANG  236

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT+VMTIHQPSSRLFY+FHKVL+L EGNP+Y+GKG D M YFS VGF+P  +MNP+DFL
Sbjct  237   GRTVVMTIHQPSSRLFYMFHKVLVLSEGNPIYYGKGMDAMDYFSDVGFTPKFSMNPADFL  296

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG++ DDS+ DQA +K+TLVSA+K  L ENL++EL +  D ++ S  + KQF RW 
Sbjct  297   LDLANGVSVDDSRDDQALIKQTLVSAYKAKLAENLQIELKQTTD-NLHSVSEGKQFNRWT  355

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVL++RG+K+RK+ESFSG+K+ Q+LVVA L G LWW+S  + LQDQ+GLLFF 
Sbjct  356   TTWWQQFSVLIRRGMKERKHESFSGIKIVQILVVAILCGLLWWQSDPSHLQDQIGLLFFY  415

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             + FWGFFPLF AIFTFP++++ML KER+SGMY+LSS+F+ART+GDLPMELVLP+VF+ I+
Sbjct  416   TGFWGFFPLFNAIFTFPQERLMLEKERASGMYRLSSYFMARTIGDLPMELVLPSVFITIT  475

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLK TA +F      +L  VLV QGLGLA+GA ++DQK+AT LGSVIML+F+LAGG
Sbjct  476   YWMAGLKATAASFLGCWLVLLYAVLVAQGLGLAVGALVLDQKNATILGSVIMLSFILAGG  535

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV+HVPSFI+WIKY+SIGQY YKL + SQY PGETYPC      CLVED P+IK I  G
Sbjct  536   YYVQHVPSFIAWIKYVSIGQYAYKLFIMSQYNPGETYPCAENK-TCLVEDFPSIKSI--G  592

Query  241   QHVIF-SVVALLLMLIGYRLLAYVALMRVGRTK  146
              H +F SVVA+ +ML+GYRL+AY+ALMR+G T+
Sbjct  593   PHGLFSSVVAMAIMLVGYRLVAYIALMRIGVTR  625



>ref|XP_002533914.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28469.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=632

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/621 (70%), Positives = 522/621 (84%), Gaps = 10/621 (2%)
 Frame = -3

Query  1981  ESDTSAAIFKKANRPVTLKFENVVYKV---KPDQ---KQGLSFLKTKKQKSEAEKIILKG  1820
             E +   +IFKKANRPVTLKF+ VVYKV   KP     ++G+  +  +      EK+ILKG
Sbjct  12    EPEEVVSIFKKANRPVTLKFDEVVYKVGLQKPSGWSCQKGMKVVSCQNGIKGDEKVILKG  71

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQ  1640
             +TG+VFPGE+LAMLGPSGSGKTTLLTALGG+LGG L G ITYNGKPFSNAMKRNTGFVTQ
Sbjct  72    ITGMVFPGEMLAMLGPSGSGKTTLLTALGGKLGGKLGGKITYNGKPFSNAMKRNTGFVTQ  131

Query  1639  DDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGI  1460
             DD+LYPHLTVTETLVFTALLRLP+ LTKQEKI   +AV+TQLGLT+CKNSIIGG FLRGI
Sbjct  132   DDVLYPHLTVTETLVFTALLRLPKELTKQEKIMHGEAVLTQLGLTRCKNSIIGGPFLRGI  191

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPS  1280
             SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVST+WE +KGGRTIVMTIHQPS
Sbjct  192   SGGERKRVSIGQELLINPSLLFLDEPTSGLDSTTAQRIVSTVWEQAKGGRTIVMTIHQPS  251

Query  1279  SRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS  1100
             SRLFY+F KVLLL EGNPLYFGKGS+VM+YFS++GF PSVAMNP+D+LLDL+NGI+    
Sbjct  252   SRLFYMFDKVLLLSEGNPLYFGKGSEVMNYFSSIGFEPSVAMNPADYLLDLSNGISSYTD  311

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLK  920
               DQATVK+TLV+A+K NL  +LK E+  + D ++ ++ + KQF RWA  WW+QF+VL +
Sbjct  312   SRDQATVKQTLVTAYKDNLAGDLKAEVQAV-DNNLQNSSNDKQFARWATTWWQQFTVLFR  370

Query  919   RGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-TDLQDQVGLLFFISSFWGFFPLFQAI  743
             RGLK+RK+ESF+G+KV QVL+VAFL+G +WW+S + LQDQ+GLLFF S FWGFFPLFQAI
Sbjct  371   RGLKERKHESFAGIKVAQVLIVAFLSGLIWWRSGSHLQDQIGLLFFYSGFWGFFPLFQAI  430

Query  742   FTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNF  563
             FTFP+++ ML KERSSGMY+LSS+F++RTV DLPMELVLP +FVII+YWMAGLK TA NF
Sbjct  431   FTFPQERRMLEKERSSGMYRLSSYFMSRTVSDLPMELVLPAIFVIITYWMAGLKSTAVNF  490

Query  562   FSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
              + L  +L  VLV QGLGLA+GA ++DQ+SATT+GSV+ML+F L  G+YV++VP FI WI
Sbjct  491   LNTLFVVLFNVLVAQGLGLALGAIVLDQRSATTVGSVLMLSFQLVSGYYVQNVPIFIGWI  550

Query  382   KYISIGQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHPAIKKIGLG-QHVIFSVVALL  209
             KYISI QYTY+LLL SQYK  +TYPC T+ SGVCLV D+PAIK +GLG    I + VALL
Sbjct  551   KYISISQYTYRLLLGSQYKQTDTYPCNTTASGVCLVGDYPAIKMVGLGVDGQIIAAVALL  610

Query  208   LMLIGYRLLAYVALMRVGRTK  146
             +ML+ +R++AY+AL R+G  K
Sbjct  611   IMLVLFRVIAYLALTRIGVVK  631



>gb|KDP27016.1| hypothetical protein JCGZ_20951 [Jatropha curcas]
Length=621

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/630 (69%), Positives = 516/630 (82%), Gaps = 13/630 (2%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M DIEA TT    N Q E   S  IF+K NRP+TLKFE+V+YKV  +++  L     +K 
Sbjct  1     MEDIEAQTT---TNEQPEDFVS--IFEKTNRPLTLKFEDVIYKVVSNKRGTLC----QKG  51

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSN  1673
               + EK+ILKGVTG V PGE+LAMLGPSGSGKTTLLTALGG+LGG L G ITYNGKPFSN
Sbjct  52    LKQEEKMILKGVTGTVLPGEMLAMLGPSGSGKTTLLTALGGKLGGQLGGVITYNGKPFSN  111

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
             A+KRNTGFVTQDD+LYPHLTVTETLVFTALLRLP +LTK+EK+  A+AVITQLGL +CKN
Sbjct  112   AVKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNSLTKEEKVMHAEAVITQLGLVRCKN  171

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
              I+G  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVST+WEL++GG
Sbjct  172   CIVGDTFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTVWELARGG  231

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             RTIVMTIHQPSSRLFY+F KVLLL EGNPLYFGKG +VM YFS++G++PS AMNPSDFLL
Sbjct  232   RTIVMTIHQPSSRLFYMFDKVLLLSEGNPLYFGKGLEVMDYFSSIGYTPSFAMNPSDFLL  291

Query  1132  DLANGIT-GDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             DLANG++   DS  +QA VK+TL SA+K NL   LK E+  +++  +    + K+F  WA
Sbjct  292   DLANGVSPSSDSCENQAEVKQTLFSAYKNNLANKLKAEVEAIDNNQLQDGLNDKKFTEWA  351

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISS  776
               W +QF++L +RG+K+RK+ESFSGLK+GQ+LVVAFL+G LWW  + LQDQ+GLLFF S 
Sbjct  352   TTWVQQFTILFRRGIKERKHESFSGLKIGQILVVAFLSGLLWWNCSQLQDQIGLLFFYSG  411

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FWGFFPLF+AIFTFP+++ ML KERSSG Y+LSS+F++R V DLPMELVLPTVF+ I+YW
Sbjct  412   FWGFFPLFEAIFTFPQERRMLAKERSSGTYRLSSYFMSRLVSDLPMELVLPTVFITITYW  471

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             MAGLKPT  NFF  L  +L  VLV QGLGLA+GA +MDQK ATTLGSVIML+FLLAGG+Y
Sbjct  472   MAGLKPTPQNFFYTLFVLLYSVLVSQGLGLALGAAVMDQKKATTLGSVIMLSFLLAGGYY  531

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V+HVPSFI+WIKY+SI QYTYKLL+ SQYK  ETYPC  G  VCLV D P +K +GL   
Sbjct  532   VQHVPSFIAWIKYLSISQYTYKLLVGSQYKANETYPC--GESVCLVGDFPLVKTVGLDGQ  589

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             ++ S VAL +ML+GYRL+AY+ALMRVG  K
Sbjct  590   IV-SAVALGIMLLGYRLIAYLALMRVGVVK  618



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score =   823 bits (2125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/630 (69%), Positives = 515/630 (82%), Gaps = 17/630 (3%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRP--VTLKFENVVYKVKPDQKQGLSFLKTK  1859
             M DI+A    + ANP+        IF KA     V LKFE V YK K   K GL     +
Sbjct  1     MVDIKAQPESITANPE-----PPPIFTKAKNSGHVILKFEEVDYKAK-THKGGL----LR  50

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPF  1679
             K     EK ILKG+TGIV PGE+LAMLGPSGSGKTTLLTALGGRLGG L G+ITYNGKPF
Sbjct  51    KDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLLTALGGRLGGRLNGSITYNGKPF  110

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             SN MKR+TGFVTQDD+LYPHLTVTETLVFTALLRLP T++K++K+  A+AVITQLGLTKC
Sbjct  111   SNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNTISKEDKVRHAEAVITQLGLTKC  170

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             K+SIIG  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+K
Sbjct  171   KDSIIGNPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELAK  230

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+VMTIHQPSSRLFY+FHKVLLL EGNPLYFGKG++ M YFS++GF+PSVAMNPSDF
Sbjct  231   GGRTVVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMNPSDF  290

Query  1138  LLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             LLDLANG+  DD   D  T+K+TLV ++++ + E LK EL E+ D  +    + KQ  RW
Sbjct  291   LLDLANGVLSDDIHEDPTTIKQTLVLSYRSKIDEGLKAELREI-DNHLQDGLEDKQLDRW  349

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFF  785
             A  WW+Q SVL +RG+K+R++ESFSGLK+GQVLVV FL+G LWW+  S+ LQDQ+GLLFF
Sbjct  350   ATTWWQQCSVLFRRGVKERRHESFSGLKIGQVLVVGFLSGLLWWQSDSSHLQDQIGLLFF  409

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGFFPLFQAIFTFP+++MML KERSSGMY+LSS+F++RT+GDLPMELVLPT+FVII
Sbjct  410   CSGFWGFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVII  469

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWMAGLKP A NF   L A+L  VLV Q LGLA+GA +MDQKSAT LGSVIML+FLLAG
Sbjct  470   TYWMAGLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAG  529

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+YV++VP FI+WIKY+SI  YTYKLLL SQYKPG+ YPC++ +  CLV D PA++ +GL
Sbjct  530   GYYVQNVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKT-TCLVGDFPAVQLVGL  588

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVG  155
              +  I + VAL +ML+GYRL+AY+ALMR+G
Sbjct  589   DKQ-ILAAVALAIMLVGYRLIAYIALMRIG  617



>ref|XP_011042498.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/632 (69%), Positives = 509/632 (81%), Gaps = 19/632 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             E  DIEA   Q    P++     AAIFKKAN  + LKFE+VVYKVK  +    S    K 
Sbjct  4     ETADIEA---QNDKQPEV-----AAIFKKANNAIALKFEDVVYKVKFTK----SCFCGKI  51

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K+E EK ILKGVTG V PGE+LAMLGPSGS KTTLLTALGG+LGG L G ITYNGK FS
Sbjct  52    TKTE-EKFILKGVTGKVLPGEMLAMLGPSGSSKTTLLTALGGKLGGLLDGNITYNGKSFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N+MKRN GFVTQDD+LYPHLTV ETLVFTALLR+  T TK+EKI  A++VITQLGLTKCK
Sbjct  111   NSMKRNMGFVTQDDVLYPHLTVAETLVFTALLRMENTFTKEEKIMHAESVITQLGLTKCK  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NSIIGG FLRG+SGGERKRVSI QEMLINPSLL LDEPTSGLDSTTAQRIVSTLWEL+KG
Sbjct  171   NSIIGGPFLRGLSGGERKRVSIAQEMLINPSLLLLDEPTSGLDSTTAQRIVSTLWELAKG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY F KVLLL EGNPLYFG+ S VM YFS++G++P+V MNP+DFL
Sbjct  231   GRTIVMTIHQPSSRLFYFFDKVLLLSEGNPLYFGERSQVMDYFSSIGYAPAVPMNPADFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG++ +       TVK+ LVSA+K+NL   LK E HE++D       D KQ  RWA
Sbjct  291   LDLANGVSSNSEVP--GTVKQNLVSAYKSNLANKLKSEAHEIDDPSQDGLND-KQVSRWA  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW++FSVLL RG+K+RK+ SFSGLK+GQVLVVAFL+G LWW+S  + +QDQ+GLLFF 
Sbjct  348   TTWWQEFSVLLIRGMKERKHNSFSGLKIGQVLVVAFLSGLLWWQSDVSHIQDQMGLLFFY  407

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWG FPLFQAIFTFP+++ ML KERSSGMY+LSS+F++R V DLPMELVLPT+FV I+
Sbjct  408   SGFWGIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVTIT  467

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLK + GNFF  LS +L  VLV  GLGLAIGA +++++SAT  GSVIML+FLLAGG
Sbjct  468   YWMAGLKGSPGNFFLTLSVLLYSVLVAGGLGLAIGALVLNRRSATITGSVIMLSFLLAGG  527

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV HVP+FISW+KYISI QYTYKLLL SQYKPG+TY C    GVCLV D+PAIKK+GL 
Sbjct  528   YYVTHVPAFISWVKYISISQYTYKLLLGSQYKPGDTYTCVGAGGVCLVGDYPAIKKVGLD  587

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               V+  VVAL +ML+GYRL+AY+ALMR+G T+
Sbjct  588   GQVL-GVVALGIMLVGYRLIAYLALMRIGVTQ  618



>ref|XP_004244204.1| PREDICTED: ABC transporter G family member 9 [Solanum lycopersicum]
Length=613

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/614 (70%), Positives = 500/614 (81%), Gaps = 6/614 (1%)
 Frame = -3

Query  1987  QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGI  1808
             Q+    SAAIFKK N PVTLKF+NVVYK+K  + +G+        KS+ EKIILKGVTGI
Sbjct  5     QITQLESAAIFKKTNFPVTLKFDNVVYKIKA-KTEGMF---KSSSKSQEEKIILKGVTGI  60

Query  1807  VFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDIL  1628
             VFPGE+LAMLGPSGSGKTTLLT LGGRL G L GTITYNG PF NAMKR TGFVTQDD+L
Sbjct  61    VFPGEMLAMLGPSGSGKTTLLTGLGGRLSGRLEGTITYNGMPFKNAMKRYTGFVTQDDVL  120

Query  1627  YPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGE  1448
             YPHLTVTETLV+TALLRLP+TL+  +K+  A+AVI+QLGLTKCK+SIIGG  LRGISGGE
Sbjct  121   YPHLTVTETLVYTALLRLPKTLSHMDKVAHAEAVISQLGLTKCKDSIIGGPLLRGISGGE  180

Query  1447  RKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLF  1268
             RKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ+IVSTLWEL  GGRTIVMTIHQPSSRLF
Sbjct  181   RKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELVNGGRTIVMTIHQPSSRLF  240

Query  1267  YLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQ  1088
             Y+FHKVLLL EGNPLYFG+G D MSYFS++GFSPSVAMNPSDFLLDLANG+  DD Q DQ
Sbjct  241   YMFHKVLLLSEGNPLYFGRGEDAMSYFSSIGFSPSVAMNPSDFLLDLANGVV-DDPQEDQ  299

Query  1087  ATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLK  908
             A++K+TLV+AFKTNLL+ +K EL   +D +      + +  RW+  WW +  VL +RG+K
Sbjct  300   ASIKQTLVTAFKTNLLDVVKEELQRYDDSEDHQKIQKGELDRWSNTWWNEAVVLFRRGMK  359

Query  907   QRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             +RK+++FS LKV QVL+V+ L   LWW+STD+QDQ GL+FFI+SFWGF+PLFQAIFTFP 
Sbjct  360   ERKHDAFSFLKVAQVLIVSILCAMLWWRSTDIQDQTGLMFFITSFWGFYPLFQAIFTFPP  419

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++MML KER+SG Y+LSS+F++R VGDLPMELVLPT+FVII+YW  GLK +  NFFS L 
Sbjct  420   ERMMLEKERASGTYRLSSYFMSRIVGDLPMELVLPTIFVIIAYWTTGLKQSPVNFFSTLF  479

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
              +L  VLV QGLGLAIGA IMD KSAT L SV ML+F L  GF+V HVPSFISW+KYIS+
Sbjct  480   TVLYGVLVAQGLGLAIGAMIMDLKSATVLASVTMLSFTLVSGFFVHHVPSFISWLKYISL  539

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
              QYT+KLL+ SQY+ GE Y C      C V D PAIK +GLG + I SVVAL +ML+GYR
Sbjct  540   TQYTFKLLVGSQYEEGEMYHCGVVDATCYVHDFPAIKSVGLGGNAI-SVVALTIMLVGYR  598

Query  187   LLAYVALMRVGRTK  146
             +LAY+ L R+G TK
Sbjct  599   VLAYLVLTRIGVTK  612



>ref|XP_006370303.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
 gb|ERP66872.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
Length=619

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/632 (69%), Positives = 509/632 (81%), Gaps = 19/632 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DIEA   Q +  P++     AAIFKKAN  + LKFE+VVYK+K   K G     TK 
Sbjct  4     EMADIEA---QNEKQPEV-----AAIFKKANSAIALKFEDVVYKIK-FTKSGFCGKITKT  54

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
             +    EKIILKGVTG V PGE+LAMLGPSGS KTTLLTALGG+LGG L G ITYNGK FS
Sbjct  55    E----EKIILKGVTGKVLPGEMLAMLGPSGSSKTTLLTALGGKLGGLLDGNITYNGKSFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N+MKRN GFVTQDD+LYPHLTV ETLVFTALLRL  T TK+EKI  A++VITQLGLTKCK
Sbjct  111   NSMKRNMGFVTQDDVLYPHLTVAETLVFTALLRLENTFTKEEKIMHAESVITQLGLTKCK  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NSIIGG FLRG+SGGERKRVSIGQEMLINPSLL LDEPTSGLDSTTAQRIVSTL EL+KG
Sbjct  171   NSIIGGQFLRGLSGGERKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIVSTLRELAKG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFYLF KVLLL EGNPLYFG+ S VM YFS++G++P+V MNP+DFL
Sbjct  231   GRTIVMTIHQPSSRLFYLFDKVLLLSEGNPLYFGERSQVMDYFSSIGYAPAVPMNPADFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG++ +       TVK+ LVSA+K+NL   LK E+HE+++       D KQ  RWA
Sbjct  291   LDLANGVSSNSEVP--GTVKQNLVSAYKSNLANKLKSEVHEIDNPSQDGLND-KQVSRWA  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
             I WW++FSVLL RG+K+RKY+SFSG K+GQVLVVA L+G +WW+S  + +QDQ+GLLFF 
Sbjct  348   ITWWQEFSVLLIRGVKERKYDSFSGHKIGQVLVVAILSGLMWWQSDVSHIQDQMGLLFFY  407

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWG FPLFQAIFTFP+++ ML KERSSGMY+LSS+F++R V DLPMELVLPT+F+ I+
Sbjct  408   SGFWGIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFLTIT  467

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLK + GNFF  L  +L  VLV  GLGLAIGA +++Q+SAT  GSVIML+FLLAGG
Sbjct  468   YWMAGLKGSPGNFFLTLFVLLYSVLVAGGLGLAIGALVLNQRSATITGSVIMLSFLLAGG  527

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV HVP+FISW+KYISI QYTYKLLL SQYKP +TY C    GVCLV D+PAIKK+GL 
Sbjct  528   YYVTHVPAFISWVKYISISQYTYKLLLGSQYKPSDTYTCGGAGGVCLVGDYPAIKKVGLD  587

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               V+   VAL +ML+GYRL+AY+ALMR+G  K
Sbjct  588   DQVL-GAVALGIMLVGYRLIAYLALMRIGVAK  618



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/626 (68%), Positives = 497/626 (79%), Gaps = 14/626 (2%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             Q N   +      IF   NRPVTLKFENVVYK+   ++           KS  EKIILKG
Sbjct  8     QQNQHTDHSKIEVIFNNINRPVTLKFENVVYKINLVKEGCFK----NSPKSNEEKIILKG  63

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVT  1643
             V+GIV PGE+LA+LGPSGSGKTTLLT LGGRL        ITYN K FSNAM RNTGFVT
Sbjct  64    VSGIVSPGEMLAILGPSGSGKTTLLTGLGGRLVNGHLKGVITYNNKTFSNAMNRNTGFVT  123

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTV+ETLVFTALLRLP+T T +EK   A+A+ITQLGLTKCK+ I+GG FLRG
Sbjct  124   QDDVLYPHLTVSETLVFTALLRLPKTFTVEEKTAHAEAIITQLGLTKCKDIIVGGPFLRG  183

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTA RIVSTL +L+KGGRT+V+TIHQP
Sbjct  184   ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTALRIVSTLRDLAKGGRTVVLTIHQP  243

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD  1103
             SSRLFY+F KVLLL EGNPLYFG+G D M YFS +GFSP VAMNPSDFLLDL+NGI  DD
Sbjct  244   SSRLFYMFKKVLLLSEGNPLYFGRGEDAMGYFSGIGFSPLVAMNPSDFLLDLSNGILSDD  303

Query  1102  SQA-------DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWW  944
              +        D A++K+TLV+AFKTNL+EN+K +  E +   V     +K+F +W+  WW
Sbjct  304   PRVLADTPIEDPASIKKTLVTAFKTNLVENMKEQFQESDVHQVVEKLHEKKFTQWSNTWW  363

Query  943   EQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGF  764
             +QF+VL +RG+K+RK+ESFS LKVG+VLVVAFL G LWWKS ++QDQVGL+FF + FW F
Sbjct  364   QQFAVLFRRGMKERKHESFSSLKVGEVLVVAFLCGLLWWKSNNIQDQVGLMFFYTDFWSF  423

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPL QAIFTFP+++MML KERSSGMY+LS++F+ART+GDLPMELVLPT+F +I+YWM GL
Sbjct  424   FPLLQAIFTFPQERMMLEKERSSGMYRLSAYFMARTIGDLPMELVLPTIFTVITYWMTGL  483

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+A NFFS L +IL  VLV QGLGLA+GA IMDQ+SAT LGSVI+L+F LAGG++V+HV
Sbjct  484   KPSALNFFSTLFSILYNVLVSQGLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQHV  543

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             P FISWIKYISI QYTYKLLL SQY  GETY C   +  CLVED P IK IG+G   I S
Sbjct  544   PWFISWIKYISISQYTYKLLLGSQYNHGETYSC-GINATCLVEDFPTIKTIGIGGKGI-S  601

Query  223   VVALLLMLIGYRLLAYVALMRVGRTK  146
             +VAL +M  GYR LAYVALMRVG TK
Sbjct  602   MVALAVMFFGYRFLAYVALMRVGVTK  627



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/626 (68%), Positives = 498/626 (80%), Gaps = 14/626 (2%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             Q N   +      IF   NRPVTLKFENVVYK+   ++           KS  EK ILKG
Sbjct  8     QQNQYTDHSKIEVIFNNINRPVTLKFENVVYKINLAKEGCFK----NSPKSNEEKRILKG  63

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVT  1643
             V+GIV PGE+LA+LGPSGSGKTTLLT LGGRL        ITYN KPF+NAM R+TGFVT
Sbjct  64    VSGIVSPGEMLAILGPSGSGKTTLLTGLGGRLVNGHLKGVITYNNKPFTNAMNRSTGFVT  123

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTV+ETLVFTALLRLP+T T +EK   A+A++TQLGLTKCK+ I+GG FLRG
Sbjct  124   QDDVLYPHLTVSETLVFTALLRLPKTFTVEEKTAHAEAIMTQLGLTKCKDIIVGGPFLRG  183

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTA RIVS+L +L+KGG+T+V+TIHQP
Sbjct  184   ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTALRIVSSLRDLAKGGKTVVLTIHQP  243

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD  1103
             SSRLFY+F KVLLL EGNPLYFG+G D M YFS +GFSP VAMNPSDFLLDL+NGI  DD
Sbjct  244   SSRLFYMFKKVLLLSEGNPLYFGRGEDAMGYFSGIGFSPLVAMNPSDFLLDLSNGILSDD  303

Query  1102  SQA-------DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWW  944
              +        D A++K+TLV+AFKTNL+EN+K +L E +   V+    +K+F +W+  WW
Sbjct  304   PRVLVDTPIEDPASIKKTLVTAFKTNLMENMKEQLQESDIHQVAEKLPEKKFTQWSNTWW  363

Query  943   EQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGF  764
             +QFSVL +RG+K+RK+ESFS LKVG+VLVVAFL G LWWKS ++QDQVGL+FF + FW F
Sbjct  364   QQFSVLFRRGMKERKHESFSSLKVGEVLVVAFLCGFLWWKSNNIQDQVGLMFFYTDFWSF  423

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPL QAIFTFP+++MML KERSSGMY+LS++F+ART+GDLPMELVLPT+F +I+YWM GL
Sbjct  424   FPLLQAIFTFPQERMMLEKERSSGMYRLSAYFIARTIGDLPMELVLPTIFTVITYWMTGL  483

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+A NFFS L  IL  VLV Q LGLA+GA IMDQ+SAT LGSVI+L+F LAGG++V+HV
Sbjct  484   KPSAFNFFSTLFTILYNVLVSQSLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQHV  543

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             P FISWIKYISI QYTYKLLL SQY  GETY C   +  CLVED P IK IGLG   I S
Sbjct  544   PWFISWIKYISISQYTYKLLLGSQYSRGETYSC-GINATCLVEDFPTIKSIGLGGKGI-S  601

Query  223   VVALLLMLIGYRLLAYVALMRVGRTK  146
             +VAL +M  GYRLLAYVALMRVG TK
Sbjct  602   MVALAVMFFGYRLLAYVALMRVGVTK  627



>ref|XP_008226675.1| PREDICTED: ABC transporter G family member 9 [Prunus mume]
Length=622

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/633 (67%), Positives = 501/633 (79%), Gaps = 21/633 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM D+E    Q Q N   ++  + AIFKKA RPVTLKFE+VVYK+KP           KK
Sbjct  4     EMVDLE---IQSQTNTTSDTVEAPAIFKKAIRPVTLKFEDVVYKIKP-----------KK  49

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
                  E++IL GV+G+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L G ITYN K FS
Sbjct  50    STKNEERVILNGVSGLVQPGEILAMLGPSGSGKTTLLTALGGRLGGRLGGAITYNNKSFS  109

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKRN GFVTQDD LYPHLTVTETLV+TALLRLP TL+K EK  QA+AVI QL LTKCK
Sbjct  110   NAMKRNIGFVTQDDFLYPHLTVTETLVYTALLRLPNTLSKAEKTMQAEAVIIQLELTKCK  169

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NS++G  FLRG+SGGER+RVSIGQE+L+NPSLLFLDEPTSGLDSTTAQRIVS LW+L+ G
Sbjct  170   NSVVGDEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQRIVSALWDLASG  229

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSR+FY+FHKV+LL EGN LYFGK S+VM YFS +G+ P VAMNP+DFL
Sbjct  230   GRTIVMTIHQPSSRIFYMFHKVMLLSEGNCLYFGKVSEVMDYFSGIGYVPLVAMNPADFL  289

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG+  D S  +++ VK++L  A+K N L+NLK E+ E N        ++K+F +W 
Sbjct  290   LDLANGLAPDGSHENKSKVKQSLALAYKHNRLDNLKAEIQETNSSHFQDGSEKKRFGKWP  349

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVLL+RGLK+R++ESFS LK+GQV+ VA L+G LWW+S  + LQDQ GLLFF+
Sbjct  350   TTWWQQFSVLLRRGLKERRHESFSSLKIGQVVAVALLSGLLWWQSDVSHLQDQTGLLFFM  409

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGFFPLFQAIFTFP+++ ML KERSSG Y+LSS+F++R V DLPMELVLP VFV I+
Sbjct  410   SGFWGFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTIT  469

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLKPTAG+FF  L  +LL VLV QG+GLA+GA +MDQK AT L SV+ML+FLLAGG
Sbjct  470   YWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGG  529

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-  245
             +YV+HVP+FI WIKYISI  Y+YKLLL S Y   +TYPC   SGVCLV + P IK +GL 
Sbjct  530   YYVQHVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCD--SGVCLVREFPNIKHVGLD  587

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             GQ  I   VAL  ML+GYRL+ Y+ALMR+G TK
Sbjct  588   GQ--ISGAVALATMLVGYRLIGYLALMRIGVTK  618



>ref|XP_010034170.1| PREDICTED: ABC transporter G family member 9 [Eucalyptus grandis]
Length=651

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/646 (64%), Positives = 509/646 (79%), Gaps = 21/646 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANP--------QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG  1880
             EM D+EA T +   +            + T++ IF +++ P+TLKF +VVYK+K  +   
Sbjct  8     EMADLEAQTRKADEDDGDVGLGRGSTTATTTSCIFSRSSNPITLKFHDVVYKIKIRRAAA  67

Query  1879  LSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs-gkttlltalggrlgghlagT  1703
               FL   K     EK+IL G+TG+V PGE+LAMLGPSGS   T L    G   GG L GT
Sbjct  68    GGFLG--KSTEAEEKVILNGLTGVVRPGEMLAMLGPSGSGKTTLLTALGGRLAGGRLGGT  125

Query  1702  ITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVI  1523
             ITYNGKPFSN++KR+TGFVTQDD++YPHLTVTETLVFTALLRL +  TK+EK+  A+ VI
Sbjct  126   ITYNGKPFSNSLKRSTGFVTQDDVMYPHLTVTETLVFTALLRLHKGYTKEEKVVHAEEVI  185

Query  1522  TQLGLTKCKNSIIGGV-FLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRI  1346
              QLGLTKCKN+IIGG  FLRG+SGGERKRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRI
Sbjct  186   AQLGLTKCKNNIIGGGGFLRGVSGGERKRVSIGQEMLVNPSLLFLDEPTSGLDSTTAQRI  245

Query  1345  VSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP  1166
             VS LWEL+KGGRT++MTIHQPSSRLFY+FHKVLLL EGN LYFG+G++VM YF+ +GF+P
Sbjct  246   VSKLWELAKGGRTVLMTIHQPSSRLFYMFHKVLLLSEGNSLYFGEGTNVMEYFAGIGFAP  305

Query  1165  SVAMNPSDFLLDLANGITGDDSQADQ---ATVKETLVSAFKTNLLENLKMELHELNDEDV  995
             SVAMNP+DFLLDLANGI  D    D+   +T+K+TL SA+KT+L + LK EL    D  +
Sbjct  306   SVAMNPADFLLDLANGIGIDPEDEDKESKSTIKQTLASAYKTHLEDGLKQELCATGDGFI  365

Query  994   SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--  821
                 + K   RW   WW+QF++LL+RG+K+RKY+SFSG+KVGQVLVVAF++G LWW+S  
Sbjct  366   EQGHEHKHSDRWPTTWWQQFTILLRRGVKERKYQSFSGIKVGQVLVVAFISGLLWWQSEA  425

Query  820   TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLP  641
             ++LQD++GLLFF S+FWGF+PLF AIFTFP+++MML KERSSGMY+LSS+F++R VGDLP
Sbjct  426   SNLQDKIGLLFFYSAFWGFYPLFNAIFTFPKERMMLEKERSSGMYRLSSYFMSRIVGDLP  485

Query  640   MELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTL  461
             MEL+LPTVFV I+YWMAG+KPTAGNF   L  +L  VLV QGLGLAIGA +MDQ+SAT L
Sbjct  486   MELILPTVFVAITYWMAGMKPTAGNFLYTLFVLLYSVLVAQGLGLAIGAVVMDQQSATIL  545

Query  460   GSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCL  281
             GSV+ML FLLAGG+YV++VP FI+WI+Y+SI  YTYKLL+ SQ++P +TYPC  G   CL
Sbjct  546   GSVLMLTFLLAGGYYVQNVPPFIAWIRYLSISHYTYKLLMTSQFRPDDTYPC-GGDSSCL  604

Query  280   VEDHPAIKKIGL-GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             V D+P IK++GL GQ V  S VAL +M + YRL+AYVALMR+G TK
Sbjct  605   VGDYPGIKEVGLDGQAV--SAVALGIMFVAYRLIAYVALMRIGMTK  648



>ref|XP_007214012.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
 gb|EMJ15211.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
Length=622

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/633 (67%), Positives = 500/633 (79%), Gaps = 21/633 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM D+E    Q Q N   ++  + AIFKKA RPVTLKFE+VVYK+KP           KK
Sbjct  4     EMVDLE---IQSQTNTTSDTVEAPAIFKKAIRPVTLKFEDVVYKIKP-----------KK  49

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
                  E++IL GV+G+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L G ITYN K FS
Sbjct  50    SIKNEERVILNGVSGLVQPGEILAMLGPSGSGKTTLLTALGGRLGGRLGGAITYNNKLFS  109

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKRN GFVTQDD LYPHLTVTETLV+TALLRLP TL+K EK  QA+AVI QL LTKCK
Sbjct  110   NAMKRNIGFVTQDDFLYPHLTVTETLVYTALLRLPNTLSKAEKTMQAEAVIIQLELTKCK  169

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NS++G  FLRG+SGGER+RVSIGQE+L+NPSLLFLDEPTSGLDSTTAQRIVS LW+L+ G
Sbjct  170   NSVVGDEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQRIVSALWDLASG  229

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+FHKV+LL EGN LYFGK S+VM YFS +G+ P VAMNP+DFL
Sbjct  230   GRTIVMTIHQPSSRLFYMFHKVMLLSEGNCLYFGKVSEVMDYFSGIGYVPLVAMNPADFL  289

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG+  D S  +++ VK++L  A+K N L+NLK E+ E N        + K F +W 
Sbjct  290   LDLANGLAPDGSHENKSKVKQSLALAYKHNRLDNLKAEIQETNSSHFQDGSENKSFGKWP  349

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVLL+RGLK+R++ESFSGLK+GQV+ VA L+G LWW+S  + LQDQ GLLFF+
Sbjct  350   TTWWQQFSVLLRRGLKERRHESFSGLKIGQVVAVALLSGLLWWQSDVSHLQDQTGLLFFM  409

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGFFPLFQAIFTFP+++ ML KERSSG Y+LSS+F++R V DLPMELVLP VFV I+
Sbjct  410   SGFWGFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTIT  469

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLKPTAG+FF  L  +LL VLV QG+GLA+GA +MDQK AT L SV+ML+FLLAGG
Sbjct  470   YWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGG  529

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-  245
             +YV+HVP+FI WIKYISI  Y+YKLLL S Y   +TYPC   SGVCLV + P IK +GL 
Sbjct  530   YYVQHVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCD--SGVCLVREFPNIKHVGLD  587

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             GQ  I   VAL  ML+GYRL+ Y+ALMR+G TK
Sbjct  588   GQ--ISGAVALATMLVGYRLIGYLALMRIGVTK  618



>ref|XP_002316916.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE97528.1| ABC transporter family protein [Populus trichocarpa]
Length=619

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/632 (68%), Positives = 510/632 (81%), Gaps = 19/632 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DIEA           E    + IFKKA R V+L+FE+VVYKV+   K G      K 
Sbjct  4     EMADIEALNE--------EEPGVSTIFKKATRAVSLRFEDVVYKVRL-TKAGFC---GKI  51

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K+E EK+ILKG+TG V PGE+LAM GPSGSGKTTLLTALGG+LGG L G I+YNGK FS
Sbjct  52    VKAE-EKVILKGITGKVLPGEMLAMFGPSGSGKTTLLTALGGKLGGLLDGNISYNGKNFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N+MKRN GFVTQDD+LYPHLTVTETLVFTALLRL  T +K+EKI  A++VITQLGLTKCK
Sbjct  111   NSMKRNMGFVTQDDVLYPHLTVTETLVFTALLRLENTFSKEEKIMHAESVITQLGLTKCK  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NSIIGG F+RG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVS LWEL+KG
Sbjct  171   NSIIGGPFMRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSNLWELAKG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+F KVLLL EG+PLYFG+GS VM YFS+ G++P+V MNP+DFL
Sbjct  231   GRTIVMTIHQPSSRLFYMFDKVLLLSEGSPLYFGEGSQVMDYFSSNGYAPAVPMNPADFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG++ +       +VK+ LVSA+K+NL   LK E+ +++D+      DQK   RWA
Sbjct  291   LDLANGVSSNSEVP--GSVKQNLVSAYKSNLASKLKSEVQDIDDQPQDGLNDQK-VARWA  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVLL+RG+K+RK++SFSGLK+ QVLVVAFL+G LWW+S  + LQDQ+GLLFF 
Sbjct  348   TTWWQQFSVLLRRGVKERKHDSFSGLKIAQVLVVAFLSGLLWWQSDVSHLQDQMGLLFFY  407

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGFFPLFQAIFTFP+++ ML KERSSGMY+LSS+F++R V DLPMELVLPT+FV I+
Sbjct  408   SGFWGFFPLFQAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSIT  467

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLK T GNF   L  +L  VLV  GLGLA+GA +++QKSAT +GSVIML+FLLAGG
Sbjct  468   YWMAGLKGTPGNFLHTLFVLLYSVLVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGG  527

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV HVP+FISW+KYISI QYTYKLLL SQ+KP +TYPC    GVCLV D+PAIK++GL 
Sbjct  528   YYVTHVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCLVGDYPAIKQVGLD  587

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               V+ + V L +ML+ YRL+A+ ALMR+G TK
Sbjct  588   GQVLGAAV-LGIMLVVYRLIAFFALMRIGVTK  618



>ref|XP_011029437.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/632 (67%), Positives = 509/632 (81%), Gaps = 19/632 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DIEA   +       ES  S  IFKKA R V+L+FE+VVYKV+   K G      K 
Sbjct  4     EMADIEALNEE-------ESGVST-IFKKATRAVSLRFEDVVYKVRL-AKAGFC---GKI  51

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K+E EK+ILKG+TG V PGE+LAM GPSGSGKTTLLTALGG+LGG L G I+YNGK FS
Sbjct  52    VKAE-EKVILKGITGKVLPGEMLAMFGPSGSGKTTLLTALGGKLGGLLDGNISYNGKNFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N+MKRN GFVTQDD+LYPHLTVTETLVFTALLRL  T +K+EKI  A++VITQLGLTKCK
Sbjct  111   NSMKRNMGFVTQDDVLYPHLTVTETLVFTALLRLENTFSKEEKIMHAESVITQLGLTKCK  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NSIIGG F+RG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVS LWEL+KG
Sbjct  171   NSIIGGPFMRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSNLWELAKG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRLFY+F KVLLL EG+PLYFG+GS VM YFS+ G++P+V MNP+DFL
Sbjct  231   GRTIVMTIHQPSSRLFYMFDKVLLLSEGSPLYFGEGSQVMDYFSSNGYAPAVPMNPADFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG++ +    D   VK+ LVSA+K+NL   LK E+ +++ +      DQK   RWA
Sbjct  291   LDLANGVSSNSE--DPGLVKQNLVSAYKSNLANKLKSEVQDIDGQPQDGLNDQK-VARWA  347

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QFSVLL+RG+K+RK++SFSGLK+ QVLVVAFL+G LWW+S  + LQDQ+GLLFF 
Sbjct  348   TTWWQQFSVLLRRGVKERKHDSFSGLKIAQVLVVAFLSGLLWWQSDVSHLQDQMGLLFFY  407

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGFFPLF+AIFTFP+++ ML KERSSGMY+LSS+F++R V DLPMELVLPT+FV I+
Sbjct  408   SGFWGFFPLFEAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSIT  467

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLK T  NF   L  +L  V+V  GLGLA+GA +++QKSAT +GSVIML+FLLAGG
Sbjct  468   YWMAGLKGTPRNFLHTLFVLLYSVVVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGG  527

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV HVP+FISW+KYISI QYTYKLLL SQ+KP +TYPC    GVC + D+PAIK++GL 
Sbjct  528   YYVTHVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCFIGDYPAIKQVGLD  587

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               V+   VAL +ML+ YRL+A+ ALMR+G TK
Sbjct  588   GQVL-GAVALGIMLVVYRLIAFFALMRIGVTK  618



>gb|KHG01243.1| ABC transporter G family member 9 [Gossypium arboreum]
Length=629

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/636 (66%), Positives = 502/636 (79%), Gaps = 19/636 (3%)
 Frame = -3

Query  2035  EMGDIEA----PTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFL  1868
             E+ DIEA    P  Q +AN         AIFK  N+ V LKF +VVY +K  +K G  F 
Sbjct  3     EVSDIEAAETRPEDQFKAN---------AIFKVTNQQVVLKFIDVVYTIKL-RKVGKLF-  51

Query  1867  KTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNG  1688
               K   S+  K+IL G+ G+V PGE+LAMLGPSGSGKTTLLTALGGRLGGHL GTITYNG
Sbjct  52    -EKNPSSDDNKVILNGIRGMVQPGEMLAMLGPSGSGKTTLLTALGGRLGGHLNGTITYNG  110

Query  1687  KPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGL  1508
             KPFSN+MKR TGFVTQDD+LYPHLTVTETL+FTALLRLP + TKQ+KI  A+AVI QLGL
Sbjct  111   KPFSNSMKRKTGFVTQDDVLYPHLTVTETLIFTALLRLPNSFTKQDKIMHAEAVIDQLGL  170

Query  1507  TKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE  1328
             TKCKNSIIG  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTL E
Sbjct  171   TKCKNSIIGEPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLLE  230

Query  1327  LSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNP  1148
             L++GGRT+V+TIHQPSSR+FY+FHKVLLLC+GNPLYFG+GS  M YFS++G+ PSVAMNP
Sbjct  231   LTEGGRTVVLTIHQPSSRIFYMFHKVLLLCDGNPLYFGQGSATMDYFSSIGYVPSVAMNP  290

Query  1147  SDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQF  968
             SDFLLDLANG + ++S  +Q  VK+TL+ A+   + + LK EL ++++E      + K+ 
Sbjct  291   SDFLLDLANGDSPNESMKEQTLVKKTLIGAYGMKIADKLKEELQDMSNEPAPDELENKKL  350

Query  967   KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGL  794
               W   WW+QF VLL+RG+K+RK+ESFSGL + +VL+VA L+G LWWK   + LQDQ+GL
Sbjct  351   AMWPTTWWQQFIVLLRRGVKERKHESFSGLNIAEVLIVAVLSGLLWWKIDISHLQDQIGL  410

Query  793   LFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVF  614
             LFF S FWGF+PLFQAIFTFP ++MML KERSSG Y+LSS+F++R   DLPMEL+LPTVF
Sbjct  411   LFFTSGFWGFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVF  470

Query  613   VIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFL  434
             + I+YWMAGLKPTA NFF  L  +L  VLV QGLGLA+GA +MD KSAT LGSVIML F 
Sbjct  471   LTITYWMAGLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFF  530

Query  433   LAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKK  254
             LAGG+Y++HVP FI+WIKY+SI  +TYKLLL SQYKP ETYPC   S  CL+ D   IK 
Sbjct  531   LAGGYYIQHVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHSKTCLIGDFQGIKS  590

Query  253   IGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             +GL   V+ S VAL +ML+ YRL+AY+ALMR+G TK
Sbjct  591   VGLNGQVV-SAVALAIMLVMYRLIAYLALMRIGVTK  625



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/628 (67%), Positives = 496/628 (79%), Gaps = 33/628 (5%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRP--VTLKFENVVYKVKPDQKQGLSFLKTK  1859
             M DI+A    + AN   E      IF KA     V LKFE V YK K   K GL     +
Sbjct  1     MVDIKAQPESITAN--PEPPPPPPIFTKAXNSGHVILKFEEVDYKAK-THKGGL----LR  53

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPF  1679
             K     EK ILKG+TGIV PGE+LAMLGPSGSGKTTLLTALGGRLGG L G+ITYNGKPF
Sbjct  54    KDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLLTALGGRLGGRLNGSITYNGKPF  113

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             SN MKR+TGFVTQDD+LYPHLTVTETLVFTALLRLP T++K++K+  A+AVITQLGLTKC
Sbjct  114   SNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNTISKEDKVRHAEAVITQLGLTKC  173

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             K+SIIG  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+K
Sbjct  174   KDSIIGNPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELAK  233

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+VMTIHQPSSRLFY+FHKVLLL EGNPLYFGKG++ M YFS++GF+PSVAMNPSDF
Sbjct  234   GGRTVVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMNPSDF  293

Query  1138  LLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             LLDLANG+  DD   D  T+K+TLV ++++ + E LK EL E+ D  +    + KQ  RW
Sbjct  294   LLDLANGVLSDDIHEDPTTIKQTLVLSYRSKIDEGLKAELREI-DNHLQDGLEDKQLDRW  352

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFIS  779
             A  WW+Q SVL +RG+K+R++ESFSGLK+G                     Q+GLLFF S
Sbjct  353   ATTWWQQCSVLFRRGVKERRHESFSGLKIG---------------------QIGLLFFCS  391

Query  778   SFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISY  599
              FWGFFPLFQAIFTFP+++MML KERSSGMY+LSS+F++RT+GDLPMELVLPT+FVII+Y
Sbjct  392   GFWGFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVIITY  451

Query  598   WMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGF  419
             WMAGLKP A NF   L A+L  VLV Q LGLA+GA +MDQKSAT LGSVIML+FLLAGG+
Sbjct  452   WMAGLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAGGY  511

Query  418   YVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQ  239
             YV++VP FI+WIKY+SI  YTYKLLL SQYKPG+ YPC++ +  CLV D PA++ +GL +
Sbjct  512   YVQNVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKT-TCLVGDFPAVQLVGLDK  570

Query  238   HVIFSVVALLLMLIGYRLLAYVALMRVG  155
               I + VAL +ML+GYRL+AY+ALMR+G
Sbjct  571   Q-ILAAVALAIMLVGYRLIAYIALMRIG  597



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9-like [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/628 (65%), Positives = 508/628 (81%), Gaps = 10/628 (2%)
 Frame = -3

Query  2005  QLQANPQLESDT-SAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
              L++N +   D  S AIFKKA RPVTLKFE+V Y +K  +  G+S+L+ K + S++EK I
Sbjct  7     DLESNRRTNIDEESPAIFKKAIRPVTLKFEDVAYTIKA-ETDGMSWLRKKDKNSDSEKHI  65

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             L G++G+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L+G+ITYN KPFSN MKRNTGF
Sbjct  66    LNGISGVVKPGEILAMLGPSGSGKTTLLTALGGRLGGKLSGSITYNNKPFSNTMKRNTGF  125

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             VTQDD LYPHLTV ETLVFTALLRLP TLTK EK  +A+AVITQL LTKC+NSIIG   L
Sbjct  126   VTQDDFLYPHLTVAETLVFTALLRLPNTLTKAEKTHEAEAVITQLELTKCRNSIIGDELL  185

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RG+SGGER+RVSIGQE+LINPSL+FLDEPTSGLDSTTAQRIV  L EL+ G RTIVMTIH
Sbjct  186   RGVSGGERRRVSIGQELLINPSLMFLDEPTSGLDSTTAQRIVKALSELAIGERTIVMTIH  245

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITG  1109
             QPSSRLFY+FHKV+LL EGN LYFG  SDVM YFS +G++P VAMNP+DFLLDLANG+T 
Sbjct  246   QPSSRLFYMFHKVMLLSEGNALYFGHVSDVMKYFSGIGYAPLVAMNPADFLLDLANGLTP  305

Query  1108  DDSQADQATVKETLVSAFKTNLLENLKMELHEL------NDEDVSSAGDQKQFKRWAIPW  947
             D+S  +++ +K++L  A++ NL + LK EL E       N++   ++ + K+F++W   W
Sbjct  306   DESNDNKSELKQSLALAYRENLEDKLKAELKETSGVDCNNNQSEEASSEDKKFRKWPTTW  365

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQVGLLFFISSFWG  767
             W+QF+VL +RG+K+RK++SFSGL++GQV+ VA L G LWW+S+ LQDQ+GLLFF+S FWG
Sbjct  366   WQQFTVLFRRGVKERKHDSFSGLRIGQVVAVALLCGLLWWQSSSLQDQIGLLFFMSGFWG  425

Query  766   FFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAG  587
             FFPLFQAIFTFP ++ ML KER+SG Y+LSS+F++R +GDLPMELVLPT+F+ I YWMAG
Sbjct  426   FFPLFQAIFTFPPERKMLEKERTSGTYRLSSYFMSRIIGDLPMELVLPTLFITIVYWMAG  485

Query  586   LKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRH  407
              K TAGNFF  L  +LL VLV QG+GLA+GA +MD +SAT LGSV+ML+FLLAGG+YV+H
Sbjct  486   FKTTAGNFFHTLFVLLLLVLVAQGMGLALGAVVMDLQSATVLGSVLMLSFLLAGGYYVQH  545

Query  406   VPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSG-VCLVEDHPAIKKIGLGQHVI  230
             VP FISWIKYISI  + YKLL+ SQYK  +T+PC + +  +CLV D P IK IGL   V 
Sbjct  546   VPRFISWIKYISISNHAYKLLIGSQYKGSDTFPCVNDANRLCLVRDFPNIKTIGLDGQV-  604

Query  229   FSVVALLLMLIGYRLLAYVALMRVGRTK  146
              ++VAL +ML+ YRL+AY+ALMR+G TK
Sbjct  605   NALVALAIMLVFYRLIAYIALMRIGVTK  632



>ref|XP_010520902.1| PREDICTED: ABC transporter G family member 9-like [Tarenaya hassleriana]
Length=620

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/633 (66%), Positives = 505/633 (80%), Gaps = 27/633 (4%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             D+EA     Q   +   + S +IF+  N PVTLKF+NVVYK+KP + +G   ++TK Q+ 
Sbjct  7     DVEA-----QIENKNGGNDSFSIFENVNLPVTLKFDNVVYKIKPKKPRGWFQIETKAQE-  60

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNA  1670
               EK ILKG+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL        ITYN KPFS  
Sbjct  61    --EKTILKGLTGVVKPGEMLAMLGPSGSGKTTLLTALGGRLSIGKLTGEITYNDKPFSKG  118

Query  1669  MKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNS  1490
             +KR+TGFVTQDD+LYP           ALLRLP ++T+QEK++QA+AV+TQLGL +CKNS
Sbjct  119   VKRSTGFVTQDDVLYP-----------ALLRLPNSMTRQEKVKQAEAVVTQLGLARCKNS  167

Query  1489  IIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGR  1310
             IIGG+FLRGISGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVS LWEL++GGR
Sbjct  168   IIGGMFLRGISGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSVLWELAQGGR  227

Query  1309  TIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLD  1130
             T+VMTIHQPSSRLFY+F K+LLL EGNPLY+G+GS+VM YF++VG+SPS+AMNPSDFLLD
Sbjct  228   TVVMTIHQPSSRLFYMFDKILLLSEGNPLYYGRGSNVMDYFASVGYSPSLAMNPSDFLLD  287

Query  1129  LANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDE-DVSSAGDQ-KQFKRWA  956
             +ANG+  D+S   Q  +KE LV A+KTNL++NL+ E+ E  D+ + S + D+ K    W 
Sbjct  288   IANGVASDESMK-QDDIKEALVGAYKTNLVDNLQAEIREHGDQVNSSDSRDRNKNVGDWP  346

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW+QF VLL+RGLK+R+++SFSGLKVGQ+LVVAFL G LWWKS  + LQDQ+GLLFF 
Sbjct  347   TTWWQQFCVLLERGLKERRHDSFSGLKVGQILVVAFLCGLLWWKSDISHLQDQIGLLFFA  406

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             SSFWGFFPLFQAIFTFP+++ ML KERSSGMYKLSS+F++R V DLPMELVLPT+FV+I+
Sbjct  407   SSFWGFFPLFQAIFTFPQERRMLEKERSSGMYKLSSYFMSRVVVDLPMELVLPTIFVVIT  466

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGL P   NFF  L  +L  VLV  GLGLA+GA +MD KSATTLGSVIMLAFLLAGG
Sbjct  467   YWMAGLNPNPRNFFLTLFGLLFNVLVSGGLGLALGAVVMDLKSATTLGSVIMLAFLLAGG  526

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHPAIKKIGL  245
             +YV+HVP F+SWIKYISIG Y YKLL+ +QYK  +TYPC   G  VC V D  AIK IGL
Sbjct  527   YYVQHVPPFVSWIKYISIGNYAYKLLVLAQYKADDTYPCGADGRSVCYVGDFGAIKNIGL  586

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                 + SV+AL LML+GYRL+AYVALMRVG+ K
Sbjct  587   DGEAM-SVLALFLMLVGYRLIAYVALMRVGKAK  618



>ref|XP_006359002.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=629

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/638 (64%), Positives = 492/638 (77%), Gaps = 21/638 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM +IE+P         +    S  IF   NRP+TLKFENV YK+K  ++  L       
Sbjct  4     EMENIESPL-------HIHHSKSEVIFDNTNRPITLKFENVAYKIKLVKEGCLK----NS  52

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPF  1679
              KSE EKIILK V+GIV+PGE+LA+LGPSG GKTTLLT LGGRL        ITYN  PF
Sbjct  53    SKSEEEKIILKDVSGIVYPGEMLAILGPSGCGKTTLLTGLGGRLVKGHLDGVITYNNNPF  112

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             S++MKR+ GFVTQDD+LYPHLTV ETLVFTALLRLP+T + +EK    DA+I QLGLTKC
Sbjct  113   SSSMKRSIGFVTQDDVLYPHLTVYETLVFTALLRLPKTYSVEEKTAHCDAIIPQLGLTKC  172

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             K+SIIG   LRGISGGERKRVSIGQEMLINPSLL LDEPTSGLDSTTA RIVSTL +L+ 
Sbjct  173   KDSIIGDSLLRGISGGERKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRIVSTLKDLAN  232

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+ MTIHQPSSRLFY+F KVLLL EGNPLYFG+G D M YFS +GF P VAMNPSDF
Sbjct  233   GGRTVAMTIHQPSSRLFYMFDKVLLLSEGNPLYFGRGKDAMGYFSGIGFPPLVAMNPSDF  292

Query  1138  LLDLANGITGDDSQA-------DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD  980
             LLDL++GI  DD +        D A++K+TLV+AFKTNL +NL  +L E  D   +    
Sbjct  293   LLDLSSGILSDDPRVLSDAPREDPASIKQTLVTAFKTNLAKNLNEQLQESIDHQATEKLP  352

Query  979   QKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQV  800
             +K+F +W+  WW+QFSVLL+RG+K+RK+ES S LKVG+VLV++F +G LWWKS ++QDQ 
Sbjct  353   EKKFSQWSNTWWQQFSVLLRRGMKERKHESLSNLKVGEVLVMSFFSGLLWWKSNNIQDQT  412

Query  799   GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPT  620
             GLLFF +SFW F+ +FQ IFTFP+++MML KERSSGMY+LS++F+A TVGDLPMELVLPT
Sbjct  413   GLLFFYTSFWEFYSVFQGIFTFPQERMMLEKERSSGMYRLSAYFMAMTVGDLPMELVLPT  472

Query  619   VFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLA  440
             +  +I+YWMAGLKP+AG FFS L ++L  VLV Q LGLAIGA +MD+KSAT L  VI+++
Sbjct  473   ISTVITYWMAGLKPSAGRFFSTLFSLLYNVLVSQSLGLAIGAMVMDEKSATVLALVILIS  532

Query  439   FLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAI  260
             F LAGGFYV+HVP FI+WIK++SI QY YKLLL SQY PGETY C   +  CLVED P+I
Sbjct  533   FTLAGGFYVQHVPRFIAWIKHVSITQYAYKLLLGSQYSPGETYSC-GLNATCLVEDSPSI  591

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             K IGLG   I S+VAL +ML G+R LAYVALMR+G TK
Sbjct  592   KTIGLGGKGI-SIVALAVMLFGFRFLAYVALMRIGVTK  628



>gb|EYU26406.1| hypothetical protein MIMGU_mgv1a004006mg [Erythranthe guttata]
Length=549

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/551 (73%), Positives = 465/551 (84%), Gaps = 5/551 (1%)
 Frame = -3

Query  1792  VLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLT  1613
             +LAMLGPSGSGKTTLLTALGGRLGG L G+ITYNGKPFSNAMKRNTGFVTQDD+LYPHLT
Sbjct  1     MLAMLGPSGSGKTTLLTALGGRLGGRLGGSITYNGKPFSNAMKRNTGFVTQDDVLYPHLT  60

Query  1612  VTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVS  1433
             VTETLV+TALLRLP+TLTKQEK   A+AVI QLGL++C+NSIIG  FLRG+SGGERKRVS
Sbjct  61    VTETLVYTALLRLPKTLTKQEKSRHAEAVIEQLGLSRCRNSIIGDHFLRGVSGGERKRVS  120

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEMLINPSLLFLDEPTSGLDSTTAQ+IVSTLWEL+ GGRT+VMTIHQPSSRL+Y+FHK
Sbjct  121   IGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELANGGRTVVMTIHQPSSRLYYMFHK  180

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKE  1073
             VLLL EGNPL+FGKG D + YF++VGF+PSVAMNP+DFLLDLANG++  DS  DQ  VK+
Sbjct  181   VLLLSEGNPLFFGKGCDALDYFASVGFAPSVAMNPADFLLDLANGVSTADSHEDQTAVKQ  240

Query  1072  TLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYE  893
             TLVSA+K NL E++K EL   N+  +    D KQF RW+  WW+QFSVL +RG+K+RK+E
Sbjct  241   TLVSAYKANLSESVKSELA--NEIQIHLPTDSKQFGRWSNTWWDQFSVLFRRGIKERKHE  298

Query  892   SFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKM  719
             SFS LK+ QVLVVA L+G LWW+S  + LQDQVGL FF + FWGF+PLFQAIFTFP++++
Sbjct  299   SFSALKIIQVLVVAILSGLLWWQSDISHLQDQVGLFFFANGFWGFYPLFQAIFTFPQERL  358

Query  718   MLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIl  539
             ML KERSSGMY+LSS+F+A T+GDLPMELVLPTVF  I+YWMAGLKP AG FFS L  +L
Sbjct  359   MLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFTITYWMAGLKPAAGPFFSGLFVLL  418

Query  538   lcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQY  359
               VL  QGLGLAIGA +MD K+AT LGSVIML FLLA G+YV+HVP FI WIKY+SI QY
Sbjct  419   YSVLCAQGLGLAIGAAVMDMKAATVLGSVIMLTFLLASGYYVQHVPVFIGWIKYLSISQY  478

Query  358   TYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLA  179
              +KLLL +QY  GETYPC  G   CLVED PA+K +GL   V+ S VAL LM++GYRL+A
Sbjct  479   AFKLLLGTQYSVGETYPCGGGGRRCLVEDFPAVKAVGLDGQVV-SAVALALMIVGYRLIA  537

Query  178   YVALMRVGRTK  146
             YVALMR+G  K
Sbjct  538   YVALMRIGVIK  548



>emb|CBI20349.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/579 (71%), Positives = 476/579 (82%), Gaps = 15/579 (3%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRP--VTLKFENVVYKVKPDQKQGLSFLKTK  1859
             M DI+A    + ANP+        IF KA     V LKFE V YK K   K GL     +
Sbjct  1     MVDIKAQPESITANPE-----PPPIFTKAKNSGHVILKFEEVDYKAK-THKGGL----LR  50

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPF  1679
             K     EK ILKG+TGIV PGE+LAMLGPSGSGKTTLLTALGGRLGG L G+ITYNGKPF
Sbjct  51    KDSKPEEKHILKGITGIVLPGEMLAMLGPSGSGKTTLLTALGGRLGGRLNGSITYNGKPF  110

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             SN MKR+TGFVTQDD+LYPHLTVTETLVFTALLRLP T++K++K+  A+AVITQLGLTKC
Sbjct  111   SNRMKRSTGFVTQDDVLYPHLTVTETLVFTALLRLPNTISKEDKVRHAEAVITQLGLTKC  170

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             K+SIIG  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+K
Sbjct  171   KDSIIGNPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELAK  230

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+VMTIHQPSSRLFY+FHKVLLL EGNPLYFGKG++ M YFS++GF+PSVAMNPSDF
Sbjct  231   GGRTVVMTIHQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMNPSDF  290

Query  1138  LLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             LLDLANG+  DD   D  T+K+TLV ++++ + E LK EL E+ D  +    + KQ  RW
Sbjct  291   LLDLANGVLSDDIHEDPTTIKQTLVLSYRSKIDEGLKAELREI-DNHLQDGLEDKQLDRW  349

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFF  785
             A  WW+Q SVL +RG+K+R++ESFSGLK+GQVLVV FL+G LWW+  S+ LQDQ+GLLFF
Sbjct  350   ATTWWQQCSVLFRRGVKERRHESFSGLKIGQVLVVGFLSGLLWWQSDSSHLQDQIGLLFF  409

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGFFPLFQAIFTFP+++MML KERSSGMY+LSS+F++RT+GDLPMELVLPT+FVII
Sbjct  410   CSGFWGFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVII  469

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWMAGLKP A NF   L A+L  VLV Q LGLA+GA +MDQKSAT LGSVIML+FLLAG
Sbjct  470   TYWMAGLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAG  529

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             G+YV++VP FI+WIKY+SI  YTYKLLL SQYKPG+ YP
Sbjct  530   GYYVQNVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYP  568



>ref|XP_008386302.1| PREDICTED: ABC transporter G family member 9-like [Malus domestica]
Length=622

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/623 (66%), Positives = 495/623 (79%), Gaps = 21/623 (3%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             QA+ + +S+T   IFK A RPVT+KFE+VVYK+K            KK     EK+IL  
Sbjct  12    QADRRPDSET-PGIFKNAIRPVTVKFEDVVYKIK-----------AKKSTKSEEKVILNS  59

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQ  1640
             V G+V PGE+LAMLGPSGSGKTTLL+ALGGRLGG L G+ITYN K F+N MKRNTGFVTQ
Sbjct  60    VNGLVQPGEILAMLGPSGSGKTTLLSALGGRLGGRLGGSITYNNKTFTNTMKRNTGFVTQ  119

Query  1639  DDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGI  1460
             DD LYPHLTVTETLVFTALLRLP TL+K++K+ QA+AVITQL LTKCKNS +G  F+RGI
Sbjct  120   DDFLYPHLTVTETLVFTALLRLPNTLSKRDKVMQANAVITQLELTKCKNSAVGDQFMRGI  179

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPS  1280
             SGGER+RVSIGQE+L+NPSLLFLDEPTSGLDSTTAQRIVS LW+L+ GGRTIVMTIHQPS
Sbjct  180   SGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQRIVSALWDLASGGRTIVMTIHQPS  239

Query  1279  SRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS  1100
             SRLFYLFHKV+LL EGN LYFGK S+VM YFS +G+ P +AMNP+DFLLDLANG+  D S
Sbjct  240   SRLFYLFHKVMLLSEGNCLYFGKASEVMDYFSGIGYVPLIAMNPADFLLDLANGLAPDGS  299

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD--QKQFKRWAIPWWEQFSVL  926
               +++ VK+ L  A+K NLL+ LK EL E N+      G    K+F +W   WW+QFSVL
Sbjct  300   VDNKSKVKQNLALAYKNNLLDRLKTELQETNNSSQFQDGSAQNKKFGKWPTTWWQQFSVL  359

Query  925   LKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLF  752
             L+RG+K+R +E+FSGLK+GQVL VA L G LWW+S    LQDQ+GLLFF+S FWGFFPLF
Sbjct  360   LRRGMKERXHEAFSGLKIGQVLAVALLVGLLWWQSDIAHLQDQIGLLFFMSGFWGFFPLF  419

Query  751   QAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTA  572
             QAIFTFP ++ ML KER SG Y+LSS+F++R V DLPMELVLPT+FV I+YWMAGLKP+A
Sbjct  420   QAIFTFPPERKMLEKERXSGTYRLSSYFMSRIVADLPMELVLPTLFVTITYWMAGLKPSA  479

Query  571   GNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFI  392
              NFF  L A+LL VLV QG+GLA+GA +MDQK AT L SVIML+FLLAGG+YV+HVP+FI
Sbjct  480   ANFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQHVPAFI  539

Query  391   SWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-GQHVIFSVVA  215
             SWIKYIS+  Y+Y+LLL SQYK  ETYPC     VC V + P IK  GL GQ    +VVA
Sbjct  540   SWIKYISLSNYSYRLLLGSQYKKSETYPCD--GRVCSVGEFPTIKSAGLDGQSS--AVVA  595

Query  214   LLLMLIGYRLLAYVALMRVGRTK  146
             L++M++GYR ++Y+ALMR+G TK
Sbjct  596   LVIMVMGYRFISYLALMRIGITK  618



>ref|XP_007021331.1| White-brown-complex ABC transporter family [Theobroma cacao]
 gb|EOY12856.1| White-brown-complex ABC transporter family [Theobroma cacao]
Length=626

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/630 (68%), Positives = 509/630 (81%), Gaps = 16/630 (3%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             DIEA   Q +A   LE+    AIF+  N+PV L+F +V Y +K   KQG  F   +K   
Sbjct  6     DIEA---QRKAEDHLEA---TAIFENTNQPVILEFVDVAYTIKLG-KQGNFF---RKNSG  55

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
               EK+IL G+TG V PGE+LAMLGPSGSGKTTLLTALGGRLGG L GTITYNGKPFSNA 
Sbjct  56    SEEKVILNGITGTVHPGEMLAMLGPSGSGKTTLLTALGGRLGGLLNGTITYNGKPFSNAT  115

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
             KRNTGFVTQDD+LYPHLTV+ETLVFTALLRLP T  ++EKI  A+AVITQLGLTKCK+SI
Sbjct  116   KRNTGFVTQDDVLYPHLTVSETLVFTALLRLPNTFGEEEKIMHAEAVITQLGLTKCKHSI  175

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG  LRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQR+VSTL E++KGGRT
Sbjct  176   IGGPLLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRMVSTLLEVAKGGRT  235

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDL  1127
             +V+TIHQPSSRLFY+FHKVLLL EGNPLY+G+GS  M YFS++G++P VAMNPSDFLLDL
Sbjct  236   VVLTIHQPSSRLFYMFHKVLLLSEGNPLYYGQGSAAMDYFSSIGYAPLVAMNPSDFLLDL  295

Query  1126  ANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPW  947
             ANG++ ++S+ +Q  VK+ L++A+K+N+ E LK EL E+         + K+F RWA  W
Sbjct  296   ANGVSSNESREEQTVVKKALIAAYKSNIAEKLKDELQEVRHRPPDQL-ENKKFVRWATTW  354

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSF  773
              +QF+VLL+RG+K+RK+ESFSGL + QVLVVA L G +WW+S    LQDQ+GLLFF S F
Sbjct  355   RQQFTVLLQRGVKERKHESFSGLNIAQVLVVAVLVGLMWWQSDIVLLQDQIGLLFFSSGF  414

Query  772   WGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWM  593
             WGFFPLFQAIFTFP+++MML KERSSGMY+LSS+F++RT+ DLPMEL+LPT FV I+YWM
Sbjct  415   WGFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIADLPMELILPTAFVTITYWM  474

Query  592   AGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYV  413
             AGLKPTAGNF   L A+L CVLV Q LGLA+GA +M+ KSAT LGSV++L FLLAGGFY+
Sbjct  475   AGLKPTAGNFLHTLFALLFCVLVSQSLGLALGALVMELKSATILGSVVILTFLLAGGFYI  534

Query  412   RHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-GQH  236
             +HVP FISWIKYISI  +TYKL+L SQYKP ETYPC     VCLV D P IK + L GQ 
Sbjct  535   QHVPPFISWIKYISISHHTYKLVLGSQYKPNETYPCDDPGKVCLVGDFPTIKNMNLDGQ-  593

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              + S VAL +ML+ YR++AY+ALMR+G TK
Sbjct  594   -LLSAVALAIMLVVYRMIAYLALMRIGVTK  622



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/604 (67%), Positives = 496/604 (82%), Gaps = 11/604 (2%)
 Frame = -3

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             +T++F++VVYK+K  +K GL     KK     EK ILKGVTGIV PGE+LAMLGPSGSGK
Sbjct  1     MTMQFDDVVYKIKA-KKGGL----FKKNIEVEEKTILKGVTGIVQPGEMLAMLGPSGSGK  55

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTLLTALGGRLGG L G+ITYN KPFSN +KRNTGFVTQDD+LYPHLTVTETLVFTALLR
Sbjct  56    TTLLTALGGRLGGKLYGSITYNEKPFSNVIKRNTGFVTQDDVLYPHLTVTETLVFTALLR  115

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLL  1397
             LP ++TK+EK+  A  VI QLGLTKCK+SI+G  +LRG+SGGERKRVSIGQE+LINPSLL
Sbjct  116   LPNSVTKEEKVTHAKNVIDQLGLTKCKDSIVGSAYLRGVSGGERKRVSIGQELLINPSLL  175

Query  1396  FLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYF  1217
             FLDEPTSGLDSTTAQRIVSTLW+L++GGRTIVMTIHQPSSRL+Y+FHKVLLL EGN LYF
Sbjct  176   FLDEPTSGLDSTTAQRIVSTLWDLARGGRTIVMTIHQPSSRLYYMFHKVLLLAEGNVLYF  235

Query  1216  GKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLE  1037
             GKGS+ + +F+ +G++P++AMNPSDFLLDLANGI  DD+  D    K+ L+SAFK N  E
Sbjct  236   GKGSEAIEHFTNIGYAPAMAMNPSDFLLDLANGIYTDDTNHDHTIDKQKLISAFKNNYDE  295

Query  1036  NLKMELHELNDEDVSSAGDQKQFK-RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVL  860
               K E  E+ND D S    Q+    +W   W EQF VLL+R +K+RKYESFSGL++ QVL
Sbjct  296   QSKPEHREINDSDTSQGRFQETGSGKWPTSWSEQFFVLLRRDVKERKYESFSGLRIAQVL  355

Query  859   VVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
             VVA ++G LW+KS  + LQDQ+GLLFF++ FWGFFPLFQAIFTFP++ MML KERSSGMY
Sbjct  356   VVALMSGLLWYKSDMSHLQDQIGLLFFVTGFWGFFPLFQAIFTFPQELMMLEKERSSGMY  415

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
             +LS++F++R V DLPMELVLPT+F++I+Y+MAGLK T  NFF  L ++LL VLV QGLGL
Sbjct  416   RLSAYFISRMVADLPMELVLPTIFLLITYFMAGLKATVINFFQTLFSLLLNVLVSQGLGL  475

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
             A+GA ++DQKSATTL SVIML FLLAGGFYV++VP FI W+KY+S+  YTY+L + SQY 
Sbjct  476   ALGAVVLDQKSATTLASVIMLCFLLAGGFYVQNVPKFIVWVKYVSVSYYTYQLFIGSQYH  535

Query  325   PGETYPCTSGSGVCLVEDHPAIKKIGLGQHVI-FSVVALLLMLIGYRLLAYVALMRVGRT  149
              G+TYPC+SG   CL+++ P IK+IG+  + + F+ +AL++MLIGYRL+AY ALMR+G T
Sbjct  536   SGDTYPCSSGQ--CLIDEFPPIKQIGIDLNGLGFAALALVIMLIGYRLIAYCALMRIGVT  593

Query  148   K*LS  137
             K L+
Sbjct  594   KKLA  597



>ref|XP_009378509.1| PREDICTED: ABC transporter G family member 9 [Pyrus x bretschneideri]
Length=622

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/623 (66%), Positives = 495/623 (79%), Gaps = 21/623 (3%)
 Frame = -3

Query  1999  QANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKG  1820
             Q + + +S+T   IFK A RPVT+KFE+VVYK+K            KK     EK+IL  
Sbjct  12    QTDRRPDSET-PGIFKNAIRPVTVKFEDVVYKIK-----------AKKGTKSEEKVILNS  59

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQ  1640
             V G+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L G+ITYN K F+N MKRNTGFVTQ
Sbjct  60    VNGLVQPGEILAMLGPSGSGKTTLLTALGGRLGGRLGGSITYNNKTFTNIMKRNTGFVTQ  119

Query  1639  DDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGI  1460
             DD LYPHLTVTETLVFTALLRLP TL K++K+ QA+AVITQL LTKCKNS +G  F+RGI
Sbjct  120   DDFLYPHLTVTETLVFTALLRLPNTLPKRDKVMQANAVITQLELTKCKNSAVGDQFMRGI  179

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPS  1280
             SGGER+RVSIGQE+L+NPSLLFLDEPTSGLDSTTAQRIVS LW+L+ GGRTIVMTIHQPS
Sbjct  180   SGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQRIVSALWDLASGGRTIVMTIHQPS  239

Query  1279  SRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS  1100
             SRLFYLFHKV+LL EGN LYFGK S+VM YFS + + P +AMNP+DFLLDLANG+  D S
Sbjct  240   SRLFYLFHKVMLLSEGNCLYFGKASEVMDYFSGISYVPVIAMNPADFLLDLANGLAPDGS  299

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD--QKQFKRWAIPWWEQFSVL  926
               +++ VK+ L  A+K NLL+ LK EL E N+      G    K+F +W   WW+QFSVL
Sbjct  300   VYNKSKVKQNLALAYKNNLLDRLKTELQETNNSSQFQDGSVQDKKFGKWPTTWWQQFSVL  359

Query  925   LKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLF  752
             L+RG+K+R++E+FSGLK+GQVL VA L G LWW+S    LQDQ+GLLFF+S FWGFFPLF
Sbjct  360   LRRGMKERRHEAFSGLKIGQVLAVALLVGLLWWQSDIVHLQDQIGLLFFMSGFWGFFPLF  419

Query  751   QAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTA  572
             QAIFTFP ++ ML KER+SG Y+LSS+F++R V DLP+ELVLPT+FV I+YWMAGLKP+A
Sbjct  420   QAIFTFPPERKMLEKERASGTYRLSSYFMSRIVADLPIELVLPTLFVTITYWMAGLKPSA  479

Query  571   GNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFI  392
             GNFF  L A+LL VLV QG+GLA+GA +MDQK AT L SVIML+FLLAGG+YV+HVP+FI
Sbjct  480   GNFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQHVPAFI  539

Query  391   SWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-GQHVIFSVVA  215
             SWIKYIS+  Y+Y+LLL SQYK  ETYPC     VC V D P IK  GL GQ    +VVA
Sbjct  540   SWIKYISLSNYSYRLLLGSQYKKSETYPCD--GRVCSVGDFPTIKSAGLDGQSS--AVVA  595

Query  214   LLLMLIGYRLLAYVALMRVGRTK  146
             L++M++GYR ++Y+ALMR+G TK
Sbjct  596   LVIMVVGYRFISYLALMRIGVTK  618



>ref|XP_008237669.1| PREDICTED: ABC transporter G family member 9-like [Prunus mume]
Length=614

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/635 (64%), Positives = 495/635 (78%), Gaps = 33/635 (5%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DIE  T          +  + AIFK+A RPVTLKFE+V+YK+K +         TK 
Sbjct  4     EMLDIEIQT----------ATEAPAIFKEAIRPVTLKFEDVIYKIKQNNS-------TKN  46

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
             +    EK+IL G++G+V PGE+LAMLGPSGSGKTTLLTAL GRLGG L+G ITYN KPFS
Sbjct  47    E----EKVILNGISGLVQPGEILAMLGPSGSGKTTLLTALAGRLGGRLSGAITYNNKPFS  102

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKRNTGFVTQDD LYPHLTV ETL +TAL+RLP TL+K +K  QA+AVI QL L+KCK
Sbjct  103   NAMKRNTGFVTQDDFLYPHLTVIETLFYTALIRLPNTLSKAKKAMQAEAVIMQLELSKCK  162

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NS++GG FLRG+SGGER+RVSIGQE+L+NPSLLFLDEPTSGLDSTTAQ+IVS LW+L+ G
Sbjct  163   NSVVGGEFLRGVSGGERRRVSIGQELLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASG  222

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSR+FY+FHKV+LL EGN LYFGK S+VM YFS +G+ P VAMNP+DFL
Sbjct  223   GRTIVMTIHQPSSRIFYMFHKVVLLSEGNCLYFGKVSEVMDYFSGIGYVPLVAMNPADFL  282

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKM-----ELHELNDEDVSSAGDQKQ  971
             LDLANG+  D S  +++ VK++L  A+K N L NLK      +L E N        + K 
Sbjct  283   LDLANGLAPDGSHENKSKVKQSLSLAYKHNRLYNLKAQLQREQLQETNSSHFQDGSEDKN  342

Query  970   FKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVG  797
             F +W   WW+QFSVLL+RGLK+R++ESFSG ++ QV+ VA L G LWW+S  ++LQD+ G
Sbjct  343   FAKWPTTWWQQFSVLLRRGLKERRHESFSGSQINQVVAVALLAGLLWWQSNISNLQDRTG  402

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFF+S FWGFFPL QAIFTFP+++MML KERSSG Y LSS+F++R V DLPMEL LPT+
Sbjct  403   LLFFMSEFWGFFPLLQAIFTFPQERMMLEKERSSGTYMLSSYFISRIVADLPMELALPTL  462

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             FV I+YWMAGLKPTAG+FF  L  +LL VLV QG+GLA+GA +MDQK A  L SV+M++F
Sbjct  463   FVTITYWMAGLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSF  522

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIK  257
              LAGGF+V+HVP+FI+WIKYISI  Y+YKLLL SQY   +TY C   SG+CLV D P+IK
Sbjct  523   QLAGGFFVQHVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCD--SGLCLVRDFPSIK  580

Query  256   KIGL-GQHVIFSVVALLLMLIGYRLLAYVALMRVG  155
              +GL GQ  I + VAL +ML+GYRL+AY+ALMR G
Sbjct  581   HVGLSGQ--IGAAVALAIMLVGYRLIAYIALMRTG  613



>ref|XP_011095241.1| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Sesamum indicum]
Length=654

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/636 (63%), Positives = 500/636 (79%), Gaps = 13/636 (2%)
 Frame = -3

Query  2029  GDIEAPTTQLQANPQLE-SDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             G +E  T+ +  + + +  D + AIFKKA   VTLKF +VVYKV   Q + L      K 
Sbjct  27    GAVEGKTSAVMVDVEAQIQDENHAIFKKAKSRVTLKFADVVYKVTIGQSKKL----LNKN  82

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFS  1676
              +  EK++LKG+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL     G  ITYNGKPFS
Sbjct  83    TNSEEKLVLKGITGVVRPGEMLAMLGPSGSGKTTLLTALGGRLVSGHLGGAITYNGKPFS  142

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
               MKRNTGFVTQDD+LYPHLTVTETLV+TALLRLPRTLTK++K+++ADAVI +LGL+KC+
Sbjct  143   TTMKRNTGFVTQDDVLYPHLTVTETLVYTALLRLPRTLTKEQKVQKADAVINELGLSKCR  202

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG FLRG+SGGERKRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRIV TL EL++G
Sbjct  203   DSIIGGPFLRGVSGGERKRVSIGQEMLMNPSLLFLDEPTSGLDSTTAQRIVHTLRELAEG  262

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT++MTIHQPSSRLFY+FHKVLLL +GNPLYFGK S  M YFS +GFSPSV MNP+DFL
Sbjct  263   GRTVLMTIHQPSSRLFYMFHKVLLLSDGNPLYFGKCSSAMDYFSNIGFSPSVPMNPADFL  322

Query  1135  LDLANGITGDDSQA-DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             LDLANG++ D  Q  DQ  +K+TLVSA+KTNL E++K +L + N+ +  S  DQKQ KRW
Sbjct  323   LDLANGVSMDGFQELDQTGIKQTLVSAYKTNLSESVKSDLADDNEYNEWSLDDQKQLKRW  382

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
             +  WW QFSVL  RGLK+RK+E+F+ +KV QVL V  ++G LWW S  + LQDQVG   F
Sbjct  383   SNTWWGQFSVLFIRGLKERKHETFNVMKVLQVLSVGIMSGLLWWHSDMSHLQDQVGFFNF  442

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              + FW +FP F+AIFT P+++MML KERSSGMY+LSSFF+A T+GDLPM+LVLPT++  +
Sbjct  443   SAGFWSYFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTL  502

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWMAGLKP  G F +     L  V+  QGLGLAIGA +MD K+AT LG++I L F LAG
Sbjct  503   TYWMAGLKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAG  562

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G++V+++P+F+ W+KY+S+ ++T+KLLL SQY+PGETYPC      CLVED P IK IG 
Sbjct  563   GYFVQNIPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNK-TCLVEDFPPIKAIG-  620

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK*LS  137
             GQ    S++A+ +M +GYRL+AY+ALMR+G T+ L+
Sbjct  621   GQAA--SIIAMAIMFVGYRLIAYLALMRIGATRKLN  654



>emb|CDX92829.1| BnaC07g40870D [Brassica napus]
Length=644

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/640 (65%), Positives = 501/640 (78%), Gaps = 19/640 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             E+ DIEA   Q++ N   +     +IFKKAN P+TLKFENVVY VK   K+  S+L   K
Sbjct  12    EVIDIEA---QIENNND-DQTLPFSIFKKANLPITLKFENVVYTVK--VKEPKSWLGQTK  65

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlgghlagTITYNGK  1685
              K+E +K ILKGV GIV PGE+LAMLGPSGSGKT+LLTA         G L G I+YN K
Sbjct  66    GKTE-DKTILKGVNGIVKPGEILAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNISYNNK  124

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS  +KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQ+KI+QA+AV+T+LGL 
Sbjct  125   PFSKGVKRATGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQDKIKQAEAVVTELGLD  184

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +CKN+IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVS LWEL
Sbjct  185   RCKNTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSVLWEL  244

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNP  1148
             ++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++VG+SPSV  +NP
Sbjct  245   ARGGRTVVTTIHQPSSRLFYMFDKILLLSEGNPIYFGLGSNAMDYFASVGYSPSVERVNP  304

Query  1147  SDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQ  977
             SDFLLD+ANGI  D+SQ  +A +K  LV+ +KTNLL+N+  +L   +D   + V S GD 
Sbjct  305   SDFLLDIANGIGSDESQRPEA-LKTALVAVYKTNLLDNVINDLKGHDDHYNQSVESLGDS  363

Query  976   KQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQ  803
             K+F  W   WW+QF VL KRGLKQR+++SFSGLK+GQVL V+ L G LWWK+    LQDQ
Sbjct  364   KRFGDWPTTWWQQFCVLSKRGLKQRRHDSFSGLKIGQVLFVSLLCGLLWWKTDLAHLQDQ  423

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             +GLLFF+SSFW FFPLFQ IFTFP+++ ML KERSSGMY+LSS+F++R VGDLPMEL+LP
Sbjct  424   LGLLFFMSSFWAFFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILP  483

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T+F+II+YWMAGL P   NFF  L  +LL VLV  GLGLA+GA +MDQK+ATTLGSVIML
Sbjct  484   TIFLIITYWMAGLNPKPVNFFLTLLTLLLHVLVSGGLGLALGALVMDQKTATTLGSVIML  543

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHP  266
              FLLAGGFYVR+VP FISWIKY+SIG YTYKL++  QY   E YPC  +G   C V D  
Sbjct  544   TFLLAGGFYVRNVPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKMKCYVGDFE  603

Query  265   AIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              IK IG    ++ S  AL LML+GYR++AY+ALMR+G+TK
Sbjct  604   GIKHIGFHGGLV-SAFALALMLVGYRVVAYIALMRIGKTK  642



>ref|XP_011095242.1| PREDICTED: ABC transporter G family member 9-like isoform X2 
[Sesamum indicum]
Length=618

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/636 (63%), Positives = 499/636 (78%), Gaps = 22/636 (3%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M D+EA   Q+Q       D + AIFKKA   VTLKF +VVYKV   Q + L      K 
Sbjct  1     MVDVEA---QIQ-------DENHAIFKKAKSRVTLKFADVVYKVTIGQSKKL----LNKN  46

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFS  1676
              +  EK++LKG+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL     G  ITYNGKPFS
Sbjct  47    TNSEEKLVLKGITGVVRPGEMLAMLGPSGSGKTTLLTALGGRLVSGHLGGAITYNGKPFS  106

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
               MKRNTGFVTQDD+LYPHLTVTETLV+TALLRLPRTLTK++K+++ADAVI +LGL+KC+
Sbjct  107   TTMKRNTGFVTQDDVLYPHLTVTETLVYTALLRLPRTLTKEQKVQKADAVINELGLSKCR  166

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG FLRG+SGGERKRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRIV TL EL++G
Sbjct  167   DSIIGGPFLRGVSGGERKRVSIGQEMLMNPSLLFLDEPTSGLDSTTAQRIVHTLRELAEG  226

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT++MTIHQPSSRLFY+FHKVLLL +GNPLYFGK S  M YFS +GFSPSV MNP+DFL
Sbjct  227   GRTVLMTIHQPSSRLFYMFHKVLLLSDGNPLYFGKCSSAMDYFSNIGFSPSVPMNPADFL  286

Query  1135  LDLANGITGDDSQA-DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             LDLANG++ D  Q  DQ  +K+TLVSA+KTNL E++K +L + N+ +  S  DQKQ KRW
Sbjct  287   LDLANGVSMDGFQELDQTGIKQTLVSAYKTNLSESVKSDLADDNEYNEWSLDDQKQLKRW  346

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
             +  WW QFSVL  RGLK+RK+E+F+ +KV QVL V  ++G LWW S  + LQDQVG   F
Sbjct  347   SNTWWGQFSVLFIRGLKERKHETFNVMKVLQVLSVGIMSGLLWWHSDMSHLQDQVGFFNF  406

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              + FW +FP F+AIFT P+++MML KERSSGMY+LSSFF+A T+GDLPM+LVLPT++  +
Sbjct  407   SAGFWSYFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTL  466

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWMAGLKP  G F +     L  V+  QGLGLAIGA +MD K+AT LG++I L F LAG
Sbjct  467   TYWMAGLKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAG  526

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G++V+++P+F+ W+KY+S+ ++T+KLLL SQY+PGETYPC      CLVED P IK IG 
Sbjct  527   GYFVQNIPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNK-TCLVEDFPPIKAIG-  584

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK*LS  137
             GQ    S++A+ +M +GYRL+AY+ALMR+G T+ L+
Sbjct  585   GQAA--SIIAMAIMFVGYRLIAYLALMRIGATRKLN  618



>emb|CDY29837.1| BnaA03g48580D [Brassica napus]
Length=644

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/640 (65%), Positives = 500/640 (78%), Gaps = 19/640 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             E+ DIEA   Q++ N   +     ++FKKAN P+TLKFENVVY VK  + +  S+L   K
Sbjct  12    EVVDIEA---QIENNND-DQTLPFSVFKKANLPITLKFENVVYTVKVKEPK--SWLGQTK  65

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlgghlagTITYNGK  1685
              K+E +K ILKGV GIV P E+LAMLGPSGSGKT+LLTA         G L G ITYN K
Sbjct  66    GKTE-DKTILKGVNGIVKPREILAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNITYNNK  124

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS  +KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQ+KI+QA+AV+T+LGL 
Sbjct  125   PFSKGVKRATGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQDKIKQAEAVVTELGLD  184

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +CKN+IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVS LWEL
Sbjct  185   RCKNTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSVLWEL  244

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNP  1148
             ++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++VG+SPSV  +NP
Sbjct  245   ARGGRTVVTTIHQPSSRLFYMFDKILLLSEGNPIYFGLGSNAMDYFASVGYSPSVERVNP  304

Query  1147  SDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQ  977
             SDFLLD+ANGI  D+SQ  +A +K  LV+ +KTNLL N+  +L   +D   + V S GD 
Sbjct  305   SDFLLDIANGIGSDESQRPEA-LKTALVAVYKTNLLGNVINDLKGQDDQYNQSVESLGDS  363

Query  976   KQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQ  803
             K+F  W   WW+QF VL KRGLKQR+++SFSGLK+GQVL V+FL G LWWK+    LQDQ
Sbjct  364   KRFGDWPTTWWQQFCVLSKRGLKQRRHDSFSGLKIGQVLFVSFLCGLLWWKTDLAHLQDQ  423

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             +GLLFF+SSFW FFPLFQ IFTFP+++ ML KERSSGMY+LSS+F++R VGDLPMEL+LP
Sbjct  424   LGLLFFMSSFWAFFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILP  483

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T+F+II+YWMAGL P   NFF  L  +LL VLV  GLGLA+GA +MDQK+ATTLGSVIML
Sbjct  484   TIFLIITYWMAGLNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIML  543

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHP  266
              FLLAGGFYVR+VP FISWIKY+SIG YTYKL++  QY   E YPC  +G   C V D  
Sbjct  544   TFLLAGGFYVRNVPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFE  603

Query  265   AIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              IK IG    ++ S  AL LML+GYR++AY+ALMR+G+TK
Sbjct  604   GIKHIGFHGGLV-SAFALALMLVGYRVVAYIALMRIGKTK  642



>ref|XP_009137658.1| PREDICTED: ABC transporter G family member 9-like [Brassica rapa]
Length=644

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/640 (65%), Positives = 499/640 (78%), Gaps = 19/640 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             E+ DIEA   Q++ N   +     ++FKKAN P+TLKFENVVY VK  + +  S+L   K
Sbjct  12    EVVDIEA---QIENNND-DQTLPFSVFKKANLPITLKFENVVYTVKVKEPK--SWLGQTK  65

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlgghlagTITYNGK  1685
              K+E +K ILKGV GIV P E+LAMLGPSGSGKT+LLTA         G L G ITYN K
Sbjct  66    GKTE-DKTILKGVNGIVKPREILAMLGPSGSGKTSLLTALGGRVSEGKGKLTGNITYNNK  124

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS  +KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQ+KI+QA+AV+T+LGL 
Sbjct  125   PFSKGVKRATGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQDKIKQAEAVVTELGLD  184

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +CKN+IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVS LWEL
Sbjct  185   RCKNTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQRIVSVLWEL  244

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNP  1148
             ++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++VG+SPSV  +NP
Sbjct  245   ARGGRTVVTTIHQPSSRLFYMFDKILLLSEGNPIYFGLGSNAMDYFASVGYSPSVERVNP  304

Query  1147  SDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQ  977
             SDFLLD+ANGI  D+SQ  +A +K  LV+ +KTNLL N+  +L   +D   + V S GD 
Sbjct  305   SDFLLDIANGIGSDESQRPEA-LKTALVAVYKTNLLGNVINDLKGQDDQYNQSVESLGDS  363

Query  976   KQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQ  803
             K+F  W   WW+QF VL KRGLKQR+++SFSGLK+GQVL V+FL G LWWK+    LQDQ
Sbjct  364   KRFGDWPTTWWQQFCVLSKRGLKQRRHDSFSGLKIGQVLFVSFLCGLLWWKTDLAHLQDQ  423

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             +GLLFF+SSFW FFPLFQ IFTFP+ + ML KERSSGMY+LSS+F++R VGDLPMEL+LP
Sbjct  424   LGLLFFMSSFWAFFPLFQQIFTFPQQRKMLEKERSSGMYRLSSYFMSRVVGDLPMELILP  483

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T+F+II+YWMAGL P   NFF  L  +LL VLV  GLGLA+GA +MDQK+ATTLGSVIML
Sbjct  484   TIFLIITYWMAGLNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIML  543

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHP  266
              FLLAGGFYVR+VP FISWIKY+SIG YTYKL++  QY   E YPC  +G   C V D  
Sbjct  544   TFLLAGGFYVRNVPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFE  603

Query  265   AIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              IK IG    ++ S  AL LML+GYR++AY+ALMR+G+TK
Sbjct  604   GIKHIGFHGGLV-SAFALALMLVGYRVVAYIALMRIGKTK  642



>ref|XP_007199008.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
 gb|EMJ00207.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
Length=614

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/610 (66%), Positives = 484/610 (79%), Gaps = 23/610 (4%)
 Frame = -3

Query  1960  IFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAM  1781
             IFK+A RPVTLKFE+VVYK+K +         TK +    EK+IL GV+G+V PGE+LAM
Sbjct  19    IFKEAIRPVTLKFEDVVYKIKQNNS-------TKNE----EKVILNGVSGLVQPGEILAM  67

Query  1780  LGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTET  1601
             LGPSGSGKTTL+TALGGRLGG L+G ITYN KPFSNAMKRNTGFVTQDD LYPHLTV ET
Sbjct  68    LGPSGSGKTTLITALGGRLGGRLSGAITYNKKPFSNAMKRNTGFVTQDDFLYPHLTVIET  127

Query  1600  LVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQE  1421
             L +TALLRLP TL+K +K  QA+AVI QL LTKCKNS++GG FLRG+SGGER+RVSIGQE
Sbjct  128   LFYTALLRLPNTLSKAKKAMQAEAVIIQLELTKCKNSVVGGEFLRGVSGGERRRVSIGQE  187

Query  1420  MLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLL  1241
             +L+NPSLLFLDEPTSGLDSTTAQ+IVS LW+L+ GGRTIVMTIHQPSSR+FY+FHKV+LL
Sbjct  188   LLVNPSLLFLDEPTSGLDSTTAQQIVSALWDLASGGRTIVMTIHQPSSRIFYMFHKVVLL  247

Query  1240  CEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKETLVS  1061
              EGN LYFGK S+VM YFS +G+ P VAMNP+DFLLDLANG+  D S  +++ VK++L  
Sbjct  248   SEGNCLYFGKVSEVMDYFSGIGYIPLVAMNPADFLLDLANGLAPDGSHENKSKVKQSLTL  307

Query  1060  AFKTNLLENLKM-----ELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKY  896
             A+K N L NLK      +L E N        + K F +W   WW+QFSVLL+RGLK+R++
Sbjct  308   AYKHNRLYNLKAQLQGEQLQETNSSHFQDGSEDKNFAKWPTTWWQQFSVLLRRGLKERRH  367

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ESFSG ++ QV+ VA L G LWW+S  + LQD+ GLLFF+S FWGFFPL QAIFTFP+++
Sbjct  368   ESFSGSQINQVVAVALLAGLLWWQSNISHLQDRTGLLFFMSEFWGFFPLLQAIFTFPQER  427

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSG Y LSS+F++R V DLPMEL LPT+FV I+YWMAGLKPTAG+FF  L  +
Sbjct  428   KMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMAGLKPTAGHFFHTLLVL  487

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             LL VLV QG+GLA+GA +MDQK A  L SV+M++F LAGGF+V+HVP+FI+WIKYISI  
Sbjct  488   LLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQHVPAFIAWIKYISIIN  547

Query  361   YTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-GQHVIFSVVALLLMLIGYRL  185
             Y+YKLLL SQY   +TY C   SGVCLV D P+IK +GL GQ  I + VAL +ML+G RL
Sbjct  548   YSYKLLLGSQYNENDTYLCD--SGVCLVRDFPSIKHVGLSGQ--IGAAVALAIMLVGCRL  603

Query  184   LAYVALMRVG  155
             +AY+ALMR G
Sbjct  604   IAYLALMRTG  613



>ref|XP_004252106.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=1013

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/660 (62%), Positives = 499/660 (76%), Gaps = 18/660 (3%)
 Frame = -3

Query  2089  SFPSSSDQQEATLMETATEMG---DIEAPTTQ-LQANPQLESDTSAAIFKKANRPVTLKF  1922
             + P S    +  ++ET   MG   ++E    + ++ +  ++   S  IF   NRP+TLKF
Sbjct  359   AVPLSKGLGKDLVVETCNGMGININMEQEIMENIENHIHIDHSKSEVIFDNTNRPITLKF  418

Query  1921  ENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllt  1742
             ENV YK+K  ++  L        KSE +KIILKGV+GIV PGE+LA+LGPSG GKTTLLT
Sbjct  419   ENVAYKIKLVKEGCLK----NSSKSEEDKIILKGVSGIVSPGEMLAILGPSGCGKTTLLT  474

Query  1741  alggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
              LGGRL        ITYN  PFS++MKR+ GFVTQDD+LYPHLTV ETLVFTALLRLP+T
Sbjct  475   GLGGRLVNGHLDGAITYNNNPFSSSMKRSIGFVTQDDVLYPHLTVYETLVFTALLRLPKT  534

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
              + +EKI  ADA+I QLGLTKCK+SIIG   LRGISGGERKRVSIGQEMLINPSLL LDE
Sbjct  535   YSIEEKIAHADAIIPQLGLTKCKDSIIGDSLLRGISGGERKRVSIGQEMLINPSLLLLDE  594

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDSTTA RIVSTL  L+ G RT+ MTIHQPSSRL+Y+F KVLLL EGNPLYFG+G 
Sbjct  595   PTSGLDSTTALRIVSTLKGLANGVRTVAMTIHQPSSRLYYMFDKVLLLSEGNPLYFGRGE  654

Query  1204  DVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA-------DQATVKETLVSAFKTN  1046
             D M YFS +GF P VAMNPSDFLLDL++GI  DD +        D A++K+TLV AFKTN
Sbjct  655   DAMGYFSGIGFPPLVAMNPSDFLLDLSSGILSDDPRVLSDAPKEDPASIKKTLVLAFKTN  714

Query  1045  LLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQ  866
             L ENL  +L E  D+  +     K+F +WA  WW+QF+VLL+RG+K+RK+ESFS LKV +
Sbjct  715   LAENLNEQLQESIDQQATEKLPDKKFSQWANTWWQQFTVLLRRGMKERKHESFSTLKVTE  774

Query  865   VLVVAFLTGALWWKSTDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
             VLV++F  G LWWKS ++QDQ GLLFF +SFW F+ +FQ IFTFP+++MML KERSSGMY
Sbjct  775   VLVMSFFAGLLWWKSNNIQDQTGLLFFYTSFWEFYSVFQGIFTFPQERMMLEKERSSGMY  834

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
             +LS++F+A TVGDLPMELVLPT+  +I+YWMAGLKP+A  FFS L ++L  VLV Q LGL
Sbjct  835   RLSAYFVAMTVGDLPMELVLPTISTLITYWMAGLKPSAWRFFSTLFSLLYNVLVSQSLGL  894

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
             AIGA +MD++SAT    VI+++F LAGGFYV HVP FI+WIK++SI QY YKLLL SQY 
Sbjct  895   AIGAMVMDEQSATVFALVILISFTLAGGFYVHHVPKFIAWIKHVSITQYAYKLLLGSQYS  954

Query  325   PGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             PGETY C   +  CLVED P+IK IGLG  VI S+VAL +ML+GYR LAY+AL R+G TK
Sbjct  955   PGETYSC-GINATCLVEDFPSIKTIGLGGKVI-SIVALAIMLLGYRFLAYIALKRIGVTK  1012



>ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=627

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/637 (65%), Positives = 497/637 (78%), Gaps = 25/637 (4%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM DIE+ T ++             I  K  R V LKF+NVVYK+K   K+G  F+K K+
Sbjct  8     EMVDIESQTVEI-----------PDILHKGKRQVILKFDNVVYKIKT--KKGGVFVKNKE  54

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              +   EK ILKGV G+V PGE+LAMLGPSGSGKTTLLTALGGRL G L G+ITYNG+ FS
Sbjct  55    TE---EKEILKGVKGVVEPGEMLAMLGPSGSGKTTLLTALGGRLRGKLYGSITYNGEAFS  111

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N+MKRNTGFVTQDD+LYPHLTVTETLVFTALLRLP T++K+EK+++A  VI QLGLTKCK
Sbjct  112   NSMKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNTISKEEKVKKAKDVIDQLGLTKCK  171

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SI+G  FLRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+ G
Sbjct  172   DSIVGSPFLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELACG  231

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRL+YLFHKVLLL EGN LYFGKGS+ + YFS +G++P++AMNP+DFL
Sbjct  232   GRTIVMTIHQPSSRLYYLFHKVLLLSEGNSLYFGKGSEAIEYFSNIGYAPALAMNPADFL  291

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLK-MELHELNDEDVSSAG-DQKQFKR  962
             LDLANGI  D+S  D A  K+ LVS  K N    LK   L  +ND   S     +K  ++
Sbjct  292   LDLANGIYTDESNTDHAIDKQKLVSMCKINCAAQLKPAALEGINDSSKSQNRFQEKGSEK  351

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLF  788
             W   W +QF+VLL+R +K+R++ESFS L+V QV VVA ++G LW+KS  + LQDQ+GLLF
Sbjct  352   WPTSWSQQFTVLLRRDIKERRHESFSALRVAQVFVVALISGLLWYKSDISHLQDQIGLLF  411

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             F+S FWGFFPLFQAIFTFP++ +ML KERSSGMY+LSS+F++R V DLPMEL LPT+F++
Sbjct  412   FVSGFWGFFPLFQAIFTFPQELLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFIL  471

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I+YWMAGLK    NF   L  +LL VLV QGLGLA+GA +MDQK+ATTL SV+ML FLLA
Sbjct  472   ITYWMAGLKGKLLNFLYTLLTLLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLA  531

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
             GGFYV+HVP FISW+KYISI  Y Y+L + SQY  GETYPC++G   C V + P+IK+ G
Sbjct  532   GGFYVQHVPVFISWVKYISINYYNYQLFIASQYSDGETYPCSTGQ--CRVAEFPSIKQTG  589

Query  247   LG---QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                  Q  + +  AL++M+IGYRL+AYVALMR+G TK
Sbjct  590   FHFNLQEQVMAASALVIMMIGYRLIAYVALMRIGVTK  626



>ref|XP_010675645.1| PREDICTED: ABC transporter G family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=636

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/632 (64%), Positives = 501/632 (79%), Gaps = 16/632 (3%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQK  1850
             D+EA     Q     ESD    I KKA  PV LKF++VVYKVK P Q++   F K     
Sbjct  2     DLEA-----QQKKTSESDL-PKIQKKAKHPVILKFKDVVYKVKFPSQRK--KFFKQTTSS  53

Query  1849  SEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNA  1670
                E++IL  ++G+V+PGE+LAMLGPSGSGKTTLLTALGGRLGG+L G+ITY+GKPFSN 
Sbjct  54    PVRERVILNSISGVVYPGEMLAMLGPSGSGKTTLLTALGGRLGGNLKGSITYDGKPFSNQ  113

Query  1669  MKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNS  1490
             MKRNTGFVTQDD+L+ HLTVTETLV+TALLRLP T TK++KI  A+ VI Q+GLT+CKNS
Sbjct  114   MKRNTGFVTQDDVLHAHLTVTETLVYTALLRLPNTFTKEQKIGVAEEVIVQMGLTRCKNS  173

Query  1489  IIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGR  1310
             IIGG  LRG+SGGERKRVSI QEMLI+PSLLFLDEPTSGLDSTTAQRIVS LWEL++GGR
Sbjct  174   IIGGPLLRGVSGGERKRVSIAQEMLIDPSLLFLDEPTSGLDSTTAQRIVSVLWELAQGGR  233

Query  1309  TIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLD  1130
             T+VMTIHQPSSRLFY+FHKVLLL EGN LYFG GS VM YF +VG+ PSV MNP+DFLLD
Sbjct  234   TVVMTIHQPSSRLFYMFHKVLLLSEGNSLYFGSGSHVMDYFESVGYVPSVPMNPADFLLD  293

Query  1129  LANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD-QKQFKRWAI  953
             LANG++ D+S+ D  TVKE L+ A+K N+   +K +L E  +E+     +   + ++W  
Sbjct  294   LANGVSPDESE-DIVTVKEKLIVAYKNNIANEVKADLQEEENEEADHRNEANTEIEKWPT  352

Query  952   PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFIS  779
              WW+Q++VLLKRGL++RK+ESF+ LK+ QVL+VAF+ G LWW+S  T LQDQVGLL+F +
Sbjct  353   TWWQQYTVLLKRGLRERKHESFNILKIAQVLIVAFIVGLLWWQSKITHLQDQVGLLYFST  412

Query  778   SFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISY  599
              FWGFFPLF AIF FP ++M+L KERSSGMY+LSS+F AR V DLP+EL+LPTV+VII+Y
Sbjct  413   GFWGFFPLFDAIFAFPPERMVLAKERSSGMYRLSSYFFARMVSDLPVELILPTVYVIITY  472

Query  598   WMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGF  419
             +M GLK  A +F   L ++LL ++V QGLGLA+GA +MD K+ATTLGSV+ML FLLAGGF
Sbjct  473   FMGGLKRNAASFLYYLFSLLLSIMVSQGLGLALGALVMDLKAATTLGSVLMLTFLLAGGF  532

Query  418   YVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-G  242
             YV+++P+FI WIKY+SI  Y +KLLL SQ+KPG+TYPC   + VCLVED P+I+ +G+ G
Sbjct  533   YVQNIPAFIKWIKYLSILNYNFKLLLGSQFKPGDTYPCDGDTKVCLVEDFPSIRSVGIRG  592

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             Q V  S + L++M +GYRL+AY AL R+G T+
Sbjct  593   QFV--SAIVLVIMFVGYRLIAYFALTRIGVTR  622



>ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9-like [Cicer arietinum]
Length=630

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/639 (66%), Positives = 506/639 (79%), Gaps = 18/639 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             +M DIE  T   +    LE +  A I     RPV LKF++VVYK+K + K GL     KK
Sbjct  4     DMEDIECQTIYKET---LEEEPPADILHNRKRPVILKFDDVVYKIKAN-KGGL----FKK  55

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
              K   EK+ILKGVTGIV PGE+LAMLGPSGSGKTTLLTALGGRLGG L G ITYNGK FS
Sbjct  56    NKKVEEKVILKGVTGIVKPGEMLAMLGPSGSGKTTLLTALGGRLGGKLYGNITYNGKTFS  115

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N +KRNTGFVTQDD+LYPHLTVTETLVFTALLRLP ++TK EK+  A  VI QLGLTKCK
Sbjct  116   NVIKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNSVTKDEKVLHAKNVIDQLGLTKCK  175

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SI+G  +LRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQRIVSTLW+L+ G
Sbjct  176   DSIVGSAYLRGVSGGERKRVSIGQELLINPSLLFLDEPTSGLDSTTAQRIVSTLWDLASG  235

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRTIVMTIHQPSSRL+Y+FHKVLLL EGNPL+FGKGSD + YFS +G+SP++AMNPSDFL
Sbjct  236   GRTIVMTIHQPSSRLYYMFHKVLLLAEGNPLFFGKGSDAIEYFSNIGYSPAMAMNPSDFL  295

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK-RW  959
             LDLANGI  DD   D    K+ L+SAFK+N    LK E  E+ND D+S    Q+    +W
Sbjct  296   LDLANGIYTDDMNQDHTVDKQKLISAFKSNYDAQLKPEQEEINDSDLSEGKFQETGSGKW  355

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
                W +QF VLL+R +K+RKYESFSGL++ Q+LVVA + G LW+KS  + LQDQ+GLLFF
Sbjct  356   PTSWSQQFFVLLRRDVKERKYESFSGLRIAQILVVALIAGLLWYKSNLSHLQDQIGLLFF  415

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
             I+ FWGFFPLFQAIFTFP++ MML KERSSGMY+LSS+F++R V DLPMELVLPT+F++I
Sbjct  416   ITGFWGFFPLFQAIFTFPQELMMLEKERSSGMYRLSSYFISRMVADLPMELVLPTIFILI  475

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +Y+M GLK T  NFF  L  +LL VLV QGLGLA+GA ++DQKSATTL SVIML FLLAG
Sbjct  476   TYFMTGLKATVINFFQTLFTLLLNVLVAQGLGLALGALVLDQKSATTLASVIMLCFLLAG  535

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             GFYV++VP FISW+KYISI  YTY+L L SQY  G+TYPC++G   C +E+ P IK++G 
Sbjct  536   GFYVQNVPKFISWVKYISISYYTYQLFLGSQYHSGDTYPCSNGH--CPIEEFPPIKQMGF  593

Query  244   ---GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK*LS  137
                G+ +  + +AL+LMLIGYRL+AY ALMR+G TK L+
Sbjct  594   QLNGEGL--AALALVLMLIGYRLIAYFALMRIGVTKKLA  630



>ref|XP_009143407.1| PREDICTED: ABC transporter G family member 9 [Brassica rapa]
 emb|CDX89252.1| BnaA01g16410D [Brassica napus]
Length=638

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/655 (62%), Positives = 495/655 (76%), Gaps = 33/655 (5%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE  +        D+EA   Q++ N   +     +IFKKAN P+TLKFENVVY VK  
Sbjct  2     DNQEVAI--------DVEA---QIENNND-DRTLPFSIFKKANLPITLKFENVVYTVK--  47

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
              K+  S+L   K K+E E  ILKG+ GIV PGE+LAMLGPSGSGKT+LLTA         
Sbjct  48    VKEPKSWLSQTKVKTE-EMTILKGINGIVKPGEILAMLGPSGSGKTSLLTALGGRISEGK  106

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KPFS  +KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQEKI+
Sbjct  107   GKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQEKIK  166

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA+AV+T+LGL +CKN+IIG  FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  167   QAEAVVTELGLDRCKNTIIGEPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  226

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQRIVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF +
Sbjct  227   TAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKILLLSEGNPIYFGLGSNAMDYFGS  286

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND  1004
             VG+SPSV  +NPSDFLLD+ANG+  D+ Q  +A +KE LV+ +KT LL+N+   +++L  
Sbjct  287   VGYSPSVERINPSDFLLDIANGVGSDELQRPEA-LKEALVAVYKTTLLDNV---INDLKG  342

Query  1003  ED------VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLT  842
             +D      + S GD K F  W   WW+QF VL +RGLK R+++SFSGLK+GQV VV+FL 
Sbjct  343   QDGHCTQSIESLGDSKHFGDWPTTWWQQFCVLSERGLKHRRHDSFSGLKIGQVFVVSFLC  402

Query  841   GALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFF  668
             G LWWK+    LQDQ+GLLFF+SSFW FFPLFQ IFTFPE++ ML KERSSGMY+LSS+F
Sbjct  403   GLLWWKTDLFHLQDQIGLLFFVSSFWAFFPLFQQIFTFPEERRMLEKERSSGMYRLSSYF  462

Query  667   LARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFI  488
             ++R VGDLPMEL+LPT+F+II+YWMAGL P   NF   L  +L  VLV  GLGLA+GA +
Sbjct  463   MSRIVGDLPMELILPTIFLIITYWMAGLNPKPANFLLTLLVLLAHVLVSGGLGLALGALV  522

Query  487   MDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             MDQK+ATTLGSV+ML FLLAGG+YVRHVP FI+WIKY+SI  YTYKLL+  QY   E YP
Sbjct  523   MDQKTATTLGSVMMLTFLLAGGYYVRHVPVFIAWIKYVSISYYTYKLLILGQYTENEWYP  582

Query  307   C-TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             C  +G+  C V D   IK IG     + S  AL  ML+GYR++AY+ALMR+G+TK
Sbjct  583   CGENGNSKCHVGDFEGIKLIGF-HSGLASSFALAAMLVGYRVVAYIALMRIGKTK  636



>emb|CDY29304.1| BnaC01g19560D [Brassica napus]
Length=638

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/652 (63%), Positives = 493/652 (76%), Gaps = 27/652 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE  +        D+EA   Q++ N   +     +IFKKAN P+TLKFEN+VY VK  
Sbjct  2     DNQEVAM--------DVEA---QIENNND-DRTLPFSIFKKANLPITLKFENIVYTVK--  47

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
              K+  S+L   K K+E E  ILKG+ GIV PGE+LAMLGPSGSGKT+LLTA         
Sbjct  48    VKEPKSWLSQTKVKTE-EMTILKGINGIVKPGEILAMLGPSGSGKTSLLTALGGRVSEGK  106

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KPFS  +KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQEKI+
Sbjct  107   GKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQEKIK  166

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA+AV+T+LGL +CKN+IIG  FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  167   QAEAVVTELGLDRCKNTIIGEPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  226

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQRIVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF +
Sbjct  227   TAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKILLLSEGNPIYFGLGSNAMDYFGS  286

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMEL---HE  1013
             VG+SPSV  +NPSDFLLD+ANG+  D+ Q  +A +KE LV+ +KT LL+N+  +L   + 
Sbjct  287   VGYSPSVERINPSDFLLDIANGVGSDELQRPEA-LKEALVAVYKTTLLDNVINDLKGQYG  345

Query  1012  LNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGAL  833
                + + S GD K F  W   WW+QF VL +RGLK R+++SFSGLK+GQV VV+FL G L
Sbjct  346   HCTQSIESLGDSKHFGDWPTTWWQQFCVLSERGLKHRRHDSFSGLKIGQVFVVSFLCGLL  405

Query  832   WWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLAR  659
             WWK+  + LQDQ+GLLFF+SSFW FFPLFQ IFTFPE++ ML KERSSGMY+LSS+F++R
Sbjct  406   WWKTDLSHLQDQIGLLFFVSSFWAFFPLFQQIFTFPEERRMLEKERSSGMYRLSSYFMSR  465

Query  658   TVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQ  479
              VGDLPMEL+LPT+F+II+YWMAGL P   NF   L  +L  VLV  GLGLA+GA +MDQ
Sbjct  466   IVGDLPMELILPTIFLIITYWMAGLNPKPVNFLLTLLVLLAHVLVSGGLGLALGALVMDQ  525

Query  478   KSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTS  299
             K+ATTLGSVIML FLLAGG+YVRHVP FI+WIKY+SI  YTYKLL+  QY   E YPC  
Sbjct  526   KTATTLGSVIMLTFLLAGGYYVRHVPVFIAWIKYVSISYYTYKLLILGQYTESEWYPCGE  585

Query  298   -GSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              G+  C V D   IK IG     + S  AL  ML+GYR++AY+ALMR+G+TK
Sbjct  586   IGNSKCHVGDFEGIKLIGF-HSGLASSFALAAMLVGYRVVAYIALMRIGKTK  636



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/615 (65%), Positives = 487/615 (79%), Gaps = 16/615 (3%)
 Frame = -3

Query  1957  FKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAML  1778
             FKKAN P+TLKFENVVY VK   K+  S+L   K K++ E+ ILKG+TGIV PGE+LAML
Sbjct  29    FKKANLPITLKFENVVYTVK--VKEPKSWLCQTKGKTK-ERTILKGLTGIVKPGEILAML  85

Query  1777  GPSgsgkttllta---lggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             GPSGSGKT+ LTA         G L G I+YN KPFS  +KR TGFVTQDD LYPHLTVT
Sbjct  86    GPSGSGKTSFLTALGGRVSEGKGKLTGNISYNNKPFSKGVKRATGFVTQDDALYPHLTVT  145

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETLVFTALLRLP ++ ++EKI+QA+AV+++LGL +CK++IIGG FLRG+SGGERKRVSIG
Sbjct  146   ETLVFTALLRLPNSIKQREKIKQAEAVVSELGLDRCKDTIIGGPFLRGVSGGERKRVSIG  205

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QE+LINPSLLFLDEPTSGLDSTTAQRIVS LWEL+ GGRT++ TIHQPSSRLFY+F K+L
Sbjct  206   QEILINPSLLFLDEPTSGLDSTTAQRIVSILWELAHGGRTVITTIHQPSSRLFYMFDKIL  265

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKET  1070
             LL EGNP+YFG GS+ M YF++VG+SPSV  +NPSDFLLD+ANG+  D+SQ  +A +K  
Sbjct  266   LLSEGNPVYFGLGSNAMDYFASVGYSPSVERINPSDFLLDIANGVGSDESQRPEA-LKAA  324

Query  1069  LVSAFKTNLLENLKMELHELND---EDVSSAGD-QKQFKRWAIPWWEQFSVLLKRGLKQR  902
             LV+ +KTNLL N+  E+   +D     + ++GD  K F  W   WW+QF VL KRGLKQR
Sbjct  325   LVAVYKTNLLNNVINEVKGQDDHYNHSIENSGDSSKHFGDWPTTWWQQFCVLSKRGLKQR  384

Query  901   KYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             +++SFSGLK+GQV+ V+FL G LW+K+    LQDQ+GLLFFISSFW FFPLFQ IFTFP+
Sbjct  385   RHDSFSGLKIGQVIFVSFLCGLLWFKTNLNHLQDQIGLLFFISSFWAFFPLFQQIFTFPQ  444

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KERSSGMY+LSS+F++R VGDLPMEL+LPT+F+II+YWMAGL P   NFF  L 
Sbjct  445   ERKMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAGLNPNPVNFFLTLL  504

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
              +L+ VLV  GLGLA+GA +MDQKSATTLGSVIMLAFLLAGG+YVRHVP FISWI+Y+SI
Sbjct  505   VLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLAFLLAGGYYVRHVPVFISWIQYLSI  564

Query  367   GQYTYKLLLESQYKPGETYPC-TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGY  191
             G YTYKLL+  QY   + YPC  +G   C V D   IK IG     + S  AL +ML+GY
Sbjct  565   GYYTYKLLILGQYTENQWYPCGENGKLKCYVGDFEGIKHIGF-HSGLSSAFALAVMLVGY  623

Query  190   RLLAYVALMRVGRTK  146
             R++AY+ALMR+G+TK
Sbjct  624   RIVAYIALMRIGKTK  638



>gb|KCW50637.1| hypothetical protein EUGRSUZ_J00337 [Eucalyptus grandis]
Length=603

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/644 (60%), Positives = 480/644 (75%), Gaps = 59/644 (9%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANP--------QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGL  1877
             M D+EA T +   +            + T++ IF +++ P+TLKF +VVYK+K  +    
Sbjct  1     MADLEAQTRKADEDDGDVGLGRGSTTATTTSCIFSRSSNPITLKFHDVVYKIKIRRAAAG  60

Query  1876  SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs-gkttlltalggrlgghlagTI  1700
              FL   K     EK+IL G+TG+V PGE+LAMLGPSGS   T L    G   GG L GTI
Sbjct  61    GFLG--KSTEAEEKVILNGLTGVVRPGEMLAMLGPSGSGKTTLLTALGGRLAGGRLGGTI  118

Query  1699  TYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVIT  1520
             TYNGKPFSN++KR+TGFVTQDD++YPHLTVTETLVFTALLRL +  TK+EK+  A+ VI 
Sbjct  119   TYNGKPFSNSLKRSTGFVTQDDVMYPHLTVTETLVFTALLRLHKGYTKEEKVVHAEEVIA  178

Query  1519  QLGLTKCKNSIIGGV-FLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIV  1343
             QLGLTKCKN+IIGG  FLRG+SGGERKRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRIV
Sbjct  179   QLGLTKCKNNIIGGGGFLRGVSGGERKRVSIGQEMLVNPSLLFLDEPTSGLDSTTAQRIV  238

Query  1342  STLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPS  1163
             S LWEL+KGGRT++MTIHQPSSRLFY+FHKVLLL EGN LYFG+G++VM YF+ +GF+PS
Sbjct  239   SKLWELAKGGRTVLMTIHQPSSRLFYMFHKVLLLSEGNSLYFGEGTNVMEYFAGIGFAPS  298

Query  1162  VAMNPSDFLLDLANGITGDDSQADQ---ATVKETLVSAFKTNLLENLKMELHELNDEDVS  992
             VAMNP+DFLLDLANGI  D    D+   +T+K+TL SA+KT+L + LK EL    D  + 
Sbjct  299   VAMNPADFLLDLANGIGIDPEDEDKESKSTIKQTLASAYKTHLEDGLKQELCATGDGFIE  358

Query  991   SAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--T  818
                + K   RW   WW+QF++LL+RG+K+RKY+SFSG+KVGQVLVVAF++G LWW+S  +
Sbjct  359   QGHEHKHSDRWPTTWWQQFTILLRRGVKERKYQSFSGIKVGQVLVVAFISGLLWWQSEAS  418

Query  817   DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPM  638
             +LQD++GLLFF S+FWGF+PLF AIFTFP+++MML KERSSGMY+LSS+F++R VGDLPM
Sbjct  419   NLQDKIGLLFFYSAFWGFYPLFNAIFTFPKERMMLEKERSSGMYRLSSYFMSRIVGDLPM  478

Query  637   ELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLG  458
             EL+LPTVFV I+YWMAG+KPTAGNF   L  +L  VLV QGLGLAIGA +MDQ+SAT LG
Sbjct  479   ELILPTVFVAITYWMAGMKPTAGNFLYTLFVLLYSVLVAQGLGLAIGAVVMDQQSATILG  538

Query  457   SVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLV  278
             SV+ML FLLAGG+YV++VP FI+WI+Y+SI  YTYKLL+ SQ++P +T            
Sbjct  539   SVLMLTFLLAGGYYVQNVPPFIAWIRYLSISHYTYKLLMTSQFRPDDT------------  586

Query  277   EDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                                           L+AYVALMR+G TK
Sbjct  587   ------------------------------LIAYVALMRIGMTK  600



>ref|XP_004134251.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
 ref|XP_004172271.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
 gb|KGN56223.1| hypothetical protein Csa_3G101820 [Cucumis sativus]
Length=617

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/638 (61%), Positives = 483/638 (76%), Gaps = 32/638 (5%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             MGDIE+           +S  +     KANRP+TL F +V YK+KP           K  
Sbjct  1     MGDIES-----------QSSNNTPFLGKANRPLTLMFMDVCYKIKP-----------KNS  38

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgs-gkttlltalggrlgghlagTITYNGKPFS  1676
             KS+  K ILKG+ G+V PGE+LAM+GPSGS   T L    G   GG L GTI+YN  PFS
Sbjct  39    KSQEMKTILKGINGVVRPGEMLAMMGPSGSGKTTLLTALGGRLGGGRLTGTISYNKNPFS  98

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N MKRN GFVTQDDIL PHLTV ETLVFTALLRLP+ LT Q+K+ QA+ VI+QLGL+KCK
Sbjct  99    NKMKRNIGFVTQDDILLPHLTVVETLVFTALLRLPKELTTQQKVGQAEVVISQLGLSKCK  158

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK-  1319
             NS++G   +RG+SGGERKRVSI QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE++  
Sbjct  159   NSVVGSQMVRGVSGGERKRVSIAQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEVANN  218

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+VMTIHQPSSRLFY+FHK+LLL EGN +YFGKGS+ M YFS++G+SPSV MNPSDF
Sbjct  219   GGRTVVMTIHQPSSRLFYMFHKILLLSEGNTMYFGKGSEAMDYFSSLGYSPSVPMNPSDF  278

Query  1138  LLDLANGITGDDSQADQATVKETLVSAFKTNLL-ENLKMELHELNDED-VSSAGDQKQFK  965
             LLDL+NG++ ++++ +   VKE L+S +K N + E L +EL + +++  V    + K F 
Sbjct  279   LLDLSNGLSMNEAEEEAGLVKEKLISCYKNNAIAEKLLLELQDSDEQHLVEEGAEDKSFG  338

Query  964   RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTD--LQDQVGLL  791
             RW+  W +QF+VLL+RG+K+RK++SFS LK+GQVL V+ + G LWW+S D  LQD++GL 
Sbjct  339   RWSATWCQQFTVLLRRGIKERKHDSFSALKIGQVLAVSLICGLLWWQSDDSHLQDKIGLF  398

Query  790   FFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFV  611
             +F SSFWGFFPL QAI TFP+++M+L KERSSGMY+LSS+F++RT  DLPMELVLPTVFV
Sbjct  399   YFSSSFWGFFPLLQAIGTFPKERMILEKERSSGMYRLSSYFVSRTTTDLPMELVLPTVFV  458

Query  610   IISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLL  431
             +I Y MAGLK T  +FF+ L ++LL VLV QG GLA+GA ++DQ SATT  SVIML FLL
Sbjct  459   VIIYVMAGLKRTVASFFATLFSLLLSVLVAQGFGLAMGALVLDQTSATTFASVIMLCFLL  518

Query  430   AGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTS---GSGVCLVEDHPAI  260
               G++V+HVP FI+W KYISIG Y+YKLLL SQYK  +TYPC S   G   C V + P I
Sbjct  519   TSGYFVQHVPKFIAWTKYISIGTYSYKLLLISQYKASDTYPCPSNDNGGRACEVGEFPPI  578

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             K++GL    +F+V A++ ML+GYRL+AY+ALMR+G TK
Sbjct  579   KQVGLDGK-LFAVSAMVAMLVGYRLVAYIALMRIGVTK  615



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/653 (62%), Positives = 499/653 (76%), Gaps = 28/653 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        DIEA       N   +     +IFKKANR VTLKFENVVY VK  
Sbjct  2     DNQEVSV--------DIEAQI----VNNDDDQTLPFSIFKKANRSVTLKFENVVYTVKVK  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
             + +G  +    K K+E E+ ILKG+TGIV PGE+LAMLGPSGSGKT+LLTA         
Sbjct  50    EAKGWPW--QTKDKTE-ERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVSEGK  106

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L GTI+YN KP S  +KR TGFVTQDD LYP+LTVTETLV+TALLRLP ++ ++EKI+
Sbjct  107   GKLTGTISYNNKPLSKGVKRTTGFVTQDDALYPYLTVTETLVYTALLRLPNSIKRKEKIK  166

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA+AV+TQLGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  167   QAEAVVTQLGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  226

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQRIVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL +GNP+YFG GS  M YF++
Sbjct  227   TAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSDGNPVYFGLGSHAMDYFAS  286

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMEL--HE-  1013
             VG+SPSV  +NPSDFLLD+ANG+  D+SQ  +A +K  LV  +KTNLL+N+  E+  HE 
Sbjct  287   VGYSPSVERINPSDFLLDIANGVGSDESQRPEA-LKAALVEVYKTNLLDNVINEVKGHED  345

Query  1012  -LNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
               N    S  G+ K F  W+  WW+QFSVLLKRGL QR+++SFSGLK+ Q+L+V+ L G 
Sbjct  346   LCNLPIGSPCGETKNFGDWSTTWWQQFSVLLKRGLTQRRHDSFSGLKICQILIVSILCGL  405

Query  835   LWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             LWW++  + LQDQ+GLLFF+SSFWGFFPLFQ IFTFP+++ ML KERSSGMY+LS++F++
Sbjct  406   LWWQTSISRLQDQIGLLFFMSSFWGFFPLFQQIFTFPQERKMLEKERSSGMYRLSAYFMS  465

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LP +F+ I+YWMAGL P   NF   L  +L+ VLV  GLGLA+GA +MD
Sbjct  466   RVVGDLPMELILPFLFLAITYWMAGLNPKFENFLLTLLVLLVHVLVSGGLGLALGALVMD  525

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-  305
             QKSATTLGSVIMLAFLLAGG+YVRHVP FISWI+Y+SIG YTYKLL+  QY   E YPC 
Sbjct  526   QKSATTLGSVIMLAFLLAGGYYVRHVPVFISWIRYVSIGYYTYKLLILGQYTESEWYPCG  585

Query  304   TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              +G   C V D   IK IG G  ++   +AL  ML+GYR +AY+ALMR+G++K
Sbjct  586   ENGKLKCYVGDFEGIKHIGFGSGLV-PALALAAMLVGYRFVAYLALMRIGKSK  637



>ref|XP_007149612.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
 gb|ESW21606.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
Length=624

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/640 (63%), Positives = 492/640 (77%), Gaps = 31/640 (5%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM D+E+   +          T   +F K    VTLKF++VVYK+K  +K GL      K
Sbjct  5     EMADVESQNLE----------TPPDVFLKGKHQVTLKFDDVVYKIKT-KKGGL----LAK  49

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
             ++    K ILKGVTG+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L G+ITYNG+ FS
Sbjct  50    KRETVVKEILKGVTGVVEPGEMLAMLGPSGSGKTTLLTALGGRLGGKLHGSITYNGEAFS  109

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N MKRNTGFVTQDD+LYPHLTV ETLVFTALLRLP+++TK++K+E A  VI QLGLT CK
Sbjct  110   NDMKRNTGFVTQDDVLYPHLTVLETLVFTALLRLPKSVTKEKKVEHAKGVIDQLGLTMCK  169

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SI+G  +LRG+SGGERKRVSI QE+LINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+ G
Sbjct  170   DSIVGSPYLRGVSGGERKRVSIAQELLINPSLLFLDEPTSGLDSTTAQRIVSTLWELACG  229

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT+VMTIHQPSSRL+Y+FHKVLLL EGN LYFGKGS+ + YFS  G++PS+AMNPSDFL
Sbjct  230   GRTVVMTIHQPSSRLYYMFHKVLLLSEGNTLYFGKGSEAIEYFSNFGYAPSLAMNPSDFL  289

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK---  965
             LDLANGI  D+  AD    K+ L+S  K N +   K  L  + D    S  DQ + +   
Sbjct  290   LDLANGIYTDEFNADHTIDKQKLISVCKVNCVAQSKPALKGIYD----SGKDQNRLQEKD  345

Query  964   --RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVG  797
               +W   W +QF VLL+R +K+R++ESFS L+V QVLVVA ++G LW+KS  + LQDQ+G
Sbjct  346   SEKWPTNWGQQFLVLLRRDVKERRHESFSVLRVCQVLVVALISGLLWYKSDISHLQDQIG  405

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFFIS FWGFFPLFQAIFTFP++  ML KERSSGMY+LSS+F++R V DLPMELVLPT+
Sbjct  406   LLFFISGFWGFFPLFQAIFTFPQELTMLQKERSSGMYRLSSYFMSRVVADLPMELVLPTI  465

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             F+ I+YWMAGLK    NF   L ++LL VL  QGLGLA+GA +MDQK+ATTL SVIML F
Sbjct  466   FLFITYWMAGLKANVVNFMYTLLSLLLNVLTAQGLGLALGACVMDQKAATTLASVIMLCF  525

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIK  257
             LLAGGFYV+HVP+FI+WIKYISI  YTY+L + SQY  GETYPC +G   C + + P+IK
Sbjct  526   LLAGGFYVQHVPNFIAWIKYISISYYTYQLFIGSQYSYGETYPCLTGQ--CSIVEFPSIK  583

Query  256   KIGL--GQH-VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             +IG+  G H  + + + LL+MLI YRL+AY+ALMR+G TK
Sbjct  584   QIGVHFGLHDQLMAALGLLIMLIVYRLIAYIALMRIGVTK  623



>ref|XP_010448138.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
 ref|XP_010448139.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
Length=638

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/653 (61%), Positives = 495/653 (76%), Gaps = 29/653 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        DIEAP  +   +  L      +IFKK+N PVTLKFEN+VY VK  
Sbjct  2     DNQEVSM--------DIEAPIEKTNDDRPL----PFSIFKKSNNPVTLKFENLVYTVKLK  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
             +  G  + +T   K+E E+ ILKG+TG+V PGE+LAMLGPSGSGKT+LLTA     G   
Sbjct  50    EPNG--WFRTN-DKTE-ERTILKGLTGLVKPGEILAMLGPSGSGKTSLLTALGGRLGEGK  105

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KP S A+KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  +QEKI 
Sbjct  106   GKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTETLVFTALLRLPNSFKQQEKIN  165

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA AV+T+LGL +CK++IIGG FLRG+SGGERKRVSIGQE+L+NPSLLFLDEPTSGLDST
Sbjct  166   QAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILVNPSLLFLDEPTSGLDST  225

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQ+IVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++
Sbjct  226   TAQKIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFAS  285

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND  1004
             +G+SPSV  +NPSDFLLD+ANG+  D+SQ   A +K  LV+ +KTNLL+N+  +L   +D
Sbjct  286   IGYSPSVERINPSDFLLDIANGVGSDESQRPDA-MKADLVALYKTNLLDNVISDLERQDD  344

Query  1003  ED----VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
              D     S  G++  F  W   WW+QF VLL+RGLKQR+++SFSG+K+ Q+ +V+ L G 
Sbjct  345   LDNRPIESPRGEKNHFGEWPTTWWQQFCVLLQRGLKQRRHDSFSGIKIAQIFIVSTLCGL  404

Query  835   LWW--KSTDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             LWW  K + LQDQ+GLLFFISSFW FFPLFQ IFTFP+++ ML KERSSGMY+LS +F++
Sbjct  405   LWWQTKMSRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMS  464

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LP  F+II+Y+MAGL     NFF  L  +L+ VLV  GLGLA+GA +MD
Sbjct  465   RVVGDLPMELILPCCFLIITYFMAGLNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMD  524

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT  302
             QKSATTLGSVIML FLLAGG+YV+HVP FISWIKY+SIG YTYKLL+  QY   E YPC 
Sbjct  525   QKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTENEWYPCG  584

Query  301   SGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                 + C V D   IK IG    ++ S VAL +ML+GYR++AY+ALMR+G+TK
Sbjct  585   ENEKLKCHVGDFEGIKHIGFHSGLV-SAVALAVMLVGYRVIAYIALMRIGKTK  636



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/653 (62%), Positives = 491/653 (75%), Gaps = 29/653 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        D+E P  +   +  L      +IFKKAN PVTLKFEN+VY VK  
Sbjct  2     DNQEVSM--------DVETPIAKTNDDRSLP----FSIFKKANNPVTLKFENLVYTVKLK  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
               QG  F K  K +   E+ ILKG+TGIV PGE+LAMLGPSGSGKT+LLTA     G   
Sbjct  50    DSQG-CFGKNDKTE---ERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGK  105

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KP S A+KR TGFVTQDD LYP+LTVTETLVFTALLRLP +  KQEKI+
Sbjct  106   GKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIK  165

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA AV+T+LGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  166   QAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  225

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQRIVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++
Sbjct  226   TAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPVYFGLGSNAMDYFAS  285

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND  1004
             VG+SP V  +NPSDFLLD+ANG+  D+SQ  +A +K  LV+ +KTNLL+++  E+   +D
Sbjct  286   VGYSPLVERINPSDFLLDIANGVGSDESQRPEA-MKAALVAFYKTNLLDSVINEVKGQDD  344

Query  1003  ----EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
                    SS      +  W   WW+QF VLLKRGLKQR+++SFSG+KV Q+ +V+FL G 
Sbjct  345   LCNKPRESSRVATNTYGDWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVAQIFIVSFLCGL  404

Query  835   LWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             LWW++  + LQDQ+GLLFFISSFW FFPLFQ IFTFP+++ ML KERSSGMY+LS +FL+
Sbjct  405   LWWQTKISRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLS  464

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LPT F++I+YWMAGL     NFF  L  +L+ VLV  GLGLA+GA +MD
Sbjct  465   RVVGDLPMELILPTCFLVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMD  524

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-  305
             QKSATTLGSVIML FLLAGG+YV+HVP FISWIKY+SIG YTYKLL+  QY   E YPC 
Sbjct  525   QKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCG  584

Query  304   TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              +G   C V D   IK IG    ++ S +AL  ML+ YR++AY+AL R+G+TK
Sbjct  585   DNGKLRCHVGDFEGIKHIGFNSGLV-SALALTAMLVVYRVIAYIALTRIGKTK  636



>ref|XP_010433373.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=638

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/638 (62%), Positives = 488/638 (76%), Gaps = 21/638 (3%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             DIEAP  +   N  L      +IFKK+N PVTLKFEN+VY VK  +  G  + +T   K+
Sbjct  9     DIEAPIEKTNDNRPL----PFSIFKKSNNPVTLKFENLVYTVKLKEPNG--WFRTN-DKT  61

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlgghlagTITYNGKPFS  1676
             E E+ ILKG+TG+V PGE+LAMLGPSGSGKT+LLTA     G   G L G I+YN KP S
Sbjct  62    E-ERTILKGLTGLVKPGEILAMLGPSGSGKTSLLTALGGRLGEGKGKLTGNISYNNKPLS  120

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
              A+KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  +QEKI QA AV+T+LGL +CK
Sbjct  121   KAVKRTTGFVTQDDALYPHLTVTETLVFTALLRLPNSFKQQEKINQAKAVMTELGLDRCK  180

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             ++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDSTTAQ+IVS LWEL++G
Sbjct  181   DTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTTAQKIVSILWELARG  240

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDF  1139
             GRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++VG+SPSV  +NPSDF
Sbjct  241   GRTVVTTIHQPSSRLFYMFDKLLLLSEGNPIYFGLGSNAMDYFASVGYSPSVERINPSDF  300

Query  1138  LLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDED----VSSAGDQKQ  971
             LLD+ANG+  D+SQ   A +K  LV+ +K+NLL+N+  +L   +D       S  G++  
Sbjct  301   LLDIANGVGSDESQRPDA-MKADLVALYKSNLLDNVISDLERQDDLSNRPIESPRGEKNH  359

Query  970   FKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW--KSTDLQDQVG  797
             F  W   WW+QF VLL+RGLKQR+++SFSG+K+ Q+ +V+ L G LWW  K + LQDQ+G
Sbjct  360   FGEWPTTWWQQFCVLLQRGLKQRRHDSFSGIKIAQIFIVSTLCGLLWWQTKMSRLQDQIG  419

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFFISSFW FFPLFQ IFTFP+++ ML KERSSGMY+LS +F++R V DLPMEL+LP  
Sbjct  420   LLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVADLPMELILPCC  479

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             F++I+YWMAGL     NFF  L  +L+ VLV  GLGLA+GA +MDQKSATTLGSVIML F
Sbjct  480   FLLITYWMAGLNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTF  539

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAI  260
             LLAGG+YV+HVP FISWIKY+SIG YTYK+L+  QY   E YPC     + C V D   I
Sbjct  540   LLAGGYYVQHVPVFISWIKYVSIGYYTYKILILGQYTENEWYPCGENEKLKCHVGDFEGI  599

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             K IG    ++ S VAL +ML+GYR++AY+ALMR+G+TK
Sbjct  600   KHIGFHSGLV-SAVALAVMLVGYRVIAYIALMRIGKTK  636



>ref|XP_009383080.1| PREDICTED: ABC transporter G family member 9 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/608 (64%), Positives = 484/608 (80%), Gaps = 15/608 (2%)
 Frame = -3

Query  1960  IFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAM  1781
             I+ KANRPVTLKFE+VVYK+K          K K +  E E++ILKGV+G V PGE+LAM
Sbjct  39    IYSKANRPVTLKFEDVVYKIKT---------KGKGKAKEGERVILKGVSGAVSPGEMLAM  89

Query  1780  LGPSgsgkttlltal--ggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             LGPSGSGKTTLLT L         L G+ITYNGKPF+N++KR TGFVTQDD+LYPHLTVT
Sbjct  90    LGPSGSGKTTLLTVLGGRIGRTRLLTGSITYNGKPFTNSLKRRTGFVTQDDVLYPHLTVT  149

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETLV+TALLRLP TL++QEK+ QA+AV+ QLGLT C++SIIGG  +RG+SGGERKRVSIG
Sbjct  150   ETLVYTALLRLPSTLSRQEKVAQAEAVMAQLGLTACRSSIIGGPLVRGVSGGERKRVSIG  209

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEMLI+PSLLFLDEPTSGLDST A RIVSTLW+L+KGG+T++MTIHQPSSRLFY+FHKVL
Sbjct  210   QEMLIDPSLLFLDEPTSGLDSTIAGRIVSTLWDLTKGGKTVIMTIHQPSSRLFYMFHKVL  269

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKETL  1067
             LL +GN +YFGKGSD M YF++VG++P+V MNP+DFLLDLANG++ D++  D+A+ KE L
Sbjct  270   LLSDGNSIYFGKGSDAMDYFASVGYAPTVPMNPADFLLDLANGVSSDETSEDRASTKEAL  329

Query  1066  VSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESF  887
             VSA++ +L + +  E+  L+ +      D  +  +W   WWEQF+VLL+R LK+RK+ESF
Sbjct  330   VSAYRLHLHDKVSEEVLALSKQFKECEPDNIE-TQWCTSWWEQFTVLLQRDLKERKHESF  388

Query  886   SGLKVGQVLVVAFLTGALWWKSTD-LQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
             SGLK+ QVLVVA L G LW  S   +QDQVGLLFF++SFW F+P+F+AIFTFP+++ ML 
Sbjct  389   SGLKISQVLVVALLAGFLWLHSGGYVQDQVGLLFFVASFWSFYPVFEAIFTFPQERTMLT  448

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F AR VGDLPMEL+LP +F+ I+YWM GLKP A NFF  L+ +LLCV
Sbjct  449   KERSSGMYRLSSYFAARLVGDLPMELILPIIFITITYWMGGLKPVAVNFFMNLAVLLLCV  508

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QG+GLA+GA +MD K+ATTLGS++ML+F+LAGGFYV+++P FI WIKYIS+  YT+K
Sbjct  509   LVAQGMGLALGALVMDLKTATTLGSILMLSFMLAGGFYVQNIPPFIEWIKYISLSYYTFK  568

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             L + SQY P +TY CT  S  C + D P+IK +G   H   +V ALLLML+ YRL AY+ 
Sbjct  569   LQIASQYSPNDTYQCTP-SMRCQIADFPSIKLVGF-DHKALAVFALLLMLVLYRLAAYLG  626

Query  169   LMRVGRTK  146
             LMRVG T 
Sbjct  627   LMRVGVTN  634



>ref|XP_006286036.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
 gb|EOA18934.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
Length=638

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/653 (61%), Positives = 494/653 (76%), Gaps = 29/653 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        D+EAP  +   +  L      +IFKKAN PVTLKFEN+VY VK +
Sbjct  2     DNQEVSV--------DVEAPIDKTNDDRSL----PFSIFKKANNPVTLKFENLVYTVKLE  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
                G    +T   K+E E+ ILKG+TG V PGE+LAMLGPSGSGKT+LLTA     G   
Sbjct  50    DPNGC--FRTN-HKTE-ERTILKGLTGFVKPGEILAMLGPSGSGKTSLLTALGGRLGEGK  105

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KP S A+KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  KQEKI 
Sbjct  106   GKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTETLVFTALLRLPNSFKKQEKIN  165

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA AV+T+LGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  166   QAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  225

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQ+IVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++
Sbjct  226   TAQKIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPIYFGLGSNAMDYFAS  285

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELH---E  1013
              G+SPSV  +NPSDFLLD+ANGI  D+SQ  +A +K  LV  +KT+LL+N+  +L    +
Sbjct  286   GGYSPSVERINPSDFLLDIANGIGSDESQRPEA-LKAALVELYKTHLLDNVITDLEGQDD  344

Query  1012  LNDEDVSSAG-DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
             L+++ + +   +   F  W   WW+QF VLL+RGLKQR+++SFSG+K+ Q+ +V+ L G 
Sbjct  345   LSNKPIENPHVETNHFGEWPTTWWQQFCVLLQRGLKQRRHDSFSGIKIAQIFIVSILCGL  404

Query  835   LWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             LWW++  + LQDQ+GLLFF+SSFW FFPLFQ IFTFP+++ ML KERSSGMY+LS +F++
Sbjct  405   LWWQTKLSRLQDQIGLLFFMSSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMS  464

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LP  FV+I+Y+MAGL     NFF  L  +L+ VLV  GLGLA+GA +MD
Sbjct  465   RVVGDLPMELILPCCFVLITYFMAGLNHHPANFFLTLLVLLVHVLVSGGLGLALGALVMD  524

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC-  305
             QKSATTLGSVIML FLLAGG+YV+HVP FISWIKY+SIG YTYKLL+  QY   E YPC 
Sbjct  525   QKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANELYPCG  584

Query  304   TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               G   C V D   IK IG    ++ S +AL +ML+GYR++AY+ALMR+G+TK
Sbjct  585   DDGKLKCHVGDFEGIKNIGFHSGLV-SALALAVMLVGYRVIAYLALMRIGKTK  636



>ref|XP_006451938.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
 gb|ESR65178.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
Length=628

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/629 (61%), Positives = 498/629 (79%), Gaps = 13/629 (2%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             DI    T  + +  LE+   + +F +A  PVTLKFE++VYK+K   K+G  F  + K+  
Sbjct  10    DINEAQTDQKEDQLLEA---SDVFTRAKHPVTLKFEDIVYKIK--MKKG--FYGSNKKIE  62

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
             E  K ILKG+TG+V PGE+LAMLGPSG GKTTLLTALGGRLG      ITYNGKPFSN M
Sbjct  63    E--KAILKGITGMVKPGEMLAMLGPSGCGKTTLLTALGGRLGPINGR-ITYNGKPFSNQM  119

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
              RNTGFVTQ+D+L P+LTVTET+VFTALL+LP + T++EKI+ A+AV+T+LGL++CKNS+
Sbjct  120   TRNTGFVTQEDVLSPYLTVTETMVFTALLQLPNSFTEKEKIKCAEAVMTELGLSECKNSL  179

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG   RG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST AQ+I+S L +L+ GGRT
Sbjct  180   IGGPLTRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTIAQQILSILLKLANGGRT  239

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDL  1127
             IVMTIHQPS+ L+Y+FHKVLLL EG PLYFG+ S  M+YF+++G+ PSVA NPSDFLLDL
Sbjct  240   IVMTIHQPSNMLYYMFHKVLLLSEGYPLYFGEASGAMNYFASIGYCPSVATNPSDFLLDL  299

Query  1126  ANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPW  947
             A+G+  + S  +QA VK+TL+S ++ NL + LK EL + N+ +     + KQF+R++  W
Sbjct  300   ASGMPSNGSWKEQALVKQTLISQYEKNLADKLKAELTQENENESQDQPEDKQFRRFSTTW  359

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSF  773
             W+QF VLL+RG+K+   ESFS LK+ +VLV+AFL+G LWW+S+   +QDQ+GLLFF   F
Sbjct  360   WQQFRVLLRRGIKEIMDESFSCLKIIEVLVIAFLSGLLWWQSSIYQIQDQIGLLFFFCDF  419

Query  772   WGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWM  593
             WGFFP+ + IFTFP+++ ML KE  SGMY+LS++F++R + DLP++LV+PTVFV I+YWM
Sbjct  420   WGFFPMLECIFTFPQEQKMLEKEIPSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWM  479

Query  592   AGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYV  413
             AGLKPTA NFF  L  +L  VLV QGLGLAIGA +M+QKSAT LGS+IM  F+LAGG+YV
Sbjct  480   AGLKPTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYV  539

Query  412   RHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHV  233
             ++VPSFI+WI+Y+SIG +TYKLLL SQY   ETYPC    G+CLV +HP IKK+GL +  
Sbjct  540   QNVPSFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKY  599

Query  232   IFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              +SV+AL +ML+GYRL+AY+ALMR+G T+
Sbjct  600   -YSVIALAIMLVGYRLIAYIALMRIGATR  627



>ref|XP_002867504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/654 (61%), Positives = 490/654 (75%), Gaps = 30/654 (5%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLK-FENVVYKVKP  1895
             D QE ++        D+EAP  +   +  L      +IFKKAN PVTLK FEN+VY VK 
Sbjct  2     DSQEVSM--------DVEAPIEKTNDDRSL----PFSIFKKANTPVTLKQFENLVYTVKL  49

Query  1894  DQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrl  1724
              + QG      +K     E+ ILKG+TGIV PGE+LAMLGPSGSGKT+LLTA     G  
Sbjct  50    KEPQGW----FRKNDKTEERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEG  105

Query  1723  gghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKI  1544
              G L G I+YN KP S A+KR TGFVTQDD LYP+LTVTETLVFTALLRLP +  +QEKI
Sbjct  106   KGKLTGNISYNNKPLSKAVKRRTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKQQEKI  165

Query  1543  EQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDS  1364
             +QA  V+T+LGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDS
Sbjct  166   KQAKVVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDS  225

Query  1363  TTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFS  1184
             TTAQRIVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS  M YF+
Sbjct  226   TTAQRIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPIYFGLGSSAMDYFA  285

Query  1183  TVGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELH---  1016
             +VG SPSV  +NPSDFLLD+ANG+  D+SQ  +A +K  LV+ +KTNLL+N+  E+    
Sbjct  286   SVGCSPSVERINPSDFLLDIANGVGSDESQRPEA-MKAALVAFYKTNLLDNVINEVKGQD  344

Query  1015  ELNDEDVSSA-GDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTG  839
             +L ++ + S  G       W   WW+QF VLLKRGLKQR+++SFSG+KV Q+ +V+ L G
Sbjct  345   DLCNKPIESPRGATNTNGEWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVAQIFLVSILCG  404

Query  838   ALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFL  665
              LWW++  + LQDQ+GLLFFISSFW FFPLFQ IFTFP+++ ML KERSSG+Y+LS +F+
Sbjct  405   LLWWQTKISRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGVYRLSPYFM  464

Query  664   ARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIM  485
             +R VGDLPMEL+LPT F++I+YWMAGL     NFF  L  +L+ VLV  GLGLA+GA +M
Sbjct  465   SRLVGDLPMELILPTCFLVITYWMAGLNHNLANFFVTLLVLLVHVLVSGGLGLALGALVM  524

Query  484   DQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC  305
             DQK+ATTLGSVIML FLLAGG+YV+HVP FISWIKY+SIG YTYKLL+  QY   E YPC
Sbjct  525   DQKTATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILGQYTANEWYPC  584

Query  304   -TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               +G   C V D   IK IG    ++ S +AL  ML+ YR++AY+AL R+G+TK
Sbjct  585   GENGILRCHVGDFEGIKHIGFNSGLV-SALALTAMLVVYRVIAYIALTRIGKTK  637



>ref|XP_010438619.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=636

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/653 (61%), Positives = 489/653 (75%), Gaps = 31/653 (5%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        DIEAP  +   +  L      +IFKK+N PVTLKFEN+VY VK  
Sbjct  2     DNQEVSM--------DIEAPIEKTNDDRSL----PFSIFKKSNNPVTLKFENLVYTVKLK  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
             +  G  + +T   K+E E+ ILKG+TG+V PGE+LAMLGPSGSGKT+LLTA     G   
Sbjct  50    EPNG--WFRTN-DKTE-ERTILKGLTGLVKPGEILAMLGPSGSGKTSLLTALGGRLGEGK  105

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KP S A+KR TGFVTQDD LYPHLTVTETLVFTALLRLP +  +QEKI 
Sbjct  106   GKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPHLTVTETLVFTALLRLPNSFKQQEKIN  165

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA AV+++LGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  166   QAKAVMSELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  225

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQ+IVS LWEL++GGRT+V TIHQPSSRLFY+F K+LLL EGNP+YFG GS+ M YF++
Sbjct  226   TAQKIVSILWELARGGRTVVTTIHQPSSRLFYMFDKLLLLSEGNPIYFGLGSNAMDYFAS  285

Query  1180  VGFSPSVA-MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELND  1004
             VG+SPSV  +NPSDFLLD+ANG+  D+SQ   A +K  LV+ +KTNLL+N+  +L   +D
Sbjct  286   VGYSPSVERINPSDFLLDIANGVGSDESQRPDA-MKADLVALYKTNLLDNVISDLERQDD  344

Query  1003  ED----VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
                    S  G++  F  W   WW+QF VLL+RGLKQR+++SFSG+K+ Q+ + + L G 
Sbjct  345   LSNRPIESPRGEKNNFGEWPTTWWQQFCVLLQRGLKQRRHDSFSGIKIAQIFIASTLCGL  404

Query  835   LWW--KSTDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             LWW  K + LQDQ+GLLFFISSFW FFPLFQ IFTFP+++ ML KERSSGMY+LS +F++
Sbjct  405   LWWQTKMSRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMS  464

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LP  F++I+YWMAGL       F  L  +L+ VLV  GLGLA+GA +MD
Sbjct  465   RVVGDLPMELILPCCFLLITYWMAGLNHNPVKNFLTLLVLLVHVLVSGGLGLALGALVMD  524

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT  302
             QKSATTLGSVIML FLLAGG+YV+HVP FISWIKY  +G YTYKLL+  QY   E YPC 
Sbjct  525   QKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKY--VGYYTYKLLILGQYTENEWYPCG  582

Query  301   SGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                 + C V D   IK IG    ++ S VAL +ML+GYR++AY+ALMR+G+TK
Sbjct  583   ENLKLKCHVGDFEGIKHIGFHSGLV-SAVALAVMLVGYRVIAYIALMRIGKTK  634



>ref|XP_007133073.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
 gb|ESW05067.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
Length=627

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/634 (62%), Positives = 484/634 (76%), Gaps = 17/634 (3%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK  1856
             EM +IE+  +  +A  Q E+     IF K N  VTLKF +V+YK+K ++K G  FLK   
Sbjct  4     EMENIESQAS-YKATVQEEARD---IFGKGNSSVTLKFHDVIYKIK-NRKWG--FLKNTV  56

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFS  1676
             +    EK++L GVTG+  PGE+LAMLGPSGSGKTTLL ALGG+LGG L G+ITYNGK FS
Sbjct  57    E----EKVVLNGVTGMAQPGEILAMLGPSGSGKTTLLAALGGKLGGKLYGSITYNGKAFS  112

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             NAMKRNTGFVTQDD+ YPHLTVTETLVFTALLRLP +L+K+EKI  A AV+ QLGLTKCK
Sbjct  113   NAMKRNTGFVTQDDVHYPHLTVTETLVFTALLRLPSSLSKKEKIVHAKAVMAQLGLTKCK  172

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             +SIIGG  LRG+SGGE+KRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRIVS LWEL+ G
Sbjct  173   DSIIGGPLLRGVSGGEKKRVSIGQEMLVNPSLLFLDEPTSGLDSTTAQRIVSILWELANG  232

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT+VMTIHQPSSR++ +FH+VLLL +GN LY+G GS+ M YF+ +G++P++A+NPSDFL
Sbjct  233   GRTVVMTIHQPSSRIYCMFHRVLLLSDGNLLYYGNGSEAMEYFTNIGYAPTMALNPSDFL  292

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAG-DQKQFKRW  959
             LDLANG+    S  DQA  K  L+SA++       K  + ++ D D S    +   F  W
Sbjct  293   LDLANGVYTGQSNEDQAINKNKLISAYRNYFDVKFKPVMQDIPDYDKSQGRFEGIGFGEW  352

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
                W +QF VLLKR +K+RKY SFSGL+V Q LVVA +TG LW+K   + LQDQ+G+LFF
Sbjct  353   PTSWSQQFLVLLKRDVKERKYASFSGLRVFQFLVVALITGLLWYKCDISRLQDQIGVLFF  412

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
             ++SFWG  PL+QAIFTFP++ +ML KERSSGMYKLSS+F++R VGDLPMELVLP++F+ I
Sbjct  413   LTSFWGGMPLYQAIFTFPQELIMLEKERSSGMYKLSSYFMSRMVGDLPMELVLPSIFLTI  472

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
              YWM GLK    NF   L  ILL VLV QGLGLAIGA +MDQKSATTL SVI+L  +L  
Sbjct  473   IYWMIGLKNNVVNFLCTLLTILLDVLVSQGLGLAIGAIVMDQKSATTLASVIVLTSVLVT  532

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+Y++HVP F++W+KY SI  Y Y LL+ SQY   +TYPC  G   CLV ++P I+++GL
Sbjct  533   GYYIQHVPKFVAWLKYFSINYYIYHLLIGSQYGSSDTYPCHQGQ--CLVAEYPLIEQMGL  590

Query  244   G-QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               Q  I S +AL +MLIGYRL+AY+ALM++G TK
Sbjct  591   HLQGKIMSALALFIMLIGYRLVAYLALMKIGMTK  624



>ref|XP_006464709.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=628

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/629 (61%), Positives = 497/629 (79%), Gaps = 13/629 (2%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             DI    T  + +  LE+   + +F +A  PVTLKFE++VYK+K   K+G  F  + K+  
Sbjct  10    DINEAQTDQKEDQLLEA---SDVFTRAKHPVTLKFEDIVYKIK--MKKG--FYGSNKKIE  62

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
             E  K ILKG+TG+V PGE+LAMLGPSG GKTTLLTALGGRLG      ITYNGKPFSN M
Sbjct  63    E--KAILKGITGMVKPGEMLAMLGPSGCGKTTLLTALGGRLGRINGR-ITYNGKPFSNQM  119

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
              RNTGFVTQ+D+L P+LTVTET+VFTALL+LP + T++EKI+ A+AV+T+LGL++CKNS+
Sbjct  120   TRNTGFVTQEDVLSPYLTVTETMVFTALLQLPNSFTEKEKIKCAEAVMTELGLSECKNSL  179

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG   RG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST AQ+I+STL +L+ GGRT
Sbjct  180   IGGPLTRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTIAQQILSTLLKLANGGRT  239

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDL  1127
             IVMTIHQPS+ L+Y+FHKVLLL EG PLY G+ S  M+YF+++G+ PSV  NPSDFLLDL
Sbjct  240   IVMTIHQPSNMLYYMFHKVLLLSEGYPLYSGEASGAMNYFASIGYCPSVPTNPSDFLLDL  299

Query  1126  ANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPW  947
             A+G+  + S  +QA VK+TL+S ++ NL + LK EL + N+ +     + KQF+R++  W
Sbjct  300   ASGMPSNGSWKEQALVKQTLISQYEKNLADKLKAELTQENENESQDQPEDKQFRRFSTTW  359

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSF  773
             W+Q  VLL+RG+K+   ESFS LK+ +VLV+AFL+G LWW+S+   +QDQ+GLLFF   F
Sbjct  360   WQQLRVLLRRGIKEIMDESFSCLKIIEVLVIAFLSGLLWWQSSIYQIQDQIGLLFFFCDF  419

Query  772   WGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWM  593
             WGFFP+ + IFTFP+++ ML KE SSGMY+LS++F++R + DLP++LV+PTVFV I+YWM
Sbjct  420   WGFFPMLECIFTFPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWM  479

Query  592   AGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYV  413
             AGLKPTA NFF  L  +L  VLV QGLGLAIGA +M+QKSAT LGS+IM  F+LAGG+YV
Sbjct  480   AGLKPTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYV  539

Query  412   RHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHV  233
             ++VPSFI+WI+Y+SIG +TYKLLL SQY   ETYPC    G+CLV +HP IKK+GL +  
Sbjct  540   QNVPSFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKY  599

Query  232   IFSVVALLLMLIGYRLLAYVALMRVGRTK  146
              +SV+AL +ML+GYRL+AY+ALMR+G T+
Sbjct  600   -YSVIALAIMLVGYRLIAYIALMRIGATR  627



>ref|XP_010277245.1| PREDICTED: ABC transporter G family member 9-like [Nelumbo nucifera]
Length=981

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/639 (63%), Positives = 493/639 (77%), Gaps = 14/639 (2%)
 Frame = -3

Query  2056  TLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGL  1877
             +L+    EM D EA       N   E + + +IFKK NR VTLKFE+VVYK+   +K+  
Sbjct  355   SLVTFEMEMIDTEA------QNQTAEVEAAPSIFKKMNRLVTLKFEDVVYKISIKKKR--  406

Query  1876  SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTIT  1697
              F   +  KSE + +IL GV+G V PGE+LA+LGPSGSGKTTLLTALGGRLGG L G+IT
Sbjct  407   -FDHFRSSKSEEKVMILNGVSGSVSPGEMLALLGPSGSGKTTLLTALGGRLGGKLGGSIT  465

Query  1696  YNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQ  1517
             YNGKPFS  +KR TGFVTQDD+LYPHLTVTETLVFTALLRLP  LTK+EKI  A+ VI+Q
Sbjct  466   YNGKPFSVLVKRMTGFVTQDDVLYPHLTVTETLVFTALLRLPNCLTKEEKITHAEVVISQ  525

Query  1516  LGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVST  1337
             LGL++CKNSIIGG  LRG+SGGERKRVSIGQE+LINPSLL LDEPTSGLDSTTAQ+IVST
Sbjct  526   LGLSRCKNSIIGGPLLRGVSGGERKRVSIGQELLINPSLLLLDEPTSGLDSTTAQQIVST  585

Query  1336  LWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA  1157
             LWELSKGGRT+V+TIHQPSSRLFY+F KVLLL EGN LYFGKG D M YFS++GF+PS  
Sbjct  586   LWELSKGGRTVVLTIHQPSSRLFYMFDKVLLLSEGNSLYFGKGEDAMDYFSSIGFAPSFP  645

Query  1156  MNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQ  977
             MNPSDFLLDLANG   ++ + D   +K+ LVSA+K N++  LK E+    +  V SA D+
Sbjct  646   MNPSDFLLDLANGTFSNNKEEDPIALKQALVSAYKKNIVGKLKAEMQSTENHCVDSARDR  705

Query  976   KQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQ  803
             +   +W   W EQFSVL+KRG+K+R++E FS LKV Q++VVA L G LWW+S  T++QDQ
Sbjct  706   ES-PKWNTTWGEQFSVLVKRGMKERRHEYFSYLKVIQIVVVAILAGLLWWQSDVTNIQDQ  764

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             VGLLFF SSFWGFFPL QA+FTFP+++MML KERSSGMY+LSS+F++RT+GDLPMEL LP
Sbjct  765   VGLLFFYSSFWGFFPLVQAVFTFPQERMMLIKERSSGMYRLSSYFISRTIGDLPMELALP  824

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T FV I+YWMAG KP+A +F   L  +LL V+V QGLGLAIG+ +M+ K+AT LGSV++ 
Sbjct  825   TAFVAITYWMAGFKPSATSFMETLYVVLLSVMVSQGLGLAIGSIVMNPKAATVLGSVVIN  884

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPA  263
              FLL GG+Y++ +P F+ WIKYISI  Y YKLLL +QY   ETYPC      C V D P 
Sbjct  885   IFLLTGGYYIQKIPPFMEWIKYISISHYNYKLLLGAQYSADETYPCDFNV-TCRVGDFPT  943

Query  262   IKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             +K  GL +  I S +AL +M + YRL+AY+ALMRVG T+
Sbjct  944   VKYAGLDRKAI-SYIALGIMFLAYRLIAYIALMRVGVTR  981



>ref|XP_003526081.1| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=624

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/634 (61%), Positives = 478/634 (75%), Gaps = 17/634 (3%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M ++E+ T+      + ESD    IF   N PVTLKF +V+YK+K  +     FLK  K 
Sbjct  1     MENMESQTSYKATVQEEESD----IFLTRNSPVTLKFHDVIYKIKTTK---WGFLKNTKA  53

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSN  1673
             +   EK+IL GVTG+   GE+LAMLGPSGSGKTTLL ALGGRLGG L G+ITYNGK FSN
Sbjct  54    E---EKVILNGVTGMAQSGEILAMLGPSGSGKTTLLAALGGRLGGKLHGSITYNGKAFSN  110

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
              MKRNTGFVTQDDILYPHLTV ET+VFTALLRLP++ T +EKI  A +V+ QLGLTKCK+
Sbjct  111   VMKRNTGFVTQDDILYPHLTVVETVVFTALLRLPKSFTTKEKIVHAKSVMAQLGLTKCKD  170

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             SIIGG  LRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST A+RIVSTLWEL+ GG
Sbjct  171   SIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTIAKRIVSTLWELANGG  230

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFL  1136
             RT+VMTIHQPSSR++ +FHKVLLL EGN LYFGKGS  M YFS++G++P ++AMNPSDFL
Sbjct  231   RTVVMTIHQPSSRMYCMFHKVLLLSEGNLLYFGKGSKAMEYFSSIGYAPMTMAMNPSDFL  290

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAG-DQKQFKRW  959
             LDL+NG+  D S  D A  K  L+SA++      L+  LHE+ + D      +   F  W
Sbjct  291   LDLSNGVYTDQSNEDHALNKRKLISAYRNYFDAKLQPVLHEITEYDKCKGRIEDNGFGEW  350

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
                W +QF VLLKR +K+RKY SFSG+++ QVL+VA + G LW+KS  + LQDQ+G+LFF
Sbjct  351   PTSWPQQFLVLLKRDVKERKYASFSGMRICQVLMVALIAGLLWYKSDISHLQDQIGILFF  410

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
             ISSFW    LFQAIFTFP++  +L KERSSGMY+LSS+F++R VGDLPMEL LPT+F+ I
Sbjct  411   ISSFWSSMALFQAIFTFPQELTILKKERSSGMYRLSSYFMSRMVGDLPMELGLPTIFLAI  470

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
              YWMAGLKP   NF   + ++ L VLV QGLGLAI A +M+QKSA+TL SVIM   +L G
Sbjct  471   VYWMAGLKPNVANFIYTMLSVFLNVLVSQGLGLAISAIVMEQKSASTLASVIMPTSILLG  530

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+Y +HVP FI+W+KY S   Y Y L++ SQY   +TYPC++G   CLV +HP IK++GL
Sbjct  531   GYYNQHVPKFIAWLKYFSTHYYVYHLVIGSQYGTSDTYPCSNGQ--CLVAEHPVIKQVGL  588

Query  244   G-QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
               Q  I + +AL +MLIG+RL+AY+ALMR+G TK
Sbjct  589   HLQGKITAALALFIMLIGFRLVAYLALMRIGVTK  622



>ref|XP_008452359.1| PREDICTED: ABC transporter G family member 9-like [Cucumis melo]
Length=575

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/573 (64%), Positives = 454/573 (79%), Gaps = 10/573 (2%)
 Frame = -3

Query  1837  KIILKGVTGIVFPGEVLAMLGPSgs-gkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             K ILKG+ G+V PGE+LAM+GPSGS   T L    G   GG L GTI+YN  PFSN MKR
Sbjct  2     KTILKGINGVVRPGEMLAMMGPSGSGKTTLLTALGGRLGGGRLTGTISYNKNPFSNKMKR  61

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
             N GFVTQDDIL PHLTV ETLVFTALLRLP+ LT Q+K+ QA+ VI+QLGL+KCKNS++G
Sbjct  62    NIGFVTQDDILLPHLTVVETLVFTALLRLPKELTTQQKVGQAEVVISQLGLSKCKNSVVG  121

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK-GGRTI  1304
                +RG+SGGERKRVSI QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE++  GGRT+
Sbjct  122   NQMVRGVSGGERKRVSIAQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEVANNGGRTV  181

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLA  1124
             VMTIHQPSS LFY+FHK+LLL EGN +YFGKGS+ M YFS++G+SPSV MNPSDFLLDL+
Sbjct  182   VMTIHQPSSTLFYMFHKILLLSEGNTVYFGKGSEAMDYFSSLGYSPSVPMNPSDFLLDLS  241

Query  1123  NGITGDDSQADQATVKETLVSAFKTNLL-ENLKMELHELNDED-VSSAGDQKQFKRWAIP  950
             NG++ ++++ +   VKE L+S +K N + E L +EL E ++   V    + K F RW+  
Sbjct  242   NGLSMNEAEEEAGMVKEKLISCYKNNAIAEKLLLELQESDEHHLVEHGAEDKSFGRWSAT  301

Query  949   WWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTD--LQDQVGLLFFISS  776
             W +QFSVLL+RG+K+RK++SFS LK+GQVL V+ + G LWW+S D  LQD++GL +F SS
Sbjct  302   WCQQFSVLLRRGIKERKHDSFSALKIGQVLAVSLICGLLWWQSDDTHLQDKIGLFYFSSS  361

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FWGFFPL QAI TFP+++M+L KERSSGMY+LSS+F++RT  DLPMEL+LPTVF++I Y 
Sbjct  362   FWGFFPLLQAINTFPKERMILEKERSSGMYRLSSYFISRTTTDLPMELILPTVFIVIIYA  421

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             MAGLK T  NFF+ L ++LL VLV QG GLA+GA ++DQ SATT  SVIML FLL  G++
Sbjct  422   MAGLKRTVANFFATLFSLLLSVLVAQGFGLAMGALVLDQTSATTFASVIMLCFLLTSGYF  481

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTS---GSGVCLVEDHPAIKKIGL  245
             V+HVP FI+W KYISIG Y+YKLLL SQYK  +TYPC S   G  VC V + P IK++GL
Sbjct  482   VQHVPKFIAWTKYISIGTYSYKLLLISQYKGSDTYPCPSKDNGGRVCEVGEFPPIKEVGL  541

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                 +F+V+A++ ML+GYRL+AY+ALMR+G TK
Sbjct  542   DGK-LFAVLAMVAMLVGYRLIAYIALMRIGVTK  573



>emb|CDP08055.1| unnamed protein product [Coffea canephora]
Length=641

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/635 (61%), Positives = 473/635 (74%), Gaps = 38/635 (6%)
 Frame = -3

Query  2017  APTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAE  1838
             A    L+ N       S  +F+KA RPV LKF +VVYK+K   +        KK    +E
Sbjct  34    AAYQSLKPNASALEQKSCTLFEKAYRPVALKFVDVVYKIKVKNEGWF-----KKNIERSE  88

Query  1837  KIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRN  1658
             K IL+GV+G+  PGE+LAMLGPSGSGKTTLLTALGG+LGG L G+ITYNG+ FS+ MKRN
Sbjct  89    KTILRGVSGLAMPGEMLAMLGPSGSGKTTLLTALGGQLGGSLTGSITYNGQSFSHVMKRN  148

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
             TGFVTQDDILYPHLTV ETLVFTALLRLP +LTK+E +  A+AVITQLGLT+CKNSIIG 
Sbjct  149   TGFVTQDDILYPHLTVNETLVFTALLRLPNSLTKEENVMLAEAVITQLGLTECKNSIIGS  208

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
               +RG+SGGE KRVSIGQEMLINPSLL LDEPTSGLDST AQ+IVSTL EL+ GGRTIVM
Sbjct  209   RLVRGVSGGECKRVSIGQEMLINPSLLLLDEPTSGLDSTNAQKIVSTLGELANGGRTIVM  268

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANG  1118
             TIHQPSSRLFYLFHKVL+L EGNP+Y+GK  D M YFS VGF P V++NP DFLLDLAN 
Sbjct  269   TIHQPSSRLFYLFHKVLVLSEGNPIYYGKSVDAMDYFSDVGFIPKVSVNPVDFLLDLAN-  327

Query  1117  ITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQ  938
                DDSQ DQ ++K+TLVSA+K  L ENL++EL +  D ++ S  + K +K W   WW+Q
Sbjct  328   ---DDSQDDQVSIKQTLVSAYKAKLTENLQIELKQTTD-NLHSISEGKLYKEWTTTWWQQ  383

Query  937   FSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQ---------VGLL  791
             FSVLL+RG+K+RK+E+FSG+++ Q+LVV+ L G LWW+S     QDQ         +GLL
Sbjct  384   FSVLLRRGMKERKHETFSGIRIFQILVVSILCGLLWWQSNTQHFQDQARLFTLIILIGLL  443

Query  790   FFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFV  611
             FF + FWG+    QAIFTFP++ +ML KER+SGMY+LSS+F+A  +GDLPMELVLP+VF+
Sbjct  444   FFYTVFWGWISASQAIFTFPQEHLMLEKERASGMYRLSSYFMAMAIGDLPMELVLPSVFI  503

Query  610   IISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLL  431
              I+YWMA LK TA +F      +L  VLV QGLGLA+GA ++DQK+A  LGSVIML+F+L
Sbjct  504   TITYWMAALKATAASFLDCWLVLLYAVLVAQGLGLAVGALVVDQKNAMILGSVIMLSFIL  563

Query  430   AGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKI  251
             +GGFYV  VP FI+WIKY+SIG + +KLL+ +                C VED P IK I
Sbjct  564   SGGFYVNQVPGFIAWIKYVSIGHHAFKLLVMT----------------CFVEDLPPIKSI  607

Query  250   GLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             GL   +  S +A+ +ML+GYRL+AY+ALMRVG  K
Sbjct  608   GL-DGLFSSAIAMAIMLVGYRLVAYIALMRVGVKK  641



>gb|KHN36795.1| ABC transporter G family member 9 [Glycine soja]
Length=555

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/556 (68%), Positives = 450/556 (81%), Gaps = 9/556 (2%)
 Frame = -3

Query  1792  VLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLT  1613
             +LAMLGPSGSGKTTLLTALGGRL G L G+ITYNG+ FSN+MKRNTGFVTQDD+LYPHLT
Sbjct  1     MLAMLGPSGSGKTTLLTALGGRLRGKLYGSITYNGEAFSNSMKRNTGFVTQDDVLYPHLT  60

Query  1612  VTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVS  1433
             VTETLVFTALLRLP T++K+EK+++A  VI QLGLTKCK+SI+G  FLRG+SGGERKRVS
Sbjct  61    VTETLVFTALLRLPNTISKEEKVKKAKDVIDQLGLTKCKDSIVGSPFLRGVSGGERKRVS  120

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL+ GGRTIVMTIHQPSSRL+YLFHK
Sbjct  121   IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELACGGRTIVMTIHQPSSRLYYLFHK  180

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKE  1073
             VLLL EGN LYFGKGS+ + YFS +G++P++AMNP+DFLLDLANGI  D+S  D A  K+
Sbjct  181   VLLLSEGNSLYFGKGSEAIEYFSNIGYAPALAMNPADFLLDLANGIYTDESNTDHAIDKQ  240

Query  1072  TLVSAFKTNLLENLK-MELHELNDEDVSSAGDQ-KQFKRWAIPWWEQFSVLLKRGLKQRK  899
              LVS  K N    LK   L  +ND   S    Q K  ++W   W +QF+VLL+R +K+R+
Sbjct  241   KLVSMCKINCAAQLKPAALEGINDSSKSQNRFQEKGSEKWPTSWSQQFTVLLRRDIKERR  300

Query  898   YESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             +ESFS L+V QV VVA ++G LW+KS  + LQDQ+GLLFFIS FWGFFPLFQAIFTFP++
Sbjct  301   HESFSALRVAQVFVVALISGLLWYKSDISHLQDQIGLLFFISGFWGFFPLFQAIFTFPQE  360

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
              +ML KERSSGMY+LSS+F++R V DLPMEL LPT+F++I+YWMAGLK    NF   L  
Sbjct  361   LLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFILITYWMAGLKGKLLNFLYTLLT  420

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             +LL VLV QGLGLA+GA +MDQK+ATTL SV+ML FLLAGGFYV+HVP FISW+KYISI 
Sbjct  421   LLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLAGGFYVQHVPVFISWVKYISIN  480

Query  364   QYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG---QHVIFSVVALLLMLIG  194
              Y Y+L + SQY  GE YPC++G   C V + P+IK+ G     Q  + +  AL++M+IG
Sbjct  481   YYNYQLFIASQYSDGEAYPCSTGQ--CQVAEFPSIKQTGFHFNLQEQVMAASALVIMMIG  538

Query  193   YRLLAYVALMRVGRTK  146
             YRL+AYVALMR+G TK
Sbjct  539   YRLIAYVALMRIGVTK  554



>gb|EPS69022.1| hypothetical protein M569_05746, partial [Genlisea aurea]
Length=577

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/579 (64%), Positives = 453/579 (78%), Gaps = 12/579 (2%)
 Frame = -3

Query  1861  KKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGK  1685
             K  K+EA K ILK V G+VFPGE+LAMLGPSGSGKTTLLTALGGRL G      ITYN K
Sbjct  3     KTPKTEA-KTILKQVAGVVFPGEMLAMLGPSGSGKTTLLTALGGRLSGGTIAGKITYNDK  61

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PF N++KRNTGFVTQDD+LYPHLTVTETL +TALLRLP  LT  EK+ QA+ VITQLGLT
Sbjct  62    PFCNSIKRNTGFVTQDDVLYPHLTVTETLFYTALLRLPGNLTAAEKLSQAEEVITQLGLT  121

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             KC++SI+GG  LRGISGGERKRVSIGQEMLINP LL LDEPTSGLDSTTAQRIVS L +L
Sbjct  122   KCRHSIVGGPLLRGISGGERKRVSIGQEMLINPGLLLLDEPTSGLDSTTAQRIVSLLKDL  181

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPS  1145
             S  G+TIVMTIHQPSSR+FY+F KVLLLC+GNPL+FGKGSD ++YFS +GFSP+VAMNP+
Sbjct  182   SGAGKTIVMTIHQPSSRIFYMFQKVLLLCDGNPLFFGKGSDSLNYFSGIGFSPAVAMNPA  241

Query  1144  DFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVS------SAG  983
             DF LDLANG    DS  DQ  VK+ L+ +++T L   ++ EL   +   +       +  
Sbjct  242   DFFLDLANGYYTGDSSEDQTQVKDLLIKSYRTTLQSTVRKELAGESQLLLHHHHLHVNLS  301

Query  982   DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTDLQDQ  803
             D+K+ + W+  W +QFSVL +RG+K+RK+E FSG ++ QV+ +A L+G LWW S DL+DQ
Sbjct  302   DKKK-RSWSNSWCQQFSVLFRRGMKERKHEYFSGFRIFQVIAIAVLSGLLWWNSHDLEDQ  360

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             VGLLFF S FWGF+PLFQAIF FP++KMML KERSSGMY+LSS+F+A  + DLPM+LVLP
Sbjct  361   VGLLFFTSGFWGFYPLFQAIFIFPKEKMMLKKERSSGMYRLSSYFMALNLSDLPMQLVLP  420

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T F  + Y+M+GL+P+   FFSALS +L  VLV   LGLAIGA +MD+KSAT +G+VIML
Sbjct  421   TAFFAVIYFMSGLRPSPAAFFSALSVLLFSVLVSHSLGLAIGAAVMDEKSATMMGTVIML  480

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPA  263
              FLLAGG+YVRHV  F+SWIKY+SI  YTYKLL+ +Q++ GE Y C  G  VC V D P 
Sbjct  481   GFLLAGGYYVRHVAGFVSWIKYVSISHYTYKLLIGAQFEGGERYDC--GGRVCFVRDFPM  538

Query  262   IKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             +K +GLG    +SV A+++ML+ Y ++AY+ALMR+G T+
Sbjct  539   VKAVGLGGSG-WSVGAMVIMLVVYSVVAYLALMRIGVTR  576



>ref|XP_006855537.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
 gb|ERN17004.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
Length=646

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/636 (57%), Positives = 474/636 (75%), Gaps = 24/636 (4%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVK-PD--QKQGLSFLKTKKQKSEAEKIIL  1826
             A P ++S+T   + ++  +P+++KFE+VVYK+K P+  +K+  S L    ++ +AE+ IL
Sbjct  12    ATPAVDSETHD-LLRQPIQPISVKFEDVVYKIKGPNNKEKEKCSLLPLGARQPDAERTIL  70

Query  1825  KGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagT----------------ITY  1694
             KG+TG V PGE+LA+LGPSGSGKTT L+ALGGRL      +                I Y
Sbjct  71    KGITGAVRPGEMLALLGPSGSGKTTFLSALGGRLPLSSKTSPFAALGGCCPGKLSGSIKY  130

Query  1693  NGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQL  1514
             NG  FS+++ R TGFVTQDDILYPHLTV E+L++TALLRLP TL+K EK+  ADAVI++L
Sbjct  131   NGHHFSDSINRRTGFVTQDDILYPHLTVYESLLYTALLRLPNTLSKGEKVRHADAVISEL  190

Query  1513  GLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTL  1334
             GL+ CK SIIGG FLRG+SGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQRIVSTL
Sbjct  191   GLSACKTSIIGGQFLRGVSGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIVSTL  250

Query  1333  WELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM  1154
             WEL+K GRT+VMTIHQPSSRLFY+FHKV+LL +G+P+Y G+ S  M YF+ +G +PSVAM
Sbjct  251   WELAKAGRTVVMTIHQPSSRLFYMFHKVILLSDGHPVYIGQASTAMEYFAGIGHAPSVAM  310

Query  1153  NPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQK  974
             NP+DFLLDLANG++ D    DQ T K+ LV+A+ TNL   + ++ H      +    +++
Sbjct  311   NPADFLLDLANGVSSDGVDQDQRTAKQRLVTAYATNLKAKVVVDAHAAEQLAMEFGEEKR  370

Query  973   QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQV  800
             + + W   WW+QF VLL+RGLK+R++E+FS LK+ QV  V+ L+G LWW S  T LQDQV
Sbjct  371   KKQEWHTTWWQQFRVLLERGLKERRHEAFSRLKLFQVFTVSLLSGLLWWHSDTTHLQDQV  430

Query  799   GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPT  620
             GLLFF ++FWGFFPLFQ+IFTFP++++ML KERSS MY+LS++F+AR  GDLPMEL+LPT
Sbjct  431   GLLFFCTNFWGFFPLFQSIFTFPQERLMLHKERSSAMYRLSAYFMARIAGDLPMELLLPT  490

Query  619   VFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLA  440
              FV I YWM GLKP   +F   L  +L  VL+  GLGLAIGA +M+ ++ATTLGSVI L 
Sbjct  491   SFVTIIYWMGGLKPDPLHFLCTLFVVLYNVLIAGGLGLAIGAMVMNLRNATTLGSVITLT  550

Query  439   FLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAI  260
             F+L GG++++ VP F++WI+YIS+  YT+KLLL SQY   E Y C  G   C + D P I
Sbjct  551   FMLTGGYFIQKVPVFMAWIRYISMTHYTFKLLLGSQYSVDEMYECEPGKS-CRIADFPMI  609

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             K IGL  H++ S + L +ML+GYRL+AY +L R+G+
Sbjct  610   KAIGL-DHMVRSALVLWIMLVGYRLVAYASLTRIGK  644



>ref|XP_008775311.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/630 (58%), Positives = 478/630 (76%), Gaps = 25/630 (4%)
 Frame = -3

Query  2005  QLQANPQLESDTSAA----IFKKANRPVTLKFENVVYK--VKPDQKQGLSFLKTKKQKSE  1844
             ++Q   QLE+D   A    IF  A  PVTLKFE+VVYK  VK D  +            +
Sbjct  5     EMQPRSQLEADEEGAGRRPIFATARHPVTLKFEDVVYKIEVKADGSR------------K  52

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgg---hlagTITYNGKPFSN  1673
              EK ILKGV+G V PGE+LAM+GPSGSGKTTLLTAL GRL      L+G+ITYNG+PFSN
Sbjct  53    GEKTILKGVSGAVLPGEMLAMMGPSGSGKTTLLTALAGRLARPGRRLSGSITYNGRPFSN  112

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
              ++RN GFV+QDDILYPHLTV+ETL++TALLRLPRTL++ EK  QA+ V+ +LGL  C N
Sbjct  113   QLRRNMGFVSQDDILYPHLTVSETLLYTALLRLPRTLSRTEKAAQAEQVMVELGLLGCCN  172

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             S+IGG  +RGISGGERKRVSIGQE+LINPSLLFLDEPTSGLDST A RIV+T+ +L++GG
Sbjct  173   SMIGGSLVRGISGGERKRVSIGQELLINPSLLFLDEPTSGLDSTIAGRIVTTIADLARGG  232

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             RT+VMTIHQPSSR+FY+FHK+LLL +G+ LYFGKGSD M+YF+++G++P+VAMNP+DFLL
Sbjct  233   RTVVMTIHQPSSRIFYMFHKILLLSDGHTLYFGKGSDAMNYFASIGYAPAVAMNPADFLL  292

Query  1132  DLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAI  953
             DLANG+  D++   +  +KETL SA+   L   +  EL E+  E   S    K    W+ 
Sbjct  293   DLANGLAPDETLESREALKETLSSAYSHRLHNQIVEELREVGGEFKESE-LHKTRNEWST  351

Query  952   PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST-DLQDQVGLLFFISS  776
              WWEQFSVLL+RG+K+RK+++FSG ++ Q+++ AFL G +W+ S   +QDQ+GLL+FI  
Sbjct  352   TWWEQFSVLLQRGMKERKHQAFSGFQIAQIIIAAFLGGFMWYGSRGHVQDQMGLLYFILG  411

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FW F+P+F+A+FTFP+++ ML KER SGMY+LSS+F AR VGDLPMEL+LP VF+ I+YW
Sbjct  412   FWSFYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITYW  471

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             + GLK +  +F   LS +LL VL+ QGLG A+GA +MD K++TTL SVI+L+F+LAGG+Y
Sbjct  472   LGGLKRSLWSFLITLSVMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGYY  531

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V+HVP FI+WIKYIS   YT+K+ + +QY PG+TY C+SG   C VE  PAI  +G   H
Sbjct  532   VQHVPPFIAWIKYISYIYYTFKIQISAQYSPGDTYECSSGQ-RCPVESVPAIAVVGF-SH  589

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                ++ AL +M I +R++AYVALMRVGR K
Sbjct  590   QSLAIAALFIMFIFFRVVAYVALMRVGRIK  619



>ref|XP_008799253.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/631 (58%), Positives = 477/631 (76%), Gaps = 25/631 (4%)
 Frame = -3

Query  2008  TQLQANPQLESDTSAA----IFKKANRPVTLKFENVVYK--VKPDQKQGLSFLKTKKQKS  1847
             T++Q   QLE+D   A    IF  A  PVTLKFE+VVYK  VK D  +            
Sbjct  4     TEMQHRSQLEADEEGAGRRPIFATARHPVTLKFEDVVYKIEVKADGSR------------  51

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgg---hlagTITYNGKPFS  1676
             + EK ILKGV+G V PGE+LAM+GPSGSGKTTLLTAL GRL      L+G+ITYNG+PFS
Sbjct  52    KGEKTILKGVSGAVLPGEMLAMMGPSGSGKTTLLTALAGRLARPGRRLSGSITYNGRPFS  111

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N ++R+ GFV+QDDILYPHLTV+ETL++TALLRLPRTL++ EK  QA+ V+ +LGL  C 
Sbjct  112   NQLRRSMGFVSQDDILYPHLTVSETLLYTALLRLPRTLSRTEKAAQAEQVMVELGLLGCC  171

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             NS+IGG  +RGISGGERKRVS+GQE+LINPSLLFLDEPTSGLDST A RIV+T+ +L++G
Sbjct  172   NSMIGGALVRGISGGERKRVSVGQELLINPSLLFLDEPTSGLDSTIAGRIVTTIADLARG  231

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT+VMTIHQPSSR+FY+FHK+LLL +G+ LYFGKGSD M+YF+++G++P+VAMNP+DFL
Sbjct  232   GRTVVMTIHQPSSRIFYMFHKILLLSDGHTLYFGKGSDAMNYFASIGYAPAVAMNPADFL  291

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
             LDLANG+  D++   Q  +KE L SA+   L   +  EL E+  E   S    K    W+
Sbjct  292   LDLANGLAPDETLQSQEALKEALSSAYSHRLHNQIVEELREVGGEFKESE-LHKTRNEWS  350

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST-DLQDQVGLLFFIS  779
               WWEQFSVLL+RG+K+RK+++FSG +V Q+++VAFL G +W+ S   +QDQ+GLL+FI 
Sbjct  351   TTWWEQFSVLLQRGMKERKHQAFSGFQVAQIIIVAFLGGFMWYGSRGHVQDQMGLLYFIL  410

Query  778   SFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISY  599
              FW F+P+F+A+FTFP+++ ML KER SGMY+LSS+F AR VGDLPMEL+LP VF+ I+Y
Sbjct  411   GFWSFYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITY  470

Query  598   WMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGF  419
             W+ GLK +  +F   LS +LL VL+ QGLG A+GA +MD K++TTL SVI+L+F+LAGG+
Sbjct  471   WLGGLKHSLWSFLITLSIMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGY  530

Query  418   YVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQ  239
             YV+HVP FI+WIKYIS   YT+K+ + +QY  G+TY C SG   C VE  PAI  +G   
Sbjct  531   YVQHVPPFIAWIKYISYIYYTFKIQISAQYSSGDTYEC-SGGQRCPVESVPAIAVVGF-S  588

Query  238   HVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             H   ++ AL +M I +R++AYVALMRVGR K
Sbjct  589   HQSLAIAALFIMFIFFRVVAYVALMRVGRIK  619



>ref|XP_009395262.1| PREDICTED: ABC transporter G family member 9-like [Musa acuminata 
subsp. malaccensis]
Length=622

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/626 (56%), Positives = 469/626 (75%), Gaps = 14/626 (2%)
 Frame = -3

Query  2005  QLQANPQLESDTSA--AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKI  1832
             +LQ   + E + +A  +IF KA+RP+ LKFE+VVYK+K  +K+G      + +  + E++
Sbjct  5     ELQQPDRGEKNDAAPQSIFAKAHRPIDLKFEDVVYKIKTKEKRG------ENKGKQRERV  58

Query  1831  ILKGVTGIVFPGEVLAMLGPSgs--gkttlltalggrlgghlagTITYNGKPFSNAMKRN  1658
             IL G++G V+PGE++AMLGPSGS       + A        L G++TYNGKPFS++++R 
Sbjct  59    ILNGISGTVYPGEMMAMLGPSGSGKTTLLTVLAGRVARTQRLTGSVTYNGKPFSSSLRRR  118

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
              GFV QDD+LYPHLTVTETLVFTALLRLP TL+++EK E+A+AVI +LGLT C++SIIGG
Sbjct  119   MGFVMQDDVLYPHLTVTETLVFTALLRLPGTLSRREKAEKAEAVIEELGLTACRDSIIGG  178

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
              F+RG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDST A RIVSTL +L+KGGRT+ M
Sbjct  179   TFVRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTIAGRIVSTLADLAKGGRTVTM  238

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANG  1118
             TIHQPSSRLFY+FHK+LLL EGN +Y+G+GS+ M YF+++G+SP++ MNP+DFLLDLANG
Sbjct  239   TIHQPSSRLFYMFHKILLLSEGNAIYYGRGSEAMGYFASIGYSPAMPMNPADFLLDLANG  298

Query  1117  ITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDE-DVSSAGDQKQFKRWAIPWWE  941
             I+ +++    A+ KE LV A+  +L   +  EL  L+ + D      +K   +W   WW+
Sbjct  299   ISFNETVEGTASTKEALVDAYNHHLRGKVAEELSGLSQQLDQQQHEAEKMTNQWCTTWWQ  358

Query  940   QFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST-DLQDQVGLLFFISSFWGF  764
             QF+VLL+RGLK+R++E+F+G KV QV++ A + G LW+ S   +QDQ GLLFFI+ FW +
Sbjct  359   QFTVLLQRGLKERRHETFAGRKVAQVIISALIGGILWYGSAGHIQDQAGLLFFIAGFWAY  418

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             +  FQAIFTFP+++ ML KERSSGMY+LSS+F+ART+GDLPMEL LP  FV I+YW+ GL
Sbjct  419   YASFQAIFTFPQERTMLSKERSSGMYRLSSYFIARTLGDLPMELSLPIAFVTITYWLGGL  478

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP A +F   LSA+LL V+V Q LGLAIGAF+ + KS + L +V+M+ F LA GFYV++V
Sbjct  479   KPVASSFLICLSALLLSVVVAQSLGLAIGAFVTNLKSGSALLTVLMVIFQLASGFYVQNV  538

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             P FISW+KY+S   YT+KL + SQY P +TY CT  +  C V + P+ K +G  +  + S
Sbjct  539   PPFISWVKYVSFNYYTFKLQIASQYSPTDTYQCTR-TTTCPVSEFPSFKLLGFDKRAL-S  596

Query  223   VVALLLMLIGYRLLAYVALMRVGRTK  146
             V+AL LM+  +R +AY+ L+RVG  K
Sbjct  597   VIALFLMMFIFRFIAYLGLLRVGIPK  622



>gb|KHN08925.1| ABC transporter G family member 9, partial [Glycine soja]
Length=592

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/598 (63%), Positives = 459/598 (77%), Gaps = 13/598 (2%)
 Frame = -3

Query  1924  FENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttll  1745
             F +V+YK+K  +     FLK  K +   EK+IL GVTG+   GE+LAMLGPSGSGKTTLL
Sbjct  1     FHDVIYKIKTTK---WGFLKNTKAE---EKVILNGVTGMAQSGEILAMLGPSGSGKTTLL  54

Query  1744  talggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
              ALGGRLGG L G+ITYNGK FSN MKRNTGFVTQDDILYPHLTV ET+VFTALLRLP++
Sbjct  55    AALGGRLGGKLHGSITYNGKAFSNVMKRNTGFVTQDDILYPHLTVVETVVFTALLRLPKS  114

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
              T +EKI  A +V+ QLGLTKCK+SIIGG  LRGISGGERKRVSIGQEMLINPSLLFLDE
Sbjct  115   FTTKEKIVHAKSVMAQLGLTKCKDSIIGGPLLRGISGGERKRVSIGQEMLINPSLLFLDE  174

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDST A+RIVSTLWEL+ GGRT+VMTIHQPSSR++ +FHKVLLL EGN LYFGKGS
Sbjct  175   PTSGLDSTIAKRIVSTLWELANGGRTVVMTIHQPSSRMYCMFHKVLLLSEGNLLYFGKGS  234

Query  1204  DVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLK  1028
               M YFS++G++P ++AMNPSDFLLDL+NG+  D S  D A  K  L+SA++      L+
Sbjct  235   KAMEYFSSIGYAPMTMAMNPSDFLLDLSNGVYTDQSNEDHALNKRKLISAYRNYFDAKLQ  294

Query  1027  MELHELNDEDVSSAG-DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVA  851
               LHE+ + D      +   F  W   W +QF VLLKR +K+RKY SFSG+++ QVL+VA
Sbjct  295   PVLHEITEYDKCKGRIEDNGFGEWPTSWPQQFLVLLKRDVKERKYASFSGMRICQVLMVA  354

Query  850   FLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLS  677
              + G LW+KS  + LQDQ+G+LFFISSFW    LFQAIFTFP++  +L KERSSGMY+LS
Sbjct  355   LIAGLLWYKSDISHLQDQIGILFFISSFWSSMALFQAIFTFPQELTILKKERSSGMYRLS  414

Query  676   SFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIG  497
             S+F++R VGDLPMEL LPT+F+ I YWMAGLKP   NF   + ++ L VLV QGLGLAI 
Sbjct  415   SYFMSRMVGDLPMELGLPTIFLAIVYWMAGLKPNVANFIYTMLSVFLNVLVSQGLGLAIS  474

Query  496   AFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGE  317
             A +M+QKSA+TL SVIM   +L GG+Y +HVP FI+W+KY S   Y Y L++ SQY   +
Sbjct  475   AIVMEQKSASTLASVIMPTSILLGGYYNQHVPKFIAWLKYFSTHYYVYHLVIGSQYGTSD  534

Query  316   TYPCTSGSGVCLVEDHPAIKKIGLG-QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             TYPC++G   CLV +HP IK++GL  Q  I + +AL +MLIG+RL+AY+ALMR+G TK
Sbjct  535   TYPCSNGQ--CLVAEHPVIKQVGLHLQGKITAALALFIMLIGFRLVAYLALMRIGVTK  590



>gb|KEH19433.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=635

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/645 (61%), Positives = 490/645 (76%), Gaps = 16/645 (2%)
 Frame = -3

Query  2050  METATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSF  1871
             M+   EM DIEA +T       L+ + S  IF K N PVTLKF +VVYK+   +K  L  
Sbjct  1     MDMEKEMQDIEAQSTY---KTTLQKEASK-IFHKRNPPVTLKFHDVVYKINKTKKWKLLE  56

Query  1870  LKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYN  1691
              KTK +    EK+IL GVTG+V PGE+LA+LGPSGSGKTTLLTALGGRLGG L+GTITYN
Sbjct  57    RKTKVE----EKVILNGVTGMVRPGEILAILGPSGSGKTTLLTALGGRLGGKLSGTITYN  112

Query  1690  GKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLG  1511
             GK FSN+MK++ GFVTQ+DILYPHLTVTETLVFT+LLRLP + T++EKIE A +V+  LG
Sbjct  113   GKIFSNSMKKSIGFVTQEDILYPHLTVTETLVFTSLLRLPNSFTEKEKIELAKSVMALLG  172

Query  1510  LTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLW  1331
             LTKCK+SIIG   LRG+SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ+IV  LW
Sbjct  173   LTKCKDSIIGKPMLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVFNLW  232

Query  1330  ELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMN  1151
             EL+ GGRT VMTIHQPSSR++ +FH VL+L EG PLY+GKGS+ M YFS +G+ P +AM+
Sbjct  233   ELASGGRTFVMTIHQPSSRIYNMFHTVLILSEGVPLYYGKGSEAMEYFSGIGYEPEIAMS  292

Query  1150  PSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDED--VSSAGDQ  977
             PSDFLLDLANG+  D S  D A  K  L+SA+K       K  + + N ++  + S  + 
Sbjct  293   PSDFLLDLANGVYTDQSNEDHALNKNELISAYKNYFDAKWKPIILDENPDNGEIQSGFED  352

Query  976   KQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQ  803
               F +W+  W +QF VLLKR LK+RK+E FS L++ +++V+A LTG LW+KS  + LQDQ
Sbjct  353   SGFGKWSTSWSQQFIVLLKRDLKERKHEPFSVLRISKIVVIALLTGLLWYKSSVSHLQDQ  412

Query  802   VGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLP  623
             +GLLFFI+SFW   P ++AIFTFP++  ML KERSSGMY+LSS+F++R + DLPMEL+LP
Sbjct  413   IGLLFFINSFWAVVPFYKAIFTFPQEATMLEKERSSGMYRLSSYFMSRMIVDLPMELILP  472

Query  622   TVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIML  443
             T+++II Y+M GLKP   NF   L ++LL VLV QGLGLAIGA IM+QKSA TLGS+I+L
Sbjct  473   TIYIIIIYFMTGLKPNVINFLYTLFSLLLNVLVSQGLGLAIGAIIMEQKSAITLGSIILL  532

Query  442   AFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPA  263
             +F+L  GFYV+HVP FI+WIKYISI  Y YKL L SQY   +TYPC++G   CL+ + P 
Sbjct  533   SFVLVVGFYVQHVPKFIAWIKYISITYYIYKLALGSQYDINDTYPCSNGK--CLIAEFPL  590

Query  262   IKKIG-LG-QHVIFSVVALLLMLIGYRLLAYVALMRVGRTK*LSL  134
             I+++G L  Q  + +V  L +MLIGYRL+AY ALMR+G TK +S+
Sbjct  591   IRQMGELNLQGQLMAVFLLFIMLIGYRLMAYFALMRIGVTKKISI  635



>emb|CAB43874.1| putative protei [Arabidopsis thaliana]
 emb|CAB81392.1| putative protein [Arabidopsis thaliana]
Length=635

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/664 (59%), Positives = 479/664 (72%), Gaps = 54/664 (8%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             D QE ++        D+E P  +   +  L      +IFKKAN PVTLKFEN+VY VK  
Sbjct  2     DNQEVSM--------DVETPIAKTNDDRSLP----FSIFKKANNPVTLKFENLVYTVKLK  49

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta---lggrlg  1721
               QG  F K  K +   E+ ILKG+TGIV PGE+LAMLGPSGSGKT+LLTA     G   
Sbjct  50    DSQG-CFGKNDKTE---ERTILKGLTGIVKPGEILAMLGPSGSGKTSLLTALGGRVGEGK  105

Query  1720  ghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIE  1541
             G L G I+YN KP S A+KR TGFVTQDD LYP+LTVTETLVFTALLRLP +  KQEKI+
Sbjct  106   GKLTGNISYNNKPLSKAVKRTTGFVTQDDALYPNLTVTETLVFTALLRLPNSFKKQEKIK  165

Query  1540  QADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDST  1361
             QA AV+T+LGL +CK++IIGG FLRG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST
Sbjct  166   QAKAVMTELGLDRCKDTIIGGPFLRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDST  225

Query  1360  TAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFST  1181
             TAQRIVS LWEL++GGRT+V TIHQPS              +GNP+YFG GS+ M YF++
Sbjct  226   TAQRIVSILWELARGGRTVVTTIHQPS--------------KGNPVYFGLGSNAMDYFAS  271

Query  1180  VGFSPSVA-MNPSDFLLDLANG-----------ITGDDSQADQATVKETLVSAFKTNLLE  1037
             VG+SP V  +NPSDFLLD+ANG           +  D+SQ  +A +K  LV+ +KTNLL+
Sbjct  272   VGYSPLVERINPSDFLLDIANGKPLLVISCWPSVGSDESQRPEA-MKAALVAFYKTNLLD  330

Query  1036  NLKMELHELND----EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVG  869
             ++  E+   +D       SS      +  W   WW+QF VLLKRGLKQR+++SFSG+KV 
Sbjct  331   SVINEVKGQDDLCNKPRESSRVATNTYGDWPTTWWQQFCVLLKRGLKQRRHDSFSGMKVA  390

Query  868   QVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSS  695
             Q+ +V+FL G LWW++  + LQDQ+GLLFFISSFW FFPLFQ IFTFP+++ ML KERSS
Sbjct  391   QIFIVSFLCGLLWWQTKISRLQDQIGLLFFISSFWAFFPLFQQIFTFPQERAMLQKERSS  450

Query  694   GMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqg  515
             GMY+LS +FL+R VGDLPMEL+LPT F++I+YWMAGL     NFF  L  +L+ VLV  G
Sbjct  451   GMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAGLNHNLANFFVTLLVLLVHVLVSGG  510

Query  514   lgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLES  335
             LGLA+GA +MDQKSATTLGSVIML FLLAGG+YV+HVP FISWIKY+SIG YTYKLL+  
Sbjct  511   LGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQHVPVFISWIKYVSIGYYTYKLLILG  570

Query  334   QYKPGETYPC-TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             QY   E YPC  +G   C V D   IK IG    ++ S +AL  ML+ YR++AY+AL R+
Sbjct  571   QYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLV-SALALTAMLVVYRVIAYIALTRI  629

Query  157   GRTK  146
             G+TK
Sbjct  630   GKTK  633



>ref|XP_010921129.1| PREDICTED: ABC transporter G family member 9 [Elaeis guineensis]
Length=619

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/630 (59%), Positives = 485/630 (77%), Gaps = 23/630 (4%)
 Frame = -3

Query  2008  TQLQANPQLESDTSAA----IFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE-  1844
             T++Q   QLE+    A    IF KA+ PVT+KFE+VVY +K           TK   S+ 
Sbjct  4     TEMQTRSQLEAAEEGAGRRSIFAKASHPVTIKFEDVVYMIK-----------TKANGSKK  52

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgg---hlagTITYNGKPFSN  1673
              EK ILKGV+G V PGE+LAM+GPSGSGKTTLLTALGGRL      L+G+ITYNG+PFSN
Sbjct  53    GEKTILKGVSGAVVPGEMLAMMGPSGSGKTTLLTALGGRLARPGRRLSGSITYNGRPFSN  112

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
             +++RN GFV QDDILYPHLTV+ETL++TALLRLPRTL++ EK  QA+AV+ +LGL  C N
Sbjct  113   SLRRNMGFVNQDDILYPHLTVSETLLYTALLRLPRTLSRDEKAAQAEAVMAELGLLGCSN  172

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             S+IGG  +RGISGGERKRVSIGQE+LINPSLL LDEPTSGLDST A RIV+T+ +L++GG
Sbjct  173   SMIGGSLVRGISGGERKRVSIGQELLINPSLLLLDEPTSGLDSTIAGRIVTTIADLTRGG  232

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             RT++MTIHQPSSR+FY+FHK+LLL +G+ +YFGKGSD M+YF+++G++P+V MNP+DFLL
Sbjct  233   RTVLMTIHQPSSRIFYMFHKILLLSDGHTIYFGKGSDAMNYFASIGYAPAVPMNPADFLL  292

Query  1132  DLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAI  953
             DLANG+  D++  ++A +KETL SA+  +L + +  EL E+  E V  +   K    W  
Sbjct  293   DLANGLAPDETLENRAALKETLFSAYSDHLHDQIIEELQEVGRE-VKVSEPHKTTNAWCT  351

Query  952   PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-TDLQDQVGLLFFISS  776
              WWEQFSVLL+R +K+RK+++FSGL+V Q+LV AFL G +W+ S   +QDQ+GLL+F   
Sbjct  352   TWWEQFSVLLRRDMKERKHQAFSGLQVAQILVTAFLGGFMWFGSGGHVQDQMGLLYFAVG  411

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FW F+P +QAIFTFP+++ ML KER SGMY+LSS+++AR VGDLPMEL+LP VF+ I+YW
Sbjct  412   FWSFYPAYQAIFTFPQERTMLTKERVSGMYRLSSYYVARMVGDLPMELILPIVFITITYW  471

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             + GLK TA +FF  L  +LL VL+ QGLG A+GA +MD K++TTL SVI+L+F+LAGGF+
Sbjct  472   LGGLKRTASSFFITLFVMLLEVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGFF  531

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V+HVP FI+WIKYIS   YT+K+ + SQ+ PGETY C SG   C +ED P I  +GL  H
Sbjct  532   VQHVPRFIAWIKYISYIYYTFKVQISSQFSPGETYQC-SGGHRCPIEDVPMISAVGL-DH  589

Query  235   VIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
                +V AL +MLI +R++AYVALMR+GR K
Sbjct  590   RSLAVAALFMMLIFFRVVAYVALMRIGRIK  619



>ref|XP_004134252.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
 ref|XP_004155283.1| PREDICTED: ABC transporter G family member 9-like [Cucumis sativus]
Length=628

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/634 (59%), Positives = 479/634 (76%), Gaps = 13/634 (2%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M DIEA T +     +L+   +    +K NRPVTL+F +V YK+K        FL  KK 
Sbjct  1     MADIEASTNK---TTELDCLGAVVFLRKPNRPVTLRFNDVHYKIKSKHTW---FLIPKKP  54

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSN  1673
             + E EK ILKG++G+V P E+L +LGPSGSGK+TLLTAL GRL G L G ITYNGKPFS+
Sbjct  55    QWE-EKTILKGLSGLVRPAEMLVILGPSGSGKSTLLTALSGRLSGRLDGAITYNGKPFSS  113

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
              MK   GFVTQDDIL+PHLT+ ETLVFTALLRLP TLTKQEK+ + +A I+QLGLT+CKN
Sbjct  114   EMKHRIGFVTQDDILHPHLTIAETLVFTALLRLPNTLTKQEKLAEVEATISQLGLTRCKN  173

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             +I+G   LRG+SGGERKRV IGQEMLINPSLLFLDEPTSGLDSTTAQ IV+ + E +KGG
Sbjct  174   TIVGSPILRGVSGGERKRVCIGQEMLINPSLLFLDEPTSGLDSTTAQTIVTMMGEFAKGG  233

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             R ++MT+HQPSSRLFYLFHK+LLL EGN +Y+GKGS+VM YF ++G+SPS+ MNPSDFLL
Sbjct  234   RAVIMTVHQPSSRLFYLFHKLLLLLEGNAVYYGKGSEVMDYFLSIGYSPSLPMNPSDFLL  293

Query  1132  DLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD---QKQFKR  962
             DLANG++ +D   D   VK+ LVS++K N+ +NLK E+ E ++E     GD   +  F+ 
Sbjct  294   DLANGLSMNDPNEDPTIVKQKLVSSYKNNIADNLKREVQESDEEHYYWCGDGSHEDNFEI  353

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTD--LQDQVGLLF  788
             W   WW+Q +VL +R +K+R+YESFS +K  QVLV+AFL G LWW+S D  LQD++GL +
Sbjct  354   WPTTWWQQVAVLWRREIKERRYESFSSIKFVQVLVIAFLAGFLWWQSDDSHLQDKLGLFY  413

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
              I SFW F P  +AI TF  ++ +L KERSS MYKLSS+F+++TV DLPMEL LPT+F++
Sbjct  414   SIQSFWTFLPTLKAISTFSNEQKILEKERSSAMYKLSSYFISKTVNDLPMELALPTLFIL  473

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I YWM GLKPT  NFF+ L  +LL VLVCQG G A+GA +MDQ  A+  G+V+ LAFLL 
Sbjct  474   IVYWMTGLKPTLPNFFATLFTLLLNVLVCQGFGFALGAVLMDQTVASISGTVLALAFLLT  533

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
              GF+V+HVP FI+WIKY+S G ++YKL+L SQ+K  +TYPC++  GVC V + P IK+IG
Sbjct  534   SGFFVQHVPKFIAWIKYLSSGHFSYKLMLISQFKGDDTYPCSNIGGVCKVGEFPVIKQIG  593

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             L    + +V+AL++M +GYR +AYVALMR+G  K
Sbjct  594   LEGKAM-TVLALVVMFVGYRFIAYVALMRIGVIK  626



>ref|XP_008452272.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
9-like [Cucumis melo]
Length=629

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/635 (60%), Positives = 482/635 (76%), Gaps = 14/635 (2%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M DIEA T ++    +L+   + A  +K   PVTL+F ++ YK+K  Q++   FL  KK 
Sbjct  1     MADIEAQTNKMT---ELDCSEAIAFSRKPKPPVTLRFNDLHYKIKSKQRR---FLIPKKP  54

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSN  1673
             + E EK ILKG++G+V P E+L +LGPSGSGK+TLLTAL GRLGG L G+ITYNGKPFS+
Sbjct  55    QCE-EKTILKGLSGLVCPAEMLVILGPSGSGKSTLLTALSGRLGGRLDGSITYNGKPFSS  113

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
              MK   GFVTQDDIL+PHLTV ETLVFTALLRLP TLTKQEK+ + +  I+QLGLT+CK+
Sbjct  114   EMKHRIGFVTQDDILHPHLTVAETLVFTALLRLPNTLTKQEKLAEVEVTISQLGLTRCKS  173

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             +I+G   LRG+SGGERKRV IGQEMLINPSL+FLDEPTSGLDSTTAQ IV+ + E +KGG
Sbjct  174   TIVGSPVLRGVSGGERKRVCIGQEMLINPSLMFLDEPTSGLDSTTAQTIVTMMGEFAKGG  233

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             RT+VMT+HQPSSRLFYLFHK+LLL EGN +YFGKGS+VM YFST+G+SPSV MNPSDFLL
Sbjct  234   RTVVMTVHQPSSRLFYLFHKLLLLLEGNAVYFGKGSEVMDYFSTIGYSPSVPMNPSDFLL  293

Query  1132  DLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD----QKQFK  965
             DLANG++ +D   D   VK+ LVS++K N+ E LK E+ E +++     GD        +
Sbjct  294   DLANGLSMNDPNEDPKIVKQKLVSSYKNNIAEKLKREVQESDEDHYYWCGDGSNEDNNIE  353

Query  964   RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTD--LQDQVGLL  791
              W   WW+QF+VLL R +K+R+YESFS +K  QV+ +AFL G LWW+S D  L D++GL 
Sbjct  354   IWPTTWWQQFAVLLIREIKERRYESFSSIKFVQVVAIAFLAGFLWWQSDDSHLHDKLGLF  413

Query  790   FFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFV  611
             + I SFW F P  +AI TF  ++ +L KERSS MYKLSS+F+++TV DLPMEL LPT+F+
Sbjct  414   YSIQSFWTFLPTLKAISTFSNEQKILEKERSSAMYKLSSYFISKTVNDLPMELALPTLFI  473

Query  610   IISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLL  431
             +I YWM GLKPT  NFFS L  +LL VLVCQGLG A+GA IMDQ SA+  GSV+ LAFLL
Sbjct  474   LIVYWMTGLKPTFPNFFSTLFTVLLNVLVCQGLGFALGALIMDQTSASIFGSVLALAFLL  533

Query  430   AGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKI  251
               GF+V+HVP FI+WIKY+S G ++YKL+L SQ+K  +TYPC++  GVC V + P IK+I
Sbjct  534   TSGFFVQHVPKFIAWIKYVSSGHFSYKLMLISQFKGDDTYPCSNIGGVCKVGEFPVIKEI  593

Query  250   GLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             GL    + +V+ L++M + YR +AYVALMR+G TK
Sbjct  594   GLEGKAM-TVLVLVVMFVVYRFIAYVALMRIGVTK  627



>gb|KDP27020.1| hypothetical protein JCGZ_20955 [Jatropha curcas]
Length=568

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/633 (59%), Positives = 453/633 (72%), Gaps = 70/633 (11%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M DIEA  T+ +         +A I KKAN PVTLKFE+VVYKV+P +K     L  K  
Sbjct  1     MEDIEAQMTEKKER------EAATILKKANSPVTLKFEDVVYKVEPTKKG----LCQKGI  50

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFS  1676
               + EK+ILKG+TG V PGE+LAMLGPSG GKTTLLTALGG+L       TITYNGKPFS
Sbjct  51    IKKEEKVILKGITGFVLPGEMLAMLGPSGCGKTTLLTALGGKLIDGKLEGTITYNGKPFS  110

Query  1675  NAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCK  1496
             N MKRN+GFVTQ DILYPHLTVTETLVFTA LRLP +LTK+EKI  A+AVITQLGL KCK
Sbjct  111   NVMKRNSGFVTQHDILYPHLTVTETLVFTAFLRLPNSLTKEEKIMHAEAVITQLGLVKCK  170

Query  1495  NSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKG  1316
             N+IIGG FLRG+SGGERKRVSIGQE+L+NPSLLFLDEPTSGLDSTTAQRIVS++WEL+KG
Sbjct  171   NTIIGGPFLRGVSGGERKRVSIGQELLVNPSLLFLDEPTSGLDSTTAQRIVSSVWELAKG  230

Query  1315  GRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFL  1136
             GRT+VMTIHQP SRL                                             
Sbjct  231   GRTVVMTIHQP-SRL---------------------------------------------  244

Query  1135  LDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWA  956
                    +  D+   QA VK+TLVSA+K NL   LK E+   ++  +      KQ+  W 
Sbjct  245   ------ASQSDAGNAQAKVKQTLVSAYKNNLANKLKAEIEAADNRHLQDGLTNKQYSEWP  298

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
             I WW+QF +L +RG+K+RK++SFSG ++ QVLV++ L+G LWW+S  + LQDQ+GLLFF 
Sbjct  299   ITWWQQFQILFRRGIKERKHKSFSGRRIVQVLVMSLLSGLLWWQSDTSHLQDQIGLLFFC  358

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             + FWGF PL+QAIFTFP ++ ML KERSSG Y+LSS+F++R  GDLPMEL+LPT+FV I+
Sbjct  359   TGFWGFIPLYQAIFTFPTERRMLAKERSSGTYRLSSYFISRMAGDLPMELLLPTIFVTIT  418

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGLKPT  NF   L  +L  VL+ Q LGLA+GA IM+QKSAT LGS+I L+F LAGG
Sbjct  419   YWMAGLKPTPQNFLHTLFVLLFNVLLWQSLGLALGALIMNQKSATILGSIINLSFQLAGG  478

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL-  245
             +++R VP FI+WIKYISI +YTYKLLL SQYKP ETYPC  G GVC + ++P+IK +GL 
Sbjct  479   YFIRQVPFFIAWIKYISISRYTYKLLLGSQYKPSETYPC--GDGVCSIRNYPSIKIVGLD  536

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             GQ  + S  AL +M +GYRL+AY+ALMR+G T+
Sbjct  537   GQ--LLSAFALGIMFLGYRLIAYLALMRIGATR  567



>ref|XP_006447786.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
 gb|ESR61026.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
Length=608

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/626 (56%), Positives = 466/626 (74%), Gaps = 31/626 (5%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             DI    T  + +  LE+   + +F +A  PVTLKFE++VYK+K   K+G  F  + K+  
Sbjct  10    DINEAQTDQKEDQLLEA---SDVFTRAKHPVTLKFEDIVYKIK--MKKG--FYGSNKKIE  62

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
             E  K ILKG+TG+V PGE+LA+LG                        +  +G   +  +
Sbjct  63    E--KAILKGITGMVKPGEMLAILG-------------------LKLAMLGPSGCGKTTLL  101

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
                 GFVTQ+D+L P+LTVTET+VFTALL+LP + T++EKI+ A+AV+T+LGL++CKNS+
Sbjct  102   TALGGFVTQEDVLSPYLTVTETMVFTALLQLPNSFTEKEKIKCAEAVMTELGLSECKNSL  161

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG   RG+SGGERKRVSIGQE+LINPSLLFLDEPTSGLDST AQ+I+S L +L+ GGRT
Sbjct  162   IGGPLTRGVSGGERKRVSIGQEILINPSLLFLDEPTSGLDSTIAQQILSILLKLANGGRT  221

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDL  1127
             I+MTIHQP + L+Y+FHKVLLL EG PLY G+ S  M+YF+++G+ PSV  NPSDFLLDL
Sbjct  222   ILMTIHQPCNMLYYMFHKVLLLSEGYPLYSGEASGAMNYFASIGYCPSVPTNPSDFLLDL  281

Query  1126  ANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPW  947
             A+G+  + S  +QA VK+TL+S ++ NL + LK EL + N+ +     + KQF+R++  W
Sbjct  282   ASGMPSNGSWKEQALVKQTLISQYEKNLADKLKAELTQENENESQDQPEDKQFRRFSTTW  341

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSF  773
             W+QF VL++RG+K+   ESFS LK+ +VLV+AFL+G LWW+S+   +QDQ+GLLFF   F
Sbjct  342   WQQFRVLVRRGIKEIMDESFSCLKIIEVLVIAFLSGLLWWQSSIYQIQDQIGLLFFFCDF  401

Query  772   WGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWM  593
             WGFFP+ + IFT P+++ ML KE SSGMY+LS++F++R + DLP++LV+PTVFV I+YWM
Sbjct  402   WGFFPMLECIFTLPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWM  461

Query  592   AGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYV  413
             AGLKPTA NFF  L  +L  VL  QGLGLAIGA +M+QKSAT LGS+IM  F+LAGG+YV
Sbjct  462   AGLKPTASNFFETLFVLLFSVLESQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYV  521

Query  412   RHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHV  233
             ++VPSFI+W+KY+SIG +TYKLLL SQY   ETYPC    G+CLV +HP IKK+GL +  
Sbjct  522   QNVPSFIAWLKYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLNRKD  581

Query  232   IFSVVALLLMLIGYRLLAYVALMRVG  155
              +SV+AL +ML+GYRL+AY+ALMR+G
Sbjct  582   -YSVIALAIMLVGYRLIAYIALMRIG  606



>gb|KGN56224.1| hypothetical protein Csa_3G102320 [Cucumis sativus]
Length=609

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/634 (58%), Positives = 469/634 (74%), Gaps = 32/634 (5%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQ  1853
             M DIEA T +     +L+   +    +K NRPVTL+        KP  +           
Sbjct  1     MADIEASTNK---TTELDCLGAVVFLRKPNRPVTLR--------KPQWE-----------  38

Query  1852  KSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSN  1673
                 EK ILKG++G+V P E+L +LGPSGSGK+TLLTAL GRL G L G ITYNGKPFS+
Sbjct  39    ----EKTILKGLSGLVRPAEMLVILGPSGSGKSTLLTALSGRLSGRLDGAITYNGKPFSS  94

Query  1672  AMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKN  1493
              MK   GFVTQDDIL+PHLT+ ETLVFTALLRLP TLTKQEK+ + +A I+QLGLT+CKN
Sbjct  95    EMKHRIGFVTQDDILHPHLTIAETLVFTALLRLPNTLTKQEKLAEVEATISQLGLTRCKN  154

Query  1492  SIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGG  1313
             +I+G   LRG+SGGERKRV IGQEMLINPSLLFLDEPTSGLDSTTAQ IV+ + E +KGG
Sbjct  155   TIVGSPILRGVSGGERKRVCIGQEMLINPSLLFLDEPTSGLDSTTAQTIVTMMGEFAKGG  214

Query  1312  RTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLL  1133
             R ++MT+HQPSSRLFYLFHK+LLL EGN +Y+GKGS+VM YF ++G+SPS+ MNPSDFLL
Sbjct  215   RAVIMTVHQPSSRLFYLFHKLLLLLEGNAVYYGKGSEVMDYFLSIGYSPSLPMNPSDFLL  274

Query  1132  DLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGD---QKQFKR  962
             DLANG++ +D   D   VK+ LVS++K N+ +NLK E+ E ++E     GD   +  F+ 
Sbjct  275   DLANGLSMNDPNEDPTIVKQKLVSSYKNNIADNLKREVQESDEEHYYWCGDGSHEDNFEI  334

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKSTD--LQDQVGLLF  788
             W   WW+Q +VL +R +K+R+YESFS +K  QVLV+AFL G LWW+S D  LQD++GL +
Sbjct  335   WPTTWWQQVAVLWRREIKERRYESFSSIKFVQVLVIAFLAGFLWWQSDDSHLQDKLGLFY  394

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
              I SFW F P  +AI TF  ++ +L KERSS MYKLSS+F+++TV DLPMEL LPT+F++
Sbjct  395   SIQSFWTFLPTLKAISTFSNEQKILEKERSSAMYKLSSYFISKTVNDLPMELALPTLFIL  454

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I YWM GLKPT  NFF+ L  +LL VLVCQG G A+GA +MDQ  A+  G+V+ LAFLL 
Sbjct  455   IVYWMTGLKPTLPNFFATLFTLLLNVLVCQGFGFALGAVLMDQTVASISGTVLALAFLLT  514

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
              GF+V+HVP FI+WIKY+S G ++YKL+L SQ+K  +TYPC++  GVC V + P IK+IG
Sbjct  515   SGFFVQHVPKFIAWIKYLSSGHFSYKLMLISQFKGDDTYPCSNIGGVCKVGEFPVIKQIG  574

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVALMRVGRTK  146
             L    + +V+AL++M +GYR +AYVALMR+G  K
Sbjct  575   LEGKAM-TVLALVVMFVGYRFIAYVALMRIGVIK  607



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/657 (57%), Positives = 465/657 (71%), Gaps = 23/657 (4%)
 Frame = -3

Query  2101  HCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKF  1922
             +C    P  +    A      +EM D       + AN Q         F++   P+TLKF
Sbjct  4     NCIAPRPEENGGGLAQGQADKSEMQDKAVLAFPIMANSQ-------PGFQQTLYPITLKF  56

Query  1921  ENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllt  1742
             E +VYKVK +QK            S  EK IL G+TG+V PGE+LAMLGPSGSGKTTLL+
Sbjct  57    EEIVYKVKIEQKG-----SCWGTWSSKEKRILNGITGMVCPGEILAMLGPSGSGKTTLLS  111

Query  1741  alggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTL  1562
             ALGGRL G  +G ITYNG PFS ++KR TGFV QDDILYPHLTV ETL FTALLRLP +L
Sbjct  112   ALGGRLSGTFSGKITYNGLPFSGSIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSL  171

Query  1561  TKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEP  1382
             T+ EK +  D VIT+LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEP
Sbjct  172   TRDEKADHVDRVITELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  231

Query  1381  TSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSD  1202
             TSGLDSTTAQRIV+T+  L+ GGRT++ TIHQPSSRL+++F KV+LL EG+P+Y+G  S 
Sbjct  232   TSGLDSTTAQRIVTTIKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGSPIYYGPASS  291

Query  1201  VMSYFSTVGFSPSVAMNPSDFLLDLANGITGD----DSQADQATVKETLVSAFKTNLLEN  1034
              + YFS+VGFS S+ +NP+D LLDLANGIT D    +S+ +Q TVKE LVSA++ N+   
Sbjct  292   ALEYFSSVGFSTSMTVNPADLLLDLANGITPDSQAENSEQEQKTVKEALVSAYEKNISTK  351

Query  1033  LKMEL--HELNDEDVSSAGDQK-QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQV  863
             LK EL   E +  D + AG    + ++W   WW QFSVLL+RG+++R+YESF+ L++ QV
Sbjct  352   LKAELCNSESHGNDYAKAGGNNFKPEQWCTSWWYQFSVLLQRGVRERRYESFNKLRIFQV  411

Query  862   LVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGM  689
             + VAFL G LWW +  + +QD+V LLFF S FWGF+PL+ A+FTFP++K ML KERSSGM
Sbjct  412   VSVAFLGGLLWWHTPKSHIQDRVALLFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGM  471

Query  688   YKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglg  509
             Y+LSS+F+AR +GDLP+EL LPT FV I YWM GLKP    F  +L  +L  VLV QGLG
Sbjct  472   YRLSSYFMARNIGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYNVLVAQGLG  531

Query  508   LAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQY  329
             LA GAF+M+ K ATTL SV  L FL+AGG+YV+H+P FI W+KY+S   Y YKLLL  QY
Sbjct  532   LAFGAFLMNIKQATTLASVTTLVFLIAGGYYVQHIPPFIVWLKYLSYSYYCYKLLLGVQY  591

Query  328   KPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
                + Y C+ G   C V D PA+K +GL    I  V  + LML+GYR +AY+AL RV
Sbjct  592   SDDDYYECSKGV-WCRVGDFPAVKSMGLNSLWI-DVSVMALMLVGYRFIAYMALHRV  646



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/664 (55%), Positives = 474/664 (71%), Gaps = 26/664 (4%)
 Frame = -3

Query  2101  HCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKF  1922
             +C    P   +   +  +E   EM   E   + + ++P   ++      K    P+TLKF
Sbjct  4     NCIAPKPEYCNSHHS--VEGPQEM--TEPHNSTVLSHPMQTNEQQQPFPKLIMYPITLKF  59

Query  1921  ENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllt  1742
             E +VYKVK +QK G  +  T   K   EK IL G+TG+V PGE+LAMLGPSGSGKTTLLT
Sbjct  60    EELVYKVKLEQKGG-CWGSTWTCK---EKTILNGITGVVCPGEILAMLGPSGSGKTTLLT  115

Query  1741  alggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTL  1562
             ALGGRL G L+G ITYNG+PFS AMKR TGFV QDD+LYPHLTVTETLVFTALLRLP +L
Sbjct  116   ALGGRLSGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSL  175

Query  1561  TKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEP  1382
             T+ EK++  + VIT+LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEP
Sbjct  176   TRDEKVQHVERVITELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  235

Query  1381  TSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSD  1202
             TSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+Y+F KV+LL EG P+Y+G  S 
Sbjct  236   TSGLDSTTAQRILNTIKRLASGGRTVVTTIHQPSSRLYYMFDKVVLLSEGCPIYYGAAST  295

Query  1201  VMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA---------DQATVKETLVSAFKT  1049
              + YFS+VGFS  V +NP+D LLDLANGI  D  QA         ++  V+E+L+SA++ 
Sbjct  296   ALDYFSSVGFSTCVTVNPADLLLDLANGIAPDSKQAAEQNEGLEQERKQVRESLISAYEK  355

Query  1048  NLLENLKMELH--ELNDEDVS---SAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
             N+  +LK E+   E+N+ +++    A +  + ++W+  WW QF VLL+RG+K+R+YE+F+
Sbjct  356   NIATSLKAEVCSLEVNNHNITKDACARNSIKPEQWSTSWWHQFKVLLQRGVKERRYEAFN  415

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + ++D+V LLFF S FWGF+PL+ A+FTFP+++ ML 
Sbjct  416   RLRIFQVVSVAFLGGLLWWHTPESHIEDRVALLFFFSVFWGFYPLYNAVFTFPQERRMLI  475

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+FLART+GDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  476   KERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMGGLKPDPVTFILSLLVVLYSV  535

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             +V Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YK
Sbjct  536   VVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYK  595

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G  +C V D P IK +GL  H+   V  + LML+GYRL+AY A
Sbjct  596   LLLGVQYNENDYYECSKGE-LCKVADFPPIKSMGL-NHLWVDVFIMALMLVGYRLVAYFA  653

Query  169   LMRV  158
             L RV
Sbjct  654   LHRV  657



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/645 (56%), Positives = 465/645 (72%), Gaps = 31/645 (5%)
 Frame = -3

Query  2017  APTTQLQANPQLESDTSAAIFKKANR---------PVTLKFENVVYKVKPDQKQGLSFLK  1865
             APT  L   P+  +    +   +AN          P TLKFE VVYKVK DQK GL +  
Sbjct  15    APTEGLPRMPETNNRAVLSYPGQANSQSVLQLTIYPTTLKFEEVVYKVKLDQK-GLCWGG  73

Query  1864  TKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGK  1685
             T    S  EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+
Sbjct  74    TW---SSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQ  130

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS  MKR TGFV QDDILYPHLTV+ETL+FTALLRLP+TLT++EK +  + VI +LGL+
Sbjct  131   PFSGTMKRRTGFVAQDDILYPHLTVSETLLFTALLRLPKTLTREEKAQHVERVIAELGLS  190

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +C+NS+IGG   RGISGGE+KRV+IGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L
Sbjct  191   QCRNSMIGGPLFRGISGGEKKRVNIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRL  250

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPS  1145
             + GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS++GFS S+ +NP+
Sbjct  251   ASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGRPIYYGPASAALDYFSSIGFSTSMTVNPA  310

Query  1144  DFLLDLANGI---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDV-  995
             D LLDLANGI          G++++ +Q +V+E L+SA++ N+   LK EL  L+  +  
Sbjct  311   DLLLDLANGIGPDSKNATDYGENTEQEQKSVREALISAYEKNISTRLKAELCNLDPNNYY  370

Query  994   ----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW  827
                 +S  ++K+ ++W   WW QF VL +RGL++R+YESF+ L++ QVL V+ L G LWW
Sbjct  371   YTKDASERNEKKSEKWCTSWWHQFKVLFQRGLRERRYESFNRLRIFQVLSVSILGGLLWW  430

Query  826   K--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTV  653
             K  ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML KER+SGMY LSS+FLART 
Sbjct  431   KTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTF  490

Query  652   GDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKS  473
             GDLP+EL LPT FV I YWM GLK     F  +L  +L  VLV Q LGLAIGA +MD K 
Sbjct  491   GDLPLELALPTAFVFIIYWMGGLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQ  550

Query  472   ATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGS  293
             ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G 
Sbjct  551   ATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGVQYNEDDHYECSKGV  610

Query  292   GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              +C V D PA+K +GL  H+   V  + LML+GYR++AY+AL RV
Sbjct  611   -LCRVGDFPAVKSMGL-NHLWVDVAIMALMLVGYRMVAYLALHRV  653



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/616 (58%), Positives = 460/616 (75%), Gaps = 23/616 (4%)
 Frame = -3

Query  1954  KKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLG  1775
             K A  P+TLKFE +VYKVK +QK G+ +  T+  K   EK ILKGVTG+V PGE++AMLG
Sbjct  41    KLAMYPITLKFEELVYKVKIEQK-GVCWGSTRSCK---EKTILKGVTGMVCPGEIMAMLG  96

Query  1774  PSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLV  1595
             PSGSGKTTLLTALGGRL G L+G +TYN +PFS AMKR TGFV QDD+LYPHLTVTETL+
Sbjct  97    PSGSGKTTLLTALGGRLSGKLSGKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVTETLL  156

Query  1594  FTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEML  1415
             FTALLRLP TLTK+EK++  + VI++LGL++C+ S+IGG F RGISGGERKRVSIGQEML
Sbjct  157   FTALLRLPNTLTKEEKVQHVEHVISELGLSRCRGSMIGGPFFRGISGGERKRVSIGQEML  216

Query  1414  INPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCE  1235
             INPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL E
Sbjct  217   INPSLLLLDEPTSGLDSTTAQRIITTIKGLASGGRTVVTTIHQPSSRLYHMFDKVVLLSE  276

Query  1234  GNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS----------QADQA  1085
             G P+Y+G  S  M YFS+VGFS S+ +NP+D +LDLANGI  D S          +A++ 
Sbjct  277   GCPIYYGHASSAMDYFSSVGFSTSMIVNPADLMLDLANGIAPDPSKLATEHSESQEAEKK  336

Query  1084  TVKETLVSAFKTNLLENLKMEL--HELNDEDV---SSAGDQKQFKRWAIPWWEQFSVLLK  920
              V+E L+SA+  N+   LK EL   E+N+  V   SS  +  + ++W   WW QF VLL+
Sbjct  337   LVREALISAYDKNIATRLKDELCSFEVNNYKVIKDSSTRNHIKPEQWCTSWWHQFKVLLQ  396

Query  919   RGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQA  746
             RGL++R++E+F+ L++ QV+ VAFL G LWW +  + + D++ LLFF S FWGF+PL+ A
Sbjct  397   RGLRERRFEAFNRLRIFQVISVAFLGGLLWWHTPESHIGDRIALLFFFSVFWGFYPLYNA  456

Query  745   IFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGN  566
             +FTFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FVII YWM GLKP    
Sbjct  457   VFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMGGLKPHPVT  516

Query  565   FFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISW  386
             F  +L  +L  VLV Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W
Sbjct  517   FLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIEW  576

Query  385   IKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLL  206
             +KY+S   Y YKLL+  Q+   + Y C+ G  +C V + P IK +GL  H+   V  + +
Sbjct  577   LKYLSYSYYCYKLLVGVQFNDDDYYECSKGV-LCKVGEFPQIKSVGL-NHLWVDVTIMAM  634

Query  205   MLIGYRLLAYVALMRV  158
             ML+GYRL+AY+AL+RV
Sbjct  635   MLVGYRLIAYLALLRV  650



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/610 (59%), Positives = 448/610 (73%), Gaps = 22/610 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE VVYKVK +QK G     T   K   EK IL G+TG+V PGE+LAMLGPSGSG
Sbjct  28    PITLKFEEVVYKVKLEQK-GSCCGGTWATK---EKTILNGITGMVCPGEILAMLGPSGSG  83

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRL G L+G ITYNG+PFS A KR TGFV QDDILYPHLTVTETL+FTALL
Sbjct  84    KTTLLTALGGRLNGKLSGKITYNGQPFSGATKRRTGFVPQDDILYPHLTVTETLLFTALL  143

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP+TLTK EK++    +I +LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSL
Sbjct  144   RLPKTLTKDEKLQHVQRIIAELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSL  203

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQRI++ +  L+ GGRT+V TIHQPSSRL+++F KV+LL EG+P+Y
Sbjct  204   LLLDEPTSGLDSTTAQRIITIIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGSPIY  263

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVKETL  1067
             +G  S  + YFS++GFS S+ +NP+D LLDLANGI          G++++ +Q  VKETL
Sbjct  264   YGSASSALDYFSSIGFSTSMTINPADLLLDLANGIAPDSKTTTEQGENTEQEQKLVKETL  323

Query  1066  VSAFKTNLLENLKMELHELNDEDVSSAGD-----QKQFKRWAIPWWEQFSVLLKRGLKQR  902
             +SAF+ N+   LK EL   +    +   D       + ++W   WW QF VL +RGL++R
Sbjct  324   ISAFEKNISTRLKAELCSTDANSYNYTKDGLARTDTKSEQWCTSWWHQFKVLFQRGLRER  383

Query  901   KYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             +YESF+ L++ QV  VA L G LWW++  + +QD++ LLFF S FWGF+PL+ A+FTFP+
Sbjct  384   RYESFNRLRIFQVTSVAILGGLLWWRTPASHIQDRIALLFFFSVFWGFYPLYNAVFTFPQ  443

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KER+SGMY LSS+FLART GDLP+EL LPT FV I YWM GLK     F  +L 
Sbjct  444   ERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADPITFILSLL  503

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
              +L  VLV Q LGLA+GA +MD K ATTL SV  L FL+AGG+YV+ +PSFI W+KY+S 
Sbjct  504   VVLYNVLVSQSLGLALGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPSFIVWLKYVSY  563

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               Y YKLLL  QY+  + Y C+ G  +C V D PA+K +GL  H+   V  + LML+GYR
Sbjct  564   SYYCYKLLLGVQYREDDYYECSKGV-LCRVGDFPAVKSMGL-NHLWIDVCIMALMLVGYR  621

Query  187   LLAYVALMRV  158
             L+AY+AL RV
Sbjct  622   LIAYLALSRV  631



>ref|XP_003537708.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN41781.1| ABC transporter G family member 14 [Glycine soja]
Length=660

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/643 (56%), Positives = 463/643 (72%), Gaps = 26/643 (4%)
 Frame = -3

Query  2038  TEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTK  1859
             TE  D    +  +Q N Q +      I      P+TLKFE +VYKVK +QK G  +  T 
Sbjct  27    TEPHDSTVISYPMQTNEQQQQPFPKLIMY----PITLKFEELVYKVKLEQKGG-CWGSTW  81

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPF  1679
               K   EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+PF
Sbjct  82    TCK---EKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQPF  138

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             S AMKR TGFV QDD+LYPHLTVTETLVFTALLRLP +L + EK++  + VIT+LGLT+C
Sbjct  139   SGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSLCRDEKVQHVERVITELGLTRC  198

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             ++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ 
Sbjct  199   RSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILNTIKHLAS  258

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDF  1139
             GGRT+V TIHQPSSRL+Y+F KV+LL EG P+Y+G  S  + YFS+VGFS  V +NP+D 
Sbjct  259   GGRTVVTTIHQPSSRLYYMFDKVVLLSEGCPIYYGPASTALDYFSSVGFSTCVTVNPADL  318

Query  1138  LLDLANGITGDDSQA---------DQATVKETLVSAFKTNLLENLKMELH--ELNDEDVS  992
             LLDLANGI  D   A         ++  V+E+L+SA++ N+   LK E+   E N+ +++
Sbjct  319   LLDLANGIAPDSKHATEQSEGLEQERKQVRESLISAYEKNIATRLKSEVCSLEANNYNIT  378

Query  991   ---SAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS  821
                 A +  + ++W   WW QF VLL+RG+++R+YE+F+ L++ QV+ VAFL G LWW +
Sbjct  379   KDACARNSIKPEQWCTSWWHQFKVLLQRGVRERRYEAFNRLRIFQVVSVAFLGGLLWWHT  438

Query  820   --TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGD  647
               + ++D+V LLFF S FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLART+GD
Sbjct  439   PESHIEDRVALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGD  498

Query  646   LPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSAT  467
             LP+EL LPT FV I YWM GLKP    F  +L  +L  V+V Q LGLA GA +M+ K AT
Sbjct  499   LPLELALPTAFVFIIYWMGGLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQAT  558

Query  466   TLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV  287
             TL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   + Y C++G  +
Sbjct  559   TLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYQCSTGE-L  617

Query  286   CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             C V D P IK +GL  H+   V  + +ML+GYRL+AY+AL RV
Sbjct  618   CKVADFPPIKSMGL-NHLWVDVCIMAMMLVGYRLVAYLALHRV  659



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/614 (57%), Positives = 450/614 (73%), Gaps = 16/614 (3%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGE  1793
             TS + F+ +  P+TLKFE V+YKVK  Q       +     S  EK IL G++G++ PGE
Sbjct  31    TSQSGFQLSMYPITLKFEEVMYKVKIKQTS-----QCFGSWSSKEKTILNGISGMICPGE  85

Query  1792  VLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLT  1613
             +LAMLGPSGSGKTTLL+ALGGRL     G + YNG+PFS  +KR TGFV QDD+LYPHLT
Sbjct  86    ILAMLGPSGSGKTTLLSALGGRLSKTFTGKVMYNGQPFSGNIKRRTGFVAQDDVLYPHLT  145

Query  1612  VTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVS  1433
             V ETL FTALLRLP TLT+ EK E  D VI +LGLT+C NS+IGG   RG+SGGE+KRVS
Sbjct  146   VWETLFFTALLRLPSTLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGLSGGEKKRVS  205

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEMLINPSLL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F K
Sbjct  206   IGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDK  265

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD----DSQADQA  1085
             V+LL EG+P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLANGI+ D     S+ +Q 
Sbjct  266   VVLLSEGSPIYYGSASSAVEYFSSVGFSTSMTVNPADLLLDLANGISPDCQKETSEQEQK  325

Query  1084  TVKETLVSAFKTNLLENLKMELHELNDEDVS---SAGDQKQFKRWAIPWWEQFSVLLKRG  914
             TVKETL+SA++ N+   LK EL   + + +    +A    + ++W   WW QF+VLL+RG
Sbjct  326   TVKETLISAYEKNISTKLKEELSNADSQSLEYTKAAAKNLKSEQWCTSWWYQFTVLLQRG  385

Query  913   LKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIF  740
             +++R++ESF+ L++ QV+ VAFL G LWW++  + +QD+  LLFF S FWGF+PL+ A+F
Sbjct  386   VRERRFESFNKLRIFQVISVAFLGGLLWWQTPKSHIQDRTALLFFFSVFWGFYPLYNAVF  445

Query  739   TFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFF  560
             TFP++K ML KERSSGMY+LSS+F+ART+GDLP+EL LPT FV I YWM GLKP A  F 
Sbjct  446   TFPQEKRMLIKERSSGMYRLSSYFMARTIGDLPLELALPTAFVFIIYWMGGLKPDATTFI  505

Query  559   SALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIK  380
              +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+H+P FI W+K
Sbjct  506   LSLLVVLYSVLVAQGLGLAFGALLMNVKQATTLASVTTLVFLIAGGYYVQHIPPFIVWLK  565

Query  379   YISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLML  200
             Y+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +ML
Sbjct  566   YLSYSYYCYKLLLGIQYTDDDVYECSKGVW-CRVGDFPAIKSMGL-HNLWVDVFVMGVML  623

Query  199   IGYRLLAYVALMRV  158
             +GYRLLAY+AL RV
Sbjct  624   VGYRLLAYMALHRV  637



>ref|XP_007156346.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
 gb|ESW28340.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
Length=648

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/634 (57%), Positives = 462/634 (73%), Gaps = 30/634 (5%)
 Frame = -3

Query  2008  TQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
             T LQ N Q       +  K A  P+TLKFE +VYKVK +QK G+ +  T    S  EK I
Sbjct  27    TVLQTNEQ-------SFLKLAVYPITLKFEELVYKVKVEQK-GMCWGSTG---SSREKTI  75

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             LKGVTG+V PGE++AMLGPSGSGKTTLLTALGGRL G L+G +TYN +PFS AMKR TGF
Sbjct  76    LKGVTGMVCPGEIMAMLGPSGSGKTTLLTALGGRLSGKLSGKVTYNNQPFSGAMKRRTGF  135

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             V QDD+LYPHLTVTETL+FTALLRLP +LTK+EK +  + VI++LGL+KC+ S+IGG   
Sbjct  136   VAQDDVLYPHLTVTETLLFTALLRLPSSLTKEEKAQHVEHVISELGLSKCRGSMIGGPLF  195

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RGISGGERKRVSIGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIH
Sbjct  196   RGISGGERKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIMTTIKRLASGGRTVVTTIH  255

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITG  1109
             QPSSRL+++F KV+LL EG P+Y+G  S  M+YFS+VGFS S+ +NP+D LLDLANGI  
Sbjct  256   QPSSRLYHMFDKVVLLSEGCPIYYGPASTAMAYFSSVGFSTSMIVNPADLLLDLANGIAP  315

Query  1108  DDS----------QADQATVKETLVSAFKTNLLENLKMELH--ELNDEDVSSAG---DQK  974
             D S          +A+   V+E L+SA+  N+   LK EL   E+N+ +V   G   +Q 
Sbjct  316   DSSKHGTEQRESQEAENKLVREALISAYDKNIGTKLKDELCSLEVNNYEVIKDGSTRNQI  375

Query  973   QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQV  800
             + +RW   WW QF VLL+RGL++R++E+F+ L++ QV+ VAFL G LWW +  + + D++
Sbjct  376   KPERWCTSWWHQFKVLLQRGLRERRFEAFNRLRIFQVISVAFLGGLLWWHTPESHIGDRI  435

Query  799   GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPT  620
              LLFF S FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT
Sbjct  436   ALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPT  495

Query  619   VFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLA  440
              FV I YWM GL P    FF +L  +L  VLV Q LGLA GA +M+ K ATTL SV  L 
Sbjct  496   AFVFIIYWMGGLNPHPLTFFLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLV  555

Query  439   FLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAI  260
             FL+AGG+Y++ +P FI W+KY+S   Y YKLL+  QY   + Y C+ G  +C V + P I
Sbjct  556   FLIAGGYYIQQIPPFIEWLKYLSYSYYCYKLLVGVQYMDDDYYECSKGV-LCKVGEFPPI  614

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             K +GL  H+   +  + +ML+GYRL+AY+AL RV
Sbjct  615   KSVGL-NHLWVDMSIMAMMLVGYRLVAYLALQRV  647



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/665 (55%), Positives = 465/665 (70%), Gaps = 29/665 (4%)
 Frame = -3

Query  2104  IHCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLK  1925
             ++C    P +        +   +E  +    T  +Q N Q       +I +     + LK
Sbjct  3     LNCIAPKPENQGNIPMEGLSRTSESDNSAVLTYPMQTNSQ-------SILQHTLYSINLK  55

Query  1924  FENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttll  1745
             FE VVYKVK +QK G  +       S  +K IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  56    FEEVVYKVKLEQK-GFCW---GGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLL  111

Query  1744  talggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
             TALGGRL G L+G ITYNG+PFS A+KR TGFV QDD+LYPHLTVTETL+FTALLRLP++
Sbjct  112   TALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKS  171

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
             L + EK +  + VI++LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDE
Sbjct  172   LARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDE  231

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y G  S
Sbjct  232   PTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPAS  291

Query  1204  DVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA---------DQATVKETLVSAFK  1052
               M YFS+VGFS  V +NP+D LLDLANGI+ D  QA         +Q +V+E L+SA++
Sbjct  292   TAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISAYE  351

Query  1051  TNLLENLKMELHELNDEDVSSAGD---QKQFK--RWAIPWWEQFSVLLKRGLKQRKYESF  887
              N+   LK EL  ++  + +   D   +  FK  +W   WW QF VLL+RGL++R+YE+F
Sbjct  352   KNISTRLKAELCSVDVNNYNYTKDGRARNNFKADQWCTSWWHQFMVLLQRGLRERRYEAF  411

Query  886   SGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMML  713
             + L++ QV+ VA L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML
Sbjct  412   NRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRML  471

Query  712   GKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllc  533
              KERSSGMY+LSS+FLART GDLP+EL LPT FVII YWM GLKP    F  +L  +L  
Sbjct  472   IKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYN  531

Query  532   vlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTY  353
             VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y Y
Sbjct  532   VLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCY  591

Query  352   KLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYV  173
             KLLL  QY   + Y C+ G   C V D PA+K +GL  H+   V  + LML+GYRL+AY+
Sbjct  592   KLLLGIQYSEDDYYECSKGV-FCRVVDFPAVKSVGL-NHLWIDVCIMALMLVGYRLVAYL  649

Query  172   ALMRV  158
             AL RV
Sbjct  650   ALHRV  654



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/668 (55%), Positives = 473/668 (71%), Gaps = 36/668 (5%)
 Frame = -3

Query  2101  HCPESFPSSSDQQEATLMETATEMGDIEAPT-TQLQANPQLESDTSAAIFKKANRPVTLK  1925
             +C    P  ++       E   EM +   P  T  Q+ P+L      A+F     P+TLK
Sbjct  4     NCIAPKPEHNNNNTTHPEEGPPEMTETVLPIKTNEQSFPKL------AMF-----PITLK  52

Query  1924  FENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttll  1745
             FE +VY VK + K GL +  T+  K   EK ILKGVTG+V PGE++AMLGPSGSGKTTLL
Sbjct  53    FEELVYNVKIEHKGGLCWGSTRSCK---EKTILKGVTGMVSPGEIMAMLGPSGSGKTTLL  109

Query  1744  talggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
             TALGGRL G L+G +TYN +PFS AMKR TGFV QDD+LYPHLTV ETL+FTALLRLP +
Sbjct  110   TALGGRLSGKLSGKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVFETLLFTALLRLPNS  169

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
             LTK+EK+   + VI++LGL++C+ S+IGG F RGISGGERKRVSIGQEMLINPSLL LDE
Sbjct  170   LTKEEKVHHVEHVISELGLSRCRGSMIGGPFFRGISGGERKRVSIGQEMLINPSLLLLDE  229

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  S
Sbjct  230   PTSGLDSTTAQRIITTIKGLACGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGPAS  289

Query  1204  DVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS----------QADQATVKETLVSAF  1055
               M YFS+VGFS S+ +NP+D +LDLANGI  D S          + ++  V+E LVSA+
Sbjct  290   SAMDYFSSVGFSTSMIVNPADLMLDLANGIAPDSSKLPTEQSGSQEVEKKLVREALVSAY  349

Query  1054  KTNLLENLKMELH--ELND----EDVSS-AGDQKQFKRWAIPWWEQFSVLLKRGLKQRKY  896
               N+   LK EL   E+N+    +D S+ AG+  + ++W   WW QF VLL+RGL++R++
Sbjct  350   DKNIATRLKDELCSLEVNNFKAIKDASTNAGNHIKPEQWCTSWWHQFKVLLQRGLRERRF  409

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             E+F+ L++ QV+ VAFL G LWW +  + + D++ LLFF S FWGF+PL+ A+FTFP+++
Sbjct  410   EAFNRLRIFQVISVAFLGGLLWWHTPESHIGDRIALLFFFSVFWGFYPLYNAVFTFPQER  469

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSGMY+LSS+FLARTVGDLP+EL LPT F II YWM GLKP    F  +L  +
Sbjct  470   RMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFAIIIYWMGGLKPHPVTFLLSLLVV  529

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             L  VLV Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   
Sbjct  530   LYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIEWLKYLSYSY  589

Query  361   YTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLL  182
             Y YKLL+  QY   + Y C+ G  +C V + P IK +GL  H+   V  + LML+GYRL+
Sbjct  590   YCYKLLVGVQYNDDDHYECSKGV-LCKVGEFPPIKSVGL-NHLWVDVAIMALMLVGYRLI  647

Query  181   AYVALMRV  158
             AY+AL R+
Sbjct  648   AYLALQRM  655



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/608 (59%), Positives = 447/608 (74%), Gaps = 16/608 (3%)
 Frame = -3

Query  1954  KKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLG  1775
             +KA   +TLKFE +VYKVK +QK            S  EK IL GVTG+V PGE+LAMLG
Sbjct  28    QKALYSITLKFEEIVYKVKIEQKG-----SCWGTWSSKEKTILNGVTGMVCPGEILAMLG  82

Query  1774  PSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLV  1595
             PSGSGKTTLL+ALGGRL G  +G ITYNG PFS ++KR TGFV QDD+LYPHLTV ETL 
Sbjct  83    PSGSGKTTLLSALGGRLSGTFSGKITYNGSPFSGSIKRRTGFVAQDDVLYPHLTVWETLF  142

Query  1594  FTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEML  1415
             FTALLRLP ++T+ EK E  D VIT+LGLT+C+NS+IGG   RGISGGE+KRVSIGQEML
Sbjct  143   FTALLRLPGSMTRDEKAEHVDRVITELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEML  202

Query  1414  INPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCE  1235
             INPSLL LDEPTSGLDSTTAQRIV+T+  L  GGRT++ TIHQPSSRL+++F KV+LL E
Sbjct  203   INPSLLLLDEPTSGLDSTTAQRIVTTIKRLVSGGRTVITTIHQPSSRLYHMFDKVVLLSE  262

Query  1234  GNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT----GDDSQADQATVKETL  1067
             G+P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLANGI      ++S+ +Q TVKE L
Sbjct  263   GSPIYYGPASSALEYFSSVGFSTSMTVNPADLLLDLANGIAPESQAENSEQEQKTVKEAL  322

Query  1066  VSAFKTNLLENLKMELHELNDEDVSSA---GDQKQFKRWAIPWWEQFSVLLKRGLKQRKY  896
              SA++ N+   LK EL         SA   G+  + ++W   WW QFSVLL+RG+++R++
Sbjct  323   ASAYEKNISTKLKAELCSPESHGFDSAKARGNNFKPEQWCTTWWYQFSVLLQRGVRERRH  382

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ESF+ L++ QV+ VAFL G LWW +  + +QD++ LLFF S FWGF+PL+ A+FTFP++K
Sbjct  383   ESFNKLRIFQVVSVAFLGGLLWWHTPKSHIQDRIALLFFFSVFWGFYPLYNAVFTFPQEK  442

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSGMY+LSS+F+AR +GDLP+EL LPT FV I YWM GLKP    F  +L  +
Sbjct  443   RMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  502

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +PSFI W+KY+S   
Sbjct  503   LYNVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPSFIVWLKYLSYSY  562

Query  361   YTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLL  182
             Y YKLLL  QY   + Y C+ G   C V D PA+K +GL  ++   V  + LML+GYRL+
Sbjct  563   YCYKLLLGVQYSDDDYYECSKGV-WCRVGDFPAVKSMGL-NNLWIDVSVMALMLVGYRLV  620

Query  181   AYVALMRV  158
             AY+AL RV
Sbjct  621   AYMALHRV  628



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/664 (55%), Positives = 471/664 (71%), Gaps = 36/664 (5%)
 Frame = -3

Query  2095  PESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFEN  1916
             P+    SS   EA L ET++E  +       +Q N Q        ++     P+TLKFE 
Sbjct  8     PKPEHGSSGPVEA-LSETSSESHNRAVLAFPIQHNSQ--PPVRVTLY-----PITLKFEK  59

Query  1915  VVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltal  1736
             VVYKVK +QK         +     EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTAL
Sbjct  60    VVYKVKLEQKGSCWGAWITR-----EKTILNGITGVVCPGEILAMLGPSGSGKTTLLTAL  114

Query  1735  ggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTK  1556
             GGRL G L+G ITYNG+PFS  +KR TGFV QDD+LYPHLTVTETL+FTALLRLP++L++
Sbjct  115   GGRLTGKLSGNITYNGQPFSGGVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLSR  174

Query  1555  QEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTS  1376
              EK++  + VI +LGLT+C+NSIIGG  LRGISGGE+KRVSIGQEMLINPSLL LDEPTS
Sbjct  175   DEKVQHVERVIAELGLTRCRNSIIGGPLLRGISGGEKKRVSIGQEMLINPSLLLLDEPTS  234

Query  1375  GLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVM  1196
             GLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  S  +
Sbjct  235   GLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGSASAAL  294

Query  1195  SYFSTVGFSPSVAMNPSDFLLDLANGITGD---------DSQADQATVKETLVSAFKTNL  1043
              YFS++GFS S+ +NP+D LLDLANGI  D         +++ +Q +VK+ L+SA++ N+
Sbjct  295   EYFSSIGFSTSMTVNPADLLLDLANGIGPDFKHSVEQVENTEQEQKSVKDALISAYEKNI  354

Query  1042  LENLKMELHELNDEDVSSAGDQKQF-------KRWAIPWWEQFSVLLKRGLKQRKYESFS  884
                LK    EL + DV++  + K+        + W   WW QF VLL+RG+++R++E+F+
Sbjct  355   SPRLKA---ELCNSDVNNHVNTKEAPARNGKSEEWCTSWWHQFKVLLQRGVRERRHEAFN  411

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
             GL++ QV+ VA L G LWW +  + + D++ LLFF S FWGF+PL+ A+FTFP+++ ML 
Sbjct  412   GLRIFQVISVAVLGGLLWWHTPASHISDRIALLFFFSVFWGFYPLYNAVFTFPQERTMLI  471

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+FLART GDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  472   KERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKPDPVTFILSLLVVLYNV  531

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P+FI W+KY+S   Y YK
Sbjct  532   LVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPAFIVWLKYLSYSYYCYK  591

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G  +C V D PAIK +GL  H+   V  + LML+GYRL+AY+A
Sbjct  592   LLLGVQYNEDDYYECSKGV-LCRVGDLPAIKSMGL-NHLWVDVCIMALMLVGYRLIAYMA  649

Query  169   LMRV  158
             L RV
Sbjct  650   LHRV  653



>ref|XP_003517105.2| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=659

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/669 (54%), Positives = 469/669 (70%), Gaps = 38/669 (6%)
 Frame = -3

Query  2116  FFNAIHCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRP  1937
             F N+ +  E  P  ++   +T++            +  +QAN Q +      I      P
Sbjct  12    FCNSHNSVEGPPEMTEPHNSTVL------------SYPMQANEQQQQPFPKLIMY----P  55

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             +TLKFE +VYKVK +QK G  +  T   K   EK IL G+TG+V PGE+LAMLGPSGSGK
Sbjct  56    ITLKFEELVYKVKLEQKGG-CWGSTWTCK---EKTILNGITGVVCPGEILAMLGPSGSGK  111

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTLLTALGGRL G L+G ITYNG+PFS AMKR TGFV QDD+LYPHLTVTETLVFTALLR
Sbjct  112   TTLLTALGGRLNGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLR  171

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLL  1397
             LP TL + EK++  + VIT+LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL
Sbjct  172   LPNTLKRDEKVQHVERVITELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLL  231

Query  1396  FLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYF  1217
              LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+Y+F KV+LL EG P+Y+
Sbjct  232   LLDEPTSGLDSTTAQRILNTIKRLASGGRTVVTTIHQPSSRLYYMFDKVVLLSEGCPIYY  291

Query  1216  GKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA---------DQATVKETLV  1064
             G  S  + YFS+VGFS  V +NP+D LLDLANGI  D   A         ++  V+E+L+
Sbjct  292   GPASTALDYFSSVGFSTCVTVNPADLLLDLANGIAPDSKHATEQSEGLEQERKQVRESLI  351

Query  1063  SAFKTNLLENLKMELH--ELNDEDVS---SAGDQKQFKRWAIPWWEQFSVLLKRGLKQRK  899
             SA++ N+   LK E+   E N+ +++    A +  +  +W   WW QF VLL+RG+++R+
Sbjct  352   SAYEKNIATRLKAEVCSLEANNYNITKDACARNSIKPDQWCTSWWHQFKVLLQRGVRERR  411

Query  898   YESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             YE+F+ L++ QV+ VAFL G LWW +  + + D+V LLFF S FWGF+PL+ A+FTFP++
Sbjct  412   YEAFNRLRIFQVVSVAFLGGLLWWHTPESHIDDRVALLFFFSVFWGFYPLYNAVFTFPQE  471

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
             + ML KERSSGMY+LSS+FLART+GDLP+EL LPT FV I YWM GLKP    F  +L  
Sbjct  472   RRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMGGLKPDPMTFILSLLV  531

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             +L  V+V Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S  
Sbjct  532   VLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYS  591

Query  364   QYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRL  185
              Y YKLLL  QY   + Y C S   +C V D P IK +GL  H+   V  + +ML+GYRL
Sbjct  592   YYCYKLLLGVQYNENDYYEC-SKEELCKVADFPPIKSMGL-NHLWVDVCIMAMMLVGYRL  649

Query  184   LAYVALMRV  158
             +AY+AL RV
Sbjct  650   VAYLALHRV  658



>gb|KHN28317.1| ABC transporter G family member 14 [Glycine soja]
Length=659

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/669 (54%), Positives = 469/669 (70%), Gaps = 38/669 (6%)
 Frame = -3

Query  2116  FFNAIHCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRP  1937
             F N+ +  E  P  ++   +T++            +  +QAN Q +      I      P
Sbjct  12    FCNSHNSVEGPPEMTEPHNSTVL------------SYPMQANEQQQQPFPKLIMY----P  55

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             +TLKFE +VYKVK +QK G  +  T   K   EK IL G+TG+V PGE+LAMLGPSGSGK
Sbjct  56    ITLKFEELVYKVKLEQKGG-CWGSTWTCK---EKTILNGITGVVCPGEILAMLGPSGSGK  111

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTLLTALGGRL G L+G ITYNG+PFS AMKR TGFV QDD+LYPHLTVTETLVFTALLR
Sbjct  112   TTLLTALGGRLNGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVTETLVFTALLR  171

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLL  1397
             LP TL + EK++  + VIT+LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL
Sbjct  172   LPNTLKRDEKVQHVERVITELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLL  231

Query  1396  FLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYF  1217
              LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+Y+F KV+LL EG P+Y+
Sbjct  232   LLDEPTSGLDSTTAQRILNTIKRLASGGRTVVTTIHQPSSRLYYMFDKVVLLSEGCPIYY  291

Query  1216  GKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA---------DQATVKETLV  1064
             G  S  + YFS+VGFS  V +NP+D LLDLANGI  D   A         ++  V+E+L+
Sbjct  292   GPASTALDYFSSVGFSTCVTVNPADLLLDLANGIAPDSKHATEQSEGLEQERKQVRESLI  351

Query  1063  SAFKTNLLENLKMELH--ELNDEDV---SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRK  899
             SA++ N+   LK E+   E N+ ++   + A +  +  +W   WW QF VLL+RG+++R+
Sbjct  352   SAYEKNIATRLKAEVCSLEANNYNIIKDACARNSIKPDQWCTSWWHQFKVLLQRGVRERR  411

Query  898   YESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             YE+F+ L++ QV+ VAFL G LWW +  + + D+V LLFF S FWGF+PL+ A+FTFP++
Sbjct  412   YEAFNRLRIFQVVSVAFLGGLLWWHTPESHIDDRVALLFFFSVFWGFYPLYNAVFTFPQE  471

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
             + ML KERSSGMY+LSS+FLART+GDLP+EL LPT FV I YWM GLKP    F  +L  
Sbjct  472   RRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMGGLKPDPMTFILSLLV  531

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             +L  V+V Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S  
Sbjct  532   VLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYS  591

Query  364   QYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRL  185
              Y YKLLL  QY   + Y C S   +C V D P IK +GL  H+   V  + +ML+GYRL
Sbjct  592   YYCYKLLLGVQYNENDYYEC-SKEELCKVADFPPIKSMGL-NHLWVDVCIMAMMLVGYRL  649

Query  184   LAYVALMRV  158
             +AY+AL RV
Sbjct  650   VAYLALHRV  658



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/655 (55%), Positives = 467/655 (71%), Gaps = 46/655 (7%)
 Frame = -3

Query  2017  APTTQLQANPQLESDTSAAIFKKA--------NRP--------VTLKFENVVYKVKPDQK  1886
             AP  +   N  +ES+TS +  K A        ++P        +TLKFE VVYKVK ++K
Sbjct  7     APKPEHACNGLVESETSKSQKKAALAFPIQHNSQPPPRLTLFHITLKFEEVVYKVKLEEK  66

Query  1885  QGL--SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
                  S++         EK IL G+TG+V PGE+LAMLGPSGSGKTTLL+ALGGRL G L
Sbjct  67    GSCWGSWITR-------EKTILNGITGVVCPGEILAMLGPSGSGKTTLLSALGGRLTGKL  119

Query  1711  agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQAD  1532
             +G ITYNG+PFS A+KR TGFV QDD+LYPHLTVTETL+FTALLRLP +LT+ EK +  +
Sbjct  120   SGKITYNGQPFSGALKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPNSLTRDEKAQHVE  179

Query  1531  AVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ  1352
              VI +LGLTKC+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQ
Sbjct  180   RVIAELGLTKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQ  239

Query  1351  RIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF  1172
             RI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  +  + YFS++GF
Sbjct  240   RILTTIKGLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGSAASALDYFSSIGF  299

Query  1171  SPSVAMNPSDFLLDLANGITGD---------DSQADQATVKETLVSAFKTNLLENLKMEL  1019
             S S+ +NP+D LLDLANGI  D          ++ +Q +VK+ L+SA++ N+   LK EL
Sbjct  300   STSITVNPADLLLDLANGIGPDLLHSVEQVESTEEEQKSVKDALLSAYEKNISTKLKAEL  359

Query  1018  HE------LNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLV  857
                     +N ++ S+  ++ +  +W   WW QF VLL+RG+++R+YE+F+ L++ QV+ 
Sbjct  360   CNSDANNFVNTKEASARYEKTE--QWCTSWWYQFKVLLQRGVRERRYEAFNRLRIFQVIS  417

Query  856   VAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYK  683
             VA L G LWW +  + + D++ LLFF S FWGF+PL+ A+FTFP+++ ML KERSSGMY+
Sbjct  418   VAVLGGLLWWHTPASHISDRIALLFFFSVFWGFYPLYNAVFTFPQERTMLIKERSSGMYR  477

Query  682   LSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLA  503
             LSS+FLART GDLP+EL LPT FV I YWM GLKP    F  +L  +L  VLV Q LGLA
Sbjct  478   LSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKPDPLTFILSLLIVLYSVLVSQSLGLA  537

Query  502   IGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP  323
             IGA +MD K ATTL SV  L FL+AGG+YV+ +PSFI W+KY+S   Y YKLLL  QY  
Sbjct  538   IGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPSFIVWLKYLSYSYYCYKLLLGIQYDE  597

Query  322   GETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              + Y C +G G+C V D PAIK +GL  H+   V  + LML+GYRLLAY+AL RV
Sbjct  598   DDVYECGTG-GLCRVGDLPAIKSMGL-NHLWIDVAIMALMLLGYRLLAYMALYRV  650



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/660 (54%), Positives = 463/660 (70%), Gaps = 36/660 (5%)
 Frame = -3

Query  2056  TLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANR----------PVTLKFENVVY  1907
              L+ T  E G    P   L   P+  +    A   + N           P+TLKFE +VY
Sbjct  4     NLIATKPEHGMSSGPLEALSETPEPHNSAMLAFPIQRNSQPPVRLTTLYPITLKFEEIVY  63

Query  1906  KVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggr  1727
             KVK +QK         +     EK IL G++G+V+PGE+LAMLGPSGSGKTTLLTALGGR
Sbjct  64    KVKLEQKGSCWGGWITR-----EKTILNGISGVVYPGEILAMLGPSGSGKTTLLTALGGR  118

Query  1726  lgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEK  1547
             L G L+G ITYNG+PF  A+KR  GFV QDD+LYPHLTVTETL+FTALLRLP +L++ EK
Sbjct  119   LTGKLSGKITYNGQPFCGAIKRRAGFVAQDDVLYPHLTVTETLLFTALLRLPNSLSRDEK  178

Query  1546  IEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLD  1367
             ++  + VI +LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLD
Sbjct  179   VQHVERVIAELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLD  238

Query  1366  STTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYF  1187
             STTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YF
Sbjct  239   STTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGSASAALEYF  298

Query  1186  STVGFSPSVAMNPSDFLLDLANGITGD---------DSQADQATVKETLVSAFKTNLLEN  1034
             S++GFS S+ +NP+D LLDLANGI  D          ++ +Q +VK+ L+SA++ N+   
Sbjct  299   SSIGFSTSMTVNPADLLLDLANGIGPDFIHSVEQVESTEQEQKSVKDALISAYEKNISTR  358

Query  1033  LKMELHE------LNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKV  872
             LK EL        +N ++ S+  D+ +  +W   WW QF VLL+RG+++R+YE+F+ L++
Sbjct  359   LKTELCNSDVNSGMNAKEPSARNDKSE--QWCTSWWHQFKVLLQRGVRERRYEAFNRLRI  416

Query  871   GQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERS  698
              QV+ VA L G LWW +  + + D++ LLFF S FWGF+PL+ A+FTFP+++ ML KERS
Sbjct  417   FQVISVAVLGGLLWWHTPASHISDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERS  476

Query  697   SGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcq  518
             SGMY+LSS+FLART GDLP+EL LPT FV I YWMAGLKP    F  +L  +L  VLV Q
Sbjct  477   SGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMAGLKPDPVTFILSLLVVLYNVLVSQ  536

Query  517   glgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLE  338
              LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P+FI W+KY+S   Y YKLLL 
Sbjct  537   SLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQQIPAFIVWLKYLSYSYYCYKLLLG  596

Query  337   SQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              QYK  + Y C+ G   C V D PAIK +GL  H+   V  + LML+GYRL+AY+AL RV
Sbjct  597   VQYKEDDYYECSKGVW-CRVGDLPAIKSMGL-SHMWIDVSIMALMLVGYRLIAYMALHRV  654



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/604 (59%), Positives = 442/604 (73%), Gaps = 18/604 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQK-QGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs  1763
             P+TLKFE VVYKVK +Q  Q L     K      EK IL G+TG+V PGE+LAMLGPSGS
Sbjct  43    PITLKFEEVVYKVKIEQTGQCLGSWSCK------EKTILNGITGMVCPGEILAMLGPSGS  96

Query  1762  gkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             GKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDDILYPHLTV ETL FTAL
Sbjct  97    GKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDILYPHLTVWETLFFTAL  156

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP +LT+ EK E  D VIT+LGLT+C NS+IGG   RGISGGE+KRVSIGQEMLINPS
Sbjct  157   LRLPSSLTRDEKAEHVDRVITELGLTRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPS  216

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+P+
Sbjct  217   LLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPI  276

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSAF  1055
             Y+G  S  M YFS+VGFS ++ +NP+D LLDLANGI  D     S+ +Q TVKETLVSA+
Sbjct  277   YYGPASSAMEYFSSVGFSTTMTVNPADLLLDLANGIPPDSQKETSEQEQKTVKETLVSAY  336

Query  1054  KTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
             + N+   LK EL   +    E   +A    + ++W   WW QF+VLL+RG+++R++ESF+
Sbjct  337   EKNISTKLKAELCNADSHSYEYTKAAAKSIKSEQWCTTWWYQFTVLLQRGVRERRFESFN  396

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + LQD+  LLFF S FWGF+PL+ A+FTFP++K ML 
Sbjct  397   KLRIFQVISVAFLGGLLWWHTPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLI  456

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F+AR +GDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  457   KERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSV  516

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK
Sbjct  517   LVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYK  576

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G   C V D P IK +GL  ++   V+ + +ML+GYRL+AY+A
Sbjct  577   LLLGIQYTDEDYYECSEGVW-CRVGDFPGIKAMGL-NNLWIDVLVMGVMLVGYRLMAYMA  634

Query  169   LMRV  158
             L RV
Sbjct  635   LHRV  638



>ref|XP_010054006.1| PREDICTED: ABC transporter G family member 14 [Eucalyptus grandis]
 gb|KCW78389.1| hypothetical protein EUGRSUZ_D02559 [Eucalyptus grandis]
Length=653

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/608 (57%), Positives = 447/608 (74%), Gaps = 17/608 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE VVYK+K DQKQ  S        S  EK IL GV+G+V PGE+LAMLGPSGSG
Sbjct  51    PITLKFEEVVYKIKLDQKQ--SCWGGTWTSSTREKTILNGVSGVVCPGEILAMLGPSGSG  108

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRLG      I YNG+PFS A+KR TGFV QDD+LYPHLTVTETL+FTALL
Sbjct  109   KTTLLTALGGRLGKLSGK-IMYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALL  167

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP TL   EK+   ++VIT+LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSL
Sbjct  168   RLPNTLALAEKLLHVESVITELGLTQCRHSMIGGPLFRGISGGEKKRVSIGQEMLINPSL  227

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQ+I++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EGNP+Y
Sbjct  228   LLLDEPTSGLDSTTAQKILTTVKRLAGGGRTVVTTIHQPSSRLYHMFDKVVLLSEGNPIY  287

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVKETL  1067
             +G+ S  + YFS++GF+ S+ +NP+D LLDLANGI          G++ + ++ +V+E L
Sbjct  288   YGRASAALDYFSSIGFTTSLTVNPADLLLDLANGIAPDSKHTTEQGENMEQEKKSVREAL  347

Query  1066  VSAFKTNLLENLKMELHELN-DEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYES  890
             +SA+  N+   LK EL  ++   +  + G +K+ ++W   WW QF VLL+RGL++R++ES
Sbjct  348   ISAYDNNISARLKSELCSVDIHYNALTKGHEKKTEQWCNSWWHQFKVLLQRGLRERRFES  407

Query  889   FSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMM  716
             F+ L++ QV+ VA L G LWW +  + + D++ LLFF S FWGF+PL+ A+FTFP+++ M
Sbjct  408   FNRLRIFQVISVAVLGGLLWWHTPASHIADRIALLFFFSVFWGFYPLYNAVFTFPQERRM  467

Query  715   LGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIll  536
             L KERSSGMY+LSS+FLART+GDLP+EL LPT FV I YWM GLKP    F  +L  +L 
Sbjct  468   LLKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMGGLKPNPATFILSLLIVLY  527

Query  535   cvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYT  356
              VLV Q LGLA GA +MD K ATTL SV  + FL+AGG+Y++ +P FI W+KY+S   Y 
Sbjct  528   SVLVSQSLGLAFGAILMDVKQATTLASVTTMVFLIAGGYYIQQIPPFIEWLKYLSYSYYC  587

Query  355   YKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAY  176
             Y+LLL  QY   + Y C  G  +C V D PA+K +GL  ++   V  +  ML+GYRL+AY
Sbjct  588   YRLLLGVQYSNDDVYECAKGE-LCRVGDFPAVKAVGL-NNLWLDVFIMASMLVGYRLIAY  645

Query  175   VALMRVGR  152
             VAL RV R
Sbjct  646   VALHRVLR  653



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/617 (56%), Positives = 444/617 (72%), Gaps = 24/617 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE V YKVK +QK G          S  EK IL G+TG V PGE+LAMLGPSGSG
Sbjct  57    PITLKFEEVFYKVKMEQKGGGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSG  116

Query  1759  kttllta-----lggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLV  1595
             KTTLLTA             ++G ITYNG+PF  ++KR TGFV QDD+LYPHLTVTETLV
Sbjct  117   KTTLLTALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQDDVLYPHLTVTETLV  176

Query  1594  FTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEML  1415
             FTALLRLPR+L++ EK++  + VI++LGL+ C++S+IGG   RGISGGE+KRVSIGQEML
Sbjct  177   FTALLRLPRSLSRDEKVQHVEHVISELGLSGCRSSMIGGPLFRGISGGEKKRVSIGQEML  236

Query  1414  INPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCE  1235
             INPSLL LDEPTSGLDSTTAQRI++ L  L+ GGRT+V TIHQPSSR++++F K++LL E
Sbjct  237   INPSLLLLDEPTSGLDSTTAQRILTILKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSE  296

Query  1234  GNPLYFGKGSDVMSYFSTVGFSPSV-AMNPSDFLLDLANGITGDDSQA---------DQA  1085
             G+P+Y+G  S  + YFS++GFS S+ ++NP+D LLDLANGI  D   A         DQ 
Sbjct  297   GSPIYYGPASAALDYFSSIGFSTSLPSLNPADLLLDLANGIAPDSKHASEQRENMEQDQK  356

Query  1084  TVKETLVSAFKTNLLENLKMEL------HELNDEDVSSAGDQKQFKRWAIPWWEQFSVLL  923
             TV++ L+SA++ N+   LK EL      +  N+    ++  Q   + W   WW+QF VLL
Sbjct  357   TVRKALISAYEKNICAKLKAELCAGLEVNNYNNYMKDASARQGTEQHWCTSWWQQFKVLL  416

Query  922   KRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQ  749
             +RGL++R+YE+F+ L++ QV+ VA L G LWW+  ++ ++D++ LLFF S FWGF+PL+ 
Sbjct  417   QRGLRERRYEAFNRLRIFQVISVATLGGLLWWRTPTSHIEDRIALLFFFSVFWGFYPLYN  476

Query  748   AIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAG  569
             A+FTFP+++ ML KERSSGMYKLSS+FLARTVGDLP+EL LPT FV+I YWM GLKP   
Sbjct  477   AVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMGGLKPDPF  536

Query  568   NFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFIS  389
              F  +L  +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+Y++ +P+FI 
Sbjct  537   TFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPAFII  596

Query  388   WIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALL  209
             W+KY+S   Y YKLLL  QY   + Y C+ G  +C V D PAIK +G   H+   V  L 
Sbjct  597   WLKYLSYSYYCYKLLLGVQYDEDDYYECSKGV-LCRVGDLPAIKSMGGLNHLWIDVSILA  655

Query  208   LMLIGYRLLAYVALMRV  158
             LML+GYRLLAY+AL RV
Sbjct  656   LMLLGYRLLAYLALHRV  672



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/663 (54%), Positives = 469/663 (71%), Gaps = 29/663 (4%)
 Frame = -3

Query  2095  PESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFEN  1916
             PE + SS      ++  +   M D +  +T L     + ++  + + K    P+TLKFE+
Sbjct  10    PEEYLSS-----LSVEASPPNMADTQTTSTVLTY--PISTNEQSLVPKLIMYPITLKFED  62

Query  1915  VVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltal  1736
             ++YKVK +QK G  +     + S  EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTAL
Sbjct  63    LIYKVKLEQKGGTCW---GSKWSYKEKTILNGITGVVCPGEILAMLGPSGSGKTTLLTAL  119

Query  1735  ggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTK  1556
             GGRL G L+G ITYN +PFS +MKR TGFV QDD+LYPHLTVTETLVFTALLRLP+TLT+
Sbjct  120   GGRLNGKLSGKITYNNQPFSGSMKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTR  179

Query  1555  QEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTS  1376
              EK+E  + VIT+LGL  C+NS+IGG  LRGISGGE++RVSIGQEMLINPSLL LDEPTS
Sbjct  180   DEKVEHVERVITELGLNLCRNSMIGGPLLRGISGGEKRRVSIGQEMLINPSLLLLDEPTS  239

Query  1375  GLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVM  1196
             GLDSTTA RI++T+ +L+ GGRT+V TIHQPSSRL+Y+F KV+LL EG P+Y+G  S  +
Sbjct  240   GLDSTTALRILNTIKKLASGGRTVVTTIHQPSSRLYYMFDKVVLLSEGCPIYYGPASTAL  299

Query  1195  SYFSTVGFSPSVAMNPSDFLLDLANGITGDDS---------QADQATVKETLVSAFKTNL  1043
              YFS+VGFS  + +NP+D LLDLANGI  D           + ++  V+E+L+SA+  N+
Sbjct  300   DYFSSVGFSTCITVNPADLLLDLANGIAPDSKHVTEQSEALEKERKIVRESLISAYDKNI  359

Query  1042  LENLKMELHELN----DEDVSSAGDQKQFK--RWAIPWWEQFSVLLKRGLKQRKYESFSG  881
                LK E+  L     +++   A  + Q K  +W   WW QF+VLL+RG+K+R++E+F+ 
Sbjct  360   ATKLKAEVCNLEVNSYNKNTKDAFTRNQIKPEQWCTSWWYQFTVLLQRGVKERRHEAFNR  419

Query  880   LKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGK  707
             L++ QV+ VAFL G LWW +  + L+D+  LLFF + FWGF+PL+ A+FTFP+++ ML K
Sbjct  420   LRIFQVISVAFLGGLLWWHTPESHLEDRTALLFFFAVFWGFYPLYNAVFTFPQERRMLIK  479

Query  706   ERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvl  527
             ERSSGMY+LSS+FLART+GDLP+EL LPT FVII YWM GLKP    F  +L  +L  V+
Sbjct  480   ERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMGGLKPDLVTFILSLLVVLYSVV  539

Query  526   vcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKL  347
             V Q LGLA GA +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YKL
Sbjct  540   VSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKL  599

Query  346   LLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             LL  QY   + Y C+ G  +C V D   IK +GL  H+   V  + LML+GYRL+AY AL
Sbjct  600   LLGVQYNENDYYECSKGE-LCKVVDFGPIKSMGL-NHMWVDVFIMALMLVGYRLVAYFAL  657

Query  166   MRV  158
              RV
Sbjct  658   HRV  660



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/604 (58%), Positives = 442/604 (73%), Gaps = 18/604 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQK-QGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs  1763
             P+TLKFE VVYKVK +Q  Q L     K      EK IL G+TG+V PGE+LAMLGPSGS
Sbjct  43    PITLKFEEVVYKVKIEQTGQCLGSWSCK------EKTILNGITGMVCPGEILAMLGPSGS  96

Query  1762  gkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             GKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDDILYPHLTV ETL FTAL
Sbjct  97    GKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDILYPHLTVWETLFFTAL  156

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP +LT+ EK E  D VI++LGLT+C NS+IGG   RGISGGE+KRVSIGQEMLINPS
Sbjct  157   LRLPSSLTRDEKAEHVDRVISELGLTRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPS  216

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+P+
Sbjct  217   LLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPI  276

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSAF  1055
             Y+G  S  M YFS+VGFS ++ +NP+D LLDLANGI  D     S+ +Q TVKETLVSA+
Sbjct  277   YYGPASSAMEYFSSVGFSTTMTVNPADLLLDLANGIPPDSQKETSEQEQKTVKETLVSAY  336

Query  1054  KTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
             + N+   LK EL   +    E   +A    + ++W   WW QF+VLL+RG+++R++ESF+
Sbjct  337   EKNISTKLKAELCNADSHSYEYTKAAAKSIKSEQWCTTWWYQFTVLLQRGVRERRFESFN  396

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + LQD+  LLFF S FWGF+PL+ A+FTFP++K ML 
Sbjct  397   KLRIFQVISVAFLGGLLWWHTPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLI  456

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F+AR +GDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  457   KERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSV  516

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK
Sbjct  517   LVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYK  576

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G   C V D P IK +GL  ++   V+ + +ML+GYRL+AY+A
Sbjct  577   LLLGIQYSDEDYYECSEGVW-CRVGDFPGIKAMGL-NNLWIDVLVMGVMLVGYRLMAYMA  634

Query  169   LMRV  158
             L RV
Sbjct  635   LHRV  638



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/639 (55%), Positives = 455/639 (71%), Gaps = 38/639 (6%)
 Frame = -3

Query  2011  TTQLQANPQL----ESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE  1844
             T  L+ +P +     S+   ++ K    P+TLKFE++VYKVK +QK              
Sbjct  16    TLSLEGSPHMTDPHSSNNEQSLPKLIMYPITLKFEDLVYKVKVNQK--------------  61

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMK  1664
              EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L G  TYN +PFS ++K
Sbjct  62    -EKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLTGKTTYNNQPFSGSIK  120

Query  1663  RNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSII  1484
             R TGFV QDD+LYPHLTVTETLVFTALLRLP+TLT+ EK+   + VI++LGL  C+NS+I
Sbjct  121   RRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTRDEKVVHVERVISELGLNNCRNSMI  180

Query  1483  GGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTI  1304
             GG  LRGISGGE++RVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+ +L+ GGRT+
Sbjct  181   GGPLLRGISGGEKRRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILNTIKKLASGGRTV  240

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLA  1124
             V TIHQPSSRL+Y+F KV+LL EG P+Y+G  S  + YFS+VGFS SV +NP+D LLDLA
Sbjct  241   VTTIHQPSSRLYYMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSVTVNPADLLLDLA  300

Query  1123  NGITGDDSQA---------DQATVKETLVSAFKTNLLENLK-----MELHELND-EDVSS  989
             NGI  D             ++ TV+E+L+SA+  N+   LK     ME++  N+    S 
Sbjct  301   NGIAPDSKHVTEQSEALEHERKTVRESLISAYDKNIAPRLKAEVSSMEVNNFNNITKDSC  360

Query  988   AGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TD  815
               +Q   ++W   WW QF+VLL+RG+++R++E+F+ L++ QV+ VAFL G LWW +  + 
Sbjct  361   TRNQINPEQWCTSWWYQFTVLLQRGVRERRHEAFNRLRIFQVISVAFLAGLLWWHTPASH  420

Query  814   LQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPME  635
             L+D+  LLFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLART+GDLP+E
Sbjct  421   LEDRTALLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLE  480

Query  634   LVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGS  455
             L LPT FVII YWM GLKP    F  +L  +L  V+V Q LGLA GA +M+ K ATTL S
Sbjct  481   LALPTAFVIILYWMGGLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLAS  540

Query  454   VIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVE  275
             V  L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G  +C V 
Sbjct  541   VTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGE-LCKVM  599

Query  274   DHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             D P IK +GL  H+   V  + LML GYRL+AY+AL RV
Sbjct  600   DFPPIKSMGL-NHMWVDVFIMALMLFGYRLVAYLALRRV  637



>ref|XP_004291249.1| PREDICTED: ABC transporter G family member 14-like [Fragaria 
vesca subsp. vesca]
Length=660

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/661 (55%), Positives = 464/661 (70%), Gaps = 35/661 (5%)
 Frame = -3

Query  2059  ATLMETATEMGDIEA-PTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQ  1883
             A + ET      + A P+   Q N Q       +  + A  P+TLKFE V YKVK D K 
Sbjct  7     AEVSETQNNRAAVLAYPSAAAQVNAQ-------SFLQLAMYPITLKFEEVFYKVKMDHKA  59

Query  1882  GL-SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag  1706
             GL  +  +   K  +EK IL G++G+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G
Sbjct  60    GLVPWPSSSSNKLTSEKSILNGISGVVCPGEILAMLGPSGSGKTTLLTALGGRLHGKLSG  119

Query  1705  TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAV  1526
              ITYN +PF  ++KR TGFV+QDD+LYPHLTVTETLVFTALLRLP TLT+ EK++  + V
Sbjct  120   KITYNSQPFCGSIKRRTGFVSQDDVLYPHLTVTETLVFTALLRLPNTLTRDEKVQHVEHV  179

Query  1525  ITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRI  1346
             I++LGL++C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQRI
Sbjct  180   ISELGLSRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRI  239

Query  1345  VSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP  1166
             ++T+  L+ GGRT+V TIHQPSSRL+++F K++LL EG P+Y+G  S  + YFS++GFS 
Sbjct  240   LTTVKRLASGGRTVVTTIHQPSSRLYHMFDKLVLLSEGYPIYYGPASSALEYFSSIGFST  299

Query  1165  SV-AMNPSDFLLDLANGITGDDSQA-----------DQATVKETLVSAFKTNLLENLKME  1022
             S+ ++NP+D LLDLANGI  D   A           +   V++ LVSA+  N+   LK E
Sbjct  300   SLPSVNPADLLLDLANGIAPDSKPAADHQQRENMEQESKMVRKDLVSAYDKNISARLKAE  359

Query  1021  LH----ELND-------EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLK  875
             L     E N+       E  SS  DQ     W   WW QF VLL+RG+++R++E+F+ L+
Sbjct  360   LCGAGVEANNVFNNYIKEAASSRHDQHHEHYWCTSWWHQFKVLLQRGIRERRFEAFNRLR  419

Query  874   VGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKER  701
             + QVL VA L G LWW+  S+ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML KER
Sbjct  420   IFQVLSVATLGGLLWWRTPSSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKER  479

Query  700   SSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvc  521
             SSGMY+LSS+FLARTVGDLP+EL LPT FV+I YWM GLKP    F  +L  +L  VLV 
Sbjct  480   SSGMYRLSSYFLARTVGDLPLELALPTAFVVIIYWMGGLKPDPFTFILSLLVVLYNVLVS  539

Query  520   qglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLL  341
             Q LGLAIGA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL
Sbjct  540   QSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSFYCYKLLL  599

Query  340   ESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMR  161
               QY+  + Y C+ G  +C V D PA+K +G   ++   V  L LML+GYR +AY+AL R
Sbjct  600   GVQYREDDYYECSKGV-LCRVGDLPAVKSMGDLNNLWIDVSILALMLLGYRFMAYLALHR  658

Query  160   V  158
             V
Sbjct  659   V  659



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/616 (57%), Positives = 449/616 (73%), Gaps = 27/616 (4%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGE  1793
              S ++ + +  P+TLKFE VVYKVK +QK G+ +  T   K   EK IL G+TG+V PGE
Sbjct  67    NSQSVLRLSIYPITLKFEEVVYKVKLEQK-GVCWGGTWGTK---EKTILNGITGMVCPGE  122

Query  1792  VLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLT  1613
             +LAMLGPSGSGKTTLLTALGGR+ G L+G +TYNG+PFS  +KR TGFV QDD+LYPHLT
Sbjct  123   ILAMLGPSGSGKTTLLTALGGRINGKLSGKVTYNGQPFSGTIKRRTGFVAQDDVLYPHLT  182

Query  1612  VTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVS  1433
             VTETLVFTALLRLP+TLT +EK+   + +I +LGLT+C+NS+IGG   RGISGGE+KRVS
Sbjct  183   VTETLVFTALLRLPKTLTNEEKLRHVERIIAELGLTRCQNSMIGGPLFRGISGGEKKRVS  242

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F K
Sbjct  243   IGQEMLINPSLLLLDEPTSGLDSTTAQRIITTIKRLASGGRTVVTTIHQPSSRLYHMFDK  302

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDS  1100
             V+LL EG+P+Y+G  S  + YFS++GF  S+ +NP+D LLDLANGI          G++ 
Sbjct  303   VVLLSEGSPIYYGPASSALDYFSSIGFYTSMTINPADLLLDLANGIAPDSKHVTEQGENM  362

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLK  920
             + +Q  V+E L+S ++  +   LK EL  L+ +           ++W   WW QF VL +
Sbjct  363   EQEQKLVQEALLSGYEKKIATRLKAELCRLDTKA----------EQWCTSWWYQFKVLFQ  412

Query  919   RGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQA  746
             RGL++R+YESF+ L++ QV+ VA L G LWW   ++ +QD++ LLFF S FWGF+PL+ A
Sbjct  413   RGLRERRYESFNRLRIFQVISVAVLGGLLWWHTPTSHIQDRIALLFFFSVFWGFYPLYNA  472

Query  745   IFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGN  566
             +FTFP+++ ML KER+SGMY LSS+FLART GDLP+EL LPT FV I YWM GLK     
Sbjct  473   VFTFPQERSMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADPIT  532

Query  565   FFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISW  386
             F  +L  IL  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P+FI W
Sbjct  533   FILSLLVILYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPTFIVW  592

Query  385   IKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLL  206
             +KY+S   Y YKLLL  QY   + Y C+ G  +C V D PA+K +GL  H+   V  + L
Sbjct  593   LKYLSYSYYCYKLLLGVQYSEDDYYECSKGV-LCRVGDFPAVKSMGL-NHLWVDVCIMAL  650

Query  205   MLIGYRLLAYVALMRV  158
             ML+GYRL+AY+AL RV
Sbjct  651   MLVGYRLVAYLALHRV  666



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/628 (56%), Positives = 452/628 (72%), Gaps = 27/628 (4%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQKQG---LSFLKTKKQKSEAEKIILKGVTGIVF  1802
              S +  + A  P+TLKFE V YKVK +QK G   +S+  T    S  EK IL G+TG V 
Sbjct  46    NSQSFLQLAMYPITLKFEEVFYKVKMEQKGGRGGVSWWGT--NTSSREKSILSGITGTVC  103

Query  1801  PGEVLAMLGPSgsgkttllta-----lggrlgghlagTITYNGKPFSNAMKRNTGFVTQD  1637
             PGE+LAMLGPSGSGKTTLLTA             ++G ITYNG+PF  ++KR TGFV QD
Sbjct  104   PGEILAMLGPSGSGKTTLLTALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQD  163

Query  1636  DILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGIS  1457
             D+LYPHLTVTETLVFTALLRLP++L++ EK++  + VI++LGL+ C++S+IGG   RGIS
Sbjct  164   DVLYPHLTVTETLVFTALLRLPKSLSRDEKVQHVEHVISELGLSGCRSSMIGGPLFRGIS  223

Query  1456  GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSS  1277
             GGE+KRVSIG EMLINPSLL LDEPTSGLDSTTAQRI++TL  L+ GGRT+V TIHQPSS
Sbjct  224   GGEKKRVSIGLEMLINPSLLLLDEPTSGLDSTTAQRILTTLKRLASGGRTLVTTIHQPSS  283

Query  1276  RLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSV-AMNPSDFLLDLANGITGDDS  1100
             R++++F K++LL EG+P+Y+G  S  + YFS++GFS S+ ++NP+D LLDLANGI  D  
Sbjct  284   RIYHMFDKLVLLSEGSPIYYGPASAALDYFSSIGFSTSLPSLNPADLLLDLANGIAPDSR  343

Query  1099  QA---------DQATVKETLVSAFKTNLLENLKMELH---ELNDEDVSSAGDQKQFKRWA  956
              A         DQ TV++ L+SA+  N+   LK EL    E+N+ + +   D    + W 
Sbjct  344   HASEQRENMEQDQKTVRKALISAYDKNICAKLKAELCAGLEVNNYN-NYMKDASAKQHWC  402

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFI  782
               WW+QF VLL+RGL++R+YE+F+ L++ QV+ VA L G LWW+  ++ ++D++ LLFF 
Sbjct  403   TSWWQQFKVLLQRGLRERRYEAFNRLRIFQVISVATLGGLLWWRTPTSHIEDRIALLFFF  462

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGF+PL+ A+FTFP+++ ML KERSSGMYKLSS+FLARTVGDLP+EL LPT FV+I 
Sbjct  463   SVFWGFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVII  522

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWM GLKP    F  +L  +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG
Sbjct  523   YWMGGLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGG  582

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +Y++ +P+FI W+KY+S   Y YKLLL  QY   E Y C+ G  +C V D PAIK +G  
Sbjct  583   YYIQQIPAFIVWLKYLSYSYYCYKLLLGVQYDEDEYYECSKGV-LCRVGDLPAIKSMGGL  641

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRV  158
              H+   V  L LML+GYRLLAY+AL RV
Sbjct  642   NHLWIDVSILALMLLGYRLLAYLALHRV  669



>gb|KDP29341.1| hypothetical protein JCGZ_18262 [Jatropha curcas]
Length=682

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/675 (56%), Positives = 483/675 (72%), Gaps = 41/675 (6%)
 Frame = -3

Query  2095  PESFPSSSDQQEATLMETATEMGDIEAPTTQLQANP----------QLESDTSA-AIFKK  1949
             P + P++S        ET + +   E P + + AN           Q E +TS   I ++
Sbjct  11    PVTPPANSGITLNNWTETVSSV-HAEPPVSSINANSCSQYRVPDHQQQELNTSRFLILRE  69

Query  1948  ANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPS  1769
             ++ PVTLKFE+V Y +    K+   +L   K  +   K +L  V+GIV PGE+LAMLGPS
Sbjct  70    SSHPVTLKFEDVSYSINLSAKRS-CYLNEPKSTT---KTVLNCVSGIVRPGELLAMLGPS  125

Query  1768  gsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFT  1589
             GSGKTTLLTAL GRL G ++GTI+YNG PFS++MKR TGFV+QDD+LYPHLTV ETL +T
Sbjct  126   GSGKTTLLTALAGRLPGKVSGTISYNGMPFSSSMKRKTGFVSQDDVLYPHLTVIETLTYT  185

Query  1588  ALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLIN  1409
             ALLRLP+ L+K+EKIEQA+ VI +LGLT+C+NS+IGG  LRG+SGGERKRVSIGQEML+N
Sbjct  186   ALLRLPKKLSKEEKIEQAELVIAELGLTRCRNSVIGGPLLRGVSGGERKRVSIGQEMLVN  245

Query  1408  PSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGN  1229
             PSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT++ TIHQPSSRL+ +F KV++L +G 
Sbjct  246   PSLLLLDEPTSGLDSTTAQRIVATLKGLARGGRTVLTTIHQPSSRLYRMFDKVVVLSDGC  305

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGDDSQAD-------------  1091
             P+Y G  S VM YF ++G+ P    MNP+DFLLDLANGI  D  Q D             
Sbjct  306   PIYSGYASRVMEYFGSIGYVPGFNFMNPADFLLDLANGIVPDTKQGDQLMESHNRLDHLD  365

Query  1090  -QATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK----RWAIPWWEQFSVL  926
              Q +VK++L+S++K NL   LK ++H+ N +D SS+G     K    +W   WW+QF VL
Sbjct  366   EQNSVKQSLISSYKKNLYPALKADIHQ-NFQD-SSSGPSSLVKYSADQWTTTWWQQFQVL  423

Query  925   LKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLF  752
             L+RGL++RK+ES+SGL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF
Sbjct  424   LRRGLRERKHESYSGLRIFQVLSVSVLSGLLWWHSDTSHIQDQVGLLFFFSIFWGFFPLF  483

Query  751   QAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTA  572
              AIFTFP+++ ML KERSSGMY+LSS++LAR  GDLPMELVLPT+FV ISYWM GLKP+ 
Sbjct  484   NAIFTFPQERPMLIKERSSGMYRLSSYYLARIAGDLPMELVLPTIFVTISYWMGGLKPSL  543

Query  571   GNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFI  392
               F   L  IL  VLV QGLGLA+GA +M+ K ATTL SV ML FLLAGG+Y++H+P FI
Sbjct  544   VTFILTLLIILFNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLAGGYYIQHIPQFI  603

Query  391   SWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVAL  212
             +W+KYIS   Y YKLL+  QY   E Y C  G   C V D PAIK +G+  ++   V AL
Sbjct  604   AWLKYISFSHYCYKLLVGVQYSVNEVYECEKGIH-CRVMDFPAIKYLGV-DNMWGDVAAL  661

Query  211   LLMLIGYRLLAYVAL  167
              +ML+GYR+LAY+AL
Sbjct  662   SIMLVGYRILAYLAL  676



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 445/605 (74%), Gaps = 22/605 (4%)
 Frame = -3

Query  1924  FENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttll  1745
             FE VVYKVK +QK G  +       S  +K IL G+TG+V PGE+LAMLGPSGSGKTTLL
Sbjct  76    FEEVVYKVKLEQK-GFCW---GGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTTLL  131

Query  1744  talggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
             TALGGRL G L+G ITYNG+PFS A+KR TGFV QDD+LYPHLTVTETL+FTALLRLP++
Sbjct  132   TALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLPKS  191

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
             L + EK +  + VI++LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDE
Sbjct  192   LARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDE  251

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y G  S
Sbjct  252   PTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGPAS  311

Query  1204  DVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA---------DQATVKETLVSAFK  1052
               M YFS+VGFS  V +NP+D LLDLANGI+ D  QA         +Q +V+E L+SA++
Sbjct  312   TAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISAYE  371

Query  1051  TNLLENLKMELHELNDEDVSSAGD---QKQFK--RWAIPWWEQFSVLLKRGLKQRKYESF  887
              N+   LK EL  ++  + +   D   +  FK  +W   WW QF VLL+RGL++R+YE+F
Sbjct  372   KNISTRLKAELCSVDVNNYNYTKDGRARNNFKADQWCTSWWHQFMVLLQRGLRERRYEAF  431

Query  886   SGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMML  713
             + L++ QV+ VA L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML
Sbjct  432   NRLRIFQVISVAVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRML  491

Query  712   GKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllc  533
              KERSSGMY+LSS+FLART GDLP+EL LPT FVII YWM GLKP    F  +L  +L  
Sbjct  492   IKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSLLVVLYN  551

Query  532   vlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTY  353
             VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y Y
Sbjct  552   VLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCY  611

Query  352   KLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYV  173
             KLLL  QY   + Y C+ G   C V D PA+K +GL  H+   V  + LML+GYRL+AY+
Sbjct  612   KLLLGIQYSEDDYYECSKGV-FCRVVDFPAVKSVGL-NHLWIDVCIMALMLVGYRLVAYL  669

Query  172   ALMRV  158
             AL RV
Sbjct  670   ALHRV  674



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/604 (58%), Positives = 440/604 (73%), Gaps = 18/604 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQ-KQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs  1763
             P+TLKFE VVYKVK +Q  Q L     K      EK IL G+TG+V PGE+LAMLGPSGS
Sbjct  50    PITLKFEEVVYKVKIEQTNQCLGSWSCK------EKTILNGITGMVCPGEILAMLGPSGS  103

Query  1762  gkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             GKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHLTV ETL FTAL
Sbjct  104   GKTTLLSALGGRLAKSFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTAL  163

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP +LT+ EK E  D VI +LGLT+C NS+IGG   RGISGGE+KRVSIGQEMLINPS
Sbjct  164   LRLPSSLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPS  223

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+P+
Sbjct  224   LLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPI  283

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSAF  1055
             Y+G  S  + YFS+VGFS S+ +NP+D LLDLANGI  D     S+ +Q TVKETLVSA+
Sbjct  284   YYGPASSAVDYFSSVGFSTSMTVNPADLLLDLANGIPPDSQKETSEQEQKTVKETLVSAY  343

Query  1054  KTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
               N+   LK EL   +    E   +A    + ++W   WW QF+VLL+RG+++R++ESF+
Sbjct  344   DKNISTKLKAELCNADSHSFEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  403

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A+FTFP++K ML 
Sbjct  404   KLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLI  463

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  464   KERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSV  523

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK
Sbjct  524   LVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYK  583

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +ML+GYRL+AY+A
Sbjct  584   LLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-SNLWIDVFVMGVMLVGYRLIAYMA  641

Query  169   LMRV  158
             L RV
Sbjct  642   LHRV  645



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/616 (57%), Positives = 445/616 (72%), Gaps = 19/616 (3%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQ--KQGLSFLKTKKQKSEAEKIILKGVTGIVFP  1799
             TS    + +  P+TLKFE VVYKVK +Q   Q L   K+K      EK IL G+TG+V P
Sbjct  39    TSQPGLQMSMYPITLKFEEVVYKVKIEQTSSQCLGSWKSK------EKTILNGITGMVCP  92

Query  1798  GEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPH  1619
             GE+LAMLGPSGSGKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPH
Sbjct  93    GEILAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPH  152

Query  1618  LTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKR  1439
             LTV ETL FTALLRLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KR
Sbjct  153   LTVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKR  212

Query  1438  VSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLF  1259
             VSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT+V TIHQPSSR++++F
Sbjct  213   VSIGQEMLINPSLLLLDEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMF  272

Query  1258  HKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQAD  1091
              KV+LL EG+P+Y+G  S  M YFS++GFS S+ +NP+D LLDLANGI  D     ++ +
Sbjct  273   DKVVLLSEGSPIYYGSASSAMEYFSSLGFSTSMTVNPADLLLDLANGIPPDSQKETTEQE  332

Query  1090  QATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLK  920
             Q TVKETLVSA++ N+   LK EL        E   +A    + ++W   WW QF+VLL+
Sbjct  333   QKTVKETLVSAYEKNISAKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQ  392

Query  919   RGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQA  746
             RG+++R++ESF+ L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A
Sbjct  393   RGVRERRFESFNKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNA  452

Query  745   IFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGN  566
             +FTFP++K ML KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    
Sbjct  453   VFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTT  512

Query  565   FFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISW  386
             F  +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W
Sbjct  513   FILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVW  572

Query  385   IKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLL  206
             +KY+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +
Sbjct  573   LKYLSYSYYCYKLLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-NNLWIDVFVMGV  630

Query  205   MLIGYRLLAYVALMRV  158
             ML+GYRL+AY+AL RV
Sbjct  631   MLVGYRLIAYMALHRV  646



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/616 (57%), Positives = 445/616 (72%), Gaps = 19/616 (3%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQ--KQGLSFLKTKKQKSEAEKIILKGVTGIVFP  1799
             TS    + +  P+TLKFE VVYKVK +Q   Q L   K+K      EK IL G+TG+V P
Sbjct  39    TSQPGLQMSMYPITLKFEEVVYKVKIEQTSSQCLGSWKSK------EKTILNGITGMVCP  92

Query  1798  GEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPH  1619
             GE+LAMLGPSGSGKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPH
Sbjct  93    GEILAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPH  152

Query  1618  LTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKR  1439
             LTV ETL FTALLRLP +LT+ EK E  D VI +LGLT+C NS+IGG   RGISGGE KR
Sbjct  153   LTVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGISGGEMKR  212

Query  1438  VSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLF  1259
             VSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT+V TIHQPSSR++++F
Sbjct  213   VSIGQEMLINPSLLLLDEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMF  272

Query  1258  HKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQAD  1091
              KV+LL EG+P+Y+G  S  M YFS++GFS S+ +NP+D LLDLANGI  D     ++ +
Sbjct  273   DKVVLLSEGSPIYYGSASSAMEYFSSLGFSTSMTVNPADLLLDLANGIPPDSQKETTEQE  332

Query  1090  QATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLK  920
             Q TVKETLVSA++ N+   LK EL        E   +A    + ++W   WW QF+VLL+
Sbjct  333   QKTVKETLVSAYEKNISAKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQ  392

Query  919   RGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQA  746
             RG+++R++ESF+ L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A
Sbjct  393   RGVRERRFESFNKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNA  452

Query  745   IFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGN  566
             +FTFP++K ML KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    
Sbjct  453   VFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTT  512

Query  565   FFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISW  386
             F  +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W
Sbjct  513   FILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVW  572

Query  385   IKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLL  206
             +KY+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +
Sbjct  573   LKYLSYSYYCYKLLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-NNLWIDVFVMGV  630

Query  205   MLIGYRLLAYVALMRV  158
             ML+GYRL+AY+AL RV
Sbjct  631   MLVGYRLIAYMALHRV  646



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/634 (57%), Positives = 464/634 (73%), Gaps = 31/634 (5%)
 Frame = -3

Query  1990  PQLESD------TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
             P L+ D        +++ +++ RP+ LKFE + Y +K    +G  +  +  Q+ +  ++I
Sbjct  37    PCLDDDGPSHQSCQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGS--QEPKQNRLI  94

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             L GV+GIV PGE+LAMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++++KR TGF
Sbjct  95    LNGVSGIVKPGELLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRRTGF  154

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             VTQDD+LYPHLTV ETL +TALLRLP+ LT++EKI+QA++VI+ LGLT+C NS+IGG  +
Sbjct  155   VTQDDVLYPHLTVMETLTYTALLRLPKELTRKEKIQQAESVISDLGLTRCCNSVIGGGLI  214

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIH
Sbjct  215   RGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIH  274

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGIT  1112
             QPSSRL+ +F KVL+L +G+P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT
Sbjct  275   QPSSRLYRMFDKVLVLSDGSPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANGIT  334

Query  1111  GDDSQADQA-------------TVKETLVSAFKTNLLENLKMELHELNDEDVS---SAGD  980
              D  Q +Q              +VK++L+SA+K NL   LK E      +D +   S   
Sbjct  335   SDTKQYEQVEINGKLDRLEEQNSVKQSLISAYKKNLYPPLKEEFSRAFPQDQTVNMSRSK  394

Query  979   QKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQD  806
              +   RW   WW QFSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QD
Sbjct  395   TRLTNRWPTSWWMQFSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHIQD  454

Query  805   QVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVL  626
             QVGLLFF S FWGF PLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+L
Sbjct  455   QVGLLFFFSIFWGFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELIL  514

Query  625   PTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIM  446
             PT+FV I+YWM GLK +   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+M
Sbjct  515   PTIFVTITYWMGGLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLM  574

Query  445   LAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDH  269
             L FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C V D+
Sbjct  575   LVFLLAGGYYIQHIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYEC--GPGLHCSVMDY  632

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
               IK + LG ++++ V+AL LML+ YR LAYVAL
Sbjct  633   EGIKNLRLG-NMMWDVLALTLMLLLYRFLAYVAL  665



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/610 (57%), Positives = 450/610 (74%), Gaps = 20/610 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE+VVYKVK +Q  G  F        + EK ILKG+TG+V PGE+LAMLGPSGSG
Sbjct  31    PITLKFEDVVYKVKLEQPIG--FCTGTGTWGDKEKTILKGITGMVCPGELLAMLGPSGSG  88

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLL+ALGGRL G L G ITYN +PFS ++KR TGFV Q+DILYPHLTVTETL+FTALL
Sbjct  89    KTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALL  148

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP +LT  EK +  + VI +LGLT+C+NS+IGG  +RGISGGE+KRVSI QEMLINP L
Sbjct  149   RLPNSLTYTEKYQHVEQVIAELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCL  208

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQRI++T+  L+  GRTI+ TIHQPSSRL+++F KV+LL EG+ +Y
Sbjct  209   LLLDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIY  268

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVKETL  1067
              G  S  + YFS++GFS SV +NP+D LLDLANG++         G+++  DQ  V+E L
Sbjct  269   NGPASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPEYRQSTEQGENTDQDQKLVREAL  328

Query  1066  VSAFKTNLLENLKMELHEL-----NDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQR  902
              SA++ N+   LK EL  L     N    +SA + ++ ++W+  WW QF VLL+RG+++R
Sbjct  329   KSAYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRER  388

Query  901   KYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             ++E+F+ L++ QV+ VA L G LWW   ++ ++D+V LLFF S FWGF+PL+ A+FTFP+
Sbjct  389   RFEAFNKLRIFQVISVAVLGGLLWWHTPTSHIEDRVALLFFFSVFWGFYPLYNAVFTFPQ  448

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KERSSGMY+LSS+FLART GDLP+EL LPT FV I YWM GLK  +  F  +L 
Sbjct  449   ERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADSVTFILSLL  508

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
             A+L  VLV QGLGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S 
Sbjct  509   AVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYLSY  568

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               Y YK+LL  QY   + Y C+ G  +C V D+PA++ +GL  ++   V  + LML+GYR
Sbjct  569   SYYCYKMLLGIQYDDDDYYECSKGE-LCRVADYPAVRSMGL-NNLWADVCIMALMLVGYR  626

Query  187   LLAYVALMRV  158
             L+AY+AL RV
Sbjct  627   LIAYMALRRV  636



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14-like [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/614 (57%), Positives = 446/614 (73%), Gaps = 23/614 (4%)
 Frame = -3

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKS----EAEKIILKGVTGIVFPGEVLAMLGPS  1769
             VTLKFE +VYKVK + K G  +              EK IL G++G+VFPGE+LAMLGPS
Sbjct  41    VTLKFEEIVYKVKLEGKGGSCWGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPS  100

Query  1768  gsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFT  1589
             GSGKTTLLTALGGRL G L+G ITYNG+PFS A KR TGFV QDD+LYPHLTV ETL+FT
Sbjct  101   GSGKTTLLTALGGRLSGKLSGKITYNGQPFSGATKRRTGFVAQDDVLYPHLTVAETLLFT  160

Query  1588  ALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLIN  1409
             ALLRLP +LT  EK E  + VI++LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLIN
Sbjct  161   ALLRLPSSLTADEKAEAVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLIN  220

Query  1408  PSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGN  1229
             PSLL LDEPTSGLDSTTA +I++T+  L+ GGRTIV TIHQPSSRL+++F KV+LL EG+
Sbjct  221   PSLLLLDEPTSGLDSTTAMKIITTVKRLAAGGRTIVTTIHQPSSRLYHMFDKVVLLSEGS  280

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVK  1076
             P+Y+G  S+ M YFS++GFS S+ +NP+D LLDLANGI          G++ + +Q +VK
Sbjct  281   PIYYGSASNAMDYFSSIGFSTSITINPADLLLDLANGIAPDSKYANEGGENMEQEQKSVK  340

Query  1075  ETLVSAFKTNLLENLKMELHELNDEDV------SSAGDQKQFKRWAIPWWEQFSVLLKRG  914
             E L+SA++ N+   LK EL  L+  +       +S  +++  + W   WW QF VLL+RG
Sbjct  341   EALISAYEKNISSTLKAELCSLDANNFNNYAKDASKREKRSREEWCTSWWYQFRVLLQRG  400

Query  913   LKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIF  740
             LK+R+Y++F+ L++ QV+ VA L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+F
Sbjct  401   LKERRYDAFNRLRIFQVISVATLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVF  460

Query  739   TFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFF  560
             TFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FV I Y+M GL P    F 
Sbjct  461   TFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGLDPHPTTFL  520

Query  559   SALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIK  380
              +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+K
Sbjct  521   LSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLK  580

Query  379   YISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLML  200
             Y+S   Y YKLLL  QY  G+ Y C  G   C V D PA+K +GL + +   V  + LML
Sbjct  581   YLSYSYYCYKLLLGVQYHNGDVYECGKGE-FCQVVDFPAVKSVGLDR-LWVDVCIMALML  638

Query  199   IGYRLLAYVALMRV  158
             +GYRL+AY+AL RV
Sbjct  639   VGYRLIAYLALHRV  652



>ref|XP_004164431.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
14-like [Cucumis sativus]
Length=655

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/614 (57%), Positives = 445/614 (72%), Gaps = 23/614 (4%)
 Frame = -3

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKS----EAEKIILKGVTGIVFPGEVLAMLGPS  1769
             VTLKFE +VYKVK + K G  +              EK IL G++G+VFPGE+LAMLGPS
Sbjct  41    VTLKFEEIVYKVKLEGKGGSCWGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPS  100

Query  1768  gsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFT  1589
             GSG TTLLTALGGRL G L+G ITYNG+PFS A KR TGFV QDD+LYPHLTV ETL+FT
Sbjct  101   GSGXTTLLTALGGRLSGKLSGKITYNGQPFSGATKRRTGFVAQDDVLYPHLTVAETLLFT  160

Query  1588  ALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLIN  1409
             ALLRLP +LT  EK E  + VI++LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLIN
Sbjct  161   ALLRLPSSLTADEKAEAVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLIN  220

Query  1408  PSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGN  1229
             PSLL LDEPTSGLDSTTA +I++T+  L+ GGRTIV TIHQPSSRL+++F KV+LL EG+
Sbjct  221   PSLLLLDEPTSGLDSTTAMKIITTVKRLAAGGRTIVTTIHQPSSRLYHMFDKVVLLSEGS  280

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVK  1076
             P+Y+G  S+ M YFS++GFS S+ +NP+D LLDLANGI          G++ + +Q +VK
Sbjct  281   PIYYGSASNAMDYFSSIGFSTSITINPADLLLDLANGIAPDSKYANEGGENMEQEQKSVK  340

Query  1075  ETLVSAFKTNLLENLKMELHELNDEDV------SSAGDQKQFKRWAIPWWEQFSVLLKRG  914
             E L+SA++ N+   LK EL  L+  +       +S  +++  + W   WW QF VLL+RG
Sbjct  341   EALISAYEKNISSTLKAELCSLDANNFNNYAKDASKREKRSREEWCTSWWYQFRVLLQRG  400

Query  913   LKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIF  740
             LK+R+Y++F+ L++ QV+ VA L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+F
Sbjct  401   LKERRYDAFNRLRIFQVISVATLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVF  460

Query  739   TFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFF  560
             TFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FV I Y+M GL P    F 
Sbjct  461   TFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGLDPHPTTFL  520

Query  559   SALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIK  380
              +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+K
Sbjct  521   LSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLK  580

Query  379   YISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLML  200
             Y+S   Y YKLLL  QY  G+ Y C  G   C V D PA+K +GL + +   V  + LML
Sbjct  581   YLSYSYYCYKLLLGVQYHNGDVYECGKGE-FCQVVDFPAVKSVGLDR-LWVDVCIMALML  638

Query  199   IGYRLLAYVALMRV  158
             +GYRL+AY+AL RV
Sbjct  639   VGYRLIAYLALHRV  652



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/661 (53%), Positives = 460/661 (70%), Gaps = 34/661 (5%)
 Frame = -3

Query  2074  SDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKP  1895
             SD    T +E + EM       TQ +A P  + + S A  +    P+TLKFE V YKVK 
Sbjct  16    SDSSCTTTVEVSPEM----PAGTQNKAAPATQVN-SQAFLQLTLYPITLKFEEVFYKVKV  70

Query  1894  DQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta-----lgg  1730
             +QK       ++ +    EK IL G+TG+V PGE+LAMLGPSGSGKTTLLT+        
Sbjct  71    EQK------GSRGRSRSREKSILSGITGMVCPGEILAMLGPSGSGKTTLLTSLGGRLNHQ  124

Query  1729  rlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQE  1550
                  ++G I+YNG+PF  A+KR TGFV QDD+LYPHLTVTETLVFTALLRLP +L++ E
Sbjct  125   NNVKFMSGKISYNGQPFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSLSRDE  184

Query  1549  KIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGL  1370
             K++  + VI++LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGL
Sbjct  185   KVQHVEQVISELGLTQCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGL  244

Query  1369  DSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSY  1190
             DSTTAQRI+ TL  L+ GGRT+V TIHQPSSR++++F K++LL EG+P+Y+G  S  ++Y
Sbjct  245   DSTTAQRILITLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPIYYGPASAALNY  304

Query  1189  FSTVGFSPSV-AMNPSDFLLDLANGITGDDSQA-----------DQATVKETLVSAFKTN  1046
             FS++GFS S+ ++NP+D LLDLANGI  D   A           +Q  V++ L+SA+  N
Sbjct  305   FSSIGFSTSLPSVNPADLLLDLANGIAPDSQHASEQWENTNAEQEQKMVRKALISAYDKN  364

Query  1045  LLENLKMELH---ELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLK  875
             +   LK EL    E+N+ D    G     + W   WW QF VL +RGL++R+YE+F+ L+
Sbjct  365   IYAKLKDELCAGLEVNNYDNYMKGAASAKQYWCTSWWHQFKVLFQRGLRERRYEAFNRLR  424

Query  874   VGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKER  701
             + QV+ VA L G LWW+  ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML KER
Sbjct  425   IFQVVSVATLGGLLWWRTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKER  484

Query  700   SSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvc  521
             SSGMY+LSS+FLARTVGDLP+EL LPT FV+I YWM GLKP    F  +L  +L  VLV 
Sbjct  485   SSGMYQLSSYFLARTVGDLPLELALPTAFVLIIYWMGGLKPDPFTFILSLLVVLYSVLVS  544

Query  520   qglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLL  341
             Q LGLAIGA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL
Sbjct  545   QSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLL  604

Query  340   ESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMR  161
               QY   + Y C+ G  +C V D PA+K +G   H+   V  L LML+GYRLLAY+AL R
Sbjct  605   GVQYDEDDFYECSKGV-LCRVGDLPAVKSMGGLDHLWLDVSILGLMLLGYRLLAYLALHR  663

Query  160   V  158
             V
Sbjct  664   V  664



>ref|XP_006493205.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=650

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/643 (54%), Positives = 467/643 (73%), Gaps = 23/643 (4%)
 Frame = -3

Query  2023  IEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG-----LSFLKTK  1859
             IE    + Q+  +L+      + KK N  V +KFE+V +K+K    +G       +L  K
Sbjct  11    IENMDEENQSQRELQKQNVEDMLKKVNMLVIIKFEDVTHKIKTKGGRGSLGRYCCYLLNK  70

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltal----ggrlgghlagTITYN  1691
                S+ EK+ILKGV+G V PGE+LA+LGPSG GKTTLLTAL             G ITYN
Sbjct  71    N--SDEEKMILKGVSGAVSPGELLAILGPSGCGKTTLLTALGGRLSNGKDTVTQGHITYN  128

Query  1690  GKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLG  1511
             GK FS  +KR TGFV Q+++ YPHLTV ETLVFTALLRLP +L ++EK+  A+AVI QLG
Sbjct  129   GKQFSAEVKRRTGFVAQNNVFYPHLTVAETLVFTALLRLPNSLKREEKVLHAEAVINQLG  188

Query  1510  LTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLW  1331
             L +C+NSIIGG  +RG+SGGERKR+SIGQE+LINPSLLFLDEPTSGLDST A++I+ +L 
Sbjct  189   LARCRNSIIGGRLVRGLSGGERKRISIGQELLINPSLLFLDEPTSGLDSTMAKKILVSLS  248

Query  1330  ELSKGGRTIVMTIHQPSSRLFYLFHKV-LLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM  1154
             +L++GGRTI+MTIHQP+S LFY+F+K+ LL  +G+ LYFGKG DV++YF+ +G+ PSVAM
Sbjct  249   KLAEGGRTILMTIHQPASSLFYMFNKILLLSSDGSSLYFGKGEDVINYFAGIGYVPSVAM  308

Query  1153  NPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQK  974
             NP+DFLLDLANG+   D + ++  VK+TL+SA+K+N+   LK E  +  D  +++  D K
Sbjct  309   NPADFLLDLANGVASGDPKENREAVKQTLISAYKSNISNKLKQEFEDRGDHSLTA--DSK  366

Query  973   QFK---RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQ  809
              ++   +W+  WW+ FSVLL+R LK+R++++F GLK+GQ+L ++ +TG +WW+S+  +++
Sbjct  367   NYRKTSKWSTTWWQHFSVLLRRDLKERRHDTFDGLKIGQILFLSIITGLVWWQSSTDNIE  426

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             DQVGLLFF S   GFFPLFQA+ TFP ++MML KERSSGMY+LSS+ +A+T GD  MELV
Sbjct  427   DQVGLLFFYSRQAGFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTAGDFVMELV  486

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPTVFVII+YWM GLK    NF S L+A L   LV Q LGLA+GA +++Q+ A T+ + +
Sbjct  487   LPTVFVIITYWMGGLKARVINFLSTLAATLYTALVAQSLGLAVGALVLNQRKAGTIATTL  546

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGS---GVCLV  278
             ML FLL GGF+V+ VP+FISW++Y+S   Y+YKLLL SQY P +TY C S S     CLV
Sbjct  547   MLTFLLTGGFFVQDVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYICASNSNSNATCLV  606

Query  277   EDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGRT  149
              D P IK +GL   ++ SVV +  M + Y+L+ Y+AL RV  T
Sbjct  607   GDFPRIKFVGLNNKLL-SVVMMAAMFVCYKLITYLALRRVAAT  648



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/610 (57%), Positives = 450/610 (74%), Gaps = 20/610 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE+VVYKVK +Q  G  F        + EK ILKG+TG+V PGE+LAMLGPSGSG
Sbjct  31    PITLKFEDVVYKVKLEQPIG--FCTGTGTWGDKEKTILKGITGMVCPGELLAMLGPSGSG  88

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLL+ALGGRL G L G ITYN +PFS ++KR TGFV Q+DILYPHLTVTETL+FTALL
Sbjct  89    KTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALL  148

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP +LT  EK +  + VI +LGLT+C+NS+IGG  +RGISGGE+KRVSI QEMLINP L
Sbjct  149   RLPNSLTYTEKYQHVEQVIAELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCL  208

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQRI++T+  L+  GRTI+ TIHQPSSRL+++F KV+LL EG+ +Y
Sbjct  209   LLLDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIY  268

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVKETL  1067
              G  S  + YFS++GFS SV +NP+D LLDLANG++         G+++  DQ  V+E L
Sbjct  269   NGPASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPDYRQSTEQGENTDQDQKFVREAL  328

Query  1066  VSAFKTNLLENLKMELHEL-----NDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQR  902
              SA++ N+   LK EL  L     N    +SA + ++ ++W+  WW QF VLL+RG+++R
Sbjct  329   KSAYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRER  388

Query  901   KYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             ++E+F+ L++ QV+ VA L G LWW   ++ ++D+V LLFF S FWGF+PL+ A+FTFP+
Sbjct  389   RFEAFNKLRIFQVISVAVLGGLLWWHTPTSHIEDRVALLFFFSVFWGFYPLYNAVFTFPQ  448

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KERSSGMY+LSS+FLART GDLP+EL LPT FV I YWM GLK  +  F  +L 
Sbjct  449   ERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADSVTFILSLL  508

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
             A+L  VLV QGLGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S 
Sbjct  509   AVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYLSY  568

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               Y YK+LL  QY   + Y C+ G  +C V D+PA++ +GL  ++   V  + LML+GYR
Sbjct  569   SYYCYKMLLGIQYDDDDYYECSKGE-LCRVADYPAVRSMGL-NNLWADVCIMALMLVGYR  626

Query  187   LLAYVALMRV  158
             L+AY+AL RV
Sbjct  627   LIAYMALRRV  636



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/628 (56%), Positives = 449/628 (71%), Gaps = 21/628 (3%)
 Frame = -3

Query  2002  LQANPQLESDTSAAI---FKKANRPVTLKFENVVYKVKPDQ-KQGLSFLKTKKQKSEAEK  1835
             +Q  P +    S ++    + +  P+TLKFE VVYKVK +Q  Q +   K+K      EK
Sbjct  18    VQGLPDMSETQSKSVQPGLQMSMYPITLKFEEVVYKVKIEQTSQCMGSWKSK------EK  71

Query  1834  IILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNT  1655
              IL G+TG+V PGE LAMLGPSGSGKTTLL+ALGGRL    +G + YNG+PFS  +KR T
Sbjct  72    TILNGITGMVCPGEFLAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRT  131

Query  1654  GFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV  1475
             GFV QDD+LYPHLTV ETL FTALLRLP +LT+ EK E  D VI +LGLT+C NS+IGG 
Sbjct  132   GFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLTRCTNSMIGGP  191

Query  1474  FLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMT  1295
               RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V T
Sbjct  192   LFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTT  251

Query  1294  IHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI  1115
             IHQPSSR++++F KV+LL EG+P+Y+G  +  + YFS++GFS S+ +NP+D LLDLANGI
Sbjct  252   IHQPSSRIYHMFDKVVLLSEGSPIYYGPATSAVEYFSSLGFSTSMTVNPADLLLDLANGI  311

Query  1114  TGDD----SQADQATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQKQFKRWA  956
               D     S+ +Q TVKETLVSA++ N+   LK EL        E   +A    + ++W 
Sbjct  312   PPDSQKETSEQEQKTVKETLVSAYEKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWC  371

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFI  782
               WW QF+VLL+RG+++R++ESF+ L++ QV+ VAFL G LWW +  + +QD+  LLFF 
Sbjct  372   TTWWYQFTVLLQRGVRERRFESFNKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFF  431

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWGF+PL+ A+FTFP++K ML KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I 
Sbjct  432   SVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFII  491

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWM GLKP    F  +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG
Sbjct  492   YWMGGLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGG  551

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YV+ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL 
Sbjct  552   YYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-  609

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRV  158
              ++   V  + +ML+GYRL+AY AL RV
Sbjct  610   NNLWIDVFVMGVMLVGYRLMAYFALHRV  637



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/610 (57%), Positives = 449/610 (74%), Gaps = 20/610 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE+VVYKVK +Q  G  F          EK ILKG+TG+V PGE+LAMLGPSGSG
Sbjct  31    PITLKFEDVVYKVKLEQPIG--FCTGTGTWGAKEKTILKGITGMVCPGELLAMLGPSGSG  88

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLL+ALGGRL G L G ITYN +PFS ++KR TGFV Q+DILYPHLTVTETL+FTALL
Sbjct  89    KTTLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALL  148

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP +LT  EK +  + VIT+LGLT+C+NS+IGG  +RGISGGE+KRVSI QEMLINP L
Sbjct  149   RLPNSLTYTEKYQHVEQVITELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCL  208

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQRI++T+  L+  GRTI+ TIHQPSSRL+++F KV+LL EG+ +Y
Sbjct  209   LLLDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIY  268

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVKETL  1067
              G  S  + YFS++GFS SV +NP+D LLDLANG++         G+++  DQ  V+E L
Sbjct  269   NGPASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPDYRQSTEQGENTDQDQKFVREAL  328

Query  1066  VSAFKTNLLENLKMELHEL-----NDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQR  902
              SA++ N+   LK EL  L     N    +SA + ++ ++W+  WW QF VLL+RG+++R
Sbjct  329   KSAYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRER  388

Query  901   KYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             ++E+F+ L++ QV+ VA L G LWW   ++ ++D+V LLFF S FWGF+PL+ A+FTFP+
Sbjct  389   RFEAFNKLRIFQVISVAVLGGLLWWHTPTSHIEDRVALLFFFSVFWGFYPLYNAVFTFPQ  448

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KERSSGMY+LSS+FLART GDLP+EL LPT FV I YWM GLK     F  +L 
Sbjct  449   ERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADPVTFILSLL  508

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
             A+L  VLV QGLGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S 
Sbjct  509   AVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYLSY  568

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               Y YK+LL  QY   + Y C+ G  +C V D+PA++ +GL  ++   V  + LML+GYR
Sbjct  569   SYYCYKMLLGIQYDDDDYYECSKGE-LCRVADYPAVRSMGL-NNLWADVCIMALMLVGYR  626

Query  187   LLAYVALMRV  158
             L+AY+AL RV
Sbjct  627   LIAYMALRRV  636



>gb|AIU41651.1| ABC transporter family protein [Hevea brasiliensis]
Length=680

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/638 (56%), Positives = 456/638 (71%), Gaps = 28/638 (4%)
 Frame = -3

Query  2014  PTTQLQANPQLESDTSA-AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAE  1838
             P +Q +   Q E   S  +I + + RPVTL F +V Y +    K            S++ 
Sbjct  43    PCSQDRLPDQQEPTPSRFSILRASLRPVTLMFVDVAYSIDLSTKGSC----CSPNGSKST  98

Query  1837  KIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRN  1658
             +I+L GV+GIV PGE++AMLGPSGSGKTTLLTAL GRL G ++GTITYNG PFS+++KR 
Sbjct  99    RIVLNGVSGIVRPGELVAMLGPSGSGKTTLLTALAGRLPGKVSGTITYNGLPFSSSVKRK  158

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
             TGFV QDD+ YPHLTV ETL F ALLRLP+ LT++EKIEQA+ VI +LGLT+C+NS++GG
Sbjct  159   TGFVAQDDVFYPHLTVIETLTFAALLRLPKMLTREEKIEQAEMVIVELGLTRCRNSVVGG  218

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
               LRGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI++TL  L++GGRT++ 
Sbjct  219   PLLRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIMATLKGLARGGRTLIT  278

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLAN  1121
             TIHQPSSRL+ +F KV++L +G P+Y G    VM  F ++G+ P    MNP+DFLLDLA+
Sbjct  279   TIHQPSSRLYMMFDKVVVLSDGCPIYSGPAGRVMECFDSIGYVPGFNFMNPADFLLDLAS  338

Query  1120  GITGDDSQ-------------ADQATVKETLVSAFKTNLLENLKMELHE-LNDEDVSSAG  983
             GI  D  Q              DQ + K++L+S++K NL   LK E+H+ L D  +S++ 
Sbjct  339   GIVPDTKQDDKMGVYGRVDHLDDQNSTKQSLISSYKKNLYPALKAEIHQNLQDPALSASS  398

Query  982   DQKQFK----RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--  821
                  +    +W   WW+QF VLL+RGL++RK+ES+SGL++ QV+ V+ L+G LW  S  
Sbjct  399   GTSSLRNSEDQWTTTWWQQFKVLLRRGLQERKHESYSGLRIFQVMSVSILSGLLWLHSDT  458

Query  820   TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLP  641
             + +QDQVGLLFF+S FWGFFP+F AIFTFP+++ ML KERSSGMY+LSS++ AR  GDLP
Sbjct  459   SHIQDQVGLLFFLSIFWGFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAGDLP  518

Query  640   MELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTL  461
             MELVLPT+FVI +YWM GLK +   F   L  IL  VLV QGLGLA+GA +M+ K ATTL
Sbjct  519   MELVLPTIFVIFTYWMGGLKSSVITFVLTLLIILFNVLVSQGLGLALGAILMEAKQATTL  578

Query  460   GSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCL  281
              SV ML FLLAGG+Y++H+P FI+W+KYIS   + YKLL+  QY   E Y C  G   C 
Sbjct  579   ASVTMLVFLLAGGYYIQHIPPFIAWLKYISFSHFCYKLLVGVQYSANEVYECELGMD-CR  637

Query  280   VEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             V D PAIK +G      + V AL +ML+GYRLLAYVAL
Sbjct  638   VMDFPAIKCLGTDNKG-WDVAALSIMLVGYRLLAYVAL  674



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/604 (58%), Positives = 441/604 (73%), Gaps = 18/604 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQ-KQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs  1763
             P+TLKFE VVYKVK +Q  Q L   K+K      EK IL G+TG+V PGE+LAMLGPSGS
Sbjct  50    PITLKFEEVVYKVKIEQTSQCLGSWKSK------EKTILNGITGMVCPGEILAMLGPSGS  103

Query  1762  gkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             GKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHLTV ETL FTAL
Sbjct  104   GKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTAL  163

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KRVSIGQEMLINPS
Sbjct  164   LRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPS  223

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDSTTA RI++T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+P+
Sbjct  224   LLLLDEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPI  283

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD----DSQADQATVKETLVSAF  1055
             Y+G  S  M YF+++GFS S+ +NP+D LLDLANGI  D     ++ +Q TVKETLVSA+
Sbjct  284   YYGPASSAMEYFTSLGFSTSMIVNPADLLLDLANGIPPDCQKETTEQEQKTVKETLVSAY  343

Query  1054  KTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
             + N+   LK EL        E   +A    + ++W   WW QF+VLL+RG+++R++ESF+
Sbjct  344   EKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  403

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A+FTFP++K ML 
Sbjct  404   KLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLI  463

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  464   KERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSV  523

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK
Sbjct  524   LVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYK  583

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +ML+GYRL+AY+A
Sbjct  584   LLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-NNLWIDVFVMGVMLVGYRLIAYMA  641

Query  169   LMRV  158
             L RV
Sbjct  642   LHRV  645



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/667 (53%), Positives = 462/667 (69%), Gaps = 46/667 (7%)
 Frame = -3

Query  2074  SDQQEATLMETATEM----GDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVY  1907
             SD   AT +E + EM     +  AP TQ+          S A  +    P+TLKFE V Y
Sbjct  103   SDSTCATTVEGSPEMPAGNQNKAAPATQVN---------SQAFLQLTLYPITLKFEEVFY  153

Query  1906  KVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta----  1739
             KVK DQK       ++      EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTA    
Sbjct  154   KVKVDQK------GSRDSSRSREKSILSGITGMVXPGEILAMLGPSGSGKTTLLTALGGR  207

Query  1738  -lggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTL  1562
                      ++G I+YNG+ F  A+KR TGFV QDD+LYPHLTVTETLVFTA+LRLP +L
Sbjct  208   LNHQNNSKFMSGKISYNGQSFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTAMLRLPNSL  267

Query  1561  TKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEP  1382
              + EK++  + VI++LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEP
Sbjct  268   GRDEKVQHVEHVISELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  327

Query  1381  TSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSD  1202
             TSGLDSTTAQRI++TL  L+ GGRT+V TIHQPSSR++++F K++LL EG+P+Y+G  S 
Sbjct  328   TSGLDSTTAQRILTTLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPIYYGPASA  387

Query  1201  VMSYFSTVGFSPSV-AMNPSDFLLDLANGITGDDSQA-----------DQATVKETLVSA  1058
              + YFS++GFS S+ ++NP+D LLDLANGI  D   A           +Q  V++ L+SA
Sbjct  388   ALDYFSSIGFSTSLPSVNPADLLLDLANGIAPDSKHACEQRENTNTEQEQKMVRKALISA  447

Query  1057  FKTNLLENLKMELH---ELNDED--VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYE  893
             +  N+   LK EL    E+N+ +  +  A   KQ+  W   WW QF VLL+RGL++R+YE
Sbjct  448   YDKNIYAKLKDELCAGLEVNNYNNYMKEAASAKQY--WCTSWWHQFKVLLQRGLRERRYE  505

Query  892   SFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKM  719
             +F+ L++ QV+ VA L G LWW+  ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ 
Sbjct  506   AFNRLRIFQVISVATLGGLLWWRTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERR  565

Query  718   MLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIl  539
             ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FV+I YWM GLKP    F  +L  +L
Sbjct  566   MLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMGGLKPDPFTFILSLLVVL  625

Query  538   lcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQY  359
               VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y
Sbjct  626   YNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYY  685

Query  358   TYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLA  179
              YKLLL  QY   + Y C+ G  +C V D PA+K +G  +H+   V  L LML+GYRLLA
Sbjct  686   CYKLLLGVQYDEDDFYECSKGV-LCRVGDLPAVKSMGGLEHLWLDVSILALMLLGYRLLA  744

Query  178   YVALMRV  158
             Y+AL RV
Sbjct  745   YLALHRV  751



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/615 (57%), Positives = 444/615 (72%), Gaps = 18/615 (3%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQ-KQGLSFLKTKKQKSEAEKIILKGVTGIVFPG  1796
             TS    + +  P+TLKFE VVYKVK +Q  Q +   K+K      EK IL G+TG+V PG
Sbjct  39    TSQPGLQMSMYPITLKFEEVVYKVKIEQTSQCMGSWKSK------EKTILNGITGMVCPG  92

Query  1795  EVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHL  1616
             E LAMLGPSGSGKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHL
Sbjct  93    EFLAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHL  152

Query  1615  TVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRV  1436
             TV ETL FTALLRLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KRV
Sbjct  153   TVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRV  212

Query  1435  SIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFH  1256
             SIGQEMLINPSLL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F 
Sbjct  213   SIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFD  272

Query  1255  KVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD----DSQADQ  1088
             KV+LL EG+P+Y+G  S  + YFS++GFS S+ +NP+D LLDLANGI  D     S+ +Q
Sbjct  273   KVVLLSEGSPIYYGAASSAVEYFSSLGFSTSLTVNPADLLLDLANGIPPDTQKETSEQEQ  332

Query  1087  ATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKR  917
              TVKETLVSA++ N+   LK EL        E   +A    + ++W   WW QF+VLL+R
Sbjct  333   KTVKETLVSAYEKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQR  392

Query  916   GLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAI  743
             G+++R++ESF+ L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A+
Sbjct  393   GVRERRFESFNKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNAV  452

Query  742   FTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNF  563
             FTFP++K ML KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F
Sbjct  453   FTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTF  512

Query  562   FSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
               +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+
Sbjct  513   ILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWL  572

Query  382   KYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLM  203
             KY+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +M
Sbjct  573   KYLSYSYYCYKLLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-NNLWIDVFVMGVM  630

Query  202   LIGYRLLAYVALMRV  158
             L+GYRL+AY+AL RV
Sbjct  631   LVGYRLMAYMALHRV  645



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/638 (56%), Positives = 457/638 (72%), Gaps = 28/638 (4%)
 Frame = -3

Query  2008  TQLQANP----QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             T+L A P    + E + S +  ++A  P+TLKFE VVYK+K + K     +      S  
Sbjct  15    TELMAAPPNSSKPEMNNSESFIQRALFPITLKFEEVVYKIKQETKG----MCCGGPSSTK  70

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             EK IL GVTGIV PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYN +PFS A+KR
Sbjct  71    EKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGAIKR  130

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFV QDD+LYPHLTVTETL+FTALLRLP++L+++EK    + VI +LGL KC+NS+IG
Sbjct  131   RTGFVAQDDVLYPHLTVTETLLFTALLRLPQSLSREEKERHVEHVIVELGLNKCRNSMIG  190

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++
Sbjct  191   GPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTTVKRLADGGRTVI  250

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLAN  1121
              TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLAN
Sbjct  251   TTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSITINPADLLLDLAN  310

Query  1120  GI---------TGDDSQADQATVKETLVSAFKTNLLENLKMEL--HELND----EDVSSA  986
             GI          GD+S+ ++ +V+E L+SA+  N+   LK EL   + N+    +DVS+ 
Sbjct  311   GIGPDSKHATEQGDNSEQEKKSVREALISAYDKNIYTRLKTELCSSDTNNYSYTKDVSTR  370

Query  985   GDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDL  812
                K  + W   W  QF VLL RGLK+R+YE+F+ L++ QV+ VAFL G LWW   ++ +
Sbjct  371   NGAKS-EHWCTSWGYQFKVLLLRGLKERRYETFNKLRIFQVVSVAFLAGLLWWHTPTSHI  429

Query  811   QDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMEL  632
             +D++ ++FF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+EL
Sbjct  430   EDRIAMVFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLEL  489

Query  631   VLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSV  452
              LPT F  I YWM GLK     F  +L  +L  VLV Q LGLA GA +MD K ATTL SV
Sbjct  490   ALPTAFTFILYWMGGLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASV  549

Query  451   IMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVED  272
               L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G   C V +
Sbjct  550   TTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGV-YCQVAE  608

Query  271   HPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              PAIK IGL  ++   V  + LML+GYRL+AY+AL RV
Sbjct  609   FPAIKSIGL-NNMWMDVFIMALMLVGYRLIAYLALNRV  645



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/657 (56%), Positives = 466/657 (71%), Gaps = 28/657 (4%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD  1892
             +QQ++     ++ M D +           +  +   ++ + A  P+TLKFE VVYKVK +
Sbjct  4     NQQQSA----SSNMSDQQQTNNTTVVAYPVHPNNPRSVLRLALFPITLKFEEVVYKVKLE  59

Query  1891  QKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
             QK+   +     + S  EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L
Sbjct  60    QKESCCW---GGKWSSREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLNGKL  116

Query  1711  agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQAD  1532
             +G ITYNG+PFS  +KR TGFV QDD+LYPHLTVTETLVFTALLRLP TLT+ EK + A+
Sbjct  117   SGKITYNGQPFSGVIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNTLTRDEKAQHAE  176

Query  1531  AVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ  1352
              VI +LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQ
Sbjct  177   HVIVELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQ  236

Query  1351  RIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF  1172
             RI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG P+Y G  S  + YFS++GF
Sbjct  237   RILTTVKRLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYHGPASAALDYFSSIGF  296

Query  1171  SPSVAMNPSDFLLDLANGITGD--------DSQAD----QATVKETLVSAFKTNLLENLK  1028
             S SV +NP+D LLDLANGI  D        D QA+    Q +V+E L+SA+  N+   LK
Sbjct  297   STSVTVNPADVLLDLANGIAPDSKHVTEQGDLQANMEQEQKSVREALISAYDKNIATRLK  356

Query  1027  MELHELNDEDV-----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQV  863
              EL  L+  +      +SA +  + ++W   W +QF VLL+RGLK+R+YESF+ L++ QV
Sbjct  357   AELCSLDVNNYGYARDASARNAAKLEQWGTSWCQQFKVLLRRGLKERRYESFNRLRIFQV  416

Query  862   LVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGM  689
             + VA L G LWW +  + LQD++ L+FF S FWGFFPL+ A+FTFP++++ML KERSSGM
Sbjct  417   ISVATLGGLLWWHTPASHLQDRIALIFFFSVFWGFFPLYNAVFTFPQERLMLIKERSSGM  476

Query  688   YKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglg  509
             Y+LSS+FLARTVGDLPMEL LPT F II YWM GLKP    F  +   +L  VLV Q LG
Sbjct  477   YRLSSYFLARTVGDLPMELALPTAFTIIIYWMGGLKPDFTTFILSWLIVLYNVLVSQSLG  536

Query  508   LAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQY  329
             LA GA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK+LL  QY
Sbjct  537   LAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKMLLGVQY  596

Query  328   KPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
                + Y C+ G   C V + PA+K +GL  H+   V  + +ML+GYRL+AY+AL RV
Sbjct  597   SENDYYECSEGV-FCRVAEFPAVKAVGL-NHLWVDVSIMAMMLVGYRLIAYMALHRV  651



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/637 (55%), Positives = 452/637 (71%), Gaps = 26/637 (4%)
 Frame = -3

Query  2008  TQLQANP----QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             T+L A P    + E   S +  ++A  P+TLKFE VVYK+K + K     +      S  
Sbjct  15    TELMAPPPNSSKPEMKNSESFIQRALFPITLKFEEVVYKIKQETKG----MCCGGPSSTK  70

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             EK IL GVTGIV PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYN +PFS A+KR
Sbjct  71    EKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGAIKR  130

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFV QDD+LYPHLTVTETL+FTALLRLP++L+++EK    + VI +LGL KC+NS+IG
Sbjct  131   RTGFVAQDDVLYPHLTVTETLLFTALLRLPQSLSREEKERHVEHVIAELGLNKCRNSMIG  190

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++
Sbjct  191   GPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTTIKRLADGGRTVI  250

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLAN  1121
              TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLAN
Sbjct  251   TTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSITINPADLLLDLAN  310

Query  1120  GI---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQK--  974
             GI          GD S+ ++ +V+E L+SA+  N+   LK EL   +  + S A D    
Sbjct  311   GIGPDSKHAIEQGDSSEQEKKSVREALISAYDKNISTRLKTELCSSDTNNYSYAKDVSTR  370

Query  973   ---QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQ  809
                + + W   W  QF VLL RGLK+R+YE+F+ L++ QV+ VAFL G LWW   ++ ++
Sbjct  371   NGVKSEHWCTSWGYQFKVLLLRGLKERRYETFNKLRIFQVVSVAFLAGLLWWHTPTSHIE  430

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             D++ ++FF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+EL 
Sbjct  431   DRIAMVFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELA  490

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPT F  I YWM GLK     F  +L  +L  VLV Q LGLA GA +MD K ATTL SV 
Sbjct  491   LPTAFTFILYWMGGLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVT  550

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDH  269
              L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G   C V + 
Sbjct  551   TLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGV-YCQVAEF  609

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             PAIK IGL  ++   V  + LML+GYRL+AY+AL RV
Sbjct  610   PAIKSIGL-NNMWMDVFIMALMLVGYRLIAYLALNRV  645



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/614 (57%), Positives = 446/614 (73%), Gaps = 23/614 (4%)
 Frame = -3

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA----EKIILKGVTGIVFPGEVLAMLGPS  1769
             VTLKFE +VYKVK + K G  +         A    EK IL G++G+VFPGE+LAMLGPS
Sbjct  41    VTLKFEEIVYKVKLEGKGGSCWGGGGGSSWGAAATREKTILNGLSGVVFPGEILAMLGPS  100

Query  1768  gsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFT  1589
             GSGKTTLLTALGGRL G L+G ITYNG+PF  A KR TGFV QDD+LYPHLTV ETL+FT
Sbjct  101   GSGKTTLLTALGGRLSGKLSGKITYNGQPFCGATKRRTGFVAQDDVLYPHLTVAETLLFT  160

Query  1588  ALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLIN  1409
             ALLRLP +LT +EK E  + VI++LGLT+C+NS+IGG   RGISGGE+KRVSIGQEMLIN
Sbjct  161   ALLRLPSSLTAEEKAEAVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLIN  220

Query  1408  PSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGN  1229
             PSLL LDEPTSGLDSTTA RI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG+
Sbjct  221   PSLLLLDEPTSGLDSTTAMRIITTVKRLAAGGRTVVTTIHQPSSRLYHMFDKVVLLSEGS  280

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT---------GDDSQADQATVK  1076
             P+Y+G  S+ M YFS++GFS S+ +NP+D LLDLANGI          G++ + +Q +VK
Sbjct  281   PIYYGSASNAMDYFSSIGFSTSITINPADLLLDLANGIAPDSKYANEGGENMEQEQKSVK  340

Query  1075  ETLVSAFKTNLLENLKMELHELNDEDV------SSAGDQKQFKRWAIPWWEQFSVLLKRG  914
             E L+SA+  N+   LK EL  L+  +       +S  +++  + W   WW QF VLL+RG
Sbjct  341   EALISAYDKNISSTLKAELCSLDANNFNNYAKDASKREKRSREEWCTSWWYQFRVLLQRG  400

Query  913   LKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIF  740
             LK+R+Y++F+ L++ QV+ VA L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+F
Sbjct  401   LKERRYDAFNRLRIFQVISVATLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVF  460

Query  739   TFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFF  560
             TFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FV I Y+M GL P    F 
Sbjct  461   TFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGLDPHPTTFL  520

Query  559   SALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIK  380
              +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+K
Sbjct  521   LSLLVVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLK  580

Query  379   YISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLML  200
             Y+S   Y YKLLL  QY  G+ Y C  G   C V D PA+K +GL + +   V  + +ML
Sbjct  581   YLSYSYYCYKLLLGVQYHKGDVYECGKGE-FCRVVDFPAVKSVGLDR-LWVDVCIMAIML  638

Query  199   IGYRLLAYVALMRV  158
             IGYRL+AY+AL RV
Sbjct  639   IGYRLIAYLALHRV  652



>ref|XP_006290691.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
 gb|EOA23589.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
Length=673

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/671 (54%), Positives = 486/671 (72%), Gaps = 40/671 (6%)
 Frame = -3

Query  2074  SDQQEATLMETATEMGDIEAPTTQLQ------ANPQLESD--------TSAAIFKKANRP  1937
             ++Q+E++  +T+       +P  + +        P L+ D          +++ +++ RP
Sbjct  5     NEQEESSFPKTSGANRHETSPVQETRFSSPSHVTPCLDDDHDGPSHQSRQSSVLRQSLRP  64

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             + LKFE + Y +K    +G ++  +  Q+ +  ++IL  V+GIV PGE+LAMLGPSGSGK
Sbjct  65    IILKFEELTYSIKSQTGKGRNWFGS--QEPKPNRLILNSVSGIVKPGELLAMLGPSGSGK  122

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTL+TAL GRL G L+GT++YNG PF++++KR TGFVTQDD+LYPHLTV ETL +TALLR
Sbjct  123   TTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTALLR  182

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLL  1397
             LP+ LT++EK+EQA+ V++ LGLT+C NS+IGG  +RGISGGERKRVSIGQEML+NPSLL
Sbjct  183   LPKELTRKEKLEQAETVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIGQEMLVNPSLL  242

Query  1396  FLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYF  1217
              LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL+L EG P+Y 
Sbjct  243   LLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVLVLSEGCPIYS  302

Query  1216  GKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQ--------------ADQAT  1082
             G    VM YF ++G+ P S  +NP+DF+LDLANGIT D  Q               +Q +
Sbjct  303   GDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGITSDTKQYCDQVEMNGRLDRLEEQNS  362

Query  1081  VKETLVSAFKTNLLENLKMELHEL---NDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGL  911
             VK++L+S++K NL   LK E+      +D+ ++ +G +    RW   WW QFSVLL+RGL
Sbjct  363   VKQSLISSYKKNLYPALKEEVSRTFPQDDQTITRSGTKSLTNRWPTSWWMQFSVLLRRGL  422

Query  910   KQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFT  737
             K+R +ESFSGL++  V+ V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF AIFT
Sbjct  423   KERSHESFSGLRIFMVMSVSLLSGLLWWHSRVSHIQDQVGLLFFFSIFWGFFPLFNAIFT  482

Query  736   FPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFS  557
             FP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GLKP+   F  
Sbjct  483   FPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFLM  542

Query  556   ALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKY  377
              L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+PSFISW+KY
Sbjct  543   TLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPSFISWLKY  602

Query  376   ISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLML  200
             +S   Y YKLL+  QY   E Y C  GSG+ C V ++  IK + +G ++++ V+AL +ML
Sbjct  603   VSFSHYCYKLLVGVQYTWDEVYEC--GSGLQCSVMNYEGIKNLKIG-NMMWDVLALAIML  659

Query  199   IGYRLLAYVAL  167
             + YR+LAY+AL
Sbjct  660   LLYRVLAYLAL  670



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/655 (55%), Positives = 457/655 (70%), Gaps = 29/655 (4%)
 Frame = -3

Query  2083  PSSSDQQEATLMETATEMGDIEAPTTQLQANPQLE--SDTSAAIFKKANRPVTLKFENVV  1910
             P   +  EAT+ +  T+M       ++ Q  P L     TS    + +  P+TLKFE V 
Sbjct  8     PRPEENGEATV-QGLTDM-------SETQGKPVLAFPVATSQPGLQLSMYPITLKFEEVE  59

Query  1909  YKVKPDQK-QGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalg  1733
             YKVK +   Q L     K      EK IL G+TG+V PGE+LAMLGPSGSGKTTLL+ALG
Sbjct  60    YKVKIEHTGQCLGSWSCK------EKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALG  113

Query  1732  grlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQ  1553
             GRL    +G + YNG+PFS  +KR TGFV QDD+LYPHLTV ETL FTALLRLP +LT+ 
Sbjct  114   GRLSKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPSSLTRD  173

Query  1552  EKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSG  1373
             EK E  D VI +LGL +C NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSG
Sbjct  174   EKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSG  233

Query  1372  LDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMS  1193
             LDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+PLY+G  S  + 
Sbjct  234   LDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPLYYGPASSALE  293

Query  1192  YFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSAFKTNLLENLKM  1025
             YFS+VGFS S+ +NP+D LLDLANGI  D     S+ +Q TVKE+L+SA++ N+   LK 
Sbjct  294   YFSSVGFSTSMTVNPADLLLDLANGIPPDSQKETSEQEQKTVKESLISAYEKNISTKLKA  353

Query  1024  ELHELNDEDV----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLV  857
             EL   +        S+A + K  ++W   WW QF+VLL+RG+++R++ESF+ L++ QV+ 
Sbjct  354   ELCNADSHSFEYTKSAAKNIKSSEQWCTSWWYQFTVLLQRGVRERRFESFNKLRIFQVIS  413

Query  856   VAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYK  683
             VAFL G LWW +  + LQD+  LLFF S FWGF+PL+ A+FTFP++K ML KERSSGMY+
Sbjct  414   VAFLGGLLWWHTPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYR  473

Query  682   LSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLA  503
             LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F  +L  +L  VLV QGLGLA
Sbjct  474   LSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSVLVAQGLGLA  533

Query  502   IGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP  323
              GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YKLLL  QY  
Sbjct  534   FGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYTD  593

Query  322   GETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              + Y C+ G   C V D P IK +GL  ++   V  + +ML+GYRL+AY+AL RV
Sbjct  594   DDYYECSEGVW-CRVGDFPGIKAMGL-NNLWIDVFVMGVMLVGYRLIAYMALHRV  646



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/604 (58%), Positives = 436/604 (72%), Gaps = 19/604 (3%)
 Frame = -3

Query  1936  VTLKFENVVYKVKPDQK-QGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             +TLKFE VVYKVK +Q  Q L     K      EK IL G+TG+V PGE+LAMLGPSGSG
Sbjct  51    ITLKFEEVVYKVKIEQTGQCLGSWSCK------EKTILNGITGMVCPGEILAMLGPSGSG  104

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHLTV ETL FTALL
Sbjct  105   KTTLLSALGGRLSKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALL  164

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KRVSIGQEMLINPSL
Sbjct  165   RLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSL  224

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+PLY
Sbjct  225   LLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPLY  284

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSAFK  1052
             +G  S  M YFS+VGF  S+ +NP+D LLDLANGI  D     S+ +Q TVKE L+SA++
Sbjct  285   YGPASSAMEYFSSVGFCTSMTVNPADLLLDLANGIPPDSQKETSEQEQKTVKEALISAYE  344

Query  1051  TNLLENLKMELHELNDEDV----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
              N+   LK EL   +        S+A + K  ++W   WW QF+VLL+RG+++R++ESF+
Sbjct  345   KNISTKLKAELCNADSHSFEYTKSAAKNIKSSEQWCTSWWYQFTVLLQRGVRERRFESFN  404

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              L++ QV+ VAFL G LWW +  + LQD+  LLFF S FWGF+PL+ A+FTFP++K ML 
Sbjct  405   KLRIFQVISVAFLGGLLWWHTPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLI  464

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F  +L  +L  V
Sbjct  465   KERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSV  524

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YK
Sbjct  525   LVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYK  584

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LLL  QY   + Y C+ G   C V D P IK +GL    I  V  + +ML+GYRL+AY+A
Sbjct  585   LLLGIQYTDDDYYECSEGVW-CRVGDFPGIKAMGLNSLWI-DVFVMGVMLVGYRLIAYMA  642

Query  169   LMRV  158
             L RV
Sbjct  643   LHRV  646



>ref|XP_003612480.1| ABC transporter-like protein [Medicago truncatula]
Length=652

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/653 (54%), Positives = 456/653 (70%), Gaps = 52/653 (8%)
 Frame = -3

Query  2011  TTQLQANPQL----ESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE  1844
             T  L+ +P +     S+   ++ K    P+TLKFE++VYKVK +QK              
Sbjct  16    TLSLEGSPHMTDPHSSNNEQSLPKLIMYPITLKFEDLVYKVKVNQK--------------  61

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMK  1664
              EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L G  TYN +PFS ++K
Sbjct  62    -EKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLNGKLTGKTTYNNQPFSGSIK  120

Query  1663  RNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSII  1484
             R TGFV QDD+LYPHLTVTETLVFTALLRLP+TLT+ EK+   + VI++LGL  C+NS+I
Sbjct  121   RRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTRDEKVVHVERVISELGLNNCRNSMI  180

Query  1483  GGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTI  1304
             GG  LRGISGGE++RVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+ +L+ GGRT+
Sbjct  181   GGPLLRGISGGEKRRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILNTIKKLASGGRTV  240

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLA  1124
             V TIHQPSSRL+Y+F KV+LL EG P+Y+G  S  + YFS+VGFS SV +NP+D LLDLA
Sbjct  241   VTTIHQPSSRLYYMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSVTVNPADLLLDLA  300

Query  1123  NGITGDDSQA---------DQATVKETLVSAFKTNLLENLK-----MELHELND-EDVSS  989
             NGI  D             ++ TV+E+L+SA+  N+   LK     ME++  N+    S 
Sbjct  301   NGIAPDSKHVTEQSEALEHERKTVRESLISAYDKNIAPRLKAEVSSMEVNNFNNITKDSC  360

Query  988   AGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TD  815
               +Q   ++W   WW QF+VLL+RG+++R++E+F+ L++ QV+ VAFL G LWW +  + 
Sbjct  361   TRNQINPEQWCTSWWYQFTVLLQRGVRERRHEAFNRLRIFQVISVAFLAGLLWWHTPASH  420

Query  814   LQDQV--------------GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLS  677
             L+D+V               LLFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LS
Sbjct  421   LEDRVRNNFFIFSVPITCTALLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLS  480

Query  676   SFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIG  497
             S+FLART+GDLP+EL LPT FVII YWM GLKP    F  +L  +L  V+V Q LGLA G
Sbjct  481   SYFLARTIGDLPLELALPTAFVIILYWMGGLKPDPVTFILSLLVVLYSVVVSQSLGLAFG  540

Query  496   AFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGE  317
             A +M+ K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   +
Sbjct  541   AILMEIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNEND  600

Query  316   TYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              Y C+ G  +C V D P IK +GL  H+   V  + LML GYRL+AY+AL RV
Sbjct  601   YYECSKGE-LCKVMDFPPIKSMGL-NHMWVDVFIMALMLFGYRLVAYLALRRV  651



>ref|XP_010425209.1| PREDICTED: ABC transporter G family member 21 isoform X1 [Camelina 
sativa]
Length=672

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/640 (55%), Positives = 473/640 (74%), Gaps = 34/640 (5%)
 Frame = -3

Query  2026  DIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKS  1847
             D + P+ Q            +++ +++ RP+TLKFE + Y +K   ++G  +  +  Q+ 
Sbjct  44    DYDGPSNQ---------SRQSSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGS--QEP  92

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
             +  ++IL GV+GIV PGE+LAMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++++
Sbjct  93    KPNRLILNGVSGIVKPGELLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSSV  152

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
             KR TGFVTQDD+LYPHLTV ETL +TALLRLP+ LT++EK+EQA+ V++ LGLT+C +S+
Sbjct  153   KRKTGFVTQDDVLYPHLTVMETLTYTALLRLPKELTRKEKLEQAETVVSDLGLTRCCHSV  212

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             +GG  +RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT
Sbjct  213   VGGGLIRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRT  272

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLD  1130
             ++ TIHQPSSRL+ +F KVL+L EG P+Y G    VM YF ++G+ P S  +NP+DF+LD
Sbjct  273   VITTIHQPSSRLYRMFDKVLVLSEGCPIYSGDSGRVMEYFGSIGYQPGSSFVNPADFVLD  332

Query  1129  LANGITGDDSQ--------------ADQATVKETLVSAFKTNLLENLKMELHEL--NDED  998
             LANGIT D  Q               +Q +VK++L+S++K NL  +LK E+      D+ 
Sbjct  333   LANGITSDTKQYCDQVDINGRLDRLEEQNSVKQSLISSYKKNLYPSLKEEVSRTFPQDQT  392

Query  997   VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST  818
             ++ +G +    RW   WW QFSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S 
Sbjct  393   ITRSGTKSLTNRWPTSWWMQFSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSR  452

Query  817   --DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDL  644
                +QDQVGLLFF S FWGFFPLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDL
Sbjct  453   VFHIQDQVGLLFFFSIFWGFFPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDL  512

Query  643   PMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATT  464
             PMEL+LPT+FV I+YWM GLKP+   F   L  +L  VLV QG+GLA+GA +MD K A T
Sbjct  513   PMELILPTIFVTITYWMGGLKPSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAAT  572

Query  463   LGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-  287
             L SV+ML FLLAGG+Y++H+P FI+W+KY+S   Y YKLL+  QY   E Y C  GSG+ 
Sbjct  573   LSSVLMLVFLLAGGYYIQHIPGFIAWLKYVSFSHYCYKLLVGVQYSWDEVYEC--GSGLH  630

Query  286   CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             C V ++  IK + +G ++++ V+AL +ML+ YR+LAY+AL
Sbjct  631   CSVMNYEGIKNLRIG-NMMWDVLALAIMLLLYRVLAYLAL  669



>ref|XP_006395639.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
 gb|ESQ32925.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
Length=670

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/619 (57%), Positives = 464/619 (75%), Gaps = 24/619 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+ LKFE + Y +K    +G  +  +  Q+ +  +++L GV+GIV PGE+L
Sbjct  54    SSVLRQSLRPIILKFEELTYSIKSQTGKGSYWFGS--QEPKPNRLVLNGVSGIVKPGELL  111

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L GT++YNG+PF++++KR TGFVTQDD+LYPHLTVT
Sbjct  112   AMLGPSGSGKTTLVTALAGRLQGKLTGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVT  171

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EKIEQA+ V++ LGLT+C NS+IGG  +RGISGGERKRVSIG
Sbjct  172   ETLTYTALLRLPKELTRKEKIEQAETVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIG  231

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
              EML+NPSLL LDEPTSGLDSTTA RIVSTL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  232   LEMLVNPSLLLLDEPTSGLDSTTAARIVSTLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  291

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-----  1085
             +L EGNP+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT D  Q DQ      
Sbjct  292   VLSEGNPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANGITSDTKQYDQVEVNGK  351

Query  1084  --------TVKETLVSAFKTNLLENLKMELHEL--NDEDVSSAGDQKQFKRWAIPWWEQF  935
                     +VK++L+S++K NL  +LK E+      ++ ++ +  +    RW   WW QF
Sbjct  352   LDRLEEQNSVKQSLISSYKKNLYPHLKEEVSRTFPQEQKINGSRAKSLTNRWPTSWWMQF  411

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFF  761
             SVLLKR LK+R +ESFSGL++  V+ V+ L+G LWW S  + LQDQVGLLFF S FWGFF
Sbjct  412   SVLLKRSLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVSHLQDQVGLLFFFSIFWGFF  471

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GLK
Sbjct  472   PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  531

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P+   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+P
Sbjct  532   PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  591

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFS  224
              FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C V D+  IK + +G ++++ 
Sbjct  592   GFIAWLKYISFSHYCYKLLVGVQYTWDEVYEC--GLGLHCRVMDYEGIKNLRIG-NMMWD  648

Query  223   VVALLLMLIGYRLLAYVAL  167
             V+AL +ML+ YR+ AY+AL
Sbjct  649   VLALAIMLLLYRVFAYLAL  667



>ref|XP_003541547.2| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Glycine max]
Length=629

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/617 (54%), Positives = 462/617 (75%), Gaps = 13/617 (2%)
 Frame = -3

Query  1987  QLESDTSAA-IFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTG  1811
             +L+SD +   I+ K N+P+TL+FE+VV+K+K  + +GL  L   K+ S  E ++LKG++G
Sbjct  16    RLQSDEAKQDIYLKVNKPLTLRFEDVVHKIKISKGKGL--LCYNKEVSSEETLVLKGISG  73

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDD  1634
             ++FPGE+L +LGPSG GKTTLL ALGGRL   +   +ITYNGKP S ++K+N GFV+Q D
Sbjct  74    VIFPGELLVILGPSGCGKTTLLAALGGRLNHSITRGSITYNGKPLSKSVKQNLGFVSQQD  133

Query  1633  ILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISG  1454
             + YPHL+V+ETL+F+ALLRLP +++K+EKI +A A++ +L LT CK++I+GG  LRG+SG
Sbjct  134   VFYPHLSVSETLIFSALLRLPNSVSKEEKILKAQAIMNELDLTHCKDTIMGGPLLRGVSG  193

Query  1453  GERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSR  1274
             GE KRVSIGQ++L NPSLL +DEPTSGLDSTTA+RIV TL EL+K GRT++MTIHQPSS+
Sbjct  194   GEWKRVSIGQQLLTNPSLLLVDEPTSGLDSTTARRIVLTLCELAKDGRTVIMTIHQPSSK  253

Query  1273  LFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA  1094
             LFY+F K+LLL +G  LYFGKG +VM+YFS++G++PSVAMNP+DFLLDLANGI  ++ + 
Sbjct  254   LFYMFQKILLLSDGRSLYFGKGENVMNYFSSIGYTPSVAMNPTDFLLDLANGIYSENLEE  313

Query  1093  DQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRG  914
             D    K+ L+SAF++NL   +KMEL +++ + +    + + F +    WW+QF++LL+RG
Sbjct  314   DTNATKQVLLSAFESNLASQVKMEL-QISRDSIHHNSEDEIFGQHCTTWWQQFTILLRRG  372

Query  913   LKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIF  740
              K+RKYE FS  K+  V V++F  G+LWW+S    + DQV LLF+ + F GFFP+ Q+IF
Sbjct  373   FKERKYEQFSPHKICHVFVLSFFAGSLWWQSGADQMHDQVALLFYYTQFCGFFPMVQSIF  432

Query  739   TFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFF  560
             TFP D+ M+ KERS  MY+LSS+ +A  + DLP++L LPT+ V ++YWM GLK  A  FF
Sbjct  433   TFPRDREMIIKERSFYMYRLSSYIIASNLDDLPLQLALPTLLVTVTYWMGGLKAKASIFF  492

Query  559   SALSAIllcvlvcqglgLAIGAFIM-DQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
               L+  LL  LV QG GLAIGA ++ +QK A T+G+V+M  FLL  GF+VR+ P+F+SWI
Sbjct  493   RTLAVALLYSLVSQGFGLAIGALLINNQKVAITVGTVVMTLFLLVNGFFVRNTPAFVSWI  552

Query  382   KYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLL  206
             KY+S G Y+YKLLL SQ+   +TY C  G  V C   ++P IK +G+ +  + SV AL+ 
Sbjct  553   KYLSHGYYSYKLLLGSQFNGYDTYHC--GQNVTCSAVNYPTIKHVGIDKQGL-SVAALVA  609

Query  205   MLIGYRLLAYVALMRVG  155
             ML+GYRL+AY AL R+G
Sbjct  610   MLVGYRLIAYFAL-RIG  625



>emb|CDX99764.1| BnaC02g35560D [Brassica napus]
Length=685

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/639 (56%), Positives = 460/639 (72%), Gaps = 46/639 (7%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+ LKFE + Y +K    +G  +  +  Q+ +  ++IL GV+GIV PG++L
Sbjct  51    SSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGS--QEPKQNRLILNGVSGIVKPGDLL  108

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF+++MKR TGFVTQ+D+LYPHLTV 
Sbjct  109   AMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSMKRRTGFVTQEDVLYPHLTVM  168

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EKI+QA++VI+ LGLT+C NS+IGG  +RGISGGERKRVSIG
Sbjct  169   ETLTYTALLRLPKELTRKEKIQQAESVISDLGLTRCCNSVIGGGLIRGISGGERKRVSIG  228

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  229   QEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  288

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-----  1085
             +L +G+P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT D +Q +Q      
Sbjct  289   VLSDGSPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANGITSDTNQYEQGEINGK  348

Query  1084  --------TVKETLVSAFKTNLLENLKMELHEL----------------------NDEDV  995
                     +VKE+L+SA+K NL   LK E                             DV
Sbjct  349   LDRLEEQNSVKESLISAYKKNLYPPLKEEFSRTFPQDQTVNWSRSKTRLTSKTYSCSNDV  408

Query  994   SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--  821
             S+ G      RW   WW QFSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S  
Sbjct  409   STLGS--HIDRWPTSWWMQFSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRV  466

Query  820   TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLP  641
               +QDQVGLLFF S FWGF PLF AIFTFP+++ ML KERSSG+Y+LSS++ ARTVGDLP
Sbjct  467   AHIQDQVGLLFFFSIFWGFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYTARTVGDLP  526

Query  640   MELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTL  461
             MEL+LPT+FV I+YWM GLK +   F   L  +L  VLV QG+GLA+GA +MD K A TL
Sbjct  527   MELILPTIFVTITYWMGGLKSSLTTFIMTLMIVLYNVLVSQGVGLALGAILMDAKKAATL  586

Query  460   GSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-C  284
              SV+ML FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C
Sbjct  587   SSVLMLVFLLAGGYYIQHIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYEC--GPGLHC  644

Query  283   LVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
              V D+  IK + LG ++++ V+AL LML+ YR LAYVAL
Sbjct  645   GVMDYEGIKNLSLG-NMMWDVLALTLMLLLYRFLAYVAL  682



>ref|XP_010514180.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=673

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/620 (56%), Positives = 466/620 (75%), Gaps = 25/620 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+TLKFE + Y +K   ++G  +  +  Q+ +  ++IL GV+GIV PGE+L
Sbjct  56    SSVLRQSLRPITLKFEELAYSIKSQTEKGSYWFGS--QEPKLNRLILNGVSGIVKPGELL  113

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++++KR TGFVTQDD+LYPHLTV 
Sbjct  114   AMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSSVKRKTGFVTQDDVLYPHLTVM  173

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EK+EQA+ V++ LGLT+C +S++GG  +RGISGGERKRVSIG
Sbjct  174   ETLTYTALLRLPKELTRKEKLEQAETVVSDLGLTRCCHSVVGGGLIRGISGGERKRVSIG  233

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  234   QEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  293

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQ---------  1097
             +L EG P+Y G    VM YF ++G+ P S  +NP+DF+LDLANGI  D  Q         
Sbjct  294   VLSEGCPIYSGDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGIISDTKQYCDQVEING  353

Query  1096  -----ADQATVKETLVSAFKTNLLENLKMELHEL--NDEDVSSAGDQKQFKRWAIPWWEQ  938
                   +Q +VK++L+S++K NL   LK E+      D+ ++ +G +    RW   WW Q
Sbjct  354   RLDRLEEQNSVKQSLISSYKKNLYPPLKEEVSRTFPQDQTITRSGTKSLTNRWPTSWWMQ  413

Query  937   FSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGF  764
             FSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGF
Sbjct  414   FSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVFHIQDQVGLLFFFSIFWGF  473

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GL
Sbjct  474   FPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGL  533

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+
Sbjct  534   KPSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHI  593

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIF  227
             P FI+W+KY+S   Y YKLL+  QY   E Y C  GSG+ C V ++  IK + +G ++++
Sbjct  594   PGFIAWLKYVSFSHYCYKLLVGVQYTWDEVYEC--GSGLHCSVMNYEGIKNLRIG-NMMW  650

Query  226   SVVALLLMLIGYRLLAYVAL  167
              V+AL +ML+ YR+LAY+AL
Sbjct  651   DVLALAIMLLSYRVLAYLAL  670



>ref|XP_002876921.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53180.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/620 (57%), Positives = 464/620 (75%), Gaps = 25/620 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+ LKFE + Y +K    +G  +  +  Q+ +  ++IL GV+GIV PGE+L
Sbjct  54    SSVLRQSLRPIILKFEELSYSIKSQTGKGSYWFGS--QEPKPNRLILNGVSGIVKPGELL  111

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG+PF++++KR TGFVTQDD+LYPHLTV 
Sbjct  112   AMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVM  171

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EKIEQA+ V++ LGLT+C NS+IGG  +RGISGGERKRVSIG
Sbjct  172   ETLTYTALLRLPKELTRKEKIEQAETVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIG  231

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  232   QEMLVNPSLLLLDEPTSGLDSTTAVRIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  291

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-----  1085
             +L EG P+Y G    VM Y  ++G+ P S  +NP+DF+LDLANGIT D  Q DQ      
Sbjct  292   VLSEGCPIYSGNSGRVMEYLGSIGYQPGSSFVNPADFVLDLANGITSDTKQYDQVEINGR  351

Query  1084  --------TVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQ---FKRWAIPWWEQ  938
                     +VK++L+S++K NL   LK E+     +D +    + +     RW   WW Q
Sbjct  352   LDRLEEQNSVKQSLISSYKKNLYPPLKEEVSRTFPQDQTITRSRTKSLLTNRWPTSWWMQ  411

Query  937   FSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGF  764
             FSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    LQDQVGLLFF S FWGF
Sbjct  412   FSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHLQDQVGLLFFFSIFWGF  471

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GL
Sbjct  472   FPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGL  531

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+
Sbjct  532   KPSLTTFIMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHI  591

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIF  227
             P FI+W+KY+S   Y YKLL+  QY  GE Y C  GSG+ C V D+  I+ + +G ++++
Sbjct  592   PGFIAWLKYVSFSHYCYKLLVGVQYTWGEVYEC--GSGLHCSVMDYEGIRNLRIG-NMMW  648

Query  226   SVVALLLMLIGYRLLAYVAL  167
              V+AL +ML+ YR+LAY+AL
Sbjct  649   DVLALAIMLLLYRVLAYLAL  668



>ref|XP_010502439.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Camelina sativa]
Length=672

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/620 (57%), Positives = 466/620 (75%), Gaps = 25/620 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+TLKFE + Y +K   ++G  +  +  Q+ +  ++IL GV+GIV PGE+L
Sbjct  55    SSVLRQSLRPITLKFEELTYSIKSQTEKGSYWFGS--QEPKPNRLILNGVSGIVKPGELL  112

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++ +KR TGFVTQDD+LYPHLTV 
Sbjct  113   AMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGTPFTSYVKRKTGFVTQDDVLYPHLTVM  172

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EK+EQA+ V++ LGLT+C +S++GG  +RGISGGERKRVSIG
Sbjct  173   ETLTYTALLRLPKELTRKEKLEQAEKVVSDLGLTRCCHSVVGGGLIRGISGGERKRVSIG  232

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  233   QEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  292

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQ---------  1097
             +L EG P+Y G    VM YF ++G+ P S  +NP+DF+LDLANGIT D  Q         
Sbjct  293   VLSEGCPIYSGDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGITSDTRQYCDQVEING  352

Query  1096  -----ADQATVKETLVSAFKTNLLENLKMELHEL--NDEDVSSAGDQKQFKRWAIPWWEQ  938
                   +Q +VK++L+S++K NL   LK E+      D+ ++ +G +    RW   WW Q
Sbjct  353   RLDRLEEQNSVKQSLISSYKKNLYPPLKEEVSRTFPQDQTITRSGTKSLTNRWPTSWWMQ  412

Query  937   FSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGF  764
             FSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGF
Sbjct  413   FSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVFHIQDQVGLLFFFSIFWGF  472

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GL
Sbjct  473   FPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGL  532

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+
Sbjct  533   KPSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHI  592

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIF  227
             P FI+W+KY+S   Y YKLL+  QY   E Y C  GSG+ C V ++  IK + +G ++++
Sbjct  593   PGFIAWLKYVSFSHYCYKLLVGVQYTWDEVYEC--GSGLHCSVMNYEGIKNLMIG-NMMW  649

Query  226   SVVALLLMLIGYRLLAYVAL  167
              V+AL +ML+ YR+LAY+AL
Sbjct  650   DVLALAIMLLLYRVLAYLAL  669



>gb|KFK39853.1| hypothetical protein AALP_AA3G297000 [Arabis alpina]
Length=672

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/619 (58%), Positives = 461/619 (74%), Gaps = 24/619 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+ LKFE + Y +K    +   +  +K+ K    ++IL GV+GIV PGE+L
Sbjct  56    SSVLRQSLRPIILKFEELTYSIKSQTGKKNYWFGSKEPK--PNRLILNGVSGIVKPGELL  113

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++ +KR TGFVTQDD+LYPHLTV 
Sbjct  114   AMLGPSGSGKTTLVTALAGRLNGKLSGTVSYNGDPFTSYIKRKTGFVTQDDVLYPHLTVM  173

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EK+EQA+ V++ LGLT+C NS+IGG  +RGISGGERKRVSIG
Sbjct  174   ETLTYTALLRLPKELTRKEKMEQAETVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIG  233

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  234   QEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVL  293

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-----  1085
             +L EG P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT D  Q DQ      
Sbjct  294   VLSEGCPIYSGDSGRVMEYFGSIGFQPGSNFVNPADFVLDLANGITSDTKQYDQVELNGK  353

Query  1084  --------TVKETLVSAFKTNLLENLKMELHELNDED--VSSAGDQKQFKRWAIPWWEQF  935
                     +VK++L+S++K NL  +LK E+     ED  VS +  +    RW   WW QF
Sbjct  354   LERLEEQNSVKQSLISSYKKNLYPHLKEEVSRTFPEDQMVSRSRAKSLTNRWPTSWWMQF  413

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFF  761
             SVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGFF
Sbjct  414   SVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRAYHIQDQVGLLFFFSIFWGFF  473

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GLK
Sbjct  474   PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P+   F   L  +L  VLV QG+GLAIGA +M+ K A TL SV+ML FLLAGG+Y++H+P
Sbjct  534   PSLATFLMTLMIVLYNVLVAQGVGLAIGAILMEAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFS  224
              FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C V D+  IK + +G ++++ 
Sbjct  594   GFIAWLKYISFSHYCYKLLVGVQYSWDEVYDC--GLGLHCSVMDYEGIKNLKIG-NMMWD  650

Query  223   VVALLLMLIGYRLLAYVAL  167
             V+AL  MLI YR+L+Y+AL
Sbjct  651   VLALAFMLIFYRVLSYLAL  669



>ref|XP_006878615.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/611 (59%), Positives = 445/611 (73%), Gaps = 25/611 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PVTLKFE+V YKVK  Q + L       +K   EK IL G+TGIV PGE+LAMLGPSGSG
Sbjct  43    PVTLKFEDVGYKVKLAQGECL-----PTRKLIVEKTILTGLTGIVSPGEILAMLGPSGSG  97

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRL G  +G +TYN  PFS++MKR  GFVTQDD+LY HLTV+ETL F ALL
Sbjct  98    KTTLLTALGGRLPGKHSGFVTYNNHPFSSSMKRRIGFVTQDDVLYAHLTVSETLTFAALL  157

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP ++T+ +K+EQA+ V+ QLGL+KCKN+IIGG  LRG+SGGERKRVSIGQEML+NPSL
Sbjct  158   RLPDSITRAKKLEQAEHVLNQLGLSKCKNTIIGGPLLRGVSGGERKRVSIGQEMLVNPSL  217

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTA +I++ +  L+KGGRT+V TIHQPSSRL+++F KV++L EG P+Y
Sbjct  218   LLLDEPTSGLDSTTAMKILTMVKGLAKGGRTVVTTIHQPSSRLYHMFDKVVVLSEGAPIY  277

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDS---QADQATVK  1076
              G+ S  M YF+ VGFS  VAMNP+DFLLDLANGI          G+ +   + D   V 
Sbjct  278   HGQASVAMGYFAAVGFSTPVAMNPADFLLDLANGIPPSKIDSEDQGEGNSLEEQDPKLVH  337

Query  1075  ETLVSAFKTNLLENLKMELHEL--NDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQR  902
             + L+SA+  N+   LK EL          S A   +  + W   WWEQ  VLLKRGLK+R
Sbjct  338   QLLISAYNENISPRLKAELRSTPSTPNQYSVACRSRVEEEWGTSWWEQVRVLLKRGLKER  397

Query  901   KYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             K+E+FSGL++ QV  V+ L+G LWW ST   +QDQ+GLLFF S FWGFFPLF A+F FP+
Sbjct  398   KHEAFSGLRIFQVTTVSILSGLLWWHSTISHIQDQIGLLFFYSIFWGFFPLFHAVFAFPQ  457

Query  727   DKMMLGKE-RSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSAL  551
             ++ +L KE R+S  Y+LSS+F ART+GDLP EL LPT+FV++SY+  GLKPT  NF   L
Sbjct  458   ERAILMKEQRTSSYYRLSSYFTARTLGDLPTELALPTLFVLLSYFTGGLKPTFTNFTLTL  517

Query  550   SAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYIS  371
               ILL VLV QGLGLA+GA +MD K  TTL SVI L FLLAGG+YV+ VPSFI+W+KY+S
Sbjct  518   LVILLNVLVSQGLGLALGAVLMDVKKGTTLASVITLVFLLAGGYYVQRVPSFIAWLKYVS  577

Query  370   IGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGY  191
                Y YKLLL  QY  G+ Y C  G+G+C V D PA+  +G+G      V AL++M++GY
Sbjct  578   FSYYCYKLLLGVQYGEGDVYGC--GTGLCRVVDLPAVANVGVGNKG-RDVGALVVMMVGY  634

Query  190   RLLAYVALMRV  158
             RL+AY AL R+
Sbjct  635   RLIAYAALRRL  645



>ref|XP_010648137.1| PREDICTED: ABC transporter G family member 21 [Vitis vinifera]
 emb|CBI27088.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/646 (56%), Positives = 466/646 (72%), Gaps = 38/646 (6%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             + P  Q    PQ       +I +++ RPVTLKFE+VVY +K    +G  F   + ++S  
Sbjct  44    QTPDGQQTTRPQF------SILRESLRPVTLKFEDVVYVIKLRSTEGSCFGSPEPKQS--  95

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
              + +L GV+GI  PGE+LAMLGPSGSGKTTLLTAL GRL G ++G ITYNG+PFS++MKR
Sbjct  96    -RTVLNGVSGIARPGELLAMLGPSGSGKTTLLTALAGRLPGKVSGNITYNGQPFSSSMKR  154

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFVTQDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+ +I +LGLT+C+NS+IG
Sbjct  155   KTGFVTQDDVLYPHLTVLETLTYAALLRLPKKLTREEKIEQAELIIVELGLTRCRNSVIG  214

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G  LRGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT++
Sbjct  215   GPLLRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAHRIVATLRGLAQGGRTVI  274

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLA  1124
              TIHQPSSRL+  F K+++L EG P+Y G  ++V+ YF T+G+ P  + +NP+DFLLDLA
Sbjct  275   TTIHQPSSRLYRTFDKLVVLSEGCPIYSGNAANVLEYFGTIGYLPGFSLLNPADFLLDLA  334

Query  1123  NGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMELHE-LNDEDVSSA  986
             NG+  D             D   DQ ++K+ L+S++K +L   ++ E+H   +  D S++
Sbjct  335   NGVAPDVRKDDQQDFHGRPDHHDDQNSIKQALISSYKKSLYHIMRAEIHRNSHGSDGSAS  394

Query  985   G---DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--  821
             G    +    +W   WWEQF VLL+RGL++RK+ES+SGL++ QV+ V+ L+G LWW S  
Sbjct  395   GPLSSRGCENQWTSSWWEQFKVLLRRGLQERKHESYSGLRIFQVMSVSILSGLLWWHSDT  454

Query  820   TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLP  641
             + +QDQVGLLFF S FWGFFPLF AIFTFP+++ ML +ERSSGMY+LSS++ AR  GDLP
Sbjct  455   SHIQDQVGLLFFFSIFWGFFPLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLP  514

Query  640   MELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTL  461
             MELVLPT+FV I+YWM GLKP+   F   L  IL  VLV QGLGLA+GA IMD K  T L
Sbjct  515   MELVLPTIFVTIAYWMGGLKPSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTAL  574

Query  460   GSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV--  287
              SV ML FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C    G+  
Sbjct  575   ASVTMLVFLLAGGYYIQHIPPFIAWLKYISFSHYCYKLLVGVQYAENEVYEC----GLRM  630

Query  286   -CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
              C V + PAIK +G+  H  + V AL +M +GYR LAY AL R+G+
Sbjct  631   HCKVWEFPAIKYLGI-DHWAWDVAALTVMFVGYRALAYAAL-RMGQ  674



>ref|XP_007046353.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY02185.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=684

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/654 (55%), Positives = 471/654 (72%), Gaps = 31/654 (5%)
 Frame = -3

Query  2044  TATEMGDIEAPTTQLQANPQLESDT--SAAIFKKANRPVTLKFENVVYKVKPD--QKQGL  1877
             +A+ +  +      + A+ Q E  T    ++ +++ RPVTLKFE V Y +  +   ++ L
Sbjct  37    SASSINVVPCSQEPIPAHQQQEQQTPLRISVLRESLRPVTLKFEEVAYSIYSNTTARRCL  96

Query  1876  SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTIT  1697
             S  + K ++S     +L GV+G+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+GTIT
Sbjct  97    SSQEPKPRRS-----VLNGVSGVVRPGELLAMLGPSGSGKTTLLTALGGRLTGKLSGTIT  151

Query  1696  YNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQ  1517
             YNG+PFS++MKR TGFV+QDD+LYPHLTV ETL + ALL+LP+ LT++EKIEQA+ +I +
Sbjct  152   YNGRPFSSSMKRKTGFVSQDDVLYPHLTVLETLTYAALLKLPKELTREEKIEQAELIIVE  211

Query  1516  LGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVST  1337
             LGL +C+N+I+GG  LRG+SGGERKRVSIG EML+NPSLL LDEPTSGLDSTTAQRIV+T
Sbjct  212   LGLVRCRNNIVGGPLLRGVSGGERKRVSIGLEMLVNPSLLLLDEPTSGLDSTTAQRIVAT  271

Query  1336  LWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA  1157
             L  L++GGRT++ TIHQPSSRL+ +F KVL+L EG P+Y G+    M YFS++GF+P   
Sbjct  272   LRRLARGGRTVITTIHQPSSRLYRMFDKVLVLYEGCPIYCGRADQAMEYFSSIGFTPGFN  331

Query  1156  -MNPSDFLLDLANGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMEL  1019
              +NP+DFLLDLANGI  D             D   DQ + K  L+ ++K N+   LK ++
Sbjct  332   FLNPADFLLDLANGIAPDVKPDEQLEFHGRVDHHDDQNSTKHYLILSYKKNIFPVLKADI  391

Query  1018  -HELNDEDVSSAGDQKQFK--RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAF  848
                L+D  +S+    K     RW   WWEQF VLL+RGL++RK+ES+S L++ QV+ V+ 
Sbjct  392   DRNLHDSSLSTVISSKSRCEVRWNTTWWEQFKVLLRRGLQERKHESYSCLRIFQVMSVSI  451

Query  847   LTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSS  674
             L+G LWW S  + +QDQVGLLFF S FWGFFPLF AIF FP+++ ML KER+SGMY+LSS
Sbjct  452   LSGLLWWHSDVSHIQDQVGLLFFFSIFWGFFPLFNAIFAFPQERPMLIKERASGMYRLSS  511

Query  673   FFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGA  494
             ++ ART GDLPMELVLPT+FV ++YWM GLKP+   F   L  +L  VLV QGLGLA+GA
Sbjct  512   YYFARTAGDLPMELVLPTIFVTVTYWMGGLKPSLVTFVLTLLIVLFNVLVSQGLGLALGA  571

Query  493   FIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGET  314
              +MD K  TTL SV ML FLLAGG+Y++H+P FI+W+KYIS   + YKLL+  QY   E 
Sbjct  572   ILMDVKQGTTLASVTMLVFLLAGGYYIQHIPLFIAWLKYISFSHFCYKLLVGVQYSVNEV  631

Query  313   YPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             Y C  G   C + D PAIK +GL    ++ V AL +ML+GYRLLAYVAL R+G+
Sbjct  632   YECDIGMH-CKIMDFPAIKYLGLDNK-LWDVAALTIMLVGYRLLAYVAL-RIGQ  682



>emb|CAN62390.1| hypothetical protein VITISV_039480 [Vitis vinifera]
Length=696

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/646 (56%), Positives = 466/646 (72%), Gaps = 38/646 (6%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             + P  Q    PQ       +I +++ RPVTLKFE+VVY +K    +G  F   + ++S  
Sbjct  64    QTPDGQQTTRPQF------SILRESLRPVTLKFEDVVYVIKLRSTEGSCFGSPEPKQS--  115

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
              + +L GV+GI  PGE+LAMLGPSGSGKTTLLTAL GRL G ++G ITYNG+PFS++MKR
Sbjct  116   -RTVLNGVSGIARPGELLAMLGPSGSGKTTLLTALAGRLPGKVSGNITYNGQPFSSSMKR  174

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFVTQDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+ +I +LGLT+C+NS+IG
Sbjct  175   KTGFVTQDDVLYPHLTVLETLTYAALLRLPKKLTREEKIEQAELIIVELGLTRCRNSVIG  234

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G  LRGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT++
Sbjct  235   GPLLRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAHRIVATLRGLAQGGRTVI  294

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLA  1124
              TIHQPSSRL+  F K+++L EG P+Y G  ++V+ YF T+G+ P  + +NP+DFLLDLA
Sbjct  295   TTIHQPSSRLYRTFDKLVVLSEGCPIYSGNAANVLEYFGTIGYLPGFSLLNPADFLLDLA  354

Query  1123  NGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMELHE-LNDEDVSSA  986
             NG+  D             D   DQ ++K+ L+S++K +L   ++ E+H   +  D S++
Sbjct  355   NGVAPDVRKDDQQDFHGRPDHHDDQNSIKQALISSYKKSLYHIMRAEIHRNSHGSDGSAS  414

Query  985   G---DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--  821
             G    +    +W   WWEQF VLL+RGL++RK+ES+SGL++ QV+ V+ L+G LWW S  
Sbjct  415   GPLSSRGCENQWTSSWWEQFKVLLRRGLQERKHESYSGLRIFQVMSVSILSGLLWWHSDT  474

Query  820   TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLP  641
             + +QDQVGLLFF S FWGFFPLF AIFTFP+++ ML +ERSSGMY+LSS++ AR  GDLP
Sbjct  475   SHIQDQVGLLFFFSIFWGFFPLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLP  534

Query  640   MELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTL  461
             MELVLPT+FV I+YWM GLKP+   F   L  IL  VLV QGLGLA+GA IMD K  T L
Sbjct  535   MELVLPTIFVTIAYWMGGLKPSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTAL  594

Query  460   GSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV--  287
              SV ML FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C    G+  
Sbjct  595   ASVTMLVFLLAGGYYIQHIPPFIAWLKYISFSHYCYKLLVGVQYAENEVYEC----GLRM  650

Query  286   -CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
              C V + PAIK +G+  H  + V AL +M +GYR LAY AL R+G+
Sbjct  651   HCKVWEFPAIKYLGI-DHWAWDVAALTVMFVGYRALAYAAL-RMGQ  694



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/627 (56%), Positives = 443/627 (71%), Gaps = 19/627 (3%)
 Frame = -3

Query  1990  PQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTG  1811
             P      S +  ++A  P+TLKFE +VYKV    ++G          +  EK IL GVTG
Sbjct  22    PNPAHKISQSFRQRALYPITLKFEEIVYKVN-GGREGSCCGGGGASTATGEKTILNGVTG  80

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDI  1631
             +V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG PFS+++KR TGFV QDD+
Sbjct  81    MVCPGELLAMLGPSGSGKTTLLTALGGRLTGKLSGKITYNGHPFSSSIKRKTGFVAQDDV  140

Query  1630  LYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGG  1451
             LY HLTV ETL+FTALLRLP++LTK+EK E  + VI +LGL KC+NS+IGG   RGISGG
Sbjct  141   LYQHLTVFETLLFTALLRLPKSLTKEEKAEHVEHVIAELGLNKCQNSMIGGPLFRGISGG  200

Query  1450  ERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRL  1271
             E+KRVSIGQEMLINPSLL LDEPTSGLDST+AQRI+ TL  L+ GGRT++ TIHQPSSRL
Sbjct  201   EKKRVSIGQEMLINPSLLLLDEPTSGLDSTSAQRILKTLKGLAGGGRTVITTIHQPSSRL  260

Query  1270  FYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD-----  1106
             +Y+F KV+LL EG+P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLANGI  D     
Sbjct  261   YYMFDKVVLLSEGSPIYYGLASTALEYFSSVGFSTSITVNPADLLLDLANGIGPDFQNAN  320

Query  1105  -----DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVS----SAGDQKQFKRWAI  953
                  + Q D + V+E L SA++TN+   LK+EL   +    +     A +  + ++W  
Sbjct  321   TNHSENPQQDPSAVREFLTSAYETNISTRLKIELCSSDGGSYTYKEACAKNDVRSEKWCT  380

Query  952   PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFIS  779
              WW QF +LL RGL++R++E+F+ L++ QVL VA L G LWW+  S+ + D+V +LFF S
Sbjct  381   TWWHQFKILLIRGLRERRFETFNKLRIFQVLSVAILGGLLWWQTPSSHIDDRVAMLFFYS  440

Query  778   SFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISY  599
              FWGF+PL+ A+FTFP+++ ML KERSSGMY+LS++FLARTV DLPMEL LPT F  I Y
Sbjct  441   VFWGFYPLYNAVFTFPQERSMLIKERSSGMYRLSAYFLARTVADLPMELALPTAFTFIFY  500

Query  598   WMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGF  419
             WM GLKP    F  +L  +L  VLV Q LGLA GA +MD K A TL SV  L FL+AGG+
Sbjct  501   WMGGLKPDPTTFVLSLLIVLFSVLVSQSLGLAFGAVLMDVKQAATLASVTTLVFLIAGGY  560

Query  418   YVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQ  239
             YVR +P FI W+KY+S   Y YKLLL   Y   + Y C      C V D+PA+K +GL  
Sbjct  561   YVRQIPPFIVWLKYLSYSYYCYKLLLGVHYTENDYYECAEKV-YCRVSDYPAVKSVGL-T  618

Query  238   HVIFSVVALLLMLIGYRLLAYVALMRV  158
             ++   +  +LLMLIGYRL+AY AL RV
Sbjct  619   NLWVDMSVMLLMLIGYRLVAYRALHRV  645



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/615 (57%), Positives = 442/615 (72%), Gaps = 20/615 (3%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQ-KQGLSFLKTKKQKSEAEKIILKGVTGIVFPG  1796
             TS    + +  P+TLK   VVYKVK +Q  Q +   K+K      EK IL G+TG+V PG
Sbjct  39    TSQPGLQMSMYPITLK--EVVYKVKIEQTSQCMGSWKSK------EKTILNGITGMVCPG  90

Query  1795  EVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHL  1616
             E LAMLGPSGSGKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHL
Sbjct  91    EFLAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHL  150

Query  1615  TVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRV  1436
             TV ETL FTALLRLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KRV
Sbjct  151   TVWETLFFTALLRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRV  210

Query  1435  SIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFH  1256
             SIGQEMLINPSLL LDEPTSGLDSTTA RIV+T+  L+ GGRT+V TIHQPSSR++++F 
Sbjct  211   SIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFD  270

Query  1255  KVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD----DSQADQ  1088
             KV+LL EG+P+Y+G  S  + YFS++GFS S+ +NP+D LLDLANGI  D     S+ +Q
Sbjct  271   KVVLLSEGSPIYYGAASSAVEYFSSLGFSTSLTVNPADLLLDLANGIPPDTQKETSEQEQ  330

Query  1087  ATVKETLVSAFKTNLLENLKMELHELND---EDVSSAGDQKQFKRWAIPWWEQFSVLLKR  917
              TVKETLVSA++ N+   LK EL        E   +A    + ++W   WW QF+VLL+R
Sbjct  331   KTVKETLVSAYEKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQR  390

Query  916   GLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAI  743
             G+++R++ESF+ L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A+
Sbjct  391   GVRERRFESFNKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNAV  450

Query  742   FTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNF  563
             FTFP++K ML KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F
Sbjct  451   FTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTF  510

Query  562   FSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
               +L  +L  VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+
Sbjct  511   ILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWL  570

Query  382   KYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLM  203
             KY+S   Y YKLLL  QY   + Y C+ G   C V D PAIK +GL  ++   V  + +M
Sbjct  571   KYLSYSYYCYKLLLGIQYTDDDYYECSKGVW-CRVGDFPAIKSMGL-NNLWIDVFVMGVM  628

Query  202   LIGYRLLAYVALMRV  158
             L+GYRL+AY+AL RV
Sbjct  629   LVGYRLMAYMALHRV  643



>ref|XP_011077437.1| PREDICTED: ABC transporter G family member 21 [Sesamum indicum]
Length=672

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/656 (56%), Positives = 466/656 (71%), Gaps = 26/656 (4%)
 Frame = -3

Query  2074  SDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKP  1895
             +DQ  +  +E      ++ +P    Q      +   +++ +++ RPVTLKFE+V Y +K 
Sbjct  17    ADQTISVQIELPGSTSNV-SPCPDDQVPENHATLVRSSVLRESLRPVTLKFEDVSYTIKL  75

Query  1894  DQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlggh  1715
               ++G         + +  + IL  V+G V PGE+LAMLGPSGSGKTTLLTAL GRL G 
Sbjct  76    QNRRGGC---CSSSEPKLTRNILNSVSGTVRPGELLAMLGPSGSGKTTLLTALAGRLPGK  132

Query  1714  lagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQA  1535
              +GTITYN + FS++MKR TGFVTQDD+LYPHLTV ETL + ALL+LP  LTK+EK+EQA
Sbjct  133   FSGTITYNEQAFSSSMKRKTGFVTQDDVLYPHLTVLETLTYAALLKLPSKLTKKEKMEQA  192

Query  1534  DAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTA  1355
             + +I +LGLT+C+NSI+GG FLRGISGGERKRVSIGQEML+NPSLL +DEPTSGLDSTTA
Sbjct  193   ELIIMELGLTRCRNSIVGGPFLRGISGGERKRVSIGQEMLVNPSLLLVDEPTSGLDSTTA  252

Query  1354  QRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVG  1175
             QRIV+TL  L++GGRT+V TIHQPSSRLF +F KV++L EG P+Y G  + VM YF+++G
Sbjct  253   QRIVATLRWLARGGRTVVTTIHQPSSRLFRMFDKVIVLAEGCPIYSGGANGVMDYFASIG  312

Query  1174  FSPSVA-MNPSDFLLDLANGITGD----------------DSQADQATVKETLVSAFKTN  1046
             ++P    MNP+DFLLDLANG+T +                D   D  + K+ L+ ++K N
Sbjct  313   YAPGFNFMNPADFLLDLANGVTPESGQDDHEHDFDHGRQLDHHDDHNSTKQFLIYSYKKN  372

Query  1045  LLENLKMELHELN-DEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVG  869
             L   +K E+H+ + D    S   +   K+W   WW QF VLL RGLK+RK+ES+SGLK+ 
Sbjct  373   LHPLIKEEIHQASQDSGKPSPLKRCSEKQWTNSWWLQFKVLLSRGLKERKHESYSGLKIF  432

Query  868   QVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSS  695
             QV+ V+ L+G LWW S    +QDQVGLLFF S FWGFFPLF A+F FP++  ML +E SS
Sbjct  433   QVMSVSILSGLLWWHSDANHIQDQVGLLFFFSIFWGFFPLFSAVFVFPQEWSMLTRECSS  492

Query  694   GMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqg  515
             GMY+LSS++ ARTVGDLPMELVLPT+FV ISYWM GLKP+   F   L  ILL VLV QG
Sbjct  493   GMYRLSSYYFARTVGDLPMELVLPTIFVTISYWMGGLKPSLITFLLTLWIILLNVLVAQG  552

Query  514   lgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLES  335
             LGLA+GA +M+ K ATTL SV+ML FLLA G+Y++H+P FI W+KYIS   Y YKLL+  
Sbjct  553   LGLALGAVLMNVKQATTLSSVLMLVFLLASGYYIQHIPPFIDWLKYISFSHYCYKLLVGV  612

Query  334   QYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             QY P E Y C  G  VC   D PAIK +G+  H+   V+AL+LML+GYRLLAYVAL
Sbjct  613   QYSPNEVYDCGLGY-VCRAVDFPAIKYLGI-DHMGLDVIALMLMLVGYRLLAYVAL  666



>ref|XP_010556399.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=685

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/639 (56%), Positives = 464/639 (73%), Gaps = 32/639 (5%)
 Frame = -3

Query  1999  QANPQLESD---TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
             + NP    D     +++ +++ RPV LKFE++ Y +     +G  +  + + KS   ++I
Sbjct  48    EENPSPHQDHQLRKSSVLRRSLRPVILKFEDLTYSINLRTGKGSFWFGSHEPKST--RLI  105

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             L GVTGIV PGE+LAMLGPSGSGKTTLLTAL GRL G L+G++TYNG+PFS+++KR  GF
Sbjct  106   LNGVTGIVKPGELLAMLGPSGSGKTTLLTALAGRLNGKLSGSVTYNGQPFSSSVKRKIGF  165

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             VTQDD+LYPHLTVTETL FTA+LRLP+ LT+ EKIEQ ++VI+ LGL +C NS+IGG  +
Sbjct  166   VTQDDVLYPHLTVTETLTFTAMLRLPKELTRLEKIEQVESVISDLGLNRCSNSVIGGGLI  225

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDST A R+++T   L++GGRT+V TIH
Sbjct  226   RGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTAAARVIATARGLARGGRTVVTTIH  285

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGIT  1112
             QPSSRL+ +F KVL+L EG+P+Y G+   VM YF ++GF P S  +NP+DF+LDLANGIT
Sbjct  286   QPSSRLYKMFDKVLILSEGSPIYSGESGRVMEYFGSIGFQPGSSFVNPADFVLDLANGIT  345

Query  1111  GDDSQADQA-------------TVKETLVSAFKTNLLENLKMELHE--LNDEDVSSAGDQ  977
              D  Q DQ              +VK+ L+ +++ +L   LK E+    L  +   S    
Sbjct  346   PDTKQYDQVEVHGRLERHEEQNSVKQMLIHSYRKSLYPLLKDEISRTSLPQDQTFSGSKT  405

Query  976   KQFKR-----WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--T  818
             K   R     W   WW QF VLLKRGLK+R++ESFSGL++ QV+ V+ L+G LWW S  +
Sbjct  406   KSSTRTKDTQWPTSWWVQFYVLLKRGLKERRHESFSGLRIFQVMSVSILSGLLWWHSRVS  465

Query  817   DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPM  638
              LQDQVGLLFF S FWGFFPLF AIFTFP+++ ML KERSSGMY+LSS+++ARTVGDLPM
Sbjct  466   HLQDQVGLLFFFSIFWGFFPLFNAIFTFPQERPMLVKERSSGMYRLSSYYIARTVGDLPM  525

Query  637   ELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLG  458
             EL+LPT+FV ISYWM GLKP+   F   L  +L  VLV Q +GLA+GA +MD K ATTL 
Sbjct  526   ELILPTIFVTISYWMGGLKPSPTTFLLTLLIVLYNVLVAQAVGLAMGAILMDVKQATTLS  585

Query  457   SVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CL  281
             SV ML FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C 
Sbjct  586   SVTMLVFLLAGGYYIQHIPGFIAWLKYISFSHYCYKLLVGVQYTGNEVYEC--GLGLRCR  643

Query  280   VEDHPAIKKIGLG-QHVIFSVVALLLMLIGYRLLAYVAL  167
             V D+  I+ + +G  ++++ V+AL +ML+GYR+LAY+AL
Sbjct  644   VMDYEGIRNLMIGNNNMMWDVLALGIMLVGYRVLAYLAL  682



>ref|XP_011028515.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/645 (56%), Positives = 465/645 (72%), Gaps = 31/645 (5%)
 Frame = -3

Query  2017  APTTQLQANPQLESDTSAAIFKKANR---------PVTLKFENVVYKVKPDQKQGLSFLK  1865
             APT  L   P+  +    +   +AN          P TLKFE VVYKVK +QK GL +  
Sbjct  15    APTEGLPKMPETNNRAVLSYPGQANSQSVLQLTIYPTTLKFEEVVYKVKLNQK-GLCW--  71

Query  1864  TKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGK  1685
                  S  EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+
Sbjct  72    -GGAWSTREKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQ  130

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS  MKR TGFV QDDILYPHLTV+ETL+FTALLRLP+TLT++EK +  + VI +LGL+
Sbjct  131   PFSGTMKRRTGFVAQDDILYPHLTVSETLLFTALLRLPKTLTREEKAQHVERVIAELGLS  190

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +C+NS+IGG   RGISGGE+KRV+IGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L
Sbjct  191   QCRNSMIGGPLFRGISGGEKKRVNIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRL  250

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPS  1145
             + GGRT+V TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS++GFS S+ +NP+
Sbjct  251   ASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGRPIYYGPASAALDYFSSIGFSTSMTVNPA  310

Query  1144  DFLLDLANGI---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDV-  995
             D LLDLANGI          G++++ +Q +V+E L+SA++ N+   LK EL  L+  +  
Sbjct  311   DLLLDLANGIGPDSKNATDYGENTEQEQKSVREALISAYEKNISTRLKAELCNLDPNNYY  370

Query  994   ----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW  827
                 +S  ++K+ ++W   WW QF VL +RGL++R+YESF+ L++ QVL V+ L G LWW
Sbjct  371   YTKDASERNEKKSEKWCTSWWHQFRVLFQRGLRERRYESFNRLRIFQVLSVSILGGLLWW  430

Query  826   K--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTV  653
             K  ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML KER+SGMY LSS+FLART 
Sbjct  431   KTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTC  490

Query  652   GDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKS  473
             GDLP+EL LPT FV I YWM GLK     F  +L  +L  VLV Q LGLAIGA +MD K 
Sbjct  491   GDLPLELALPTAFVFIIYWMGGLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQ  550

Query  472   ATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGS  293
             ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y+YKLLL  QY   + Y C+ G 
Sbjct  551   ATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGV  610

Query  292   GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              +C V D P++K +GL  H+   V  + LML+GYR++AY+AL RV
Sbjct  611   -LCRVGDFPSVKSMGL-NHLWVDVAIMALMLVGYRMVAYLALHRV  653



>ref|XP_009793168.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=644

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/626 (57%), Positives = 458/626 (73%), Gaps = 21/626 (3%)
 Frame = -3

Query  1993  NPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVT  1814
             N Q  +    ++ +K+ RPVTLKF+NV Y +K +  +G+S+  T ++K    + IL+GVT
Sbjct  18    NQQQSNHVKLSVLRKSLRPVTLKFQNVSYTIKLESNKGISYFSTPQRKQN--RAILQGVT  75

Query  1813  GIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQD  1637
             GI+ PGE LAMLGPSGSGKTTLLTAL GRL G L+  +ITYNG+ FS++MKR  GFVTQD
Sbjct  76    GIIHPGEFLAMLGPSGSGKTTLLTALAGRLSGKLSSGSITYNGQQFSSSMKRKIGFVTQD  135

Query  1636  DILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGIS  1457
             D+LYPHLTV ETL + ALLRLP+ LTKQEK EQA+ V  +LGLT+CKNSIIGG   RGIS
Sbjct  136   DVLYPHLTVLETLTYAALLRLPKKLTKQEKSEQAEFVTVELGLTRCKNSIIGGTLFRGIS  195

Query  1456  GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSS  1277
             GGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI++TL  L++GGRTIV TIHQPSS
Sbjct  196   GGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIIATLRWLARGGRTIVTTIHQPSS  255

Query  1276  RLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGDDS  1100
             +L+ +F K+++L +G P+Y GK S VM YF ++G+ P    MNPSDFLLDLANG++ D  
Sbjct  256   KLYRMFDKIIVLSDGCPIYCGKNSHVMEYFESIGYVPGFHFMNPSDFLLDLANGVSPDTR  315

Query  1099  QAD-------------QATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
             Q D             Q   K+ L++++K N+   LK E+ +     +  +   +   +W
Sbjct  316   QDDLHESLPKSDQTENQNATKQFLITSYKKNIYPALKEEIDQSFGHPIRLSSRSRDENQW  375

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
             +  WW QF VLL+RGLK+RK+ES+SGL++ QV+ V+FL+G LWW S    + DQVGLLFF
Sbjct  376   STSWWLQFKVLLQRGLKERKHESYSGLRIFQVMSVSFLSGLLWWHSDTNHIMDQVGLLFF  435

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGFFPLF AIF FP+++  L +ERSSGMY+LSS++ ARTVGDLPMEL+LPT+FV I
Sbjct  436   FSIFWGFFPLFSAIFAFPQERPKLIRERSSGMYRLSSYYFARTVGDLPMELILPTIFVTI  495

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWM GLKP+   F   L  ILL VLV QGLGLA+GA +MD K ATTL SV+ML FLLA 
Sbjct  496   TYWMGGLKPSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFLLAS  555

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+Y++H+PSF++W+KY+S   Y YKLL+  QY   E Y C      C V D PAIK +G+
Sbjct  556   GYYIQHIPSFVTWLKYVSFSHYCYKLLVGVQYSRFEVYECGIDEE-CKVMDFPAIKCLGI  614

Query  244   GQHVIFSVVALLLMLIGYRLLAYVAL  167
               ++   +VAL++M + +R+LAYVAL
Sbjct  615   -DNLALDLVALVVMFVIFRVLAYVAL  639



>ref|XP_011082193.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/619 (56%), Positives = 449/619 (73%), Gaps = 19/619 (3%)
 Frame = -3

Query  1975  DTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPG  1796
             ++S +  ++   P+TLKFE +VYKV  ++K+      T    S  EK IL G+TG+V PG
Sbjct  40    NSSRSFLQRTLYPITLKFEEIVYKVYYERKRSCGGTST----SAKEKTILNGITGMVSPG  95

Query  1795  EVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHL  1616
             E+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+PFS ++KR TGFV QDD+LYPHL
Sbjct  96    EILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQPFSGSIKRRTGFVAQDDVLYPHL  155

Query  1615  TVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRV  1436
             TV ETL+FTALLRLP++L+K EK +  + VI +LGLT+C NS+IGG   RGISGGE+KRV
Sbjct  156   TVFETLLFTALLRLPKSLSKDEKAQHVENVIAELGLTRCHNSMIGGPLFRGISGGEKKRV  215

Query  1435  SIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFH  1256
             SIGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRTI+ TIHQPSSRL+++F 
Sbjct  216   SIGQEMLINPSLLLLDEPTSGLDSTTAQRILNTVKGLASGGRTIITTIHQPSSRLYHMFD  275

Query  1255  KVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA------  1094
             KV+LL EG P+Y+G  S  + YFS++GFS SVA+NP+D LLDLANGI  D   A      
Sbjct  276   KVVLLSEGCPIYYGLASAALEYFSSIGFSTSVAVNPADLLLDLANGIGPDFQHANDHKDN  335

Query  1093  ---DQATVKETLVSAFKTNLLENLKMEL--HELNDEDVSSAGDQKQFKRWAIPWWEQFSV  929
                D  +V+E L+SA+  N+   LK EL   ++N    SS  +  + ++W   WW QF +
Sbjct  336   IKQDPVSVREFLISAYDKNISTGLKSELCSADVNYTKESSTRNDVKSEKWCTTWWHQFKI  395

Query  928   LLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPL  755
             LL RGL++R++E+F+ L++ QVL VA L G LWW   S+ + D++ +LFF S FWGF+PL
Sbjct  396   LLLRGLRERRFEAFNRLRIFQVLSVAILGGLLWWHTPSSHIDDRIAMLFFFSVFWGFYPL  455

Query  754   FQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPT  575
             + A+FTFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT F  I YWM GLKP 
Sbjct  456   YNAVFTFPQERNMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFTFIFYWMGGLKPD  515

Query  574   AGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSF  395
                F  +L  +L  VLV Q LGLA GA +MD K A TL SV  + FL+AGG+YVRH+P F
Sbjct  516   PATFILSLLVVLFSVLVSQSLGLAFGALLMDVKQAATLASVTTMVFLIAGGYYVRHIPPF  575

Query  394   ISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVA  215
             I+W++Y+S   Y Y+LLL  QY   + Y C  G+  C V D+P IK +GL  H+   +  
Sbjct  576   IAWLRYLSYSYYCYRLLLGIQYNENDYYECAKGA-YCRVADYPPIKAVGL-SHLWIDISI  633

Query  214   LLLMLIGYRLLAYVALMRV  158
             ++LML+GYR +AY+AL RV
Sbjct  634   MMLMLVGYRFIAYLALHRV  652



>ref|XP_010676724.1| PREDICTED: ABC transporter G family member 14 [Beta vulgaris 
subsp. vulgaris]
Length=634

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/616 (55%), Positives = 428/616 (69%), Gaps = 35/616 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgs-  1763
             P+TLKFE VVYKVK      L  +K K      EK IL GV+G+VFPGE+LAMLGPSGS 
Sbjct  31    PITLKFEEVVYKVK------LEDIKCK------EKTILNGVSGMVFPGEILAMLGPSGSG  78

Query  1762  gkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
               T L    G   G  L G ITYN  PFS  +KR TGFV QDD+LYPHLTV ETL+FTAL
Sbjct  79    KTTLLSALGGRLGGKLLCGKITYNSLPFSGTIKRRTGFVAQDDVLYPHLTVFETLLFTAL  138

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP TL  + K+ Q + V+ +LGL++ +NS+IGG  +RG+SGGE+KRVSIGQEMLINPS
Sbjct  139   LRLPSTLAHESKVGQVERVVAELGLSRVRNSMIGGPLVRGLSGGEKKRVSIGQEMLINPS  198

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDSTTA RI++ L  L++GGRT++ TIHQPSSRL+++FHKV+LL EG P+
Sbjct  199   LLLLDEPTSGLDSTTALRIMTILKGLAEGGRTVITTIHQPSSRLYHMFHKVVLLSEGRPI  258

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDSQADQATVKET  1070
             Y+G  S  + YFS+ GFS S+ MNP+D LLDLA+GI          G+  + ++  V+ET
Sbjct  259   YYGSASSALEYFSSFGFSTSLTMNPADLLLDLASGIGPESKHAMEQGEAMEQEKKQVRET  318

Query  1069  LVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKR-------WAIPWWEQFSVLLKRGL  911
             L+SA++ N+   LK EL  L         D     R       W   WW QF VL++RG+
Sbjct  319   LISAYENNISTRLKSELCNLETTTYPWKKDTSNIARINTKGEQWCTSWWHQFKVLVQRGM  378

Query  910   KQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFT  737
             K+R++E+F+ L++ QVL VAFL G LWW +  + ++D+V L+FF S FWGF+PL+ A+FT
Sbjct  379   KERRFEAFNRLRIFQVLSVAFLGGLLWWHTPESHIEDRVALIFFFSVFWGFYPLYNAVFT  438

Query  736   FPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFS  557
             FP+++ ML KER+SGMYKLSS+FLART+GDLP+EL LPT FV I YWM GLKP    F  
Sbjct  439   FPQERRMLIKERTSGMYKLSSYFLARTIGDLPLELALPTAFVFIIYWMGGLKPNPIVFVL  498

Query  556   ALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKY  377
             +L  +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY
Sbjct  499   SLIVVLYNVLVAQSLGLAIGAILMDIKPATTLASVTTLVFLIAGGYYVQQIPPFIVWLKY  558

Query  376   ISIGQYTYKLLLESQYKPGETYPCTSGSGV---CLVEDHPAIKKIGLGQHVIFSVVALLL  206
             +S   Y YKLLL  QY+  +TYPC         C V D PA+K +GL  H+   V  L L
Sbjct  559   LSYSYYCYKLLLGVQYQQNDTYPCIKMGNKWEWCKVVDVPAVKSMGL-DHLWIDVCVLGL  617

Query  205   MLIGYRLLAYVALMRV  158
             ML+GYRLLAY+AL RV
Sbjct  618   MLVGYRLLAYLALQRV  633



>ref|XP_006441201.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
 gb|ESR54441.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
Length=607

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/610 (56%), Positives = 454/610 (74%), Gaps = 23/610 (4%)
 Frame = -3

Query  1924  FENVVYKVKPDQKQG-----LSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             FE+V +K+K    +G       +L  K   S+ EK+ILKGV+G V PGE+LA+LGPSG G
Sbjct  1     FEDVTHKIKTKGGRGGPGRYCCYLLNKN--SDEEKMILKGVSGAVSPGELLAILGPSGCG  58

Query  1759  kttlltal----ggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVF  1592
             KTTLLTAL             G ITYNGK FS  +KR TGFV Q+++ YPHLTV ETLVF
Sbjct  59    KTTLLTALGGRLSNGRDRVTQGHITYNGKQFSAEVKRRTGFVAQNNVFYPHLTVAETLVF  118

Query  1591  TALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLI  1412
             TALLRLP +L K+EK+  A+AVI QLGL +C+NSIIGG  +RG+SGGERKR+SIGQE+LI
Sbjct  119   TALLRLPNSLKKEEKVLHAEAVINQLGLARCRNSIIGGRLVRGLSGGERKRISIGQELLI  178

Query  1411  NPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKV-LLLCE  1235
             NPSLLFLDEPTSGLDST A++I+ +L +L++GGRTI+MTIHQP+S LFY+F+K+ LL  +
Sbjct  179   NPSLLFLDEPTSGLDSTMAKKILVSLTKLAEGGRTILMTIHQPASSLFYMFNKILLLSSD  238

Query  1234  GNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKETLVSAF  1055
             G+ LYFGKG DV++YF+ +G+ PSVAMNP+DFLLDLANG+   D + ++  VK+TL+SA+
Sbjct  239   GSSLYFGKGEDVINYFAGIGYVPSVAMNPADFLLDLANGVASGDPKENREAVKQTLISAY  298

Query  1054  KTNLLENLKMELHELNDEDVSSAGDQKQFK---RWAIPWWEQFSVLLKRGLKQRKYESFS  884
             K+N+   LK E  +  D  +++  D K +K   +W+  WW+ FSVLL+R LK+R++++F 
Sbjct  299   KSNISNKLKQEFEDGGDHSLTT--DSKNYKKTSKWSTTWWQHFSVLLRRDLKERRHDTFD  356

Query  883   GLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
              LK+GQ+L ++ +TG +WW+S+  +++DQVGLLFF S   GFFPLFQA+ TFP ++MML 
Sbjct  357   SLKIGQILFLSIITGLIWWQSSTDNIEDQVGLLFFYSRQAGFFPLFQALHTFPLERMMLE  416

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY+LSS+ +A+T GD  MELVLPTVFVII+YWM GLK    NF S L+A L   
Sbjct  417   KERSSGMYRLSSYIMAKTTGDFVMELVLPTVFVIITYWMGGLKARVINFLSTLAATLYTA  476

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV Q LGLA+GAF+++Q+ A T+ + +ML FLL GGF+++ VP+FISW++Y+S   Y+YK
Sbjct  477   LVAQSLGLAVGAFVLNQRKAGTIATTLMLTFLLTGGFFLQDVPAFISWLEYLSFTHYSYK  536

Query  349   LLLESQYKPGETYPCTSGS---GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLA  179
             LLL SQY P +TY C S S     CLV D P IK +GL   ++ SVV + +M + Y+L+ 
Sbjct  537   LLLMSQYNPNDTYVCASNSNSNATCLVGDFPRIKFVGLNNKLL-SVVMMAVMFVCYKLIT  595

Query  178   YVALMRVGRT  149
             Y+AL RVG T
Sbjct  596   YLALRRVGVT  605



>ref|XP_010265331.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=666

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/652 (55%), Positives = 462/652 (71%), Gaps = 36/652 (6%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTS---------AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFL  1868
             E P      +P LE   +          +I +++ RPVTLKFE+VVY +K  +  G  F 
Sbjct  20    ELPALSSNVSPCLEDRMAEQLKARMGECSILRRSLRPVTLKFEDVVYSIKLKKSDGYCF-  78

Query  1867  KTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNG  1688
                    + E+ IL GVTGIV PGE+LAMLGPSGSGKTTLLTAL GRL G  +G+ITYNG
Sbjct  79    --SSPDPKPERTILNGVTGIVRPGELLAMLGPSGSGKTTLLTALAGRLPGKFSGSITYNG  136

Query  1687  KPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGL  1508
             +PFS ++KR TGFVTQDD+LYPHLTV ETL + ALLRLP  LT++EK+EQA+ VI +LGL
Sbjct  137   RPFSGSIKRKTGFVTQDDVLYPHLTVLETLTYAALLRLPNKLTREEKVEQAELVIAELGL  196

Query  1507  TKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE  1328
               C+NSI+GG  LRG+SGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  
Sbjct  197   MICRNSIVGGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLQG  256

Query  1327  LSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM-N  1151
             L++GGRT+V TIHQPSSRLF  F KV++L +G P+Y G     + YF+++G++P   + N
Sbjct  257   LARGGRTVVTTIHQPSSRLFRSFDKVVVLSDGYPIYSGSAFRALDYFASIGYAPGAHLVN  316

Query  1150  PSDFLLDLANGITGDDSQADQA------------TVKETLVSAFKTNLLENLKMELHELN  1007
             P+DFLLD+ANG+  +  Q DQ             ++K+ L+S++K NL   +K EL   +
Sbjct  317   PADFLLDIANGVAPESKQGDQPDNYGRSDHGDLNSIKQRLISSYKKNLHSMVKAELGLTS  376

Query  1006  DEDVSSAGDQKQFK----RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTG  839
                 S       F+    +W   WWEQF VLL RGLK+RK+ES+SGL++ QV+ V+ L+G
Sbjct  377   QVSESLLAGTTSFRGSEEQWMTSWWEQFKVLLSRGLKERKHESYSGLRIFQVISVSILSG  436

Query  838   ALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFL  665
              LWW S  + +QDQVGLLFF S FWGFFP+F AIFTFP+++ ML KERSSGMY+LSS++ 
Sbjct  437   LLWWHSDVSHIQDQVGLLFFFSIFWGFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYF  496

Query  664   ARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIM  485
             AR  GDLPMELVLPT+FV ++YWM GL+P+  NF   L  IL  VLV QGLGLA+GA +M
Sbjct  497   ARIAGDLPMELVLPTIFVSVTYWMGGLRPSPVNFLLTLLIILYNVLVSQGLGLALGAILM  556

Query  484   DQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPC  305
             + K ATTL SV ML FLLA G+Y++H+P+FI W+KY S   Y YKLL+  QY   + Y C
Sbjct  557   ELKQATTLASVTMLVFLLASGYYIQHIPAFIVWLKYTSFSHYCYKLLVGVQYTEDDYYDC  616

Query  304   TSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
               G G+ C + + PA+K +G+  ++   V AL +ML+GYRL+AYVAL R+G+
Sbjct  617   --GIGLHCKIFNFPAVKNLGI-NNMGLDVAALTVMLVGYRLIAYVAL-RIGQ  664



>ref|XP_007225163.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
 gb|EMJ26362.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
Length=683

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/643 (58%), Positives = 464/643 (72%), Gaps = 39/643 (6%)
 Frame = -3

Query  1999  QANPQLESDTSA--------AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE  1844
               NP L  D  A        +I +++ RPVTLKFE+V Y +K    +G      + +++ 
Sbjct  42    NVNPCLGDDMPADRPTSHRTSILRQSLRPVTLKFEDVTYSIKLQTTRGGCVASHEPKQT-  100

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMK  1664
               + IL GV+GIV PGE+LAMLGPSGSGKTTLLTALGGRL G ++G ITYNG+ FS++MK
Sbjct  101   --RTILNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPGKISGKITYNGQHFSSSMK  158

Query  1663  RNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSII  1484
              NTGFVTQDD+LYPHLTV ETL +TALLRLP+ LTK+EK+EQA+ VI +LGLT+C +SI+
Sbjct  159   HNTGFVTQDDVLYPHLTVLETLTYTALLRLPKQLTKEEKMEQAEMVIMELGLTRCSDSIV  218

Query  1483  GGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTI  1304
             GG  LRG+SGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL +L++GGRT+
Sbjct  219   GGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRQLARGGRTV  278

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDL  1127
             + TIHQPSSRL+ +F KV++L +G P+Y G  S VM YF ++G+      +NP+DFLLDL
Sbjct  279   ISTIHQPSSRLYRMFDKVVVLSDGYPIYSGHASRVMEYFGSIGYEAGFNFINPADFLLDL  338

Query  1126  ANGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDV---  995
             ANGI  D             + Q DQ T K+ L+S++K NL   LK E+ + + + V   
Sbjct  339   ANGIGPDAKQDDQLEYNGRLEHQEDQNTTKQFLISSYKKNLYPVLKAEIQQSHKDTVLAP  398

Query  994   -----SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALW  830
                  SS G+ K   +W   WW QF VLL+RGLK+RK+ESFSGL++ QVL V+ L+G LW
Sbjct  399   SRTTPSSRGNGKY--QWTTSWWVQFKVLLERGLKERKHESFSGLRIFQVLSVSLLSGLLW  456

Query  829   WKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLART  656
             W S  + +QDQVGLLFF S FWGFFPLF AIF FP ++ ML KERSSGMY+LSS++ ART
Sbjct  457   WHSDTSHIQDQVGLLFFFSIFWGFFPLFNAIFAFPMERPMLIKERSSGMYRLSSYYFART  516

Query  655   VGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQK  476
             VGDLPMELVLPTVFV +SYWM GLKP+   F   LS +L  VLV QGLGLA+GA +MD K
Sbjct  517   VGDLPMELVLPTVFVTVSYWMGGLKPSFVTFALTLSIVLYNVLVSQGLGLALGAILMDVK  576

Query  475   SATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSG  296
               TTL SV ML FLL GG+Y++H+PSFI+W+KYIS   Y YKLL+  QY   E Y C  G
Sbjct  577   QGTTLASVTMLVFLLVGGYYIQHIPSFIAWLKYISFSHYCYKLLVGVQYSANEVYECEMG  636

Query  295   SGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
                C V D PAIK +GL   +   V AL +ML+GYR+LAYVAL
Sbjct  637   MH-CSVMDFPAIKYLGL-DSMWSDVAALAVMLVGYRVLAYVAL  677



>ref|XP_009586692.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
tomentosiformis]
Length=675

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/627 (58%), Positives = 468/627 (75%), Gaps = 25/627 (4%)
 Frame = -3

Query  1987  QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGI  1808
             Q  +    ++ +++ RPVTLKFE+V Y +K ++ +G  F  T+++++   +++L+GVTGI
Sbjct  49    QQSNHAKLSVLRESLRPVTLKFEDVSYTIKLERNKGGCFSSTQQKQT---RMLLQGVTGI  105

Query  1807  VFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDIL  1628
             V PGE+LAMLGPSG GKTTLLTAL GRL G  +GTITYNG+ FS++MKR  GFVTQDD+L
Sbjct  106   VKPGEILAMLGPSGCGKTTLLTALSGRLPGKFSGTITYNGQQFSSSMKRKIGFVTQDDVL  165

Query  1627  YPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGE  1448
             YPHLTV ETL + ALLRLP  LT QEKIEQA+ VI +LGLT+CKNS+IGG   RGISGGE
Sbjct  166   YPHLTVLETLTYAALLRLPNKLTNQEKIEQAELVIMELGLTRCKNSMIGGQLFRGISGGE  225

Query  1447  RKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLF  1268
             RKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT++ TIHQPSSRLF
Sbjct  226   RKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRWLARGGRTVITTIHQPSSRLF  285

Query  1267  YLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-----  1106
              +F K+++L EG P+Y GK S VM YF+++G++P    MNP+DFLLDLANGIT D     
Sbjct  286   RMFDKIIVLTEGCPIYSGKSSHVMEYFTSIGYAPGFNFMNPADFLLDLANGITPDTRHDD  345

Query  1105  --------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK----R  962
                     D   +Q   K++L+++++ N+  +LK +L++ +   + + G +   +    +
Sbjct  346   QHELLVKPDQSDNQNATKQSLITSYRKNIHPSLKEDLNQSSKHSIHTGGGRSPSRSPEDQ  405

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLF  788
             W   WW QF VLL RGLK+RK+E++SGL++ QV+ VAFL+G LWW   +  + DQVGLLF
Sbjct  406   WTTSWWLQFKVLLGRGLKERKHEAYSGLRIFQVMSVAFLSGLLWWHCDTNHIMDQVGLLF  465

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             F S FWGFFPLF AIF FP+++ ML +ERSSGMY+LSS++ ARTVGDLPMELVLPT+FV 
Sbjct  466   FFSIFWGFFPLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVT  525

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             ++YWM GLKP+   F   L  ILL VLV QGLGLA+GA +MD K ATTL SV+ML FLLA
Sbjct  526   VTYWMGGLKPSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLA  585

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
              G+Y++H+P FI+W+KYIS   Y YKLLL  QY   E Y C  G   C V + PAIK +G
Sbjct  586   SGYYIQHIPIFINWLKYISFSHYCYKLLLGVQYSKNELYECGIGK-YCEVMEFPAIKVLG  644

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVAL  167
             +  +++  VVAL++ML+ YRLLAYVAL
Sbjct  645   I-DNLVLDVVALVVMLVVYRLLAYVAL  670



>ref|XP_006437762.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
 gb|ESR51002.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
Length=691

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/654 (54%), Positives = 461/654 (70%), Gaps = 27/654 (4%)
 Frame = -3

Query  2065  QEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQK  1886
             Q +      +   D +  + Q+Q  P +      +I +++  PVTLKFE+V Y +     
Sbjct  38    QPSVSANNVSPCSDDDGISVQIQEPPLV---IRFSILRESLHPVTLKFEDVAYSINLHTS  94

Query  1885  QGLSFLKTKKQKSEAEKII--LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
             +G  F  +  + ++  + +  L GV+G+V PGE+LAMLGPSGSGKTTLLTAL GRL G  
Sbjct  95    KGSCFATSHDEPNKQTRTVSVLNGVSGVVKPGELLAMLGPSGSGKTTLLTALAGRLRGKF  154

Query  1711  agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQAD  1532
             +G ITYNG+ FS+++KR TGFVTQDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+
Sbjct  155   SGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAALLRLPKKLTREEKIEQAE  214

Query  1531  AVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ  1352
              VI +LGLT+C+NS++GG   RGISGGERKRVSIGQEML+NPS L LDEPTSGLDSTTAQ
Sbjct  215   MVIMELGLTRCRNSVVGGPLFRGISGGERKRVSIGQEMLVNPSCLLLDEPTSGLDSTTAQ  274

Query  1351  RIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF  1172
             RIV+TL  L++GGRT++ TIHQPSSRL+ +F KV++L EG+P+Y G+ + VM YF ++G+
Sbjct  275   RIVATLRGLARGGRTVITTIHQPSSRLYRMFDKVVVLSEGSPIYSGRAAQVMDYFGSIGY  334

Query  1171  SPSVA-MNPSDFLLDLANGITGD-------------DSQADQATVKETLVSAFKTNLLEN  1034
              P    +NP+DFLLDLANGI  D             +   DQ   K++L+S++K NL   
Sbjct  335   VPGFNLLNPADFLLDLANGIAPDVKQDDQLEFHGRLEHHDDQNATKQSLISSYKKNLHPA  394

Query  1033  LKMELHELNDEDVSSAGDQKQF--KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVL  860
             L  E+ +   + ++S    ++     W   WWEQF VLLKRGL++RK+ES+S L++ QVL
Sbjct  395   LMAEIQQNVGDPIASGKSSRKNCDNEWTASWWEQFKVLLKRGLQERKHESYSYLRIFQVL  454

Query  859   VVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
              V+ L+G LWW S  + +QDQVGLLFF S FWGFFPL  AIF FP+++ ML KERSSGMY
Sbjct  455   SVSILSGLLWWHSDRSHIQDQVGLLFFFSIFWGFFPLNNAIFVFPQERAMLIKERSSGMY  514

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
             +LSS++ AR VGDLPMELVLPT+F+ ++YWM GLKP+   F   LS IL  VLV Q LGL
Sbjct  515   RLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLKPSLITFLLTLSIILFNVLVAQSLGL  574

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
              +GA IMD K AT L SV ML FL+AGG+Y++H+  FI+W+KYIS   Y YKLL+  QY 
Sbjct  575   LLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMSPFIAWLKYISFSHYCYKLLVGVQYS  634

Query  325   PGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
               E Y C  GSG+ C V + PAIK +G+   +I  V AL +ML+GYRLLAYV L
Sbjct  635   ANEVYAC--GSGLHCSVMEFPAIKYLGVDNKLI-DVAALTMMLVGYRLLAYVTL  685



>ref|XP_011013139.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
 ref|XP_011015812.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/645 (56%), Positives = 461/645 (71%), Gaps = 31/645 (5%)
 Frame = -3

Query  2017  APTTQLQANPQLESDTSAAIFKKANR---------PVTLKFENVVYKVKPDQKQGLSFLK  1865
             AP   L+   ++ +    A   +AN          P TLKFE VVYKVK DQK GL +  
Sbjct  15    APVEGLRKMSEINNRAVVAYPGQANSQSVHQLTIYPTTLKFEEVVYKVKQDQK-GLCWGG  73

Query  1864  TKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGK  1685
             T   +   EK IL  VTG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+
Sbjct  74    TWTTR---EKTILNEVTGMVCPGEILAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQ  130

Query  1684  PFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLT  1505
             PFS AMKR TGFV QDDILYPHLTVTETL+FTALLRLP+TLT+ EK +  + V+ +LGL+
Sbjct  131   PFSGAMKRRTGFVAQDDILYPHLTVTETLLFTALLRLPKTLTRDEKAQHVERVMAELGLS  190

Query  1504  KCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWEL  1325
             +C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L
Sbjct  191   RCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRL  250

Query  1324  SKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPS  1145
             + GGRT+V TIHQPSSRL+++F KV+LL EG+P+Y+G  S  + YFS++GFS S+ +NP+
Sbjct  251   ASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGHPIYYGPASAALEYFSSIGFSTSMTVNPA  310

Query  1144  DFLLDLANGI---------TGDDSQADQATVKETLVSAFKTNLLENLKMEL-----HELN  1007
             D LLDLANGI          G++ + +Q  VKE L+SA++  +   LK EL     +  N
Sbjct  311   DLLLDLANGIGPDSKNATDQGENMEQEQKLVKEALISAYEKKISTRLKAELCNSDPNNYN  370

Query  1006  DEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW  827
                 +SA  + + ++W   WW QF VL +RGL++R+YESF+ L++ QVL V+ L G LWW
Sbjct  371   YTKDASAKTETKSEQWCTSWWYQFKVLFQRGLRERRYESFNRLRIFQVLSVSILGGLLWW  430

Query  826   K--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTV  653
                ++ ++D++ LLFF S FWGF+PL+ A+FTFP+++ ML KER+SGMY LSS+FLART 
Sbjct  431   HTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTC  490

Query  652   GDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKS  473
             GDLP+EL LPT FV I YWM GLK     F  +L  +L  VLV Q LGLAIGA +MD K 
Sbjct  491   GDLPLELALPTAFVFIIYWMGGLKADPITFILSLLVVLYSVLVSQSLGLAIGALLMDIKQ  550

Query  472   ATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGS  293
             ATTL SV  L FL+AGG+YV+H+P FI W+KY+S   Y+YKLLL  QY   + Y C+ G 
Sbjct  551   ATTLASVTTLVFLIAGGYYVQHIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGV  610

Query  292   GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              +C V D P++K +GL  H+   V  + LML+GYRL+AY+AL RV
Sbjct  611   -LCRVGDFPSVKSMGL-NHLWVDVAIMALMLVGYRLVAYLALHRV  653



>ref|XP_002304113.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
 gb|EEE79092.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
Length=656

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/610 (59%), Positives = 450/610 (74%), Gaps = 22/610 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P TLKFE VVYKVK DQK GL +  T   +   EK IL  +TG+V PGE+LAMLGPSGSG
Sbjct  50    PTTLKFEEVVYKVKQDQK-GLCWGGTWTTR---EKTILNEITGMVCPGEILAMLGPSGSG  105

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRL G L+G ITYNG+PFS AMKR TGFV QDDILYPHLTVTETL+FTALL
Sbjct  106   KTTLLTALGGRLTGKLSGKITYNGQPFSGAMKRRTGFVAQDDILYPHLTVTETLLFTALL  165

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP+TLT+ EK +    VIT+LGL++C+NS+IGG   RGISGGE+KRVSIGQEMLINPSL
Sbjct  166   RLPKTLTRDEKAQHVQRVITELGLSRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSL  225

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+LL EG+P+Y
Sbjct  226   LLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGHPIY  285

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDSQADQATVKETL  1067
             +G  S  + YFS++GFS S+ +NP+D LLDLANGI          G++ + +Q  VKE L
Sbjct  286   YGPASAALEYFSSIGFSTSMTVNPADLLLDLANGIGPDSKNATDQGENMEQEQKLVKEAL  345

Query  1066  VSAFKTNLLENLKMEL-----HELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQR  902
             +SA++ N+   LK EL     +  N    +SA  + + ++W   WW QF VL +RGL++R
Sbjct  346   ISAYEKNISTRLKAELCNSDPNNYNYTKDASAKTETKSEQWCTSWWYQFKVLFQRGLRER  405

Query  901   KYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
             +YESF+ L++ QVL V+ L G LWW   ++ ++D++ LLFF S FWGF+PL+ A+FTFP+
Sbjct  406   RYESFNRLRIFQVLSVSVLGGLLWWHTPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQ  465

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KER+SGMY LSS+FLART GDLP+EL LPT FV I YWM GLK     F  +L 
Sbjct  466   ERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADPITFILSLL  525

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
              +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S 
Sbjct  526   VVLYSVLVSQSLGLAIGALLMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSY  585

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               Y+YKLLL  QY   + Y C+ G  +C V D P++K +GL  H+   V  + LML+GYR
Sbjct  586   SYYSYKLLLGVQYNEDDYYECSKGV-LCRVGDFPSVKSMGL-NHLWVDVAIMALMLVGYR  643

Query  187   LLAYVALMRV  158
             L+AY+AL RV
Sbjct  644   LVAYLALHRV  653



>ref|XP_008347334.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Malus domestica]
Length=771

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/681 (52%), Positives = 462/681 (68%), Gaps = 58/681 (9%)
 Frame = -3

Query  2074  SDQQEATLMETATEM----GDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVY  1907
             SD   AT +E + EM     +  AP TQ+          S A  +    P+TLKFE V Y
Sbjct  103   SDSTCATTVEGSPEMPAGNQNKAAPATQVN---------SQAFLQLTLYPITLKFEEVFY  153

Query  1906  KVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta----  1739
             KVK DQK       ++      EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTA    
Sbjct  154   KVKVDQK------GSRDSSRSREKSILSGITGMVXPGEILAMLGPSGSGKTTLLTALGGR  207

Query  1738  -lggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTL  1562
                      ++G I+YNG+ F  A+KR TGFV QDD+LYPHLTVTETLVFTA+LRLP +L
Sbjct  208   LNHQNNSKFMSGKISYNGQSFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTAMLRLPNSL  267

Query  1561  TKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEP  1382
              + EK++  + VI++LGLT+C++S+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEP
Sbjct  268   GRDEKVQHVEHVISELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  327

Query  1381  TSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSD  1202
             TSGLDSTTAQRI++TL  L+ GGRT+V TIHQPSSR++++F K++LL EG+P+Y+G  S 
Sbjct  328   TSGLDSTTAQRILTTLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPIYYGPASA  387

Query  1201  VMSYFSTVGFSPSV-AMNPSDFLLDLANGITGDDSQA-----------DQATVKETLVSA  1058
              + YFS++GFS S+ ++NP+D LLDLANGI  D   A           +Q  V++ L+SA
Sbjct  388   ALDYFSSIGFSTSLPSVNPADLLLDLANGIAPDSKHACEQRENTNTEQEQKMVRKALISA  447

Query  1057  FKTNLLENLKMELH---ELNDED------------VSSAGDQKQF----KRWAIPWWEQF  935
             +  N+   LK EL    E+N+ +            +S +     F    + W   WW QF
Sbjct  448   YDKNIYAKLKDELCAGLEVNNYNNYMKEAASASNSLSISSLALIFLAPEQYWCTSWWHQF  507

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFF  761
              VLL+RGL++R+YE+F+ L++ QV+ VA L G LWW+  ++ ++D++ LLFF S FWGF+
Sbjct  508   KVLLQRGLRERRYEAFNRLRIFQVISVATLGGLLWWRTPTSHIEDRIALLFFFSVFWGFY  567

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PL+ A+FTFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FV+I YWM GLK
Sbjct  568   PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMGGLK  627

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P    F  +L  +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AGG+Y++ +P
Sbjct  628   PDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIP  687

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSV  221
              FI W+KY+S   Y YKLLL  QY   + Y C+ G  +C V D PA+K +G  +H+   V
Sbjct  688   PFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGV-LCRVGDLPAVKSMGGLEHLWLDV  746

Query  220   VALLLMLIGYRLLAYVALMRV  158
               L LML+GYRLLAY+AL RV
Sbjct  747   SILALMLLGYRLLAYLALHRV  767



>emb|CDY51602.1| BnaCnng21050D [Brassica napus]
Length=666

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/617 (57%), Positives = 457/617 (74%), Gaps = 24/617 (4%)
 Frame = -3

Query  1960  IFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAM  1781
             + +++ RP+ LKFE + Y +    + G        Q+ +  + +L GV+GIV PGE+LAM
Sbjct  52    VLRQSLRPIILKFEELTYSIT--SQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGELLAM  109

Query  1780  LGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTET  1601
             LGPSGSGKTTL+TAL GRL G L+GT++YN +PFS+A+KR TGFVTQ+D++YPHLTV ET
Sbjct  110   LGPSGSGKTTLVTALAGRLHGKLSGTVSYNEEPFSSAVKRKTGFVTQEDVIYPHLTVLET  169

Query  1600  LVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQE  1421
             L +TALLRLP+ LT++EKIEQA+ V++ LGLT+C NS+IGG  +RGISGGERKRVSIGQE
Sbjct  170   LTYTALLRLPKELTRKEKIEQAETVVSDLGLTRCCNSVIGGGLVRGISGGERKRVSIGQE  229

Query  1420  MLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLL  1241
             ML+NPSLL LDEPTSGLDSTTA RIVSTL  L++GGRT+V TIHQPSSRL+ +F KVL+L
Sbjct  230   MLVNPSLLLLDEPTSGLDSTTAARIVSTLRTLARGGRTVVTTIHQPSSRLYRMFDKVLVL  289

Query  1240  CEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-------  1085
              EG+P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT D  Q DQ        
Sbjct  290   SEGSPIYSGDSGRVMEYFGSIGFQPGSNFVNPADFVLDLANGITSDTKQYDQVDINGRLD  349

Query  1084  ------TVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQ--FKRWAIPWWEQFSV  929
                   +VK++L+S++K +L   LK E+     +D +  G + +    RW   WW QFSV
Sbjct  350   RLEEQNSVKQSLISSYKKHLYPPLKEEVSRTYPQDQTVNGSRAKSLTNRWPTSWWMQFSV  409

Query  928   LLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPL  755
             LLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGFFPL
Sbjct  410   LLKRGLKERSHESFSGLRIFMVMSVSILSGLLWWHSRVAHIQDQVGLLFFFSIFWGFFPL  469

Query  754   FQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPT  575
             F AIFTFP+++ ML KERSSG+Y+LSS+++AR VGDLPMEL+LPT+FV I+YWM GLKP+
Sbjct  470   FNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLKPS  529

Query  574   AGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSF  395
                F   L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+P F
Sbjct  530   LSTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGF  589

Query  394   ISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVV  218
             I+W+KYIS   Y YKLL+E QY   E Y C  G G+ C V D+  IK + +G ++++ V+
Sbjct  590   IAWLKYISFSHYCYKLLVEVQYTWDEVYEC--GPGLHCSVMDYEGIKNLRIG-NMMWDVL  646

Query  217   ALLLMLIGYRLLAYVAL  167
             AL LML  YR+LAY+AL
Sbjct  647   ALALMLFLYRVLAYLAL  663



>gb|KDO70136.1| hypothetical protein CISIN_1g005545mg [Citrus sinensis]
Length=691

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/654 (54%), Positives = 461/654 (70%), Gaps = 27/654 (4%)
 Frame = -3

Query  2065  QEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQK  1886
             Q +      +   D +  + Q+Q  P +      +I +++  PVTLKFE+V Y +     
Sbjct  38    QPSVSANNVSPCSDDDGISVQIQEPPLV---IRFSILRESLHPVTLKFEDVAYSINLHTS  94

Query  1885  QGLSFLKTKKQKSEAEKII--LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
             +G  F  +  + ++  + +  L GV+G+V PGE+LAMLGPSGSGKTTLLTAL GRL G  
Sbjct  95    KGSCFATSHGEPNKQTRTVSVLNGVSGMVKPGELLAMLGPSGSGKTTLLTALAGRLRGKF  154

Query  1711  agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQAD  1532
             +G ITYNG+ FS+++KR TGFVTQDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+
Sbjct  155   SGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAALLRLPKKLTREEKIEQAE  214

Query  1531  AVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ  1352
              VI +LGLT+C+NS++GG   RGISGGERKRVSIGQEML+NPS L LDEPTSGLDSTTAQ
Sbjct  215   MVIMELGLTRCRNSVVGGPLFRGISGGERKRVSIGQEMLVNPSCLLLDEPTSGLDSTTAQ  274

Query  1351  RIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF  1172
             RIV+TL  L++GGRT++ TIHQPSSRL+ +F KV++L EG+P+Y G+ + VM YF ++G+
Sbjct  275   RIVATLRGLARGGRTVITTIHQPSSRLYRMFDKVVVLSEGSPIYSGRAAQVMDYFGSIGY  334

Query  1171  SPSVA-MNPSDFLLDLANGITGD-------------DSQADQATVKETLVSAFKTNLLEN  1034
              P    +NP+DFLLDLANGI  D             +   DQ   K++L+S++K NL   
Sbjct  335   VPGFNLLNPADFLLDLANGIAPDVKQDDQLEFHGRLEHHDDQNATKQSLISSYKKNLHPA  394

Query  1033  LKMELHELNDEDVSSAGDQKQF--KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVL  860
             L  E+ +   + ++S    ++     W   WWEQF VLLKRGL++RK+ES+S L++ QVL
Sbjct  395   LMAEIQQNVGDPIASGKSSRKNCDNEWTASWWEQFKVLLKRGLQERKHESYSYLRIFQVL  454

Query  859   VVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
              V+ L+G LWW S  + +QDQVGLLFF S FWGFFPL  AIF FP+++ ML KERSSGMY
Sbjct  455   SVSILSGLLWWHSDRSHIQDQVGLLFFFSIFWGFFPLNNAIFVFPQERAMLIKERSSGMY  514

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
             +LSS++ AR VGDLPMELVLPT+F+ ++YWM GLKP+   F   LS IL  VLV Q LGL
Sbjct  515   RLSSYYFARMVGDLPMELVLPTIFITVAYWMGGLKPSLITFLLTLSIILFNVLVAQSLGL  574

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
              +GA IMD K AT L SV ML FL+AGG+Y++H+  FI+W+KYIS   Y YKLL+  QY 
Sbjct  575   LLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMSPFIAWLKYISFSHYCYKLLVGVQYS  634

Query  325   PGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
               E Y C  GSG+ C V + PAIK +G+   +I  V AL +ML+GYRLLAYV L
Sbjct  635   ANEVYAC--GSGLHCSVMEFPAIKYLGVDNKLI-DVAALTMMLVGYRLLAYVTL  685



>ref|XP_008243143.1| PREDICTED: ABC transporter G family member 21 [Prunus mume]
Length=683

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/679 (56%), Positives = 480/679 (71%), Gaps = 54/679 (8%)
 Frame = -3

Query  2107  AIHCPESFPSSSDQQEATLMETATEMGD---IEAPTTQLQANPQLESDTSAAIFKKANRP  1937
             ++H   S P SS+         +  +GD    + PT+             ++I +++ RP
Sbjct  30    SVHAERSAPPSSN--------VSPCLGDDMPADRPTSH-----------RSSILRRSLRP  70

Query  1936  VTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             VTLKFE+V Y +K    +G  ++ + + K    + IL GV+GIV PGE+LAMLGPSGSGK
Sbjct  71    VTLKFEDVTYSIKLQTTKG-GWVASHEPKQT--RTILNGVSGIVRPGELLAMLGPSGSGK  127

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTLLTAL GRL G ++G ITYNG+ FS++MK NTGFVTQDD+LYPHLTV ETL +TALLR
Sbjct  128   TTLLTALSGRLPGKISGKITYNGQHFSSSMKHNTGFVTQDDVLYPHLTVLETLTYTALLR  187

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLL  1397
             LP+ LTK+EK+EQA+ VI +LGLT+C++SI+GG  LRG+SGGERKRVSIGQEML+NPSLL
Sbjct  188   LPKQLTKEEKMEQAEMVIMELGLTRCRDSIVGGPLLRGVSGGERKRVSIGQEMLVNPSLL  247

Query  1396  FLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYF  1217
              LDEPTSGLDSTTAQRIV+TL +L++GGRT++ TIHQPSSRL+ +F KV++L +G P+Y 
Sbjct  248   LLDEPTSGLDSTTAQRIVATLRQLARGGRTVITTIHQPSSRLYRMFDKVVVLSDGYPIYS  307

Query  1216  GKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------------DSQADQATV  1079
             G    VM YF ++G+      +NP+DFLLDLANG+  D             + Q DQ T 
Sbjct  308   GHAGRVMEYFGSIGYEAGFNFINPADFLLDLANGVGPDAKQDDQLEYNGRLEHQEDQNTT  367

Query  1078  KETLVSAFKTNLLENLKMELHELNDEDV--------SSAGDQKQFKRWAIPWWEQFSVLL  923
             K+ L+S++K NL   LK E+ + + +          SS G  K   +W   WWEQF VLL
Sbjct  368   KQFLISSYKKNLYPVLKAEIQQSHKDTFLAPSRTTPSSRGSGKY--QWTTSWWEQFKVLL  425

Query  922   KRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQ  749
             +RGLK+RK+ESFSGL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF 
Sbjct  426   ERGLKERKHESFSGLRIFQVLSVSLLSGLLWWHSDTSHIQDQVGLLFFFSIFWGFFPLFN  485

Query  748   AIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAG  569
             AIF FP ++ ML KERSSGMY+LSS++ ARTVGDLPMELVLPTVFV +SYWM GLKP+  
Sbjct  486   AIFAFPMERPMLVKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVSYWMGGLKPSFV  545

Query  568   NFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFIS  389
              F   LS +L  VLV QGLGLA+GA +MD K  TTL SV ML FLLAGG+Y++H+PSFI+
Sbjct  546   TFALTLSIVLYNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLAGGYYIQHIPSFIA  605

Query  388   WIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALL  209
             W+KYIS   Y YKLL+  QY   E Y C  G   C V + PAIK +GL   +   V AL 
Sbjct  606   WLKYISFSHYCYKLLVGVQYSANEVYECEMGMH-CSVMNFPAIKYLGL-DSMWSDVAALA  663

Query  208   LMLIGYRLLAYVALMRVGR  152
             +ML+GYR+LAYVAL R+G+
Sbjct  664   VMLVGYRVLAYVAL-RMGQ  681



>ref|XP_003520157.2| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=680

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/618 (58%), Positives = 452/618 (73%), Gaps = 21/618 (3%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             ++ +++ RPVTLKFE+V Y +     K G        QK +  K +L GVTG+V P EV+
Sbjct  66    SVLQQSLRPVTLKFEDVSYSITFGRDKNGC----VSSQKPKHTKTVLNGVTGMVGPREVM  121

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTLLTAL GRL G L+G ITYNG PFS++MKRN GFV+QDD+LYPHLTV 
Sbjct  122   AMLGPSGSGKTTLLTALAGRLAGKLSGAITYNGHPFSSSMKRNIGFVSQDDVLYPHLTVL  181

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG--VFLRGISGGERKRVS  1433
             ETL + A+L+LP++LT+++K+EQA+ +I +LGL++C+NS IGG     RGISGGERKRVS
Sbjct  182   ETLTYAAMLKLPKSLTREDKMEQAEMIIVELGLSRCRNSPIGGGSALFRGISGGERKRVS  241

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEML+NPSLL LDEPTSGLDSTTAQRIV+ L   ++ GRT+V TIHQPSSRL+++F K
Sbjct  242   IGQEMLVNPSLLLLDEPTSGLDSTTAQRIVAMLQSFARAGRTVVTTIHQPSSRLYWMFDK  301

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQ  1097
             V++L +G P++ GK   VM Y  TVGF P+   +NP+DFLLDLANGI  D       D  
Sbjct  302   VVVLSDGYPIFTGKTDRVMDYLETVGFVPAFNFVNPADFLLDLANGIVADVKQEEQIDHH  361

Query  1096  ADQATVKETLVSAFKTNLLENLKMELHELNDED--VSSAGDQKQFKRWAIPWWEQFSVLL  923
              DQA++K+ LVS++K NL   LK E+ + + E   ++S   +    +W   WWEQF VLL
Sbjct  362   EDQASIKQFLVSSYKKNLYPLLKQEIQQNHRELAFLNSGTPRSSENQWTTSWWEQFMVLL  421

Query  922   KRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQ  749
             KRGLK+R++ES+SGL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF 
Sbjct  422   KRGLKERRHESYSGLRIFQVLSVSILSGLLWWHSDPSHIQDQVGLLFFFSIFWGFFPLFN  481

Query  748   AIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAG  569
             AIF FP D+ ML KERSSGMY LSS+++ARTVGDLPMELVLPT+FV ISYWM GLKP+  
Sbjct  482   AIFAFPLDRPMLTKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLKPSLV  541

Query  568   NFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFIS  389
              F   L  +L  VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +P FI+
Sbjct  542   TFVLTLLIMLFNVLVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIPFFIA  601

Query  388   WIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALL  209
             W+KYIS   Y YKLL+  QY   E Y C  G   C V D PAIK +GL   +   V  L 
Sbjct  602   WLKYISFSHYCYKLLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGLDS-LWGDVAVLA  660

Query  208   LMLIGYRLLAYVALMRVG  155
             +M IGYR++AY+AL R+G
Sbjct  661   VMFIGYRVVAYLAL-RMG  677



>ref|XP_009768130.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=674

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/634 (57%), Positives = 469/634 (74%), Gaps = 26/634 (4%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             E P  Q Q+N         ++ +++ RPVTLKFE+V Y +K +  +G  F  T+++++  
Sbjct  46    EVPDHQQQSN-----HAKLSVLRESLRPVTLKFEDVSYTIKLESNKGGCFSSTQQKQT--  98

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
              +++L+GVTGIV PGE+LAMLGPSGSGKTTLLTAL GRL G  +GTITYNG+ FS++MKR
Sbjct  99    -RMLLQGVTGIVKPGEILAMLGPSGSGKTTLLTALSGRLPGKFSGTITYNGQQFSSSMKR  157

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
               GFVTQDD+LYPHLTV ETL + ALLRLP  LT QEKIEQA+ VI +LGLT+CKNS+IG
Sbjct  158   KIGFVTQDDVLYPHLTVLETLTYAALLRLPNKLTNQEKIEQAELVIMELGLTRCKNSMIG  217

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G   RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT++
Sbjct  218   GQLFRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRWLARGGRTVI  277

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLA  1124
              TIHQPSSRLF +F K+++L EG P+Y GK S VM YF+++G++P    MNP+DFLLDLA
Sbjct  278   TTIHQPSSRLFRMFDKIIVLTEGCPIYSGKSSPVMEYFTSIGYAPGFNFMNPADFLLDLA  337

Query  1123  NGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAG  983
             NGIT D             D   +Q+ +K++L+++++ N+  + K +L++        + 
Sbjct  338   NGITPDTRHDDQHELVVKPDQSDNQSAIKQSLITSYRKNIYPSSKEDLNQSYKHSGGRSP  397

Query  982   DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQ  809
              +    +W   WW QF VLL RGLK+RK+E++SGL++ QV+ V+FL+G LWW   +  + 
Sbjct  398   SRSAEDQWTTSWWLQFKVLLGRGLKERKHEAYSGLRIFQVMSVSFLSGLLWWHCDTNHIM  457

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             DQVGLLFF S FWGFFPLF AIF FP+++ ML +ERSSGMY+LSS++ ARTVGDLPMELV
Sbjct  458   DQVGLLFFFSIFWGFFPLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELV  517

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPT+FV ++YWM GLKP+   F   L  ILL VLV QGLGLA+GA +MD K ATTL SV+
Sbjct  518   LPTIFVTVTYWMGGLKPSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVL  577

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDH  269
             ML FLLA G+Y++H+P FI+W+KYIS   Y YKLLL  QY   E Y C  G   C V + 
Sbjct  578   MLVFLLASGYYIQHIPIFINWLKYISFSHYCYKLLLGVQYSRNEVYQCGIGK-YCEVVEF  636

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             PAIK +G+  +++  VVAL++ML+ YRLLAYVAL
Sbjct  637   PAIKVLGI-DNLVLDVVALVVMLVVYRLLAYVAL  669



>emb|CDY48079.1| BnaA06g33490D [Brassica napus]
Length=665

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/666 (54%), Positives = 472/666 (71%), Gaps = 38/666 (6%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAPTTQ-----------LQANPQLESDTSAAIFKKANRPVTLK  1925
             ++QE++  +T      + +P  +               P  +S  S+ +  ++ RP+ LK
Sbjct  4     NEQESSFPKTPGANQSVTSPVQETRFSSPSHVIPCHGGPSHQSRQSS-VLCQSLRPIILK  62

Query  1924  FENVVYKV-KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttl  1748
             FE + Y +  P  K+   F     Q+ +  + +L GV+GIV PGE+LAMLGPSGSGKTTL
Sbjct  63    FEELTYSITSPTGKRSYWF---GSQEPKPNRFVLNGVSGIVKPGELLAMLGPSGSGKTTL  119

Query  1747  ltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPR  1568
             +TAL GRL G L+GT++YNG+PF++A+KR TGFVTQ+D+LYPHLTV ETL +TALLRLP+
Sbjct  120   VTALAGRLHGKLSGTVSYNGEPFTSAVKRKTGFVTQEDVLYPHLTVMETLTYTALLRLPK  179

Query  1567  TLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLD  1388
              LT++EKIEQ + V++ LGL +C NS+IGG  +RGISGGERKRV IGQEML+NPSLL LD
Sbjct  180   ELTRKEKIEQTETVVSDLGLNRCSNSVIGGGLVRGISGGERKRVGIGQEMLVNPSLLLLD  239

Query  1387  EPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKG  1208
             EPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL+L EG+P+Y G  
Sbjct  240   EPTSGLDSTTAARIVATLRTLARGGRTVVTTIHQPSSRLYRMFDKVLVLSEGSPIYSGDS  299

Query  1207  SDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-------------TVKET  1070
               VM YF ++GF P S  +NP+DF+LDLANGIT D  Q DQ              +VK++
Sbjct  300   GRVMEYFGSIGFQPGSSFVNPADFVLDLANGITSDTKQHDQVDINGRLDRLEEQNSVKQS  359

Query  1069  LVSAFKTNLLENLKMELHELNDEDVSSAGDQKQ--FKRWAIPWWEQFSVLLKRGLKQRKY  896
             L+S++K NL   LK E+     +D ++ G + +    RW   WW QFSVLLKRGLK+R +
Sbjct  360   LISSYKNNLYPPLKEEVSRTYPQDQTANGSRAKSLTNRWPTSWWMQFSVLLKRGLKERSH  419

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGFFPLF A+FTFP+++
Sbjct  420   ESFSGLRIFMVMSVSILSGLLWWHSRVAHIQDQVGLLFFFSIFWGFFPLFNAVFTFPQER  479

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSG+Y+LSS+++AR VGDLPMEL+LPT+FV I+YWM GLKP+   F   L  +
Sbjct  480   PMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLKPSLTTFLLTLMIV  539

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             L  VLV QG+GLA+GA +MD K A T  SV+ML FLLAGG+Y++H+P FI+W+KYIS   
Sbjct  540   LYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIPGFIAWLKYISFSH  599

Query  361   YTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRL  185
             Y YKLL+  QY   E Y C  G G+ C V D+  IK + +G ++++ V+AL LML  YR+
Sbjct  600   YCYKLLVGVQYTWDEVYEC--GPGLHCSVMDYEGIKNLRIG-YMMWDVLALALMLFLYRV  656

Query  184   LAYVAL  167
             LAY+AL
Sbjct  657   LAYLAL  662



>emb|CDP00551.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/637 (56%), Positives = 464/637 (73%), Gaps = 30/637 (5%)
 Frame = -3

Query  2008  TQLQANPQLESDTSA---AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAE  1838
             T +  +P  E+ TS    +I +++ RPVTLKFE+V Y +      G  F  +  + + A 
Sbjct  43    TNVNQSPD-ENQTSPVRYSILRQSLRPVTLKFEDVAYTLSLRGTGGGCFSSSHPKPTRA-  100

Query  1837  KIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRN  1658
               IL GV+GIV PGE+LAMLGPSGSGKTTLLTAL GRL G ++GTITYNG PFS++MKR 
Sbjct  101   --ILNGVSGIVRPGELLAMLGPSGSGKTTLLTALAGRLSGKVSGTITYNGLPFSSSMKRK  158

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
             TGFV+QDD+LY HLTV ETL +TA LRLP  L++ EKIEQ + +I +LGL +C+N +IGG
Sbjct  159   TGFVSQDDVLYAHLTVLETLTYTAFLRLPNKLSRNEKIEQVELIIMELGLNRCRNGMIGG  218

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
               LRG+SGGERKRV+IGQEML+NPSLL LDEPTSGLDSTTAQRI++TL  L++GGRT++ 
Sbjct  219   PLLRGVSGGERKRVTIGQEMLVNPSLLLLDEPTSGLDSTTAQRIIATLRWLARGGRTVIT  278

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLAN  1121
             T+HQPSSR++ +F KVL+L EG P+Y G  S VM YF+++G+ P    +NP+DFLLDLAN
Sbjct  279   TLHQPSSRMYTMFDKVLVLSEGYPIYSGSASLVMEYFASIGYMPGFNFVNPADFLLDLAN  338

Query  1120  GIT-------------GDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSS---  989
             G+                D   +++++++ LVS++K  L  +LK E+   + + V+S   
Sbjct  339   GVVLGTRQDDRTEFPGRPDHHDEKSSIRQFLVSSYKKILYPSLKDEMQRRSQDPVNSRGA  398

Query  988   AGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TD  815
              G +    +W   WW QF VLL RGLK+RK+ES+SGL++ QV+ V+ L+G LWW S    
Sbjct  399   TGSKSSENQWTTTWWLQFKVLLSRGLKERKHESYSGLRIFQVMSVSILSGLLWWHSGTIH  458

Query  814   LQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPME  635
             +QDQVGLLFF S FWGFFP+F A+F FP+++ ML +ERSSGMY+LSS++ ARTVGDLPME
Sbjct  459   IQDQVGLLFFFSIFWGFFPMFNAVFAFPQEQPMLTRERSSGMYRLSSYYFARTVGDLPME  518

Query  634   LVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGS  455
             LVLPT+FVI++YWM+GLKP+   F   L  IL  VLV QG GLA+GA +MD K ATTL S
Sbjct  519   LVLPTIFVIVTYWMSGLKPSLVTFVLTLLIILFNVLVSQGFGLALGAILMDLKQATTLSS  578

Query  454   VIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLV  278
             V+ML FLLA G+Y+RH+P FI+W+KYIS   Y+YKLLL  QY   E Y C  G GV C V
Sbjct  579   VMMLVFLLASGYYIRHIPPFIAWLKYISFSHYSYKLLLAVQYSNNELYQC--GVGVHCRV  636

Query  277   EDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
              D+PAIK +G+ +++   V AL +MLIGYRLLAY+AL
Sbjct  637   MDNPAIKFLGI-ENLGMDVAALAVMLIGYRLLAYIAL  672



>ref|XP_009152126.1| PREDICTED: ABC transporter G family member 21 [Brassica rapa]
Length=666

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/619 (57%), Positives = 456/619 (74%), Gaps = 24/619 (4%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             +++ +++ RP+ LKFE + Y +    + G        Q+ +  + +L GV+GIV PGE+L
Sbjct  50    SSVLRQSLRPIILKFEELTYSIT--SQTGKRSYWFGSQEPKPNRFVLNGVSGIVKPGELL  107

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTL+TAL GRL G L+GT++YNG+PF++A+KR TGFVTQ+D+LYPHLTV 
Sbjct  108   AMLGPSGSGKTTLVTALAGRLHGKLSGTVSYNGEPFTSAVKRKTGFVTQEDVLYPHLTVM  167

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LT++EKIEQ + V++ LGL +C NS+IGG  +RGISGGERKRV IG
Sbjct  168   ETLTYTALLRLPKELTRKEKIEQTETVVSDLGLNRCSNSVIGGGLVRGISGGERKRVGIG  227

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL
Sbjct  228   QEMLVNPSLLLLDEPTSGLDSTTAARIVATLRTLARGGRTVVTTIHQPSSRLYRMFDKVL  287

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQADQA-----  1085
             +L EG+P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT D  Q DQ      
Sbjct  288   VLSEGSPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANGITSDTKQHDQVDINGR  347

Query  1084  --------TVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQ--FKRWAIPWWEQF  935
                     +VK++L+S++K NL   LK E+     +D ++ G + +    RW   WW QF
Sbjct  348   LDRLEEQNSVKQSLISSYKNNLYPPLKEEVSRTYPQDQTANGSRAKSLTNRWPTSWWMQF  407

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFF  761
             SVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QDQVGLLFF S FWGFF
Sbjct  408   SVLLKRGLKERSHESFSGLRIFMVMSVSILSGLLWWHSRVAHIQDQVGLLFFFSIFWGFF  467

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PLF AIFTFP+++ ML KERSSG+Y+LSS+++AR VGDLPMEL+LPT+FV I+YWM GLK
Sbjct  468   PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  527

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P+   F   L  +L  VLV QG+GLA+GA +MD K A T  SV+ML FLLAGG+Y++H+P
Sbjct  528   PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIP  587

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFS  224
              FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C V D+  IK + +G ++++ 
Sbjct  588   GFIAWLKYISFSHYCYKLLVGVQYTWDEVYEC--GPGLHCSVMDYEGIKNLRIG-YMMWD  644

Query  223   VVALLLMLIGYRLLAYVAL  167
             V+AL LML  YR+LAY+AL
Sbjct  645   VLALALMLFLYRVLAYLAL  663



>ref|NP_001189973.1| ABC transporter G family member 21 [Arabidopsis thaliana]
 sp|Q7XA72.2|AB21G_ARATH RecName: Full=ABC transporter G family member 21; Short=ABC transporter 
ABCG.21; Short=AtABCG21; AltName: Full=White-brown 
complex homolog protein 21; Short=AtWBC21 [Arabidopsis thaliana]
 dbj|BAB03081.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE77044.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=672

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/670 (54%), Positives = 484/670 (72%), Gaps = 40/670 (6%)
 Frame = -3

Query  2071  DQQEATLMETATEMGDIEAP------TTQLQANPQLESDTS----------AAIFKKANR  1940
             ++QE++  +T +      +P      ++    NP L+ D            +++ +++ R
Sbjct  5     NEQESSFPKTPSANRHETSPVQENRFSSPSHVNPCLDDDNDHDGPSHQSRQSSVLRQSLR  64

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+ LKFE + Y +K    +G  +  +  Q+ +  +++LK V+GIV PGE+LAMLGPSGSG
Sbjct  65    PIILKFEELTYSIKSQTGKGSYWFGS--QEPKPNRLVLKCVSGIVKPGELLAMLGPSGSG  122

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTL+TAL GRL G L+GT++YNG+PF++++KR TGFVTQDD+LYPHLTV ETL +TALL
Sbjct  123   KTTLVTALAGRLQGKLSGTVSYNGEPFTSSVKRKTGFVTQDDVLYPHLTVMETLTYTALL  182

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP+ LT++EK+EQ + V++ LGLT+C NS+IGG  +RGISGGERKRVSIGQEML+NPSL
Sbjct  183   RLPKELTRKEKLEQVEMVVSDLGLTRCCNSVIGGGLIRGISGGERKRVSIGQEMLVNPSL  242

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIHQPSSRL+ +F KVL+L EG P+Y
Sbjct  243   LLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIHQPSSRLYRMFDKVLVLSEGCPIY  302

Query  1219  FGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGITGDDSQAD-------------QAT  1082
              G    VM YF ++G+ P S  +NP+DF+LDLANGIT D  Q D             Q +
Sbjct  303   SGDSGRVMEYFGSIGYQPGSSFVNPADFVLDLANGITSDTKQYDQIETNGRLDRLEEQNS  362

Query  1081  VKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQF--KRWAIPWWEQFSVLLKRGLK  908
             VK++L+S++K NL   LK E+     +D ++A  +K+    RW   WW QFSVLLKRGLK
Sbjct  363   VKQSLISSYKKNLYPPLKEEVSRTFPQDQTNARLRKKAITNRWPTSWWMQFSVLLKRGLK  422

Query  907   QRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTF  734
             +R +ESFSGL++  V+ V+ L+G LWW S    LQDQVGLLFF S FWGFFPLF AIFTF
Sbjct  423   ERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHLQDQVGLLFFFSIFWGFFPLFNAIFTF  482

Query  733   PEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSA  554
             P+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+LPT+FV I+YWM GLKP+   F   
Sbjct  483   PQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFIMT  542

Query  553   LSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYI  374
             L  +L  VLV QG+GLA+GA +MD K A TL SV+ML FLLAGG+Y++H+P FI+W+KY+
Sbjct  543   LMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGFIAWLKYV  602

Query  373   SIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLI  197
             S   Y YKLL+  QY   E Y C  GSG+ C V D+  IK + +G ++++ V+AL +ML+
Sbjct  603   SFSHYCYKLLVGVQYTWDEVYEC--GSGLHCSVMDYEGIKNLRIG-NMMWDVLALAVMLL  659

Query  196   GYRLLAYVAL  167
              YR+LAY+AL
Sbjct  660   LYRVLAYLAL  669



>ref|XP_008339724.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/634 (57%), Positives = 453/634 (71%), Gaps = 28/634 (4%)
 Frame = -3

Query  1990  PQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTG  1811
             PQ  S   A+I +++ RPVTLKFE+V Y +K    +G         ++   + +L GV+G
Sbjct  55    PQPTSH-RASILRQSLRPVTLKFEDVGYSIKLQTPKGGC---VXSHEATPTRTVLNGVSG  110

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDI  1631
             IV PGE+LAMLGPSGSGKTTLLTALGGRL   ++G ITYNG+ FS++MK NTGFVTQDD+
Sbjct  111   IVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNFSSSMKHNTGFVTQDDV  170

Query  1630  LYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGG  1451
             LYPHLTV ETL +TALLRLP+ LTK+EKIEQA+ VI +LGL +C++SIIGG  LRG+SGG
Sbjct  171   LYPHLTVLETLTYTALLRLPKQLTKEEKIEQAETVIMELGLNRCRDSIIGGPLLRGVSGG  230

Query  1450  ERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRL  1271
             ERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI+ TL  L++GGRT++ TIHQPSSRL
Sbjct  231   ERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIIVTLRRLARGGRTVITTIHQPSSRL  290

Query  1270  FYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD----  1106
             + +F KV++L +G P+Y G    VM YF ++G+      +NP+DF+LDLANGI  D    
Sbjct  291   YRMFDKVVVLSDGCPIYSGHAGRVMDYFGSIGYEAGFNFINPADFMLDLANGIPPDAKQD  350

Query  1105  ---------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK----  965
                      D Q +Q T K+ L+S++K NL   LK+E+ +   + V S+      +    
Sbjct  351   EQVEYSGRLDHQEEQNTTKQFLISSYKMNLYPALKIEIQQTQKDTVVSSSRTPSSRGRVN  410

Query  964   -RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGL  794
              +W   WWE+F VLL+RGLK+RK+ESFSGLK+ QV  V+ L+G LWW S  + +QDQVGL
Sbjct  411   YQWTTSWWEEFRVLLERGLKERKHESFSGLKIFQVXSVSILSGLLWWHSDISHIQDQVGL  470

Query  793   LFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVF  614
             LFF S FWGFFPL  AIF+FP ++ ML KERSSGMY+LSS++ ARTVGDLPMELVLPTVF
Sbjct  471   LFFFSIFWGFFPLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVF  530

Query  613   VIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFL  434
             + ISYWM GLKP+   F   L  +L  VLV QGLGLA+GA +M+ K  TTL SV ML FL
Sbjct  531   ITISYWMGGLKPSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFL  590

Query  433   LAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKK  254
             L GG+Y++H+P FI+W+KY S   Y YKLL+  QY   E Y C  G   C V D P I  
Sbjct  591   LVGGYYIQHIPPFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMH-CRVIDFPGIXC  649

Query  253   IGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             +GL  ++   V AL +M +GYR LAYVAL R+G+
Sbjct  650   VGL-DNMWIDVAALAVMXVGYRFLAYVAL-RMGQ  681



>ref|XP_008361741.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/634 (57%), Positives = 453/634 (71%), Gaps = 28/634 (4%)
 Frame = -3

Query  1990  PQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTG  1811
             PQ  S   A+I +++ RPVTLKFE+V Y +K    +G         ++   + +L GV+G
Sbjct  55    PQPTSH-RASILRQSLRPVTLKFEDVGYSIKLQTPKGGC---VXSHEATPTRTVLNGVSG  110

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDI  1631
             IV PGE+LAMLGPSGSGKTTLLTALGGRL   ++G ITYNG+ FS++MK NTGFVTQDD+
Sbjct  111   IVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNFSSSMKHNTGFVTQDDV  170

Query  1630  LYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGG  1451
             LYPHLTV ETL +TALLRLP+ LTK+EKIEQA+ VI +LGL +C++SIIGG  LRG+SGG
Sbjct  171   LYPHLTVLETLTYTALLRLPKQLTKEEKIEQAETVIMELGLNRCRDSIIGGPLLRGVSGG  230

Query  1450  ERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRL  1271
             ERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI+ TL  L++GGRT++ TIHQPSSRL
Sbjct  231   ERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIIVTLRXLARGGRTVITTIHQPSSRL  290

Query  1270  FYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD----  1106
             + +F KV++L +G P+Y G    VM YF ++G+      +NP+DF+LDLANGI  D    
Sbjct  291   YRMFDKVVVLSDGCPIYSGHAGRVMDYFGSIGYEAGFNFINPADFMLDLANGIPPDAKQD  350

Query  1105  ---------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK----  965
                      D Q +Q T K+ L+S++K NL   LK+E+ +   + V S+      +    
Sbjct  351   EQVEYSGRLDHQEEQNTTKQFLISSYKMNLYPALKIEIQQTQKDTVVSSSRTPSSRGRVN  410

Query  964   -RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGL  794
              +W   WWE+F VLL+RGLK+RK+ESFSGLK+ QV  V+ L+G LWW S  + +QDQVGL
Sbjct  411   YQWTTSWWEEFRVLLERGLKERKHESFSGLKIFQVXSVSILSGLLWWHSDISHIQDQVGL  470

Query  793   LFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVF  614
             LFF S FWGFFPL  AIF+FP ++ ML KERSSGMY+LSS++ ARTVGDLPMELVLPTVF
Sbjct  471   LFFFSIFWGFFPLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVF  530

Query  613   VIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFL  434
             + ISYWM GLKP+   F   L  +L  VLV QGLGLA+GA +M+ K  TTL SV ML FL
Sbjct  531   ITISYWMGGLKPSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFL  590

Query  433   LAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKK  254
             L GG+Y++H+P FI+W+KY S   Y YKLL+  QY   E Y C  G   C V D P I  
Sbjct  591   LVGGYYIQHIPPFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMH-CRVIDFPGIXC  649

Query  253   IGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             +GL  ++   V AL +M +GYR LAYVAL R+G+
Sbjct  650   VGL-DNMWIDVAALAVMXVGYRFLAYVAL-RMGQ  681



>ref|XP_006484387.1| PREDICTED: ABC transporter G family member 21-like [Citrus sinensis]
Length=691

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/654 (54%), Positives = 460/654 (70%), Gaps = 27/654 (4%)
 Frame = -3

Query  2065  QEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQK  1886
             Q +      +   D +  + Q+Q  P +      +I +++  PV L+FE+V Y +     
Sbjct  38    QPSVSANNVSPCSDDDGISVQIQEPPLV---IRFSILRESLHPVMLQFEDVAYSINLHTS  94

Query  1885  QGLSFLKTKKQKSEAEKII--LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
             +G  F  +  + ++  + +  L GV+G+V PGE+LAMLGPSGSGKTTLLTAL GRL G  
Sbjct  95    KGSCFAASHDEPNKQTRTVSVLNGVSGMVKPGELLAMLGPSGSGKTTLLTALAGRLRGKF  154

Query  1711  agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQAD  1532
             +G ITYNG+ FS+++KR TGFVTQDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+
Sbjct  155   SGKITYNGRQFSSSLKRKTGFVTQDDVLYPHLTVLETLSYAALLRLPKKLTREEKIEQAE  214

Query  1531  AVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQ  1352
              VI +LGLT+C+NS++GG   RGISGGERKRVSIGQEML+NPS L LDEPTSGLDSTTAQ
Sbjct  215   MVIMELGLTRCRNSVVGGPLFRGISGGERKRVSIGQEMLVNPSCLLLDEPTSGLDSTTAQ  274

Query  1351  RIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF  1172
             RIV+TL  L++GGRT++ TIHQPSSRL+ +F KV++L EG+P+Y G+ + VM YF ++G+
Sbjct  275   RIVATLRGLARGGRTVITTIHQPSSRLYRMFDKVVVLSEGSPIYSGRAAQVMDYFGSIGY  334

Query  1171  SPSVA-MNPSDFLLDLANGITGD-------------DSQADQATVKETLVSAFKTNLLEN  1034
              P    +NP+DFLLDLANGI  D             +   DQ   K++L+S++K NL   
Sbjct  335   VPGFNLLNPADFLLDLANGIAPDVKQDDQLEFHGRLEHHDDQNATKQSLISSYKKNLHPA  394

Query  1033  LKMELHELNDEDVSSAGDQKQF--KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVL  860
             L  E+ +   + ++S    ++     W   WWEQF VLLKRGL++RK+ES+S L++ QVL
Sbjct  395   LMAEIQQNVGDPIASGKSSRKNCDNEWTASWWEQFKVLLKRGLQERKHESYSYLRIFQVL  454

Query  859   VVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
              V+ L+G LWW S  + +QDQVGLLFF S FWGFFPL  AIF FP+++ ML KERSSGMY
Sbjct  455   SVSILSGLLWWHSDRSHIQDQVGLLFFFSIFWGFFPLNNAIFVFPQERAMLIKERSSGMY  514

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
             +LSS++ AR VGDLPMELVLPT+F+ ++YWM GLKP+   F   LS IL  VLV Q LGL
Sbjct  515   RLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLKPSLITFLLTLSIILFNVLVAQSLGL  574

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
              +GA IMD K AT L SV ML FL+AGG+Y++H+  FI+W+KYIS   Y YKLL+  QY 
Sbjct  575   LLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMSPFIAWLKYISFSHYCYKLLVGVQYS  634

Query  325   PGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
               E Y C  GSG+ C V + PAIK +G+   +I  V AL +ML+GYRLLAYV L
Sbjct  635   ANEVYAC--GSGLHCSVMEFPAIKYLGVDNKLI-DVAALTMMLVGYRLLAYVTL  685



>gb|KGN61520.1| hypothetical protein Csa_2G153580 [Cucumis sativus]
Length=673

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/644 (55%), Positives = 461/644 (72%), Gaps = 25/644 (4%)
 Frame = -3

Query  2023  IEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQKS  1847
             I  P   L  +    +  + +I +++   +TLKFEN+ Y +K    K+G   L+  + +S
Sbjct  24    ISHPRPDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQS  83

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
                + IL GV+G+V PGE+LAMLG SGSGKTTLLTAL  RL G ++GTITYN KPFS+++
Sbjct  84    NTTRTILNGVSGLVRPGELLAMLGTSGSGKTTLLTALAARLPGKISGTITYNDKPFSSSI  143

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
             KR  GFV+QDD+LYPHL+V ETL + A+LRLP  LT +EK+ Q + +I +LGLT+C+NS+
Sbjct  144   KRKIGFVSQDDVLYPHLSVLETLTYAAMLRLPNKLTYEEKVAQTEMIIEELGLTRCRNSV  203

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG  LRGISGGERKRVSIG EM++NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT
Sbjct  204   IGGGILRGISGGERKRVSIGHEMIVNPSLLLLDEPTSGLDSTTAQRIVATLRGLARGGRT  263

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM-NPSDFLLD  1130
             +VMTIHQPS+RL+ +F KV++L +G+P+Y G    VM YF ++G+ P   + NP+DFLLD
Sbjct  264   LVMTIHQPSTRLYRMFDKVVVLSDGSPIYSGDAVRVMPYFESIGYLPPFNLINPADFLLD  323

Query  1129  LANGITGD----------------DSQADQATVKETLVSAFKTNLLENLKME-LHELNDE  1001
             LANGI  D                D Q DQ ++K++LV++F+ NL   +K + L E N  
Sbjct  324   LANGIAPDSIREDQVEHFHGGLLLDRQDDQNSIKQSLVASFRKNLYPQIKAQILTETNIS  383

Query  1000  DVSSAGDQKQFKR--WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW  827
              V+ +   K  K   W   WWEQF +LLKRGL++R++ES+SGL++ QV+ V+FL+G LWW
Sbjct  384   TVARSNSLKGSKNNEWTTSWWEQFKILLKRGLRERRHESYSGLRIFQVMSVSFLSGLLWW  443

Query  826   KS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTV  653
              S  + +QDQVGL+FF S FWGFFPLF AIF FP ++ ML KERSSGMY+LSS+++ART 
Sbjct  444   HSDPSHIQDQVGLIFFFSIFWGFFPLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTA  503

Query  652   GDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKS  473
             GDLPMELVLPTVFV ++YWM GL P+   F   L  +LL VLV QGLGLA+GA +M+ K 
Sbjct  504   GDLPMELVLPTVFVTVTYWMGGLNPSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQ  563

Query  472   ATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP-GETYPCTSG  296
             ATTL SV ML FLL GG+Y+ H+P FISW+KY+S   Y YKL++E+QY    E Y C   
Sbjct  564   ATTLASVTMLVFLLVGGYYIEHIPLFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGS  623

Query  295   SGVCLVEDHPAIKKIGLGQHVI-FSVVALLLMLIGYRLLAYVAL  167
              G C V D PA+K +G+G H + + V AL  ML+GYR+LA++AL
Sbjct  624   FGYCKVGDFPAVKCLGIGNHSLWWDVTALFFMLVGYRILAFLAL  667



>ref|XP_004170842.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=673

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/646 (54%), Positives = 461/646 (71%), Gaps = 29/646 (4%)
 Frame = -3

Query  2023  IEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQKS  1847
             I  P   L  +    +  + +I +++   +TLKFEN+ Y +K    K+G   L+  + +S
Sbjct  24    ISHPRPDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQS  83

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
                + IL GV+G+V PGE+LAMLG SGSGKTTLLTAL  RL G ++GTITYN KPFS+++
Sbjct  84    NTTRTILNGVSGLVRPGELLAMLGTSGSGKTTLLTALAARLPGKISGTITYNDKPFSSSI  143

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
             KR  GFV+QDD+LYPHL+V ETL + A+LRLP  LT +EK+ Q + +I +LGLT+C+NS+
Sbjct  144   KRKIGFVSQDDVLYPHLSVLETLTYAAMLRLPNKLTYEEKVAQTEMIIEELGLTRCRNSV  203

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG  LRGISGGERKRVSIG EM++NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT
Sbjct  204   IGGGILRGISGGERKRVSIGHEMIVNPSLLLLDEPTSGLDSTTAQRIVATLRGLARGGRT  263

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM-NPSDFLLD  1130
             +VMTIHQPS+RL+ +F KV++L +G+P+Y G    VM YF ++G+ P   + NP+DFLLD
Sbjct  264   LVMTIHQPSTRLYRMFDKVVVLSDGSPIYSGDAVRVMPYFESIGYLPPFNLINPADFLLD  323

Query  1129  LANGITGD----------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDED  998
             LANGI  D                D Q DQ ++K++LV++F+ NL   +K ++  L + +
Sbjct  324   LANGIAPDSIREDQVEHFHGGLLLDRQDDQNSIKQSLVASFRKNLYPQIKAQI--LTETN  381

Query  997   VSSAGDQKQFK-----RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGAL  833
             +S+       K      W   WWEQF +LLKRGL++R++ES+SGL++ QV+ V+FL+G L
Sbjct  382   ISTVARSNSLKGSKNNEWTTSWWEQFKILLKRGLRERRHESYSGLRIFQVMSVSFLSGLL  441

Query  832   WWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLAR  659
             WW S  + +QDQVGL+FF S FWGFFPLF AIF FP ++ ML KERSSGMY+LSS+++AR
Sbjct  442   WWHSDPSHIQDQVGLIFFFSIFWGFFPLFNAIFAFPLERPMLNKERSSGMYRLSSYYMAR  501

Query  658   TVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQ  479
             T GDLPMELVLPTVFV ++YWM GL P+   F   L  +LL VLV QGLGLA+GA +M+ 
Sbjct  502   TAGDLPMELVLPTVFVTVTYWMGGLNPSMITFLLTLLIVLLNVLVSQGLGLALGAILMEV  561

Query  478   KSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP-GETYPCT  302
             K ATTL SV ML FLL GG+Y+ H+P FISW+KY+S   Y YKL++E+QY    E Y C 
Sbjct  562   KQATTLASVTMLVFLLVGGYYIEHIPLFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCG  621

Query  301   SGSGVCLVEDHPAIKKIGLGQHVI-FSVVALLLMLIGYRLLAYVAL  167
                G C V D PA+K +G+G H + + V AL  ML+GYR+LA++AL
Sbjct  622   GSFGYCKVGDFPAVKCLGIGNHSLWWDVTALXFMLVGYRILAFLAL  667



>ref|XP_010251517.1| PREDICTED: ABC transporter G family member 14-like [Nelumbo nucifera]
Length=650

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/621 (58%), Positives = 452/621 (73%), Gaps = 25/621 (4%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLA  1784
             ++ + A  P+TLKFE VVYKVK ++K G  +  T   K   EK IL G+TG+V PGE+LA
Sbjct  33    SVLQLAVFPITLKFEEVVYKVKLEEK-GFWWGGTWNTK---EKTILNGITGMVCPGEILA  88

Query  1783  MLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTE  1604
             MLGPSGSGKTTLLTALGGRL G L+G ITYNG+PFS A+KR TGFV QDD+LYPHLTVTE
Sbjct  89    MLGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAIKRRTGFVAQDDVLYPHLTVTE  148

Query  1603  TLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQ  1424
             TLVFTALLRLP TLT+ EK++  + VI +LGL +C+NS+IGG   RGISGGE+KRVSIGQ
Sbjct  149   TLVFTALLRLPDTLTRAEKVQHVEHVIAELGLGRCRNSMIGGPLFRGISGGEKKRVSIGQ  208

Query  1423  EMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLL  1244
             EMLI+PSLL LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL+++F KV+L
Sbjct  209   EMLISPSLLLLDEPTSGLDSTTAQRILTTVKRLADGGRTVVTTIHQPSSRLYHMFDKVVL  268

Query  1243  LCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD--------DSQAD-  1091
             LCEG P+Y G  S  + YFS++GFS SV++NP+D LLDLANGI  D        D QA+ 
Sbjct  269   LCEGYPIYHGPASAALDYFSSIGFSTSVSVNPADHLLDLANGIAPDSKHVNEQGDFQANM  328

Query  1090  ---QATVKETLVSAFKTNLLENLKMEL-----HELNDEDVSSAGDQKQFKRWAIPWWEQF  935
                Q +VKE L+SA+  N+   LK EL     +  N    +SA +  +   W   W +QF
Sbjct  329   EQEQKSVKEALISAYDKNIATRLKAELCSTDVNSYNYTRDASARNSTKSDHWGTNWCQQF  388

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFF  761
              +LLKRGLK+R+YESF+ L++ QV+ VA L G LWW +  + LQD++ LLFF S FWGFF
Sbjct  389   LILLKRGLKERRYESFNRLRIFQVISVATLGGLLWWHTPASHLQDRIALLFFFSVFWGFF  448

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PL+ A+FTFP+++ ML KERSSGMY+LSS+FLART GDLPMEL LPT FVII YWM GLK
Sbjct  449   PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVIIIYWMGGLK  508

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P    F  +   +L  VLV Q LGLA GA +MD K A TL SV  L FL+AGG+YV+ +P
Sbjct  509   PDFTAFVLSWLVVLFSVLVSQSLGLAYGAILMDVKQAATLASVTTLVFLIAGGYYVQQIP  568

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSV  221
              FI W+KY+S   Y YKLLL  QY   + Y C+ G   C V D PA+K +GL +++   V
Sbjct  569   PFIVWLKYLSYSFYCYKLLLGIQYTENDYYECSQGM-FCRVVDFPAVKVVGL-KNLWVDV  626

Query  220   VALLLMLIGYRLLAYVALMRV  158
               + +ML+GYRL+AY+AL RV
Sbjct  627   SIMAMMLVGYRLIAYMALRRV  647



>gb|KHN46331.1| ABC transporter G family member 9 [Glycine soja]
Length=610

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/597 (54%), Positives = 448/597 (75%), Gaps = 12/597 (2%)
 Frame = -3

Query  1930  LKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgktt  1751
             L+FE+VV+K+K  + +GL  L   K+ S  E ++LKG++G++FPGE+L +LGPSG GKTT
Sbjct  17    LQFEDVVHKIKISKGKGL--LCYNKEVSSEETLVLKGISGVIFPGELLVILGPSGCGKTT  74

Query  1750  lltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRL  1574
             LL ALGGRL   +   +ITYNGKP S ++K+N GFV+Q D+ YPHL+V+ETL+F+ALLRL
Sbjct  75    LLAALGGRLNHSITRGSITYNGKPLSKSVKQNLGFVSQQDVFYPHLSVSETLIFSALLRL  134

Query  1573  PRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLF  1394
             P +++K+EKI +A A++ +L LT CK++I+GG  LRG+SGGE KRVSIGQ++L NPSLL 
Sbjct  135   PNSVSKEEKILKAQAIMNELDLTHCKDTIMGGPLLRGVSGGEWKRVSIGQQLLTNPSLLL  194

Query  1393  LDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFG  1214
             +DEPTSGLDSTTA+RIV TL EL+K GRT++MTIHQPSS+LFY+F K+LLL +G  LYFG
Sbjct  195   VDEPTSGLDSTTARRIVLTLCELAKDGRTVIMTIHQPSSKLFYMFQKILLLSDGRSLYFG  254

Query  1213  KGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLEN  1034
             KG +VM+YFS++G++PSVAMNP+DFLLDLANGI  ++ + D    K+ L+SAF++NL   
Sbjct  255   KGENVMNYFSSIGYTPSVAMNPTDFLLDLANGIYSENLEEDTNATKQVLLSAFESNLASQ  314

Query  1033  LKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVV  854
             +KMEL +++ + +    + + F +    WW+QF++LL+RG K+RKYE FS  K+  V V+
Sbjct  315   VKMEL-QISRDSIHHNSEDEIFGQHCTTWWQQFTILLRRGFKERKYEQFSPHKICHVFVL  373

Query  853   AFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKL  680
             +F  G+LWW+S    + DQV LLF+ + F GFFP+ Q+IFTFP D+ M+ KERS  MY+L
Sbjct  374   SFFAGSLWWQSGADQMHDQVALLFYYTQFCGFFPMVQSIFTFPRDREMIIKERSFYMYRL  433

Query  679   SSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAI  500
             SS+ +A  + DLP++L LPT+ V ++YWM GLK  A  FF  L+  LL  LV QG GLAI
Sbjct  434   SSYIIASNLDDLPLQLALPTLLVTVTYWMGGLKAKASIFFRTLAVALLYSLVSQGFGLAI  493

Query  499   GAFIM-DQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP  323
             GA ++ +QK A T+G+V+M  FLL  GF+VR+ P+F+SWIKY+S G Y+YKLLL SQ+  
Sbjct  494   GALLINNQKVAITVGTVVMTLFLLVNGFFVRNTPAFVSWIKYLSHGYYSYKLLLGSQFNG  553

Query  322   GETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVG  155
              +TY C  G  V C   ++P IK +G+ +  + SV AL+ ML+GYRL+AY AL R+G
Sbjct  554   YDTYHC--GQNVTCSAVNYPTIKHVGIDKQGL-SVAALVAMLVGYRLIAYFAL-RIG  606



>ref|XP_011071699.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/637 (56%), Positives = 452/637 (71%), Gaps = 25/637 (4%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEA  1841
             EA  T   A P      S +  ++   P+TLKFE +VYKV  ++K G     T   K   
Sbjct  25    EACNTAYLAYPI--QRNSQSFLQRILYPITLKFEEIVYKVNSERK-GTCCGGTSSTK---  78

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+PFS ++KR
Sbjct  79    EKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRLSGRLSGKITYNGQPFSGSIKR  138

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFV QDD+LYPHLTV ETLVFTALLRLP +LTK+EK++  + VIT+LGLT+C+NS+IG
Sbjct  139   RTGFVAQDDVLYPHLTVFETLVFTALLRLPNSLTKEEKVQHVEHVITELGLTRCQNSMIG  198

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDST AQRI+ TL  L+ GGRTI+
Sbjct  199   GPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTAAQRILKTLKGLASGGRTII  258

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLAN  1121
              TIHQPSSRL+Y+F KV+LL EG+P+Y+G  S  + YFS++GFS S+ +NP+D LLDLAN
Sbjct  259   TTIHQPSSRLYYMFDKVVLLSEGSPIYYGLASSALEYFSSIGFSTSLTVNPADLLLDLAN  318

Query  1120  GITGDDSQA---------DQATVKETLVSAFKTNLLENLKMELH-----ELNDEDVSSAG  983
             GI  D   A         D  +V+E L+SA+  N+   LK+EL        N ++ S+  
Sbjct  319   GIGPDFQHATDQSDSSQQDSTSVREFLISAYDKNISTRLKIELCSSDVGSYNYKEASTGN  378

Query  982   DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQ  809
             D K  ++W   WW QF +LL RGL++R++E+F+ L++ QVL VA L G LWW+  S+ + 
Sbjct  379   DVKS-EKWCTTWWHQFKILLLRGLRERRFEAFNRLRIFQVLSVAILGGLLWWRTPSSHID  437

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             D++ +LFF S FWGF+PL+ A+FTFP+++ ML KERSSGMY+LS++FLARTVGDLPMEL 
Sbjct  438   DRIAMLFFFSVFWGFYPLYNAVFTFPQERNMLIKERSSGMYRLSAYFLARTVGDLPMELA  497

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPT F  I YWM GLKP   +F  +L  +L  VLV Q LGLA GA +MD K A TL SV 
Sbjct  498   LPTAFTFIFYWMGGLKPDPSSFVLSLLVVLFSVLVSQSLGLAFGAILMDVKQAATLASVT  557

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDH  269
              L FL+AGG+YVR +P FI W+KY+S   Y YKLLL   Y   + Y C      C V D+
Sbjct  558   TLVFLIAGGYYVRQIPPFIVWLKYLSYSYYCYKLLLGVHYNEDDYYECAK-EVYCRVSDY  616

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             PAIK +GL  H+   +  ++LML+GYR +AY+AL RV
Sbjct  617   PAIKSVGL-SHLWMDMSIMVLMLVGYRFIAYIALHRV  652



>ref|XP_009129040.1| PREDICTED: ABC transporter G family member 21-like [Brassica 
rapa]
Length=669

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/634 (56%), Positives = 464/634 (73%), Gaps = 31/634 (5%)
 Frame = -3

Query  1990  PQLESD------TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
             P L+ D        +++ +++ RP+ LKFE + Y +K    +G  +  +  Q+ +  ++I
Sbjct  38    PCLDDDGPSHQSCQSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGS--QEPKQNRLI  95

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             L GV+GIV PGE+LAMLGPSGSGKTTL+TAL GRL G L+GT++YNG PF++++KR TGF
Sbjct  96    LNGVSGIVKPGELLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRRTGF  155

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             VTQDD+LYPHLTV ETL +TALLRLP+ LT++EKI+QA++VI+ LGLT+C NS+IGG  +
Sbjct  156   VTQDDVLYPHLTVMETLTYTALLRLPKELTRKEKIQQAESVISDLGLTRCCNSVIGGGLI  215

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RGISGGERKRVSIGQE+L+NPSLL LDEPTSGLDSTTA RIV+TL  L++GGRT+V TIH
Sbjct  216   RGISGGERKRVSIGQELLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTTIH  275

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDLANGIT  1112
             QPSSRL+ +F KVL+L +G+P+Y G    VM YF ++GF P S  +NP+DF+LDLANGIT
Sbjct  276   QPSSRLYRMFDKVLVLSDGSPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANGIT  335

Query  1111  GDDSQADQA-------------TVKETLVSAFKTNLLENLKMELHELNDEDVS---SAGD  980
              D  Q +Q              +VK++L+SA+K NL   LK E      +D +   S   
Sbjct  336   SDTKQYEQVEINGKLDRLEEQNSVKQSLISAYKKNLYPPLKEEFSRAFPQDQTVNMSRSK  395

Query  979   QKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQD  806
              +   RW   WW QFSVLLKRGLK+R +ESFSGL++  V+ V+ L+G LWW S    +QD
Sbjct  396   TRLTNRWPTSWWMQFSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHSRVAHIQD  455

Query  805   QVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVL  626
             QVGLLFF S FWGF PLF AIFTFP+++ ML KERSSG+Y+LSS+++ARTVGDLPMEL+L
Sbjct  456   QVGLLFFFSIFWGFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELIL  515

Query  625   PTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIM  446
             PT+FV I+YWM GLK +   F   L  +L  VLV QG+GLA+GA +MD K A TL SV+M
Sbjct  516   PTIFVTITYWMGGLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLM  575

Query  445   LAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDH  269
             L FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C  G G+ C V D+
Sbjct  576   LVFLLAGGYYIQHIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYEC--GPGLHCSVMDY  633

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
               IK + LG ++++ V+AL LML+ YR LAYVAL
Sbjct  634   EGIKNLRLG-NMMWDVLALTLMLLLYRFLAYVAL  666



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/634 (56%), Positives = 452/634 (71%), Gaps = 36/634 (6%)
 Frame = -3

Query  2008  TQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKII  1829
             T+L  +    S  S +  ++A  P+TLKFE +VYK+                 S  EK I
Sbjct  15    TELMVDSPNSSMNSESFTQRALFPITLKFEEIVYKIT----------------STKEKTI  58

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGF  1649
             L GVTGIV PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYN +PFS A+KR+TGF
Sbjct  59    LNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGAIKRSTGF  118

Query  1648  VTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFL  1469
             V QDDILYPHLTVTETL+FTALLRLP++L+KQEK +  + VIT+LGL KC+NS+IGG   
Sbjct  119   VAQDDILYPHLTVTETLLFTALLRLPQSLSKQEKEQHVEHVITELGLNKCRNSMIGGPLF  178

Query  1468  RGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIH  1289
             RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIH
Sbjct  179   RGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTTVKRLANGGRTVITTIH  238

Query  1288  QPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI--  1115
             QPSSRL+++F KV+LL EG P+Y+G  S  + YFS+VG S S+ +NP+D LLDLANGI  
Sbjct  239   QPSSRLYHMFDKVVLLSEGCPIYYGPASTALEYFSSVGVSTSITINPADLLLDLANGIGP  298

Query  1114  -------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELN------DEDVSSAGDQK  974
                     GD+ + ++ +V+E L+SA+   +   LK EL  L+       +DVS+    K
Sbjct  299   DSKHAIEQGDNPEQEKKSVREALISAYDKTISTRLKTELCSLDTNNYSYKKDVSTKNGVK  358

Query  973   QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQV  800
               ++W   W  QF VLL RGL++R+YE+F+ L++ QV+ VAFL G LWW   ++ ++D++
Sbjct  359   S-EQWCTSWGYQFKVLLLRGLRERRYETFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRI  417

Query  799   GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPT  620
              +LFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+EL LPT
Sbjct  418   AMLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELALPT  477

Query  619   VFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLA  440
              F  I YWM GLK     F  +L  +L  VLV Q LGLA GA +MD K ATTL SV  L 
Sbjct  478   AFTFILYWMGGLKANPATFILSLLIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLV  537

Query  439   FLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAI  260
             FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QYK  + Y C+ G   C V D PAI
Sbjct  538   FLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYKDKDYYECSKGV-YCRVADFPAI  596

Query  259   KKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             K +GL  ++   V+ + LML+GYRL+AY+AL RV
Sbjct  597   KSVGL-NNMWMDVLIMALMLVGYRLVAYLALNRV  629



>ref|XP_008457190.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
 ref|XP_008457191.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
Length=673

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/667 (53%), Positives = 470/667 (70%), Gaps = 28/667 (4%)
 Frame = -3

Query  2086  FPSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVY  1907
              P   D   A    TAT    I  P   L  +    +  + +I +++  P+TLKFE+V Y
Sbjct  2     LPPEQDTSTAPAAATATTTTSISHPRPDLLIHAVPSAPDTFSILRQSLFPLTLKFEDVSY  61

Query  1906  --KVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalg  1733
               K++ ++++ LS L+  + +S   + IL GV+G+V PGE+LAMLG SGSGKTTLLTAL 
Sbjct  62    SIKIQTNKRRCLS-LRNNESQSNTTRTILNGVSGVVRPGELLAMLGTSGSGKTTLLTALA  120

Query  1732  grlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQ  1553
              RL G ++GTITYN KPFS+++KR  GFV+QDD+LYPHLTV ETL + A+LRLP  LT  
Sbjct  121   ARLPGKISGTITYNDKPFSSSIKRKVGFVSQDDVLYPHLTVLETLTYAAMLRLPNKLTYD  180

Query  1552  EKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSG  1373
             EKI Q + +I +LGLT+C+NS+IGG  LRGISGGERKRVSIG EM++NPSLL LDEPTSG
Sbjct  181   EKIAQTEMIIAELGLTRCRNSVIGGGLLRGISGGERKRVSIGHEMIVNPSLLLLDEPTSG  240

Query  1372  LDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMS  1193
             LDSTTAQRIV+TL  L++GGRT+VMTIHQPS+RL+ +F KV++L +G+P+Y G  S VM 
Sbjct  241   LDSTTAQRIVATLRGLARGGRTLVMTIHQPSTRLYRMFDKVVVLSDGSPIYSGDASRVMP  300

Query  1192  YFSTVGFSPSVAM-NPSDFLLDLANGITGD----------------DSQADQATVKETLV  1064
             YF ++G+ P   + NP+DFLLDLANGI  D                D Q DQ ++K++L+
Sbjct  301   YFESIGYLPPFNLINPADFLLDLANGIAPDSIREDQVEHFHGGLLLDRQDDQNSIKQSLI  360

Query  1063  SAFKTNLLENLKME-LHELNDEDVSSAGDQ---KQFKRWAIPWWEQFSVLLKRGLKQRKY  896
             ++F+ NL   +K + L E N   V +  +    ++   W   WWEQF +LLKRGL++R++
Sbjct  361   ASFRKNLYPQIKAQILTETNISTVDARSNSLRGRKKNEWTTSWWEQFKILLKRGLRERRH  420

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ES+SGL++ QV+ V+FL+G LWW S  + +QDQVGL+FF S FWGFFPLF AIF FP ++
Sbjct  421   ESYSGLRIFQVMSVSFLSGLLWWHSDPSHIQDQVGLIFFFSIFWGFFPLFNAIFAFPLER  480

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSGMY+LSS++++RT GDLPMELVLPTVFV ++YWM GL P+   F   L  +
Sbjct  481   PMLNKERSSGMYRLSSYYMSRTAGDLPMELVLPTVFVTVTYWMGGLNPSMIPFLLTLLVV  540

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             LL VLV QGLGLA+GA +M+ K ATTL SV ML FLL GG+Y+ H+P F+SW+KY+S   
Sbjct  541   LLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIPHFMSWLKYVSFSH  600

Query  361   YTYKLLLESQYKP-GETYPCTSGSGVCLVEDHPAIKKIGLGQHVI-FSVVALLLMLIGYR  188
             Y YKL++  QY    E Y C    G C V D PA+K +G+G H + + V AL  ML+GYR
Sbjct  601   YCYKLVVGIQYNSLNEAYHCGGSFGYCKVGDFPAVKCLGIGNHSLWWDVAALFFMLVGYR  660

Query  187   LLAYVAL  167
             +LA++AL
Sbjct  661   ILAFLAL  667



>ref|XP_002314895.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
 gb|EEF01066.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
Length=683

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/639 (57%), Positives = 460/639 (72%), Gaps = 34/639 (5%)
 Frame = -3

Query  2005  QLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIIL  1826
             Q Q  P L   T   I + + RPVTL+F +V Y V    K G  F  ++ + +   + +L
Sbjct  56    QGQQEPALSRFT---ILRASLRPVTLEFADVAYSVSLSTK-GTWFTSSEPKST---RTVL  108

Query  1825  KGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFV  1646
              G +GIV PGE+LAMLGPSGSGKTTLLTAL GRL G ++GTITYNG+ FS++MKR TGFV
Sbjct  109   NGASGIVRPGELLAMLGPSGSGKTTLLTALAGRLPGKVSGTITYNGQAFSSSMKRRTGFV  168

Query  1645  TQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLR  1466
             TQDD+LYPHLTV ETL + ALLRLP+ LT+QEKIEQA+ +I +LGLT+C+NS++GG   R
Sbjct  169   TQDDVLYPHLTVLETLTYAALLRLPKKLTRQEKIEQAELIIMELGLTRCRNSVVGGPLFR  228

Query  1465  GISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQ  1286
             GISGGERKRVSIG EML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT+V TIHQ
Sbjct  229   GISGGERKRVSIGLEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRGLARGGRTVVTTIHQ  288

Query  1285  PSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITG  1109
             PSSRL+ +F KV++L EG P+Y G+   VM YF ++G++P    MNP+DFLLDLANG+  
Sbjct  289   PSSRLYRMFDKVVVLSEGCPIYSGQAGRVMEYFKSLGYNPGFNFMNPADFLLDLANGLVP  348

Query  1108  D--------------DSQADQATVKETLVSAFKTNLLENLKMELHE-LNDEDVSSAGDQK  974
             D              D   DQ + K++L+S++K NL   L  E+H    D  + S+  + 
Sbjct  349   DTRSQDDQLEFHGRLDHHDDQNSAKQSLISSYKNNLYPLLISEIHRNAQDPVLPSSSLRG  408

Query  973   QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQV  800
                +W    W+QF VLL+RGL++RK+ES+SGL++ QV+ V+ L+G LWW S  + +QDQV
Sbjct  409   SEVQWTTSCWQQFKVLLRRGLQERKHESYSGLRIFQVISVSILSGLLWWHSDTSHIQDQV  468

Query  799   GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPT  620
             GLLFF S FWGFFPLF AIF FP+++ ML KERSSGMY+LSS++ AR  GDLPMELV+PT
Sbjct  469   GLLFFFSIFWGFFPLFNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPT  528

Query  619   VFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLA  440
             +FV ++YWM GLKP+   F   L  IL  VLV QGLGLA+GA +MD K ATTL SV ML 
Sbjct  529   IFVTVTYWMGGLKPSLITFVLTLLVILFNVLVSQGLGLALGAILMDVKQATTLASVTMLV  588

Query  439   FLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV---CLVEDH  269
             FLLAGG+Y++H+P FI+W+KYIS   Y YKLL+  QY   E Y C    G+   C V D 
Sbjct  589   FLLAGGYYIQHIPPFIAWLKYISFSHYCYKLLVGVQYSATEVYDC----GLQMHCRVMDF  644

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             PAIK +GL  ++ +   AL +ML+GYRLLAYVAL R+G+
Sbjct  645   PAIKYLGL-DNMWWDAAALTIMLVGYRLLAYVAL-RMGQ  681



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21-like [Fragaria 
vesca subsp. vesca]
Length=694

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/639 (57%), Positives = 456/639 (71%), Gaps = 32/639 (5%)
 Frame = -3

Query  1993  NPQLESDTSAAIFKKANRPVTLKFENVVYKVK--PDQKQGLSFLKTKKQKSEAEKIILKG  1820
              P   +   A++ +++ RPVTLKFE+V Y +K  P +   +S     KQ     + +L G
Sbjct  61    QPHPGTPHRASVLRESLRPVTLKFEDVTYSIKLEPTKGSCVSSYNEPKQT----RNLLNG  116

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQ  1640
             V+GIV PGE+LAMLGPSGSGKTTLLTALGGRL G + G +TYNG+ FS++MK NTGFVTQ
Sbjct  117   VSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPGKITGKVTYNGQHFSSSMKHNTGFVTQ  176

Query  1639  DDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGI  1460
             DD+LYPHLTV ETL +TALLRLP+ L+KQEK EQA+ V+ +LGLT+C++S++GG  LRG+
Sbjct  177   DDVLYPHLTVLETLTYTALLRLPKQLSKQEKKEQAETVMVELGLTRCRDSVVGGPLLRGV  236

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPS  1280
             SGGERKRVSIGQEML+NPSLLFLDEPTSGLDSTTAQRIV+TL  L++GGRT++ TIHQPS
Sbjct  237   SGGERKRVSIGQEMLVNPSLLFLDEPTSGLDSTTAQRIVATLRRLARGGRTVITTIHQPS  296

Query  1279  SRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-  1106
             SRL+ +F KV++L +G P+Y G    VM YF ++G+      +NP+DFLLDLANGI  D 
Sbjct  297   SRLYRMFDKVVVLSDGCPIYSGHAGRVMEYFGSIGYEVGFNFINPADFLLDLANGIAPDA  356

Query  1105  ------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK-  965
                         D   +Q + K+ LVS++K NL   LK E+ +   +    +   +    
Sbjct  357   KQDDQLEYNGRLDHHEEQNSTKQFLVSSYKKNLHPALKAEIQQSQKDPAVVSSSSRTLSS  416

Query  964   ------RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQ  809
                    W   WWEQF VLL+RGLK+RK+ESFSGL++ QV+ VA L+G  WW S  + LQ
Sbjct  417   RGSRDYEWTTSWWEQFIVLLQRGLKERKHESFSGLRIFQVMSVAILSGLCWWHSDTSHLQ  476

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             DQVGLLFF S FWGFFPLF AIF FP ++ ML KERSSGMY+LSS++ ARTVGDLPMELV
Sbjct  477   DQVGLLFFFSIFWGFFPLFNAIFAFPMERPMLRKERSSGMYRLSSYYFARTVGDLPMELV  536

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPTVFV ++YWM GLKP+   +   L  +L  VLV QGLGLA+GA +MD K  TTL SV 
Sbjct  537   LPTVFVTVAYWMGGLKPSLVTYGLTLFIVLFNVLVSQGLGLALGAILMDVKQGTTLASVT  596

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDH  269
             ML FLL GG+Y++H+P FI+W+KYIS   Y YKLLL  QY   E Y C  G   C V D+
Sbjct  597   MLVFLLVGGYYIQHMPGFIAWLKYISFSHYCYKLLLGVQYSVKEVYECDLGV-RCRVIDY  655

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             PA+K +GL   +   V AL +ML+GYR+LAYVAL R+G+
Sbjct  656   PAVKFVGL-DGLWSDVAALGVMLVGYRVLAYVAL-RMGQ  692



>gb|EYU28941.1| hypothetical protein MIMGU_mgv1a002356mg [Erythranthe guttata]
Length=684

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/676 (54%), Positives = 465/676 (69%), Gaps = 45/676 (7%)
 Frame = -3

Query  2068  QQEATLMETATEMGDIEAPTT-----QLQANPQLESD------------TSAAIFKKANR  1940
             QQE T   T      IE P        L  N QL  D               ++ +++ R
Sbjct  5     QQENTTASTDNISIQIEQPNNYNVSPSLDNNHQLPPDNNNNNNTNHAILVRCSVLRESLR  64

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PVTLKFE+V Y +K  ++ G +      Q     K+ L GVTG V PGE+LAMLGPSGSG
Sbjct  65    PVTLKFEDVSYTIKLSRRSGATNCCASSQPKVTRKL-LNGVTGTVRPGELLAMLGPSGSG  123

Query  1759  kttlltalggrlgghlagTITYNGKPFS-NAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTAL G+L G ++GTI+YNG+ FS + MKR TGFVTQDD+LYPHLTV ETL + AL
Sbjct  124   KTTLLTALAGKLSGKVSGTISYNGQSFSGSCMKRKTGFVTQDDVLYPHLTVLETLTYAAL  183

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             L+LP +LTK+EK+EQA+ ++ +LGLT+C+NS+IGG  LRG+SGGERKRVSIGQEML+NPS
Sbjct  184   LKLPSSLTKEEKMEQAEFIVMELGLTRCRNSVIGGPLLRGVSGGERKRVSIGQEMLVNPS  243

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL +DEPTSGLDSTTAQRIV TL  +++GGRT+V TIHQPSSRLF +F KV++L EG P+
Sbjct  244   LLLVDEPTSGLDSTTAQRIVGTLRWVARGGRTVVTTIHQPSSRLFRMFDKVIVLSEGCPI  303

Query  1222  YFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGDDSQADQ--------------  1088
             Y G    VM YF+++G++P    +NP+DFLLDLANG+T D  Q ++              
Sbjct  304   YSGGAGRVMDYFASIGYAPGFDFVNPADFLLDLANGVTPDSRQEEENELHGNGRQDNKHD  363

Query  1087  ---ATVKETLVSAFKTNLLENLKMELHELNDED----VSSAGDQKQFKRWAIPWWEQFSV  929
                 + K+ L+ ++K N+   LK E+H L  +      S+        +W   WW QF V
Sbjct  364   NIIQSTKQFLIHSYKNNIYPLLKEEIHHLPSQHHIQPHSTKSSTSSDNQWTSSWWLQFRV  423

Query  928   LLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPL  755
             LL RGLK+RK+ESFSGL++ QV+ V+ L+G LWW S    +QDQVGLLFF S FWGFFPL
Sbjct  424   LLSRGLKERKHESFSGLRIFQVMSVSILSGILWWHSDPNHIQDQVGLLFFFSIFWGFFPL  483

Query  754   FQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPT  575
             F AIF FP++K ML +E SSGMY+LSS++ AR VGDLPMELVLPT+FV I+YWM GLKP+
Sbjct  484   FNAIFVFPQEKPMLARETSSGMYRLSSYYTARIVGDLPMELVLPTLFVTITYWMGGLKPS  543

Query  574   AGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSF  395
                F   LS +LL VLV QGLGLA+GA +MD K ATTL SV+ML FLL  G+Y++H+P F
Sbjct  544   LITFLLTLSIVLLNVLVAQGLGLALGAVLMDVKQATTLSSVLMLVFLLVSGYYIQHIPPF  603

Query  394   ISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVA  215
             I W+KY+S  Q+ Y+LL+  QY   E Y C  GS VC V D PAIK +G+  ++   V A
Sbjct  604   IDWLKYVSFSQFCYRLLVGVQYSENEVYECGLGS-VCRVVDSPAIKYLGI-HNLAADVAA  661

Query  214   LLLMLIGYRLLAYVAL  167
             L +ML+GYR+LAYVAL
Sbjct  662   LAVMLVGYRVLAYVAL  677



>ref|XP_009336649.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/627 (57%), Positives = 451/627 (72%), Gaps = 29/627 (5%)
 Frame = -3

Query  1966  AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             A+I  ++ RP+TLKFE+V Y +K     G         K +  + +L GV+GI  PGE+L
Sbjct  62    ASILHQSLRPITLKFEDVGYSIKLQATNGGC---VASHKPKPTRTVLNGVSGIALPGELL  118

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTT LTALGGRL G ++G ITYNG+ FS++MK N GFV+QDD+LYPHLTV 
Sbjct  119   AMLGPSGSGKTTFLTALGGRLPGKISGKITYNGQNFSSSMKHNIGFVSQDDVLYPHLTVL  178

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETL +TALLRLP+ LTK+EKIEQ + VI +LGL +C+++++GG  LRGISGGERKRVSIG
Sbjct  179   ETLTYTALLRLPKQLTKEEKIEQVETVIMELGLNRCRDTVVGGPLLRGISGGERKRVSIG  238

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVL  1247
             QEML+NPSLL LDEPTSGLDSTTAQRI++TL  L++GGRT++ TIHQPSSRL+ +F KV+
Sbjct  239   QEMLVNPSLLLLDEPTSGLDSTTAQRIITTLLRLARGGRTVITTIHQPSSRLYRMFDKVV  298

Query  1246  LLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD------------  1106
             +L +G P+Y G    VM YF ++G+      +NP+D LLDLANGI  D            
Sbjct  299   VLSDGYPIYSGHAGRVMEYFGSIGYEVGFNFINPADVLLDLANGIAPDAKQDEEVEYNGR  358

Query  1105  -DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFK-----RWAIPWW  944
              D Q DQ T K+ L+S++K  +   LK E+ + + + V S+      +     +W   WW
Sbjct  359   LDHQEDQNTTKQFLISSYKKYIYPALKTEIQQTHKDTVVSSSRTPSSRGSGNYKWTTSWW  418

Query  943   EQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFW  770
             EQFSVLL+RGLK+RK+ESFS L++ QV+ VA ++G LWW S  + +QDQVGLLFF S FW
Sbjct  419   EQFSVLLERGLKERKHESFSRLRIFQVMSVAIISGLLWWHSNISHIQDQVGLLFFFSIFW  478

Query  769   GFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMA  590
             GFFPL  AIF+FP ++ ML KERSSGMY+LSS+F ARTVGDLPMELVLPTVFV ISYWM+
Sbjct  479   GFFPLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFVTISYWMS  538

Query  589   GLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVR  410
             GLKP+   F   L  +L  VLV QG+GLA+GA +MD K  TTL SV  L FLL GG+Y++
Sbjct  539   GLKPSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQ  598

Query  409   HVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHV  233
             H+P FI+W+KYIS   Y YKLL+  QY   E Y C  G GV C V D P IK +GL  ++
Sbjct  599   HLPPFIAWLKYISYSHYCYKLLVGVQYSVHEVYEC--GMGVHCRVLDFPGIKCVGL-DNM  655

Query  232   IFSVVALLLMLIGYRLLAYVALMRVGR  152
                V AL +ML+GYR+LAYVAL R+G+
Sbjct  656   WIDVAALAVMLVGYRVLAYVAL-RMGQ  681



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/647 (55%), Positives = 465/647 (72%), Gaps = 34/647 (5%)
 Frame = -3

Query  2017  APTTQLQANPQLESDT--SAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE  1844
             +P+ + Q   QL++      ++ + + RP+TLKFE+V Y +K  +  G  F  +  +   
Sbjct  46    SPSLEDQMPEQLQAAMGGQCSLLRGSLRPITLKFEDVSYSIKIKKSGGCWF--SAPEPKP  103

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMK  1664
             +E+ IL GVTG+V PG++LAMLGPSGSGKTTLLTAL GRL G  +G+ITYNG  FS ++K
Sbjct  104   SERTILNGVTGVVQPGDLLAMLGPSGSGKTTLLTALAGRLPGKFSGSITYNGHTFSGSIK  163

Query  1663  RNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSII  1484
             R  GFV+QDD+LYPHLTV ETL + ALLRLP  LT++EK+EQA+ VI +LGLT+C+NS++
Sbjct  164   RKIGFVSQDDVLYPHLTVLETLTYAALLRLPNKLTREEKVEQAELVIVELGLTRCRNSVV  223

Query  1483  GGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTI  1304
             GG  LRG+SGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++ GRT+
Sbjct  224   GGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVTTLQGLARSGRTV  283

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM-NPSDFLLDL  1127
             V TIHQPSSRL+ +F K+++L +G P+Y G  S  + YF ++G+ P V + NP+DFLLDL
Sbjct  284   VATIHQPSSRLYRMFDKLVVLSDGCPIYSGSASRALEYFVSIGYMPGVNLVNPADFLLDL  343

Query  1126  ANGITGDDSQ------------ADQATVKETLVSAFKTNLLENLKMELHELNDE------  1001
             A G+  +  Q             DQ+++K+ L+S++K NL   LK EL +          
Sbjct  344   ATGVAPETRQRDQQNNHGQLEHEDQSSMKQHLISSYKRNLYNVLKAELCQTPQAPEAFVA  403

Query  1000  -DVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK  824
                SS   ++Q   W   WWEQF VLL R LK+RK+ES+SGL++ QV+ V+ L+G LWW 
Sbjct  404   GKTSSRCPEEQ---WMTSWWEQFRVLLSRSLKERKHESYSGLRIFQVMSVSILSGLLWWH  460

Query  823   S--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVG  650
             S  + +QDQVGLLFF S FWGFFP+F AIFTFP+++ ML KERSSGMY+LSS++ AR  G
Sbjct  461   SDISHVQDQVGLLFFFSIFWGFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAG  520

Query  649   DLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSA  470
             DLPMELVLPT+FV ++YWM GL+P+  NF   L  IL  VLV QGLGLA+GA +M+ K A
Sbjct  521   DLPMELVLPTIFVAVTYWMGGLRPSPVNFMLTLLIILYNVLVSQGLGLALGAIVMEVKQA  580

Query  469   TTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSG  290
             TTL SV ML FLLAGG+Y++H+P FI+W+KY S   Y YKLL+ +QY   + Y C  G+G
Sbjct  581   TTLASVTMLVFLLAGGYYIQHIPPFIAWLKYSSFSHYCYKLLVGAQYTEDDYYNC--GTG  638

Query  289   V-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
             V C + D P++K +GL    +  V AL +ML+GYRL+AYVAL R+G+
Sbjct  639   VHCKIMDFPSVKSLGLDNKRL-DVAALTVMLVGYRLMAYVAL-RIGQ  683



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/637 (55%), Positives = 454/637 (71%), Gaps = 39/637 (6%)
 Frame = -3

Query  2008  TQLQANP---QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAE  1838
             T+L A P    +    S +  ++A  P+TLKFE +VYK+                 S  E
Sbjct  15    TELMAAPPNSSMPEMNSESFTQRALFPITLKFEEIVYKIT----------------STKE  58

Query  1837  KIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRN  1658
             K IL GVTGIV PGE+LAMLGPSGSGKTTLLTALGGRL G L+G I YN +PFS A+KR+
Sbjct  59    KTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKIAYNNQPFSGAIKRS  118

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
             TGFV QDDILYPHLTVTETL+FTALLRLP++L+K+EK +  + VIT+LGL KC+NS+IGG
Sbjct  119   TGFVAQDDILYPHLTVTETLLFTALLRLPQSLSKEEKEQHVEHVITELGLNKCRNSMIGG  178

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
                RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++ 
Sbjct  179   PLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTTVKRLANGGRTVIT  238

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANG  1118
             TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS+VGFS S+ +NP+D LLDLANG
Sbjct  239   TIHQPSSRLYHMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSITINPADLLLDLANG  298

Query  1117  I---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELND------EDVSSAG  983
             I          GD+++ ++ +V+E L+SA+   +   LK EL  L+       +DVS+  
Sbjct  299   IGPDSKHAIEQGDNTEQEKKSVREALISAYDKVISTRLKTELCSLDTNNYTYIKDVSTRN  358

Query  982   DQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQ  809
               K  ++W+  W  QF VLL RGL++R+YE+F+ L++ QV+ VAFL G LWW   ++ ++
Sbjct  359   GVKS-EQWSTSWGYQFKVLLLRGLRERRYETFNRLRIFQVISVAFLAGLLWWHTPTSHIE  417

Query  808   DQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELV  629
             D++ +LFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+EL 
Sbjct  418   DRIAMLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELA  477

Query  628   LPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVI  449
             LPT F  I YWM GLK     F  +L  +L  VLV Q LGLA GA +MD K ATTL SV 
Sbjct  478   LPTAFTFILYWMGGLKANPATFILSLVIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVT  537

Query  448   MLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDH  269
              L FL+AGG+Y++ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G   C V D 
Sbjct  538   TLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGV-YCQVADF  596

Query  268   PAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             PAIK +GL  ++   V+ + LML+GYRLLAY+AL RV
Sbjct  597   PAIKSVGL-NNMWMDVLIMALMLVGYRLLAYLALNRV  632



>ref|XP_010943389.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=661

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/637 (54%), Positives = 440/637 (69%), Gaps = 32/637 (5%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG----LSFLKTKKQKSEAEKII  1829
             A P   S     +   A  PV LKFE V YKVK          L          +AEK I
Sbjct  24    AYPTPHSYPCCTLLATAVFPVLLKFEEVEYKVKVSHHGSKGPGLCCCGRGGGGGQAEKTI  83

Query  1828  LKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTG  1652
             LKG+TG+V PGE+LAMLGPSGSGKTTLLTALGGR         ITYNG PFS  MKR TG
Sbjct  84    LKGITGVVCPGEMLAMLGPSGSGKTTLLTALGGRCLAGKLSGKITYNGLPFSGPMKRRTG  143

Query  1651  FVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVF  1472
             FV QDD+LYPHLTV ETLVFTALLRLPR+L + EK+ QA  V+ +LGLT+  +++IGG  
Sbjct  144   FVAQDDVLYPHLTVAETLVFTALLRLPRSLDRAEKVRQAHQVMAELGLTRVADTMIGGRL  203

Query  1471  LRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMT  1295
             +RG+SGGER+RVSIGQEMLINPSLL LDEPTSGLDSTTA RIV+TL  L+ + GRT+V T
Sbjct  204   VRGVSGGERRRVSIGQEMLINPSLLLLDEPTSGLDSTTAARIVTTLKRLATERGRTVVTT  263

Query  1294  IHQPSSRLFYLFHKVLLL-CEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANG  1118
             IHQPSSRL+++F KV++L  EG+P+Y+G+ +  + YF+++GFS  + +NP+D LLDLANG
Sbjct  264   IHQPSSRLYHMFDKVVVLSAEGSPIYYGRATAALDYFASIGFSSPLTLNPADLLLDLANG  323

Query  1117  ITGDDSQA------------DQATVKETLVSAFKTNLLENLKMELHELND------EDVS  992
             I  D   A            +Q  V+E L SA+  N+   LK EL  ++        D +
Sbjct  324   IKPDSPHAAEHGEAPGSTEREQKAVREELTSAYDRNIAARLKAELCSIDPANYGYTRDAA  383

Query  991   SAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--T  818
             SA  ++Q   W   WWEQF VL++RGLK+R+YE+F+ L++ QVL VA L G LWWK+  +
Sbjct  384   SAAKREQ---WCTSWWEQFWVLMRRGLKERRYEAFNKLRIFQVLSVATLGGLLWWKTPPS  440

Query  817   DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPM  638
              +QD+  LLFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLART GDLPM
Sbjct  441   HIQDKTALLFFFTVFWGFYPLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPM  500

Query  637   ELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLG  458
             EL LPT FV+I YWM GL P A  F  +L  +L  VLV Q LGLA+GA +MD K ATTL 
Sbjct  501   ELALPTAFVLIIYWMGGLNPQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLA  560

Query  457   SVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLV  278
             SV  L FL+AGG+YV+H+P FI W+KY+S   Y YKLLL  Q+   + Y C+ G  +C V
Sbjct  561   SVTTLVFLIAGGYYVQHIPPFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGV-MCPV  619

Query  277   EDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
              + PAIK +GL  ++   V  + +ML+GYRL+AY+AL
Sbjct  620   VEFPAIKSVGL-NNMWVDVCIMAIMLLGYRLVAYLAL  655



>ref|XP_007153314.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
 gb|ESW25308.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
Length=671

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/616 (57%), Positives = 454/616 (74%), Gaps = 21/616 (3%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVL  1787
             ++ +++ RPVTLKFE+V Y +    +K G        QK +  + +L GV+G+V PGEV+
Sbjct  58    SVLRQSLRPVTLKFEDVSYSITFGREKNGC----VSSQKPKHTRTVLNGVSGMVGPGEVM  113

Query  1786  AMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             AMLGPSGSGKTTLLTAL GRL G L+G +TYN  PFS++M+RN GFV+QDD+LYPHLTV 
Sbjct  114   AMLGPSGSGKTTLLTALAGRLAGKLSGAVTYNNHPFSSSMRRNIGFVSQDDVLYPHLTVI  173

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG--VFLRGISGGERKRVS  1433
             ETL + A+L+LP++LT++EK+EQA+ +I +LGL++C+NS +GG   F RGISGGERKRVS
Sbjct  174   ETLGYAAMLKLPKSLTREEKMEQAEMIIGELGLSQCRNSRVGGGAAFFRGISGGERKRVS  233

Query  1432  IGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHK  1253
             IGQEML+NPSLL LDEPTSGLDSTTAQRIV+ L  L++ GRT+V TIHQPSSRLF++F K
Sbjct  234   IGQEMLVNPSLLLLDEPTSGLDSTTAQRIVAMLHGLARSGRTVVTTIHQPSSRLFWMFDK  293

Query  1252  VLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQ  1097
             VLLL EG P++ G+ S  M+Y  ++GF P+ + +NP+DFLLDLANG+  D       D  
Sbjct  294   VLLLSEGCPIFTGQASQAMNYLDSIGFVPTFSFINPADFLLDLANGVVVDVKEDEHLDQH  353

Query  1096  ADQATVKETLVSAFKTNLLENLKMELHELNDEDV--SSAGDQKQFKRWAIPWWEQFSVLL  923
              DQA++K+ LVS++K N+   LK E+ + + E    +S        +W   WWEQF VLL
Sbjct  354   EDQASIKQFLVSSYKKNVYPLLKQEIQQNHRELAFFASRTFGSSENQWTTSWWEQFMVLL  413

Query  922   KRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQ  749
             KRGLK+R++ES+S L++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF 
Sbjct  414   KRGLKERRHESYSSLRIFQVLSVSILSGLLWWHSDPSQIQDQVGLLFFFSIFWGFFPLFN  473

Query  748   AIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAG  569
             AIF FP D+ ML KERSSGMY LSS+++ARTVGDLPMELVLPT+FV ISYWM GLKP+  
Sbjct  474   AIFAFPLDRPMLIKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMEGLKPSLV  533

Query  568   NFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFIS  389
              F   L  +L  VLV QG+GLA+GA ++D K ATTL SV ML FLLAGG+Y++ +P FIS
Sbjct  534   TFVFTLLIMLFNVLVSQGIGLALGAILIDVKQATTLASVTMLVFLLAGGYYIQKIPFFIS  593

Query  388   WIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALL  209
             W+KYIS   Y YKLL   QY   E Y C  G   C + D PAIK +GL  ++   VV L 
Sbjct  594   WLKYISFSHYCYKLLAGVQYSVNEVYECGHGLH-CKIRDFPAIKCLGL-DNLWKDVVVLT  651

Query  208   LMLIGYRLLAYVALMR  161
             +MLIGYR++AY+AL +
Sbjct  652   IMLIGYRVVAYLALRK  667



>ref|XP_003591854.1| ABC transporter G family member [Medicago truncatula]
 gb|AES62105.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=665

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/657 (56%), Positives = 464/657 (71%), Gaps = 31/657 (5%)
 Frame = -3

Query  2080  SSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKV  1901
             SSS++ + +L      +     PTT L         TS +I  ++ RPVTLKFE+V Y +
Sbjct  18    SSSNKVKPSLDIDHNAINIPSHPTTPL---------TSFSILPQSLRPVTLKFEDVSYSI  68

Query  1900  K-PDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrl  1724
                +QK+    +    ++S+  + IL GVTG+  PGE+ AMLGPSGSGKTTLLTAL GRL
Sbjct  69    TMTNQKKNGCVMG---KESKVTRKILNGVTGVARPGELTAMLGPSGSGKTTLLTALAGRL  125

Query  1723  gghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKI  1544
              G + GTITYNG   S+ MKR  GFV+QDD++YPHLTV ETL +TALLRLP+TLT++EK+
Sbjct  126   AGKVTGTITYNGNSDSSCMKRKIGFVSQDDVVYPHLTVLETLTYTALLRLPKTLTREEKV  185

Query  1543  EQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGL  1370
             E A+ +IT+LGLT+C+N+ +GG     RGISGGERKR+SIGQEML+NPSLLFLDEPTSGL
Sbjct  186   EHAERIITELGLTRCRNTQVGGCMGLFRGISGGERKRMSIGQEMLVNPSLLFLDEPTSGL  245

Query  1369  DSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSY  1190
             DSTTAQ IVS L  L++ GRT+V TIHQPSSRL+ +F KV++L +G P+Y G    VM Y
Sbjct  246   DSTTAQLIVSVLRGLARSGRTVVTTIHQPSSRLYRMFDKVVVLSDGYPIYSGNAGRVMDY  305

Query  1189  FSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQADQATVKETLVSAFKTNLLEN  1034
               +VGF P    +NP+DFLLDLANGI  D           DQA+VK++L+S++K NL   
Sbjct  306   LGSVGFVPGFNFVNPADFLLDLANGIIADVKHDEIEQHDQDQASVKQSLISSYKKNLYPA  365

Query  1033  LKMELHELNDEDV--SSAGDQKQF--KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQ  866
             LK ++  +N E V  +S G  ++    +W   WWEQF VLLKRGL++R++ESFSGLK+ Q
Sbjct  366   LKEDIQHINTEPVVFASRGTSRRSSDNQWCTSWWEQFKVLLKRGLQERRHESFSGLKIFQ  425

Query  865   VLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSG  692
             VL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF AIF FP D+ ML KERSSG
Sbjct  426   VLSVSILSGLLWWHSDPSHIQDQVGLLFFFSIFWGFFPLFNAIFAFPLDRPMLTKERSSG  485

Query  691   MYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqgl  512
             MY LSS+++AR VGDLPMELVLPT+FV I+YWM GLKP+   F   L  +L  VLV QG+
Sbjct  486   MYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGLKPSLVTFVLTLLIMLFNVLVSQGI  545

Query  511   gLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQ  332
             GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +PSFI+W+KY S   Y YKLL+  Q
Sbjct  546   GLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKMPSFIAWLKYFSFSHYCYKLLVGVQ  605

Query  331   YKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMR  161
             +   E Y C  G   C   D PAIK + LG ++   V AL +M +GYR++AY+AL R
Sbjct  606   FSVNEVYECREGLH-CRARDFPAIKCLELG-NMWGDVAALTIMFVGYRVVAYLALRR  660



>ref|XP_010943390.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=660

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/618 (56%), Positives = 435/618 (70%), Gaps = 32/618 (5%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQG----LSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGP  1772
             PV LKFE V YKVK          L          +AEK ILKG+TG+V PGE+LAMLGP
Sbjct  42    PVVLKFEEVEYKVKVSHHGSKGPGLCCCGRGGGGGQAEKTILKGITGVVCPGEMLAMLGP  101

Query  1771  Sgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLV  1595
             SGSGKTTLLTALGGR         ITYNG PFS  MKR TGFV QDD+LYPHLTV ETLV
Sbjct  102   SGSGKTTLLTALGGRCLAGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAETLV  161

Query  1594  FTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEML  1415
             FTALLRLPR+L + EK+ QA  V+ +LGLT+  +++IGG  +RG+SGGER+RVSIGQEML
Sbjct  162   FTALLRLPRSLDRAEKVRQAHQVMAELGLTRVADTMIGGRLVRGVSGGERRRVSIGQEML  221

Query  1414  INPSLLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLL-  1241
             INPSLL LDEPTSGLDSTTA RIV+TL  L+ + GRT+V TIHQPSSRL+++F KV++L 
Sbjct  222   INPSLLLLDEPTSGLDSTTAARIVTTLKRLATERGRTVVTTIHQPSSRLYHMFDKVVVLS  281

Query  1240  CEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA-----------  1094
              EG+P+Y+G+ +  + YF+++GFS  + +NP+D LLDLANGI  D   A           
Sbjct  282   AEGSPIYYGRATAALDYFASIGFSSPLTLNPADLLLDLANGIKPDSPHAAEHGEAPGSTE  341

Query  1093  -DQATVKETLVSAFKTNLLENLKMELHELND------EDVSSAGDQKQFKRWAIPWWEQF  935
              +Q  V+E L SA+  N+   LK EL  ++        D +SA  ++Q   W   WWEQF
Sbjct  342   REQKAVREELTSAYDRNIAARLKAELCSIDPANYGYTRDAASAAKREQ---WCTSWWEQF  398

Query  934   SVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFF  761
              VL++RGLK+R+YE+F+ L++ QVL VA L G LWWK+  + +QD+  LLFF + FWGF+
Sbjct  399   WVLMRRGLKERRYEAFNKLRIFQVLSVATLGGLLWWKTPPSHIQDKTALLFFFTVFWGFY  458

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PL+ A+FTFP+++ ML KERSSGMY+LSS+FLART GDLPMEL LPT FV+I YWM GL 
Sbjct  459   PLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVLIIYWMGGLN  518

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P A  F  +L  +L  VLV Q LGLA+GA +MD K ATTL SV  L FL+AGG+YV+H+P
Sbjct  519   PQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLASVTTLVFLIAGGYYVQHIP  578

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSV  221
              FI W+KY+S   Y YKLLL  Q+   + Y C+ G  +C V + PAIK +GL  ++   V
Sbjct  579   PFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGV-MCPVVEFPAIKSVGL-NNMWVDV  636

Query  220   VALLLMLIGYRLLAYVAL  167
               + +ML+GYRL+AY+AL
Sbjct  637   CIMAIMLLGYRLVAYLAL  654



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/650 (53%), Positives = 456/650 (70%), Gaps = 35/650 (5%)
 Frame = -3

Query  2020  EAPTTQLQA----------NPQLESDTSA---AIFKKANRPVTLKFENVVYKVKPDQKQG  1880
             E P+ QL            NP L     A   +  +  + P+TLKFE +VYKV+ + K G
Sbjct  11    ENPSIQLMGGLPISSESCDNPYLAYPIQARTQSFLQMTSNPITLKFEEIVYKVRIETK-G  69

Query  1879  LSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTI  1700
             +   +T   K   EK IL G+TG+V PGE+LAMLGPSGSGKTTLLTALGGRL   L+G I
Sbjct  70    MCCGQTLSSK---EKTILNGLTGMVCPGEILAMLGPSGSGKTTLLTALGGRLTSKLSGKI  126

Query  1699  TYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVIT  1520
             TYN +P S  ++R TGFV QDD+LYPHLTV ETL+FTALLRLP+TLTK+EK++  + VI 
Sbjct  127   TYNTQPISGHIRRQTGFVAQDDVLYPHLTVFETLLFTALLRLPKTLTKEEKVQHVEQVIA  186

Query  1519  QLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVS  1340
             +LGL++C+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++
Sbjct  187   ELGLSRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAMRILT  246

Query  1339  TLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSV  1160
             T+  L+  GRT+V TIHQPSSRL+++F K++LL EG+P+Y+G  S  + YFS++GFS ++
Sbjct  247   TIKRLASAGRTVVTTIHQPSSRLYHMFDKLVLLSEGSPIYYGPASTALEYFSSIGFSTTL  306

Query  1159  AMNPSDFLLDLANGI---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELN  1007
              +NP+DFLLDLANGI          G+ ++ +Q  V+E L+SA+  N+   LK EL  L+
Sbjct  307   TVNPADFLLDLANGIGPDAKHAFELGESAEKEQKLVREALISAYDKNIATRLKAELCSLD  366

Query  1006  DEDVSSAGDQK-----QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLT  842
               + + A D       + ++W   W+ QF+VLL RGL++R+YE+F+ L++ QV+ VA L 
Sbjct  367   INNYAYAKDSSTKRDAKSEQWCTSWFHQFNVLLLRGLRERRYETFNRLRIFQVISVATLG  426

Query  841   GALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFF  668
             G LWW +  + ++DQ+ +LFF S FWGF+P++ A+FTFP+++ ML KERSSGMY LSS+F
Sbjct  427   GLLWWHTPMSHIEDQIAMLFFFSVFWGFYPIYNAVFTFPQERRMLIKERSSGMYHLSSYF  486

Query  667   LARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFI  488
             LA+TVGDLP+EL LPT F  I YWM GLKP    F  +L  +L  VLV Q LGLA GA +
Sbjct  487   LAKTVGDLPLELALPTAFTFIIYWMGGLKPEPATFILSLLIVLYSVLVSQSLGLAFGAIL  546

Query  487   MDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             MD K ATTL SV  L FL+AGG+Y++ +P+FI W+KY+S   Y +KLLL  QY   + Y 
Sbjct  547   MDVKQATTLASVTTLVFLIAGGYYIQQIPAFIVWLKYLSYSYYCFKLLLGVQYNGNDYYE  606

Query  307   CTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             C+ G   C V D P +K +GL  H+   V  + LM++GYR +AY+AL RV
Sbjct  607   CSKGV-YCRVADFPYVKSVGL-NHLWIDVSIMALMMVGYRFIAYLALRRV  654



>ref|XP_006589394.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=684

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/670 (54%), Positives = 466/670 (70%), Gaps = 42/670 (6%)
 Frame = -3

Query  2056  TLMETATEMGDIEAPTTQLQANPQLESDTSA-------------------AIFKKANRPV  1934
             T  ET++   D E   T  +  P LE D +                    ++  ++ RP+
Sbjct  20    TRQETSSIHHDSEGSNTN-KIKPSLELDDNCIPAQQQTQPTPPPPTTSRFSVLHQSLRPI  78

Query  1933  TLKFENVVYKV--KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             TLKFE+V Y +  +  +K+G       +++S+  + +L GVTG+V PGE+ AMLGPSGSG
Sbjct  79    TLKFEDVSYTITFESQKKKGCVL----RKESKLRRKVLTGVTGVVNPGELTAMLGPSGSG  134

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTAL GRL G ++GTITYNG+     +KR  GFV QDD+ YPHLTV ETL + ALL
Sbjct  135   KTTLLTALAGRLAGKVSGTITYNGQTDPTFVKRKVGFVPQDDVHYPHLTVLETLTYAALL  194

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRVSIGQEMLINP  1406
             RLP++L+++EK E A+ VI +LGLT+C+NS +GG     RGISGGERKRVSIGQEML+NP
Sbjct  195   RLPKSLSREEKKEHAEMVIAELGLTRCRNSPVGGCMALFRGISGGERKRVSIGQEMLVNP  254

Query  1405  SLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNP  1226
             SLLF+DEPTSGLDSTTAQ IVS L  L++ GRT+V TIHQPSSRL+ +F KV++L +G+P
Sbjct  255   SLLFVDEPTSGLDSTTAQLIVSVLHGLARAGRTVVATIHQPSSRLYRMFDKVIVLSDGHP  314

Query  1225  LYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQADQATVKET  1070
             +Y G    VM Y  +VG+ P+   MNP+DFLLDLANG+  D       D   DQA+VK++
Sbjct  315   IYSGHAGRVMDYLGSVGYVPAFNFMNPADFLLDLANGVVADVKHDDQIDHHEDQASVKQS  374

Query  1069  LVSAFKTNLLENLKMELHELNDED--VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKY  896
             L+S+FK NL   LK ++H+ N      +S   ++   +W   WWEQF VLLKRGL++R++
Sbjct  375   LISSFKKNLYPALKEDIHQNNSHPSAFTSGTPRRSDNQWTSSWWEQFRVLLKRGLQERRH  434

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ESFSGL++ QVL V+ L+G LWW S    +QDQVGLLFF S FWGFFPLF AIF FP ++
Sbjct  435   ESFSGLRIFQVLSVSILSGLLWWHSDPAHVQDQVGLLFFFSIFWGFFPLFNAIFAFPLER  494

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              ML KERSSGMYKLSS+++AR VGDLPMELVLPT+FV ISYWM GLKP+   F   L  +
Sbjct  495   PMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLKPSLVTFVLTLLIM  554

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             L  VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +P+FI+W+KYIS   
Sbjct  555   LFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMPAFIAWLKYISFSH  614

Query  361   YTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLL  182
             Y YKLL+  QY   E Y C  G   C V D PAIK +GL   +   V AL +MLIGYR++
Sbjct  615   YCYKLLVGVQYSVNEVYECGPGLH-CRVRDFPAIKCMGLDDTMWGDVAALTVMLIGYRVV  673

Query  181   AYVALMRVGR  152
             AY+AL R+G+
Sbjct  674   AYLAL-RMGQ  682



>gb|KHN07718.1| ABC transporter G family member 21, partial [Glycine soja]
Length=602

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/605 (59%), Positives = 442/605 (73%), Gaps = 21/605 (3%)
 Frame = -3

Query  1924  FENVVYKVK-PDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttl  1748
             FE+V Y +     K G        QK +  K +L GVTG+V P EV+AMLGPSGSGKTTL
Sbjct  1     FEDVSYSITFGRDKNGC----VSSQKPKHTKTVLNGVTGMVGPREVMAMLGPSGSGKTTL  56

Query  1747  ltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPR  1568
             LTAL GRL G L+G ITYNG PFS++MKRN GFV+QDD+LYPHLTV ETL + A+L+LP+
Sbjct  57    LTALAGRLAGKLSGAITYNGHPFSSSMKRNIGFVSQDDVLYPHLTVLETLTYAAMLKLPK  116

Query  1567  TLTKQEKIEQADAVITQLGLTKCKNSIIGG--VFLRGISGGERKRVSIGQEMLINPSLLF  1394
             +LT+++K+EQA+ +I +LGL++C+NS IGG     RGISGGERKRVSIGQEML+NPSLL 
Sbjct  117   SLTREDKMEQAEMIIVELGLSRCRNSPIGGGSALFRGISGGERKRVSIGQEMLVNPSLLL  176

Query  1393  LDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFG  1214
             LDEPTSGLDSTTAQRIV+ L   ++ GRT+V TIHQPSSRL+++F KV++L +G P++ G
Sbjct  177   LDEPTSGLDSTTAQRIVAMLQSFARAGRTVVTTIHQPSSRLYWMFDKVVVLSDGYPIFTG  236

Query  1213  KGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQADQATVKETLVSA  1058
             K   VM Y  TVGF P+   +NP+DFLLDLANGI  D       D   DQA++K+ LVS+
Sbjct  237   KTDRVMDYLETVGFVPAFNFVNPADFLLDLANGIVADVKQEEQIDHHEDQASIKQFLVSS  296

Query  1057  FKTNLLENLKMELHELNDED--VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFS  884
             +K NL   LK E+ + + E   ++S   +    +W   WWEQF VLLKRGLK+R++ES+S
Sbjct  297   YKKNLYPLLKQEIQQNHRELAFLNSGTPRSSENQWTTSWWEQFMVLLKRGLKERRHESYS  356

Query  883   GLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLG  710
             GL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF AIF FP D+ ML 
Sbjct  357   GLRIFQVLSVSILSGLLWWHSDPSHIQDQVGLLFFFSIFWGFFPLFNAIFAFPLDRPMLT  416

Query  709   KERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcv  530
             KERSSGMY LSS+++ARTVGDLPMELVLPT+FV ISYWM GLKP+   F   L  +L  V
Sbjct  417   KERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLKPSLVTFVLTLLIMLFNV  476

Query  529   lvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYK  350
             LV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +P FI+W+KYIS   Y YK
Sbjct  477   LVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIPFFIAWLKYISFSHYCYK  536

Query  349   LLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             LL+  QY   E Y C  G   C V D PAIK +GL   +   V  L +MLIGYR++AY+A
Sbjct  537   LLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGL-DSLWGDVAVLAVMLIGYRVVAYLA  595

Query  169   LMRVG  155
             L R+G
Sbjct  596   L-RMG  599



>ref|XP_002524381.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37992.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=709

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/674 (55%), Positives = 481/674 (71%), Gaps = 30/674 (4%)
 Frame = -3

Query  2101  HCPESFPSSSDQQEATLMETATEMGDIE-APTTQLQANPQLESDTSA--AIFKKANRPVT  1931
             +CP +  + ++  E   +     +  I   P +Q    P  E  T +  +I +++ RP+T
Sbjct  40    NCPPNHIALNNWTETVPVYAEPSVSSINLNPCSQEHQLPDEEEQTQSRFSILRESLRPIT  99

Query  1930  LKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgktt  1751
             LKFE+V Y V      G S     + KS+  + +L GV+GIV PGE+LAMLGPSGSGKTT
Sbjct  100   LKFEDVEYSVN-FSTNGSSCCSRNEPKSK--RTVLNGVSGIVRPGELLAMLGPSGSGKTT  156

Query  1750  lltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLP  1571
             LLTAL GRL   ++GTITYNG P+S++MKRNTGFV QDDILYPHLTV ETL + ALLRLP
Sbjct  157   LLTALSGRLPVKVSGTITYNGLPYSSSMKRNTGFVAQDDILYPHLTVIETLTYAALLRLP  216

Query  1570  RTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFL  1391
             + L+KQEKIEQA+ VI +LGL +C+NSIIGG  LRG+SGGERKRVSIGQE+L+NPSLL L
Sbjct  217   KKLSKQEKIEQAEMVIMELGLNRCRNSIIGGPLLRGVSGGERKRVSIGQELLVNPSLLLL  276

Query  1390  DEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGK  1211
             DEPTSGLDSTTAQRIV+TL  L++GGRTI+ TIHQPSSRL+ +F K+++L +G P+Y G 
Sbjct  277   DEPTSGLDSTTAQRIVATLKGLARGGRTIITTIHQPSSRLYRMFDKLVVLSDGCPIYSGL  336

Query  1210  GSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGI---TGDDSQ----------ADQATVKE  1073
                VM YF ++G+ P    +NP+DFLLDLANGI   T  D Q           DQ+++K+
Sbjct  337   ADPVMEYFGSIGYVPGFNFVNPADFLLDLANGIVPGTKQDDQLEVHGRLDHPDDQSSIKQ  396

Query  1072  TLVSAFKTNLLENLKMELHELNDEDV--SSAGD---QKQFKRWAIPWWEQFSVLLKRGLK  908
             +L+S++K NL   LK E+   + + V  SS G    +    +WA  WW+QF VLL+RGL+
Sbjct  397   SLISSYKKNLYPALKAEIRRNSQDPVLPSSTGTSSLRNSENQWATTWWQQFKVLLRRGLQ  456

Query  907   QRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTF  734
             +RK+ES+SGL++ QV+ V+ L+G LWW S  + +QDQVGLLFF S FWGFFPLF AIF F
Sbjct  457   ERKHESYSGLRIFQVMSVSILSGLLWWHSDTSHIQDQVGLLFFFSIFWGFFPLFNAIFAF  516

Query  733   PEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSA  554
             P+++ +L KERSSGMY+LSS++ AR  GDLPMELV+P +FV ++YWM GLKP+   F   
Sbjct  517   PQERPILIKERSSGMYRLSSYYFARMAGDLPMELVMPIIFVTVAYWMGGLKPSLITFVLT  576

Query  553   LSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYI  374
             L  IL  VLV QGLGLA+GA +MD K  TTL SV ML FLLAGG+Y++H+P+FI+W+KYI
Sbjct  577   LLIILFNVLVSQGLGLALGAVLMDVKQGTTLASVTMLVFLLAGGYYIQHIPAFIAWLKYI  636

Query  373   SIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIG  194
             S   Y YKLL+  QY   E Y C +G   C V D PAI+ +GL  ++ + V ALL+ML+G
Sbjct  637   SFSHYCYKLLVGVQYSVNEVYECEAGMH-CRVMDFPAIRYLGL-DNMWWDVAALLIMLVG  694

Query  193   YRLLAYVALMRVGR  152
             YR LAYVAL R+G+
Sbjct  695   YRFLAYVAL-RMGQ  707



>ref|XP_010111780.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXC31694.1| ABC transporter G family member 14 [Morus notabilis]
Length=666

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/629 (55%), Positives = 440/629 (70%), Gaps = 37/629 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQ---KQGLSF-------LKTKKQKSEAEKIILKGVTGIVFPGEV  1790
             P+TLKFE VVYKVK D+   K G  +         +    S  EK IL G+TG+V PGE+
Sbjct  37    PITLKFEEVVYKVKVDELHEKGGWCWGNNSSTSASSSSWPSTREKSILNGITGMVCPGEI  96

Query  1789  LAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTV  1610
             LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG PFS  +KR TGFV QDD+LYPHLTV
Sbjct  97    LAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGHPFSGTIKRRTGFVAQDDVLYPHLTV  156

Query  1609  TETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSI  1430
             TETL+FTA+LRLP +L++ EK    D VIT+LGLT+C++ +IGG   RGISGGE+KRVSI
Sbjct  157   TETLLFTAMLRLPESLSRDEKAGHVDRVITELGLTRCRHGMIGGPLFRGISGGEKKRVSI  216

Query  1429  GQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKV  1250
             GQEMLINPSLL LDEPTSGLDSTTAQ I++TL  L+ GGRTIV TIHQPSSRL+++F KV
Sbjct  217   GQEMLINPSLLLLDEPTSGLDSTTAQWILTTLKRLASGGRTIVTTIHQPSSRLYHMFDKV  276

Query  1249  LLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD---------DSQ  1097
             +LL EG+P+Y G  S  + YFS +GFS S+ +NP+D LLDLANG+  D           +
Sbjct  277   VLLSEGSPIYNGPASTALDYFSDIGFSASITLNPADLLLDLANGVGPDFKYATEHSESME  336

Query  1096  ADQATVKETLVSAFKTNLLENLKMEL--HELNDEDVSSAGDQK------------QFKRW  959
              ++  V+E L+SA+  N+   LK +L   E    + SS   +             +   W
Sbjct  337   QEKKKVREALISAYDKNISARLKAQLCTSEAATNNTSSYAKKDASSSYKTEKGVVKADEW  396

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFF  785
                WW QF VLL+RG+K+R+YE+F+ L++ QV+ VA L G LWW+  ++ ++D++ LLFF
Sbjct  397   YTSWWHQFKVLLQRGIKERRYETFNRLRIFQVISVAVLGGLLWWRTPTSHIEDRIALLFF  456

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+T+GDLP+EL LPT FV I
Sbjct  457   FSVFWGFYPLYNAVFTFPQERTMLMKERSSGMYRLSSYFLAKTIGDLPLELALPTAFVFI  516

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
              YWM GLK     F  +L  +L  VLV Q LGLAIGA +MD K ATTL SV  L FL+AG
Sbjct  517   IYWMGGLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAG  576

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+YV+ +P FI W+KY+S   Y YKLLL  QY   + Y C+ G   C + D PA+K +GL
Sbjct  577   GYYVQQIPPFIVWLKYLSYSYYCYKLLLGVQYNDDDYYECSPGVW-CPIADFPAVKSMGL  635

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              +++   V  + LML+GYR LAY+AL RV
Sbjct  636   -RNLWMDVFIMALMLVGYRFLAYLALQRV  663



>ref|XP_008389336.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
 ref|XP_008367026.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
Length=683

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/666 (54%), Positives = 459/666 (69%), Gaps = 41/666 (6%)
 Frame = -3

Query  2083  PSSSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYK  1904
             PS+S +   +      +M D   PT+             A+I  ++  PVTLKFE+V Y 
Sbjct  35    PSASSRTNVSPC-LGDDMADQPRPTS-----------ARASILHQSLHPVTLKFEDVGYS  82

Query  1903  VKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrl  1724
             +K     G         K +  + +L GV+GIV PGE+LAMLGPSGSGKTTLLTALG RL
Sbjct  83    IKLQATNGGC---VASHKXKPTRTVLNGVSGIVLPGELLAMLGPSGSGKTTLLTALGXRL  139

Query  1723  gghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKI  1544
              G ++G ITYNG+ FS++MK N GFV+QDD+LYPHL+V ETL +TALLRLP+ LTK+EKI
Sbjct  140   PGKISGKITYNGQNFSSSMKHNIGFVSQDDVLYPHLSVLETLTYTALLRLPKQLTKEEKI  199

Query  1543  EQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDS  1364
             EQ + VI +LGL +C+++++GG  LRGISGGERKRVSIGQEML+NPSLL LDEPTSGLDS
Sbjct  200   EQVETVIMELGLNRCRDTVVGGPLLRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDS  259

Query  1363  TTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFS  1184
             TTAQRI+ TL  L++GGRT++ TIHQPSSRL+ +F KV++L +G P+Y G    VM YF 
Sbjct  260   TTAQRIIVTLQRLARGGRTVITTIHQPSSRLYRMFDKVMVLSDGYPIYSGHADRVMEYFG  319

Query  1183  TVGFSPSVA-MNPSDFLLDLANGITGD-------------DSQADQATVKETLVSAFKTN  1046
              +G+      +NP+D LLDLANGI  D             D Q DQ T K+ L+S++K  
Sbjct  320   XIGYEVGFNFINPADVLLDLANGIAPDAKQDEEVEYNGRLDHQEDQNTTKQFLISSYKKY  379

Query  1045  LLENLKMELHELNDEDVSSAGDQKQFK-----RWAIPWWEQFSVLLKRGLKQRKYESFSG  881
             L   LK+E+ + + + V S+      +     +W   WWEQFSVLL+RGLK+RK+ESFS 
Sbjct  380   LYPALKIEIQQTHKDTVVSSSRTPSSRGSGNYKWTTSWWEQFSVLLERGLKERKHESFSR  439

Query  880   LKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGK  707
             L++ QV+ V+ ++G LWW S  + +QDQVGLLFF S FWGFFPL  AIF+FP ++ ML K
Sbjct  440   LRIFQVMSVSIISGLLWWHSNISHIQDQVGLLFFFSIFWGFFPLSNAIFSFPMERPMLIK  499

Query  706   ERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvl  527
             ERSSGMY+LSS+F ARTVGDLPMELVLPTVF  I YWM+GLKP+   F   L  +L  VL
Sbjct  500   ERSSGMYRLSSYFFARTVGDLPMELVLPTVFXTICYWMSGLKPSIVTFALTLFIVLYNVL  559

Query  526   vcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKL  347
             V QG+GLA+GA +MD K  TTL SV  L FLL GG+Y++H+P FI+W+KYIS   Y YKL
Sbjct  560   VAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHMPPFIAWLKYISYSHYCYKL  619

Query  346   LLESQYKPGETYPCTSGSGV-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
             L+  QY   E Y C  G GV C V D P IK +GL    I  V AL +ML+GYR+LAYVA
Sbjct  620   LVGVQYSVHEVYEC--GMGVHCRVLDFPGIKCVGLDDMWI-DVAALAVMLVGYRVLAYVA  676

Query  169   LMRVGR  152
             L R+G+
Sbjct  677   L-RMGQ  681



>ref|XP_009593646.1| PREDICTED: ABC transporter G family member 21 [Nicotiana tomentosiformis]
Length=644

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/629 (57%), Positives = 459/629 (73%), Gaps = 21/629 (3%)
 Frame = -3

Query  2002  LQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILK  1823
              Q N Q  +    ++  ++  PVTLKFE++ Y +K +  +G+S+  T ++K    + IL+
Sbjct  15    FQDNQQQSNHVKLSVLHESLHPVTLKFEDISYTIKLESNKGISYFSTPQRKQN--RAILQ  72

Query  1822  GVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFV  1646
             GVTGIV PGE LAMLGPSGSGKTTLLTAL GRL G L+  +ITYNG+ FS+ MKR  GFV
Sbjct  73    GVTGIVHPGEFLAMLGPSGSGKTTLLTALAGRLPGKLSTGSITYNGQQFSSYMKRKIGFV  132

Query  1645  TQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLR  1466
             TQDD+LYPHLTV ETL + ALLRLP+ LTKQ+K E A+ VI +LGLT+CKNSIIGG   R
Sbjct  133   TQDDVLYPHLTVLETLTYAALLRLPKKLTKQQKTEHAEFVIVELGLTRCKNSIIGGSLFR  192

Query  1465  GISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQ  1286
             GISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRTIV TIHQ
Sbjct  193   GISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRWLARGGRTIVTTIHQ  252

Query  1285  PSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITG  1109
             PSS+L+ +F K+++L EG P+Y GK S VM YF ++G+ P    MNP+DFLLDLANG++ 
Sbjct  253   PSSKLYRMFDKIIVLTEGCPIYCGKNSHVMEYFESIGYVPGFDFMNPADFLLDLANGVSP  312

Query  1108  DDSQAD-------------QATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQF  968
             D  Q D             Q   K+ L++++K N+   LK E+ +     +  +   +  
Sbjct  313   DTRQDDLHESLPKSDQTENQNATKQFLIASYKKNIYPALKEEIDQSFRHPIRLSSRSRDE  372

Query  967   KRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGL  794
              +W   WW QF VLL+RGLK+RK+ES+SGL++ QV+ V+FL+G LWW S    + DQVGL
Sbjct  373   NQWTTSWWLQFKVLLQRGLKERKHESYSGLRIFQVMSVSFLSGLLWWHSDTNHIMDQVGL  432

Query  793   LFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVF  614
             LFF S FWGFFPLF AIF FP+++ ML +ERSSG+Y+LSS++ ARTVGDLPMEL+LPT+F
Sbjct  433   LFFFSIFWGFFPLFSAIFAFPQERPMLIRERSSGIYRLSSYYFARTVGDLPMELILPTIF  492

Query  613   VIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFL  434
             V ++YWM GLKP+   F   L  ILL VLV QGLGLA+GA +MD K ATTL SV+ML FL
Sbjct  493   VTVTYWMGGLKPSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFL  552

Query  433   LAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKK  254
             LA G+Y++H+PSF++W+KY+S   Y YKLL+  QY   E Y C  G   C V D PAIK 
Sbjct  553   LASGYYIQHIPSFVAWLKYVSFSHYCYKLLVGVQYSRFEVYECGIGEE-CRVMDFPAIKC  611

Query  253   IGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             +G+  +++  +VAL++ML+ +R+LAYVAL
Sbjct  612   LGI-DNLVLDLVALVVMLVVFRILAYVAL  639



>gb|KHN16959.1| ABC transporter G family member 14 [Glycine soja]
Length=569

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/570 (58%), Positives = 426/570 (75%), Gaps = 21/570 (4%)
 Frame = -3

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDI  1631
             +V PGE++AMLGPSGSGKTTLLTALGGRL G L+G +TYN +PFS AMKR TGFV QDD+
Sbjct  1     MVSPGEIMAMLGPSGSGKTTLLTALGGRLSGKLSGKVTYNNQPFSGAMKRRTGFVAQDDV  60

Query  1630  LYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGG  1451
             LYPHLTV ETL+FTALLRLP +LTK+EK+   + VI++LGL++C+ S+IGG F RGISGG
Sbjct  61    LYPHLTVFETLLFTALLRLPNSLTKEEKVHHVEHVISELGLSRCRGSMIGGPFFRGISGG  120

Query  1450  ERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRL  1271
             ERKRVSIGQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRT+V TIHQPSSRL
Sbjct  121   ERKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIITTIKGLACGGRTVVTTIHQPSSRL  180

Query  1270  FYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDS---  1100
             +++F KV+LL EG P+Y+G  S  M YFS+VGFS S+ +NP+D +LDLANGI  D S   
Sbjct  181   YHMFDKVVLLSEGCPIYYGPASSAMDYFSSVGFSTSMIVNPADLMLDLANGIAPDSSKLP  240

Query  1099  -------QADQATVKETLVSAFKTNLLENLKMELH--ELND----EDVSS-AGDQKQFKR  962
                    + ++  V+E LVSA+  N+   LK EL   E+N+    +D S+ AG+  + ++
Sbjct  241   TEQSESQEVEKKLVREALVSAYDKNIATRLKDELCSLEVNNFKAIKDASTNAGNHIKPEQ  300

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLF  788
             W   WW QF VLL+RGL++R++E+F+ L++ QV+ VAFL G LWW +  + + D++ LLF
Sbjct  301   WCTSWWHQFKVLLQRGLRERRFEAFNRLRIFQVISVAFLGGLLWWHTPESHIGDRIALLF  360

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             F S FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLARTVGDLP+EL LPT FVI
Sbjct  361   FFSVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVI  420

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I YWM GLKP    F  +L  +L  VLV Q LGLA GA +M+ K ATTL SV  L FL+A
Sbjct  421   IIYWMGGLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIA  480

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
             GG+Y++ +P FI W+KY+S   Y YKLL+  QY   + Y C+ G  +C V + P IK +G
Sbjct  481   GGYYIQQIPPFIEWLKYLSYSYYCYKLLVGVQYNDDDHYECSKGV-LCKVGEFPPIKSVG  539

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             L  H+   V  + LML+GYRL+AY+AL R+
Sbjct  540   L-NHLWVDVAIMALMLVGYRLIAYLALQRM  568



>ref|XP_011008785.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
 ref|XP_011008793.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
Length=684

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/638 (56%), Positives = 459/638 (72%), Gaps = 31/638 (5%)
 Frame = -3

Query  2002  LQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILK  1823
             LQ   Q  + +   I + + RPVTL+F +V Y V    K G  F  ++ + +   + +L 
Sbjct  55    LQGRQQEPALSRFTILRASLRPVTLEFADVAYSVSLSTK-GTWFASSEPKST---RTVLN  110

Query  1822  GVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVT  1643
             GV+GIV PGE+LAMLGPSGSGKTTLLTAL GRL G ++GTI YNG+ FS++MKR TGFVT
Sbjct  111   GVSGIVRPGELLAMLGPSGSGKTTLLTALAGRLPGKVSGTIAYNGQAFSSSMKRRTGFVT  170

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTV ETL + ALLRLP+ LT++EKIEQA+ +I +LGLT+C+NS++GG   RG
Sbjct  171   QDDVLYPHLTVLETLTYAALLRLPKKLTREEKIEQAELIIMELGLTRCRNSVVGGPLFRG  230

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIG EML+NPSLL LDEPTSGLDSTTAQRIV++L  L++GGRT+V TIHQP
Sbjct  231   ISGGERKRVSIGLEMLVNPSLLLLDEPTSGLDSTTAQRIVASLRGLARGGRTVVTTIHQP  290

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD  1106
             SSRL+ +F KV++L EG P+Y G+   VM YF ++G++P    MNP+DFLLDLANG+  D
Sbjct  291   SSRLYRMFDKVVVLSEGCPIYSGQAGRVMEYFKSLGYNPGFNFMNPADFLLDLANGLVPD  350

Query  1105  --------------DSQADQATVKETLVSAFKTNLLENLKMELHE-LNDEDVSSAGDQKQ  971
                           D   DQ + K++L+S++K NL   L  E+H    D  + S+  +  
Sbjct  351   TRSEDDQLEFHGRLDHHDDQNSAKQSLISSYKNNLYPLLISEIHRNAQDPVLPSSSLRGS  410

Query  970   FKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVG  797
               +W    W+QF VLL+RGL++RK+ES+SGL++ QV+ V+ L+G LWW S  + +QDQVG
Sbjct  411   EVQWTTSCWQQFKVLLRRGLQERKHESYSGLRIFQVISVSILSGLLWWHSDTSHIQDQVG  470

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFF S FWGFFPL  AIF FP+++ ML KERSSGMY+LSS++ AR  GDLPMELV+PT+
Sbjct  471   LLFFFSIFWGFFPLSNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPTI  530

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             FV ++YWM GLKP+   F   L  IL  VLV QGLGLA+GA ++D K ATTL SVIML F
Sbjct  531   FVTVAYWMGGLKPSLITFVLTLLIILFNVLVSQGLGLALGAILIDVKQATTLASVIMLVF  590

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGV---CLVEDHP  266
             LLAGG+Y++H+P FI+W+KY+S   Y YKLL+  QY   E Y C    G+   C V D P
Sbjct  591   LLAGGYYIQHIPPFIAWLKYVSFSHYCYKLLVGVQYSATEVYDC----GLQMHCRVMDFP  646

Query  265   AIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
              IK +GL  ++ +   AL +ML+GYRLLAYVAL R+G+
Sbjct  647   DIKYLGL-DNMWWDAAALTIMLVGYRLLAYVAL-RMGQ  682



>ref|XP_006366061.1| PREDICTED: ABC transporter G family member 21-like [Solanum tuberosum]
Length=675

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/627 (57%), Positives = 461/627 (74%), Gaps = 24/627 (4%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPD-QKQGLSFLKTKKQKSEAEKIILKG  1820
             ++ Q       +I +++  PVTLKFE+V Y +K +  K+G  +  + +QK    ++IL+ 
Sbjct  51    SDHQQSHHAKLSILRESLHPVTLKFEDVSYTIKLESNKRG--YFSSHQQKQT--RMILQN  106

Query  1819  VTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQ  1640
             V GIV PGE+LAMLGPSGSGKTTLLT++ GRL G  +GTITYN + FS++MKR  GFVTQ
Sbjct  107   VMGIVKPGELLAMLGPSGSGKTTLLTSIAGRLHGKFSGTITYNDQQFSSSMKRKIGFVTQ  166

Query  1639  DDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGI  1460
             DD+LYPHLTV ETL + ALLRLP  LT QEKIEQA+ VI +LGLT+C+NS+IGG   RGI
Sbjct  167   DDVLYPHLTVLETLTYAALLRLPSKLTNQEKIEQAELVIMELGLTRCRNSMIGGQLFRGI  226

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPS  1280
             SGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI+STL  L++GGRT+V TIHQPS
Sbjct  227   SGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIMSTLRWLARGGRTVVTTIHQPS  286

Query  1279  SRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-  1106
             S LF +F K+++L EG P+Y+GK S VM YF+++G++P    MNP+DFLLDLANGIT D 
Sbjct  287   STLFRMFDKIIVLTEGCPIYYGKSSLVMEYFASIGYAPGFNFMNPADFLLDLANGITHDT  346

Query  1105  ------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKR  962
                         D   +Q   K++L+S+++ N+   LK E+++  +  + S+   +   +
Sbjct  347   RHDDQHELIMKQDQSENQNATKQSLISSYRKNIYPLLKEEINQSCNRPIRSSSTSRD-DQ  405

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW--KSTDLQDQVGLLF  788
             W   WW QF VLL RGLK+RK+E++SGL++ QV+ V+FL+G LWW  K+  + DQVGLLF
Sbjct  406   WTTSWWLQFKVLLGRGLKERKHEAYSGLRIFQVMSVSFLSGLLWWHCKTNHIMDQVGLLF  465

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             F S FWGFFPLF AIF FP+++ ML +ERSSGMY+LSS++ ARTVGDLPMELVLPT+FV 
Sbjct  466   FFSIFWGFFPLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVT  525

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             ++YWM GLKP    F   L  ILL VLV QGLGLA+GA +MD K ATTL SV+ML FLLA
Sbjct  526   VTYWMGGLKPKFVTFILTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLA  585

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
              G+Y++H+P FI+W+KYIS   Y YKLLL  QY   E Y C  G   C V + P IK +G
Sbjct  586   SGYYIQHIPIFINWLKYISFSHYCYKLLLGVQYSRNEVYECGIGK-YCEVLEFPPIKYLG  644

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVAL  167
             +  +++  VVAL++ML+ YRLLAYVAL
Sbjct  645   I-DNLVLDVVALVVMLVVYRLLAYVAL  670



>ref|XP_007143780.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
 gb|ESW15774.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
Length=681

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/669 (54%), Positives = 468/669 (70%), Gaps = 40/669 (6%)
 Frame = -3

Query  2059  ATLMETATEMGDIEAPTTQLQANPQLESDTSA-----------------AIFKKANRPVT  1931
             +T  ET++   + E  TT  +  P LE D +                  ++  ++ RP+T
Sbjct  18    STRSETSSVHHEPEGSTTN-KIKPSLELDDNDIPTQHHTQPTPPPPPRLSVLHQSLRPIT  76

Query  1930  LKFENVVYKV--KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgk  1757
             LKFE+V Y +  +  +K+G       + +S+  + +L GVTG+  PGE+ AMLGPSGSGK
Sbjct  77    LKFEDVSYTITFESQKKKGCVL----RNESKLRRKVLSGVTGVANPGELTAMLGPSGSGK  132

Query  1756  ttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLR  1577
             TTLLTAL GRL G ++GTITYNG   S+ +KR  GFV QDD+LYPHLTV ETL + ALLR
Sbjct  133   TTLLTALAGRLAGKVSGTITYNGHSDSSFVKRKVGFVPQDDVLYPHLTVLETLTYAALLR  192

Query  1576  LPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRVSIGQEMLINPS  1403
             LP++L+++EK E A+ VI++LGLT+C+NS +GG     RGISGGERKRVSIGQEML+NPS
Sbjct  193   LPKSLSREEKKEHAEMVISELGLTRCRNSPVGGCMALFRGISGGERKRVSIGQEMLVNPS  252

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LLF+DEPTSGLDSTTAQ IVS L EL++ GRT+V TIHQPSSRL+ +F KV++L +G P+
Sbjct  253   LLFVDEPTSGLDSTTAQLIVSVLRELARAGRTVVTTIHQPSSRLYRMFDKVVVLSDGYPI  312

Query  1222  YFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQADQATVKETL  1067
             Y G    VM Y  ++G+ P+   MNP+DFLLDLANGI  D       D   DQA+VK++L
Sbjct  313   YSGHAGRVMDYLGSIGYVPAFNFMNPADFLLDLANGIVADVKHDDQIDHNEDQASVKQSL  372

Query  1066  VSAFKTNLLENLKMELHELNDEDV--SSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYE  893
             +S+FK NL   LK ++ + N   +  +S   ++   +W   WW QF VLLKRGL++R++E
Sbjct  373   ISSFKKNLYPALKEDIQQNNTNPLAFTSGTPRRSDNQWTTSWWGQFRVLLKRGLQERRHE  432

Query  892   SFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKM  719
             SFSGL++ QVL V+ L+G LWW S    +QDQVGLLFF S FWGFFPLF AIF FP ++ 
Sbjct  433   SFSGLRIFQVLSVSVLSGLLWWHSDPAHVQDQVGLLFFFSIFWGFFPLFNAIFAFPLERP  492

Query  718   MLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIl  539
             ML KERSSGMY+LSS+++AR VGDLPMELVLPT+FV ISYWM GLKP+   F   +  +L
Sbjct  493   MLIKERSSGMYQLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLKPSLVTFVLTILIML  552

Query  538   lcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQY  359
               VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +P+FI+W+KYIS   Y
Sbjct  553   FNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMPAFIAWLKYISFSHY  612

Query  358   TYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLA  179
              YKLL+  QY   E Y C  G   C V D PAIK + L  ++   V AL +MLIGYR++A
Sbjct  613   CYKLLVAVQYPINEVYECGPGLH-CRVRDFPAIKCLELDDNMWGEVAALTVMLIGYRIVA  671

Query  178   YVALMRVGR  152
             Y+AL R+G+
Sbjct  672   YLAL-RMGQ  679



>gb|KDO40886.1| hypothetical protein CISIN_1g046786mg, partial [Citrus sinensis]
Length=604

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/564 (57%), Positives = 428/564 (76%), Gaps = 16/564 (3%)
 Frame = -3

Query  1855  QKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltal----ggrlgghlagTITYNG  1688
             + S+ EK+ILKGV+G V PGE+LA+LGPSG GKTTLLTAL             G ITYNG
Sbjct  43    KNSDEEKMILKGVSGAVSPGELLAILGPSGCGKTTLLTALGGRLSNGKDTVTQGHITYNG  102

Query  1687  KPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGL  1508
             K FS  +KR TGFV Q+++ YPHLTV ETLVFTALLRLP +L ++EK+  A+AVI QLGL
Sbjct  103   KQFSAEVKRRTGFVAQNNVFYPHLTVAETLVFTALLRLPNSLKREEKVLHAEAVINQLGL  162

Query  1507  TKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE  1328
              +C+NSIIGG  +RG+SGGERKR+SIGQE+LINPSLLFLDEPTSGLDST A++I+ +L +
Sbjct  163   ARCRNSIIGGRLVRGLSGGERKRISIGQELLINPSLLFLDEPTSGLDSTMAKKILVSLSK  222

Query  1327  LSKGGRTIVMTIHQPSSRLFYLFHKV-LLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMN  1151
             L++GGRTI+MTIHQP+S LFY+F+K+ LL  +G+ LYFGKG DV++YF+ +G+ PSVAMN
Sbjct  223   LAEGGRTILMTIHQPASSLFYMFNKILLLSSDGSSLYFGKGEDVINYFAGIGYVPSVAMN  282

Query  1150  PSDFLLDLANGITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQ  971
             P+DFLLDLANG+   D + ++  VK+TL+SA+K+N+   LK E  +  D  +++  D K 
Sbjct  283   PADFLLDLANGVASGDPKENREAVKQTLISAYKSNISNKLKQEFEDGGDHSLTT--DSKN  340

Query  970   FK---RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQD  806
             +K   +W+  WW+ FSVLL+R LK+R++++F GLK+GQ+L ++ +TG +WW+S+  +++D
Sbjct  341   YKKTSKWSTTWWQHFSVLLRRDLKERRHDTFDGLKIGQILFLSIITGLVWWQSSTDNIED  400

Query  805   QVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVL  626
             QVGLLFF S   GFFPLFQA+ TFP ++MML KERSSGMY+LSS+ +A+T GD  MELVL
Sbjct  401   QVGLLFFYSRQAGFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTAGDFVMELVL  460

Query  625   PTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIM  446
             PTVFVII+YWM GLK    NF S L+A L   LV Q LGLA+GA +++Q+ A T+ + +M
Sbjct  461   PTVFVIITYWMGGLKARVINFLSTLAATLYTALVAQSLGLAVGALVLNQRKAGTIATTLM  520

Query  445   LAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGS---GVCLVE  275
             L FLL GGF+V+ VP+FISW++Y+S   Y+YKLLL SQY P +TY C S S     CLV 
Sbjct  521   LTFLLTGGFFVQDVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYICASNSNSNATCLVG  580

Query  274   DHPAIKKIGLGQHVIFSVVALLLM  203
             D P IK +GL   ++ SVV +  M
Sbjct  581   DFPRIKFVGLNNKLL-SVVMMAAM  603



>ref|XP_004139018.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
21-like [Cucumis sativus]
Length=666

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/639 (54%), Positives = 453/639 (71%), Gaps = 22/639 (3%)
 Frame = -3

Query  2023  IEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK-PDQKQGLSFLKTKKQKS  1847
             I  P   L  +    +  + +I +++   +TLKFEN+ Y +K    K+G   L+  + +S
Sbjct  24    ISHPRPDLLIHAVPSAPDTFSILRQSLFSLTLKFENISYSIKVQTNKRGCLSLRNNESQS  83

Query  1846  EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
                + IL GV+G+V PGE+LAMLG SGSGKTTLLTAL  RL G ++GTITYN KPFS+++
Sbjct  84    NTTRTILNGVSGLVRPGELLAMLGTSGSGKTTLLTALAARLPGKISGTITYNDKPFSSSI  143

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
             KR  GFV+QDD+LYPHL+V ETL + A+LRLP  LT +EK+ Q + +I +LGLT+C+NS+
Sbjct  144   KRKIGFVSQDDVLYPHLSVLETLTYAAMLRLPNKLTYEEKVAQTEMIIEELGLTRCRNSV  203

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IGG  LRGISGGERKRVSIG EM++NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT
Sbjct  204   IGGGILRGISGGERKRVSIGHEMIVNPSLLLLDEPTSGLDSTTAQRIVATLRGLARGGRT  263

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM-NPSDFLLD  1130
             +VMTIHQPS+RL+ +F KV++L +G+P+Y G    VM YF ++G+ P   + NP+DFLLD
Sbjct  264   LVMTIHQPSTRLYRMFDKVVVLSDGSPIYSGDAVRVMPYFESIGYLPPFNLINPADFLLD  323

Query  1129  LANGITGDDSQADQATV-----------KETLVSAFKTNLLENLKME-LHELNDEDVSSA  986
             LANGI  D  + DQ               + LV++F+ NL   +K + L E N   V+ +
Sbjct  324   LANGILSDSIREDQVEHFHGGLLLDRQDDQNLVASFRKNLYPQIKAQILTETNISTVARS  383

Query  985   GDQKQFKR--WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--T  818
                K  K   W   WWEQF +LLKRGL  R+ ES+SGL++ QV+ V+FL+G LWW S  +
Sbjct  384   NSLKGSKNNEWTTSWWEQFKILLKRGL--REXESYSGLRIFQVMSVSFLSGLLWWHSDPS  441

Query  817   DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPM  638
              +QDQVGL+FF S FWGFFPLF AIF FP ++ ML KERSSGMY+LSS+++ART GDLPM
Sbjct  442   HIQDQVGLIFFFSIFWGFFPLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTAGDLPM  501

Query  637   ELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLG  458
             ELVLPTVFV ++YWM GL P+   F   L  +LL VLV QGLGLA+GA +M+ K ATTL 
Sbjct  502   ELVLPTVFVTVTYWMGGLNPSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQATTLA  561

Query  457   SVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP-GETYPCTSGSGVCL  281
             SV ML FLL GG+Y+ H+P FISW+KY+S   Y YKL++E+QY    E Y C    G C 
Sbjct  562   SVTMLVFLLVGGYYIEHIPLFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGSFGYCK  621

Query  280   VEDHPAIKKIGLGQHVI-FSVVALLLMLIGYRLLAYVAL  167
             V D PA+K +G+G H + + V AL  ML+GYR+LA++AL
Sbjct  622   VGDFPAVKCLGIGNHSLWWDVTALFFMLVGYRILAFLAL  660



>ref|XP_004496215.1| PREDICTED: ABC transporter G family member 21-like [Cicer arietinum]
Length=681

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/624 (57%), Positives = 448/624 (72%), Gaps = 22/624 (4%)
 Frame = -3

Query  1972  TSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGE  1793
             TS +I  ++ RPVTLKFE+V Y +    ++    +  K+ K    + +L GVTGI  PGE
Sbjct  61    TSFSILPQSLRPVTLKFEDVSYSITLTNQKNKGCVLGKEPK--VTRKVLNGVTGIAKPGE  118

Query  1792  VLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLT  1613
             + AMLGPSGSGKTTLLTAL GRL G ++GTITYNG   S+ MKR  GFV+QDD++YPHLT
Sbjct  119   LTAMLGPSGSGKTTLLTALAGRLTGKVSGTITYNGNSDSSCMKRKIGFVSQDDVVYPHLT  178

Query  1612  VTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVF--LRGISGGERKR  1439
             V ETL +TALLRLP+TLT++EK+E A+ +IT+LGLT+C+NS +GG     RGISGGERKR
Sbjct  179   VLETLTYTALLRLPKTLTREEKVEHAERIITELGLTRCRNSPVGGCLGLFRGISGGERKR  238

Query  1438  VSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLF  1259
             +SIGQEML+NPSLLFLDEPTSGLDSTTAQ IVS L  L++ GRT+V TIHQPSSRL+ +F
Sbjct  239   MSIGQEMLVNPSLLFLDEPTSGLDSTTAQLIVSVLRRLARSGRTVVTTIHQPSSRLYRMF  298

Query  1258  HKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD--------  1106
              KV++L +G P+Y G    VM Y   VGF P    +NP+DFLLDLANGI  D        
Sbjct  299   DKVVVLSDGYPIYSGDAGRVMDYLGFVGFVPGYNFVNPADFLLDLANGIVADVQHDDEIE  358

Query  1105  DSQADQATVKETLVSAFKTNLLENLKMELHELNDED--VSSAGDQKQF--KRWAIPWWEQ  938
                 DQA+VK++L+S++K  L   LK ++   N E     S G  K+    +W   WWEQ
Sbjct  359   HHDQDQASVKQSLISSYKKILYSALKDDIQHTNTEPSVFPSGGTPKRCSDNQWNTSWWEQ  418

Query  937   FSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGF  764
             F VLLKRGL++R++ESFSGLK+ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGF
Sbjct  419   FKVLLKRGLRERRHESFSGLKIFQVLSVSILSGLLWWHSDPSHIQDQVGLLFFFSIFWGF  478

Query  763   FPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGL  584
             FPLF AIF FP ++ ML KERSSGMY LSS+++AR VGDLPMELVLPT+FV I+YWM GL
Sbjct  479   FPLFNAIFAFPLERPMLTKERSSGMYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGL  538

Query  583   KPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHV  404
             KP+   F   L  +L  VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +
Sbjct  539   KPSLITFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKM  598

Query  403   PSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFS  224
             PSFI+W+KYIS   Y YKLL+  QY   E Y C  G   C V D PAIK + +  ++   
Sbjct  599   PSFIAWLKYISFSHYCYKLLVGVQYSVSEVYECRQGLH-CRVRDFPAIKCLEI-DNMWVD  656

Query  223   VVALLLMLIGYRLLAYVALMRVGR  152
             V AL +M IG+R++AY+AL R+G+
Sbjct  657   VAALTIMFIGFRVVAYLAL-RMGQ  679



>ref|XP_003556255.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=682

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/621 (57%), Positives = 450/621 (72%), Gaps = 24/621 (4%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKV--KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEV  1790
             ++  ++ RP+TLKFE+V Y +  +  +K+G       +++S+  + +L GVTG+  PGE+
Sbjct  67    SVLHQSLRPITLKFEDVSYTITFESQKKKGCVL----RKESKLRRKVLTGVTGVANPGEL  122

Query  1789  LAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTV  1610
              AMLGPSGSGKTTLLTAL GRL G ++GTITYNG      +KR  GFV Q+D+LYPHLTV
Sbjct  123   TAMLGPSGSGKTTLLTALAGRLAGKVSGTITYNGHTDPTFVKRKVGFVPQEDVLYPHLTV  182

Query  1609  TETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRV  1436
              ETL + ALLRLP++L+++EK E A+ VIT+LGLT+C+NS +GG     RGISGGERKRV
Sbjct  183   LETLTYAALLRLPKSLSREEKKEHAEMVITELGLTRCRNSPVGGCMALFRGISGGERKRV  242

Query  1435  SIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFH  1256
             SIGQEML+NPSLLF+DEPTSGLDSTTAQ IVS L  L+  GRT+V TIHQPSSRL+ +F 
Sbjct  243   SIGQEMLVNPSLLFVDEPTSGLDSTTAQLIVSVLRGLALAGRTVVTTIHQPSSRLYRMFD  302

Query  1255  KVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DS  1100
             KV++L +G P+Y G+   VM Y  +VG+ P+   MNP+DFLLDLANG+  D       D 
Sbjct  303   KVVVLSDGYPIYSGQAGRVMDYLGSVGYVPAFNFMNPADFLLDLANGVVADVKHDDQIDH  362

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVS---SAGDQKQFKRWAIPWWEQFSV  929
               DQA+VK++L+S+FK NL   LK ++H+ N+ D S   S   ++    W   WWEQF V
Sbjct  363   HEDQASVKQSLMSSFKKNLYPALKEDIHQ-NNTDPSALISGTPRRCDNHWTSSWWEQFRV  421

Query  928   LLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPL  755
             LLKRGL++R++ESFSGL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPL
Sbjct  422   LLKRGLQERRHESFSGLRIFQVLSVSILSGLLWWHSDPSHVQDQVGLLFFFSIFWGFFPL  481

Query  754   FQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPT  575
             F AIF FP ++ ML KERSSGMYKLSS++ AR VGDLPMELVLPT+F+ ISYWM GL P+
Sbjct  482   FNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFITISYWMGGLNPS  541

Query  574   AGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSF  395
                F   L  +L  VLV QG+GLA+GA +MD K AT+L SV ML FLLAGG+Y++ +P+F
Sbjct  542   LVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMPAF  601

Query  394   ISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVA  215
             I+W+KYIS   Y YKLL+  QY   E Y C  G   C V D PAIK + L   +   V A
Sbjct  602   IAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLH-CRVRDFPAIKCLELEDTMWGDVAA  660

Query  214   LLLMLIGYRLLAYVALMRVGR  152
             L +MLIGYR++AY+AL R+G+
Sbjct  661   LTVMLIGYRVVAYLAL-RMGQ  680



>ref|XP_006573283.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=678

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/643 (55%), Positives = 456/643 (71%), Gaps = 28/643 (4%)
 Frame = -3

Query  2032  MGDIEAPTTQLQANPQLE-SDTSAAIFKKANRPVTLKFENVVYKVK--PDQKQGLSFLKT  1862
             + DI   T+Q   N Q+  S    +I +++ RPVTLKFE+V Y +    D    +S    
Sbjct  44    INDIHNHTSQ---NHQVAPSAPRFSILQQSLRPVTLKFEDVSYSITFGRDNNGCVS----  96

Query  1861  KKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKP  1682
               QK +  + +L GVTG+V PGEV+AMLGPSGSGKTTLLTAL GRL G L+G ITYNG P
Sbjct  97    -PQKPKHTRTVLNGVTGMVGPGEVMAMLGPSGSGKTTLLTALAGRLDGKLSGAITYNGHP  155

Query  1681  FSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTK  1502
             FS++MKRN GFV+QDD+LYPHLTV E+L + A+L+LP++LT++EK+EQ + +I  LGL++
Sbjct  156   FSSSMKRNIGFVSQDDVLYPHLTVLESLTYAAMLKLPKSLTREEKMEQVEMIIVDLGLSR  215

Query  1501  CKNSIIGG--VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWE  1328
             C+NS +GG     RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI++ L  
Sbjct  216   CRNSPVGGGAALFRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIMAMLQS  275

Query  1327  LSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MN  1151
             L+   RT+V TIHQPSSRL+++F KV++L +G P++ G+   VM Y  ++GF P    +N
Sbjct  276   LAGAYRTVVTTIHQPSSRLYWMFDKVVVLSDGYPIFTGQTDQVMDYLESIGFVPVFNFVN  335

Query  1150  PSDFLLDLANGITGD-------DSQADQATVKETLVSAFKTNLLENLKMELHELNDED--  998
             P+DFLLDLANGI  D       D   DQA++K+ LVS++K NL   LK E+ + + E   
Sbjct  336   PADFLLDLANGIVADAKQEEQIDHHEDQASIKQFLVSSYKKNLYPLLKQEIQQNHRELAF  395

Query  997   VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-  821
             ++S   +    +W   WWEQF VLLKRGL +R++ES+S L++ QVL V+ L+G LWW S 
Sbjct  396   LTSGAPRSSENQWTTSWWEQFMVLLKRGLMERRHESYSRLRIFQVLSVSILSGLLWWHSD  455

Query  820   -TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDL  644
              + + DQVGLLFF S FWGFFPLF A+F FP ++ ML KERSSGMY LSS+++AR VGDL
Sbjct  456   PSHIHDQVGLLFFFSIFWGFFPLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDL  515

Query  643   PMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATT  464
             PME VLPT+FV ISYWM GLKP+   F   L  +L  VLV QG+GLA+GA +MD K ATT
Sbjct  516   PMEFVLPTIFVTISYWMGGLKPSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATT  575

Query  463   LGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVC  284
             L SV ML FLLAGG+Y+RH+P FI+W+KYIS   Y YKLL+  QY   E Y C  G    
Sbjct  576   LASVTMLVFLLAGGYYIRHIPFFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRQGLHY-  634

Query  283   LVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVG  155
              + D PAIK +GL   +   V  L +MLIGYR++AY+AL R+G
Sbjct  635   RIRDFPAIKCLGLDS-LWGDVAVLAVMLIGYRVVAYLAL-RMG  675



>ref|XP_004236984.1| PREDICTED: ABC transporter G family member 21 [Solanum lycopersicum]
Length=675

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/626 (57%), Positives = 457/626 (73%), Gaps = 22/626 (4%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGV  1817
             +N Q       +I +++  PVTLKFE+V Y +K    +G  F   +++++   ++IL+ V
Sbjct  51    SNHQQSHHAKLSILRESLHPVTLKFEDVSYTIKLKSNKGGYFFSHQQKQN---RVILQNV  107

Query  1816  TGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQD  1637
              GIV PGE+LAMLGPSGSGKTTLLT+L GRL G  +G ITYN + FS++MKR TGFVTQD
Sbjct  108   MGIVKPGELLAMLGPSGSGKTTLLTSLAGRLHGKFSGNITYNDQQFSSSMKRKTGFVTQD  167

Query  1636  DILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGIS  1457
             D+LYPHLTV ETL + ALLRLP  LTK+EKIEQ + VI +LGLT+C+NS+IGG   RGIS
Sbjct  168   DVLYPHLTVFETLTYAALLRLPSKLTKEEKIEQVELVIMELGLTRCRNSMIGGQLFRGIS  227

Query  1456  GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSS  1277
             GGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRIV+TL  L++GGRT+V TIHQPSS
Sbjct  228   GGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVATLRWLARGGRTVVTTIHQPSS  287

Query  1276  RLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD--  1106
              LF +F K+++L EG P+Y+GK S VM YF+++G++P    MNP+DFLLDLANGIT D  
Sbjct  288   TLFRMFDKIIVLTEGCPIYYGKSSLVMEYFASIGYAPGFNFMNPADFLLDLANGITHDTR  347

Query  1105  -----------DSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRW  959
                        D   +Q   K++L+S+++ N+   LK E+++ + +    +    +  +W
Sbjct  348   HYDQHELIMKQDQSENQNATKQSLISSYRKNIYPLLKEEINQ-SCKRSIRSSSISRDHQW  406

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWW--KSTDLQDQVGLLFF  785
                WW QF VLL RGLK+RK+E++SGL++ QV+ V+FL+G LWW   +  + DQVGLLFF
Sbjct  407   TTSWWLQFKVLLGRGLKERKHEAYSGLRIFQVMSVSFLSGLLWWHCNTNHIMDQVGLLFF  466

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGFFPLF AIF FP+++ ML +ERSSGMY+LSS++ AR+VGDLPMELVLPT+FV +
Sbjct  467   FSIFWGFFPLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARSVGDLPMELVLPTIFVTV  526

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWM GLKP    F   L  ILL VLV QG+GLA+GA +MD K ATTL SV+ML FLLA 
Sbjct  527   TYWMGGLKPKFLTFILTLLIILLNVLVSQGIGLALGAILMDVKQATTLSSVLMLVFLLAS  586

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+Y++H+P FI W+KYIS   Y YKLLL  QY   E Y C  G   C V + P IK +G+
Sbjct  587   GYYIQHIPIFIDWLKYISFSHYCYKLLLGVQYSRNEVYECGIGK-YCEVLEFPPIKYLGI  645

Query  244   GQHVIFSVVALLLMLIGYRLLAYVAL  167
               +++  VVAL++ML+ YRLLAYVAL
Sbjct  646   -DNLVLDVVALVVMLVVYRLLAYVAL  670



>gb|KHN07535.1| ABC transporter G family member 21 [Glycine soja]
Length=566

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/566 (58%), Positives = 415/566 (73%), Gaps = 17/566 (3%)
 Frame = -3

Query  1810  IVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDI  1631
             +V PGEV+AMLGPSGSGKTTLLTAL GRL G L+  ITYNG PFS++MKRN GFV+QDD+
Sbjct  1     MVGPGEVMAMLGPSGSGKTTLLTALAGRLDGKLSSAITYNGHPFSSSMKRNIGFVSQDDV  60

Query  1630  LYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG--VFLRGIS  1457
             LYPHLTV E+L + A+L+LP++LT++EK+EQ + +I  LGL++C+NS +GG     RGIS
Sbjct  61    LYPHLTVLESLTYAAMLKLPKSLTREEKMEQVEMIIVDLGLSRCRNSPVGGGAALFRGIS  120

Query  1456  GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSS  1277
             GGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI++ L  L+   RT+V TIHQPSS
Sbjct  121   GGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIMAMLQSLAGAYRTVVTTIHQPSS  180

Query  1276  RLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD--  1106
             RL+++F KV++L +G P++ G+   VM Y  ++GF P    +NP+DFLLDLANGI  D  
Sbjct  181   RLYWMFDKVVMLSDGYPIFTGQTDQVMDYLESIGFVPVFNFVNPADFLLDLANGIVADVK  240

Query  1105  -----DSQADQATVKETLVSAFKTNLLENLKMELHELNDE--DVSSAGDQKQFKRWAIPW  947
                  D   DQA++K+ LVS++K NL   LK E+ + + E   ++S   +    +W   W
Sbjct  241   QEEQIDHHEDQASIKQFLVSSYKKNLYPLLKQEIQQNHRELAFLTSGAPRSSENQWTTSW  300

Query  946   WEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSF  773
             WEQF VLLKRGL +R++ES+S L++ QVL V+ L+G LWW S  + + DQVGLLFF S F
Sbjct  301   WEQFMVLLKRGLMERRHESYSRLRIFQVLSVSILSGLLWWHSDPSHIHDQVGLLFFFSIF  360

Query  772   WGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWM  593
             WGF+PLF A+F FP ++ ML KERSSGMY LSS+++AR VGDLPME VLPT+FV ISYWM
Sbjct  361   WGFYPLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDLPMEFVLPTIFVAISYWM  420

Query  592   AGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYV  413
              GLKP+   F   L  +L  VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y+
Sbjct  421   GGLKPSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYI  480

Query  412   RHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHV  233
             RH+P FI+W+KYIS   Y YKLL+  QY   E Y C  G   C + D  AIK +GL   +
Sbjct  481   RHIPFFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRHGLH-CRIRDFLAIKCLGLDS-L  538

Query  232   IFSVVALLLMLIGYRLLAYVALMRVG  155
                V  L +MLIGYR++AY+AL R+G
Sbjct  539   WGDVAVLAVMLIGYRVVAYLAL-RMG  563



>gb|EPS63929.1| hypothetical protein M569_10851 [Genlisea aurea]
Length=634

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/611 (54%), Positives = 436/611 (71%), Gaps = 20/611 (3%)
 Frame = -3

Query  1969  SAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEV  1790
             S +I ++   PVTLKFE++  KV            +K      +K IL G+TG V PGEV
Sbjct  34    SNSIVQRTLFPVTLKFEDIGCKVG-----------SKSDSVLKQKTILNGITGTVSPGEV  82

Query  1789  LAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTV  1610
             LAMLGPSGSGKTTLLTALGGRL G L+G ITYNG+PFS  ++R TGFV+QDD+LY HLTV
Sbjct  83    LAMLGPSGSGKTTLLTALGGRLAGKLSGRITYNGEPFSGTIRRKTGFVSQDDVLYQHLTV  142

Query  1609  TETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSI  1430
              ETL+FTALLRLP +L + +K+   ++VI +LGLTKC++S+IGG  LRGISGGE+KRVSI
Sbjct  143   FETLLFTALLRLPDSLKEHDKVRHVESVIAELGLTKCRSSMIGGPLLRGISGGEKKRVSI  202

Query  1429  GQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKV  1250
             GQEMLINPSLL LDEPTSGLDSTTAQRI++T+  L+ GGRTIV TIHQPSSR++ +F KV
Sbjct  203   GQEMLINPSLLLLDEPTSGLDSTTAQRIMNTIRGLAGGGRTIVTTIHQPSSRVYQMFDKV  262

Query  1249  LLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQATVKET  1070
             +LL EG P+Y+G GS  M YFS++GFSPS+ +NP+D LLDLANG+  D  +     V+E 
Sbjct  263   VLLSEGRPIYYGSGSGAMEYFSSIGFSPSIPINPADLLLDLANGVAPDYCEKKTEDVREY  322

Query  1069  LVSAFKTNLLENLKMELHE---LNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRK  899
             L++A++ N+    K E+     +ND         ++ ++W+  WW +F +L+ RGL++R+
Sbjct  323   LLAAYEKNIWSKAKTEVRSSETINDTSGGGGLKHRRGEKWSTSWWNEFCILIARGLRERR  382

Query  898   YESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             +E+F+ L++ QVL VA L G LWW++  + + D++ ++FF S FWGF+PL+ A+FTFP+D
Sbjct  383   FEAFNKLRIFQVLSVAILGGLLWWQTPPSHIDDRIAMIFFYSVFWGFYPLYNAVFTFPQD  442

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
             + +L KE+SS MY+LSS+FLARTV DLP++L LP  F ++ Y+M GL P    F  +L  
Sbjct  443   RAILRKEKSSSMYRLSSYFLARTVADLPLDLALPAAFTVVFYFMGGLTPRPLPFLLSLLN  502

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             ILL VLV QGLGL  GA +MD K A TL SV  L FL+AGG+YVR +P FI WI+Y+S  
Sbjct  503   ILLAVLVSQGLGLLFGALLMDVKQAATLASVTTLVFLIAGGYYVRRIPPFIGWIRYLSFS  562

Query  364   QYTYKLLLESQYKPGETYPC---TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIG  194
              Y+Y++LL  QY  G+ Y C     G+  C V D PA+K +GLG   +    A++ ML+G
Sbjct  563   YYSYRMLLGVQYGEGDVYECGGGGGGTSYCRVADFPAVKAVGLGGLWV-DAAAMVAMLVG  621

Query  193   YRLLAYVALMR  161
             YR+LAY AL R
Sbjct  622   YRVLAYFALRR  632



>ref|XP_006361228.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum tuberosum]
Length=659

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/671 (52%), Positives = 465/671 (69%), Gaps = 37/671 (6%)
 Frame = -3

Query  2104  IHCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQ-----LESDTSAAIFKKANR  1940
             +HC    P   ++    LME +T      +P +  Q +       ++  +  +  +KA  
Sbjct  3     LHCVAPNP---EKGGTDLMEASTN-----SPNSSKQYDKSCLGFPVQIKSQQSFLQKAMY  54

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE +VYK+  + K G+        K   EK IL GVTG V+PGE+LAMLGPSGSG
Sbjct  55    PITLKFEEIVYKISQENK-GMCCGGPSNTK---EKTILNGVTGTVYPGEMLAMLGPSGSG  110

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRL G L+G ITYN +PFS ++KR TGFV+QDD+LYPHLTV ETL+FTALL
Sbjct  111   KTTLLTALGGRLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALL  170

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP++L + EK+   + VI +LGL KC+NS+IGG   RGISGGE+KRVSIGQEMLINPS+
Sbjct  171   RLPQSLDRVEKVRHVEHVIAELGLNKCRNSMIGGSLFRGISGGEKKRVSIGQEMLINPSI  230

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIHQPSSRL+++F KV+LL EG P+Y
Sbjct  231   LLLDEPTSGLDSTTALRILNTVKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIY  290

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDSQADQATVKETL  1067
             +G  S  + YFS++GFS S+ +NP+D LLDLANGI          GD  + ++  V+E L
Sbjct  291   YGPASTALEYFSSIGFSISITINPADLLLDLANGIGPETKNANDQGDSIEQEKKLVREAL  350

Query  1066  VSAFKTNLLENLKMELHELND------EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQ  905
             +SA++ N+   LK E+  L++      +DVS+    K  ++W   W  QF +LL RGL++
Sbjct  351   ISAYEKNISTRLKTEVCSLDNSSYSYTKDVSTRNGVK-LEQWCTSWMHQFKILLMRGLRE  409

Query  904   RKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFP  731
             R++ESF+ L++ QV+ VAFL G LWW   ++ ++D++ +LFF + FWGF+PL+ A+FTFP
Sbjct  410   RRHESFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFP  469

Query  730   EDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSAL  551
             +++ ML KERSSGMY+LSS+FLA+TV DLP+EL LPT F  I YWM GLKP    F  +L
Sbjct  470   QERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMGGLKPDPTTFILSL  529

Query  550   SAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYIS  371
               +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+KY+S
Sbjct  530   LVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLS  589

Query  370   IGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGY  191
                Y+YKLLL  QY   + Y C+ G   C V + PAI+ +GL    I  V  + +ML+GY
Sbjct  590   YSYYSYKLLLGVQYNDNDYYECSKGV-YCQVANLPAIESVGLNNMWI-DVSVMAVMLVGY  647

Query  190   RLLAYVALMRV  158
             R++AY+AL RV
Sbjct  648   RVVAYLALTRV  658



>ref|XP_006361227.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum tuberosum]
Length=662

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/673 (51%), Positives = 463/673 (69%), Gaps = 38/673 (6%)
 Frame = -3

Query  2104  IHCPESFPSSSDQQEATLMETATEMGDIEAPTTQLQANPQ-----LESDTSAAIFKKANR  1940
             +HC    P   ++    LME +T      +P +  Q +       ++  +  +  +KA  
Sbjct  3     LHCVAPNP---EKGGTDLMEASTN-----SPNSSKQYDKSCLGFPVQIKSQQSFLQKAMY  54

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+TLKFE +VYK+  + K G+        K   EK IL GVTG V+PGE+LAMLGPSGSG
Sbjct  55    PITLKFEEIVYKISQENK-GMCCGGPSNTK---EKTILNGVTGTVYPGEMLAMLGPSGSG  110

Query  1759  kttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALL  1580
             KTTLLTALGGRL G L+G ITYN +PFS ++KR TGFV+QDD+LYPHLTV ETL+FTALL
Sbjct  111   KTTLLTALGGRLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALL  170

Query  1579  RLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSL  1400
             RLP++L + EK+   + VI +LGL KC+NS+IGG   RGISGGE+KRVSIGQEMLINPS+
Sbjct  171   RLPQSLDRVEKVRHVEHVIAELGLNKCRNSMIGGSLFRGISGGEKKRVSIGQEMLINPSI  230

Query  1399  LFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLY  1220
             L LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIHQPSSRL+++F KV+LL EG P+Y
Sbjct  231   LLLDEPTSGLDSTTALRILNTVKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIY  290

Query  1219  FGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGIT------------GDDSQADQATVK  1076
             +G  S  + YFS++GFS S+ +NP+D LLDLANG++            GD  + ++  V+
Sbjct  291   YGPASTALEYFSSIGFSISITINPADLLLDLANGLSGIGPETKNANDQGDSIEQEKKLVR  350

Query  1075  ETLVSAFKTNLLENLKMELHELNDEDVSSAGDQK-----QFKRWAIPWWEQFSVLLKRGL  911
             E L+SA++ N+   LK E+  L++   S   D       + ++W   W  QF +LL RGL
Sbjct  351   EALISAYEKNISTRLKTEVCSLDNSSYSYTKDVSTRNGVKLEQWCTSWMHQFKILLMRGL  410

Query  910   KQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFT  737
             ++R++ESF+ L++ QV+ VAFL G LWW   ++ ++D++ +LFF + FWGF+PL+ A+FT
Sbjct  411   RERRHESFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRIAMLFFFAVFWGFYPLYNAVFT  470

Query  736   FPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFS  557
             FP+++ ML KERSSGMY+LSS+FLA+TV DLP+EL LPT F  I YWM GLKP    F  
Sbjct  471   FPQERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMGGLKPDPTTFIL  530

Query  556   ALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKY  377
             +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P FI W+KY
Sbjct  531   SLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKY  590

Query  376   ISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLI  197
             +S   Y+YKLLL  QY   + Y C+ G   C V + PAI+ +GL    I  V  + +ML+
Sbjct  591   LSYSYYSYKLLLGVQYNDNDYYECSKGV-YCQVANLPAIESVGLNNMWI-DVSVMAVMLV  648

Query  196   GYRLLAYVALMRV  158
             GYR++AY+AL RV
Sbjct  649   GYRVVAYLALTRV  661



>ref|XP_009356025.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/650 (55%), Positives = 454/650 (70%), Gaps = 36/650 (6%)
 Frame = -3

Query  2011  TTQLQANPQLESDTS---------AAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTK  1859
             +++   NP L  D +         A+I  ++ RPVTLKFE+V Y +K    +G       
Sbjct  38    SSRTNVNPCLGDDMTDQPQPTSHRASILHQSLRPVTLKFEDVGYSIKLQTAKGGC---VA  94

Query  1858  KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPF  1679
               + +  + +L GV+GIV PGE+LAMLGPSGSGKTTLLTALGGRL   ++G ITYNG+ F
Sbjct  95    SHEPKPTRTVLNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPNKISGKITYNGQNF  154

Query  1678  SNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKC  1499
             S++MK NTGFVTQDD+LYPHLTV ETL +TALLRLP+ LTK+EKIEQA+ VI +LGL +C
Sbjct  155   SSSMKHNTGFVTQDDVLYPHLTVLETLTYTALLRLPKQLTKEEKIEQAETVIMELGLNRC  214

Query  1498  KNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSK  1319
             ++ IIGG  LRG+SGGERKRVSIGQEML+NPSLL LDEPTSGLDSTTAQRI+ TL  L++
Sbjct  215   RDGIIGGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIIVTLRRLAR  274

Query  1318  GGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSD  1142
             GGR    T  QPSSRL+ +F KV++L +G P+Y G    VM YF ++G+      +NP+D
Sbjct  275   GGRXXXPTSQQPSSRLYRMFDKVVVLSDGYPIYSGHAGRVMDYFGSIGYEAGFNFINPAD  334

Query  1141  FLLDLANGITGD-------------DSQADQATVKETLVSAFKTNLLENLKMELHELNDE  1001
             FLLDLANGI  +             D Q +Q T K+ L+S++K NL   LK+E+ +   +
Sbjct  335   FLLDLANGIAPNAKQDEQVEYSGRLDHQEEQNTTKQFLISSYKMNLYPALKIEIQQTQKD  394

Query  1000  DVSSAGDQKQFK-----RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
              V S+      +     +W   WWE+F VLL+RGLK+RK+ESFSGLK+ QV+ V+ L+G 
Sbjct  395   TVVSSSRIPSSRGRGNYQWTTSWWEEFRVLLERGLKERKHESFSGLKIFQVMSVSILSGL  454

Query  835   LWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
              WW S  + +QDQVGLLFF S FWGFFPL  AIF+FP ++ ML KERSSGMY+LSS++ A
Sbjct  455   FWWHSDISHIQDQVGLLFFFSIFWGFFPLSNAIFSFPMERPMLIKERSSGMYRLSSYYFA  514

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             RTVGDLPMELVLPTVF+ ISYWM GLKP+   F   L  +L  VLV QGLGLA+GA +M+
Sbjct  515   RTVGDLPMELVLPTVFITISYWMGGLKPSLVTFALTLFIVLYNVLVSQGLGLALGAILMN  574

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT  302
              K  TTL SV ML FLL GG+Y++H+P FI+W+KY+S   Y YKLL+  QY   E Y C 
Sbjct  575   VKQGTTLASVTMLVFLLVGGYYIQHIPPFIAWLKYVSFSHYCYKLLVGVQYSAHEVYECE  634

Query  301   SGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
              G   C V D P IK +GL  ++   V AL +ML+GYR LAY+AL R+G+
Sbjct  635   MGMH-CRVIDFPGIKCVGL-DNMWIDVAALAVMLVGYRFLAYMAL-RMGQ  681



>ref|XP_010528033.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=684

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/642 (56%), Positives = 463/642 (72%), Gaps = 27/642 (4%)
 Frame = -3

Query  2023  IEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSE  1844
             I  P  +     Q E     +I  ++  P+ L FE++ Y +  + + G +      Q+S+
Sbjct  44    IPCPDHESSGPHQNEQSRKYSILCRSLCPLILNFEDLTYSI--NLQTGKASYWFCSQESK  101

Query  1843  AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMK  1664
               ++IL GVTG+V PGE+LAMLGPSGSGKTTLLTAL GRL G L+G++TYNG PFS+++K
Sbjct  102   PTRLILNGVTGLVKPGELLAMLGPSGSGKTTLLTALAGRLNGKLSGSVTYNGHPFSSSVK  161

Query  1663  RNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSII  1484
             R  GFVTQDD+LYPHLTVTETL FTALLRLP+ LT+ EK E  ++VI+ LGL +C NSII
Sbjct  162   RKIGFVTQDDVLYPHLTVTETLTFTALLRLPKELTRLEKTEHVESVISDLGLNRCINSII  221

Query  1483  GGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTI  1304
             GG  +RGISGGERKRVSIGQEML+NPSLL LDEPTSGLDST A R+++T   L++GGRT+
Sbjct  222   GGGLIRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTAAARVIATARGLARGGRTV  281

Query  1303  VMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSP-SVAMNPSDFLLDL  1127
             V TIHQPSSRL+ +F KVL+L +G+P+Y G    VM YF  +GF P S  +NP+DF+LDL
Sbjct  282   VATIHQPSSRLYRMFDKVLVLSDGSPIYSGDSGRVMEYFGFIGFQPGSSFVNPADFVLDL  341

Query  1126  ANGITGDDSQADQA-------------TVKETLVSAFKTNLLENLKMELHELNDEDVSSA  986
             ANGIT D  Q DQA             +VK+ L+S+++ NL   LK E+     +  + +
Sbjct  342   ANGITPDTKQYDQAELHGRLDRHEEQNSVKQMLMSSYRKNLYPLLKEEISRTLPQHQAVS  401

Query  985   GDQKQFK------RWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK  824
             G + +        +W+  WW QF VLL RGLK+R++ESFSGL++ QV+ V+ L+G LWW 
Sbjct  402   GSRTKSPTRTKEIKWSASWWMQFYVLLNRGLKERRHESFSGLRILQVMSVSILSGLLWWH  461

Query  823   S--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVG  650
             S  + LQDQVGLLFF S FWGFFPLF AIFTFP+++ ML KERSSGMYKLSS+F+ARTVG
Sbjct  462   SRVSHLQDQVGLLFFFSIFWGFFPLFNAIFTFPQERPMLLKERSSGMYKLSSYFVARTVG  521

Query  649   DLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSA  470
             DLPMEL+LPTVF+ ++YWM+GLKP+   F   L  +L  VLV QG+GLA+GA +MD K A
Sbjct  522   DLPMELILPTVFITVTYWMSGLKPSLTTFLLTLLIVLYNVLVAQGVGLAMGAILMDVKQA  581

Query  469   TTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSG  290
             TTL SV ML FLLAGG+Y++H+P+FI+W+KYIS   Y YKLL+  QY   E Y C  G G
Sbjct  582   TTLSSVTMLVFLLAGGYYIQHIPAFIAWLKYISFSHYCYKLLVGVQYTGNEVYEC--GLG  639

Query  289   V-CLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             + C V D+  I+ +  G ++++ VVAL +ML+GYR+LAY+AL
Sbjct  640   LHCRVMDYEGIRNLMTGDNMMWDVVALGIMLVGYRVLAYLAL  681



>ref|XP_009631041.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=660

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/650 (54%), Positives = 463/650 (71%), Gaps = 30/650 (5%)
 Frame = -3

Query  2056  TLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGL  1877
             T +  ++E+ D+      +Q N Q       +  ++A  P+TLKFE +VYK++  + QG+
Sbjct  22    TNLPDSSELHDMSCLAFPVQFNSQ-------SFAQRALYPITLKFEEIVYKIR-QETQGM  73

Query  1876  SFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTIT  1697
                      +  EK IL GVTGIV PGE+LAMLGPSGSGKTTLLTALGGRL G L+G IT
Sbjct  74    CC--GDGASNTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKIT  131

Query  1696  YNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQ  1517
             YN +PFS ++KR TGFV QDD+LYPHLTV ETL+FTALLRLP++L+K+ K+   + VIT+
Sbjct  132   YNSQPFSGSIKRKTGFVAQDDVLYPHLTVIETLLFTALLRLPQSLSKEAKVRHVEHVITE  191

Query  1516  LGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVST  1337
             LGL KC+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T
Sbjct  192   LGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTT  251

Query  1336  LWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA  1157
             +  L+ GGRT++ TIHQPSSRL+++F KV+LL EG P+Y+G  S  + YFS++GFS S+ 
Sbjct  252   VKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASSALDYFSSIGFSISIT  311

Query  1156  MNPSDFLLDLANGI---------TGDDSQADQATVKETLVSAFKTNLLENLKMELHELND  1004
             +NP+D LLDLANGI          GD+++ ++  V+E L+SA++ N+   LK EL   ++
Sbjct  312   VNPADLLLDLANGIGPDSKHAIEQGDNTEQEKKLVREALISAYEKNISTRLKSELCSSDN  371

Query  1003  ------EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLT  842
                   +DVS+    K  ++W   W  QF VLL RGL++R+YE+F+ L++ QV+ VAFL 
Sbjct  372   SNYSYKKDVSTRNGVKS-EQWCTNWSHQFKVLLLRGLRERRYETFNRLRIFQVISVAFLA  430

Query  841   GALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFF  668
             G LWW   ++ ++D++ +LFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+F
Sbjct  431   GLLWWHTPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYF  490

Query  667   LARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFI  488
             LA+TVGDLP+EL LPT F  I YWM GLK     F  +L  +L  VLV Q LGLA GA +
Sbjct  491   LAKTVGDLPLELALPTAFTFILYWMGGLKADPTTFILSLLVVLYNVLVSQSLGLAFGALL  550

Query  487   MDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             MD K ATTL SV  L FL+AGG+Y++ +PSFI W+KY+S   Y+YKLLLE QY   + Y 
Sbjct  551   MDVKQATTLASVTTLVFLIAGGYYIQQIPSFIVWLKYLSYSYYSYKLLLEVQYNDSDFYE  610

Query  307   CTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             C+ G   C V D PAIK +GL    I  V  + +MLIGYRL+AY+AL RV
Sbjct  611   CSKGV-YCQVADFPAIKSVGLNNMWI-DVSIMAVMLIGYRLVAYLALTRV  658



>gb|KHN00888.1| ABC transporter G family member 21 [Glycine soja]
Length=674

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/621 (56%), Positives = 447/621 (72%), Gaps = 31/621 (5%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKV--KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEV  1790
             ++  ++ RP+TLKFE+V Y +  +  +K+G       +++S+  + +L GVTG+  PGE+
Sbjct  66    SVLHQSLRPITLKFEDVSYTITFESQKKKGCVL----RKESKLRRKVLTGVTGVANPGEL  121

Query  1789  LAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTV  1610
              AMLGPSGSGKTTLLTAL GRL G ++GTITYNG+     +KR  GFV Q+D+LYPHLTV
Sbjct  122   TAMLGPSGSGKTTLLTALAGRLAGKVSGTITYNGQTDPTFVKRKVGFVPQEDVLYPHLTV  181

Query  1609  TETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRV  1436
              ETL + ALLRLP++L+++EK E A+ VIT+LGLT+C+NS +GG     RGISGGERKRV
Sbjct  182   LETLTYAALLRLPKSLSREEKKEHAEMVITELGLTRCRNSPVGGCMALFRGISGGERKRV  241

Query  1435  SIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFH  1256
             SIGQEML+NPSLLF+DEPTSGLDSTTAQ I       +  GRT+V TIHQPSSRL+ +F 
Sbjct  242   SIGQEMLVNPSLLFVDEPTSGLDSTTAQLI-------ALAGRTVVTTIHQPSSRLYRMFD  294

Query  1255  KVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DS  1100
             KV++L +G P+Y G+   VM Y  +VG+ P+   MNP+DFLLDLANG+  D       D 
Sbjct  295   KVVVLSDGYPIYSGQAGRVMDYLGSVGYVPAFNFMNPADFLLDLANGVVADVKHDDQIDH  354

Query  1099  QADQATVKETLVSAFKTNLLENLKMELHELNDEDVS---SAGDQKQFKRWAIPWWEQFSV  929
               DQA+VK++L+S+FK NL   LK ++H+ N+ D S   S   ++    W   WWEQF V
Sbjct  355   HEDQASVKQSLMSSFKKNLYPALKEDIHQ-NNTDPSALISGTPRRCDNHWTSSWWEQFRV  413

Query  928   LLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPL  755
             LLKRGL++R++ESFSGL++ QVL V+ L+G LWW S  + +QDQVGLLFF S FWGFFPL
Sbjct  414   LLKRGLQERRHESFSGLRIFQVLSVSILSGLLWWHSDPSHVQDQVGLLFFFSIFWGFFPL  473

Query  754   FQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPT  575
             F AIF FP ++ ML KERSSGMYKLSS++ AR VGDLPMELVLPT+FV ISYWM GL P+
Sbjct  474   FNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFVTISYWMGGLNPS  533

Query  574   AGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSF  395
                F   L  +L  VLV QG+GLA+GA +MD K AT+L SV ML FLLAGG+Y++ +P+F
Sbjct  534   LVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMPAF  593

Query  394   ISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVA  215
             I+W+KYIS   Y YKLL+  QY   E Y C  G   C V D PAIK + L   +   V A
Sbjct  594   IAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLH-CRVRDFPAIKCLELEDTMWGDVAA  652

Query  214   LLLMLIGYRLLAYVALMRVGR  152
             L +MLIGYR++AY+AL R+G+
Sbjct  653   LTVMLIGYRVVAYLAL-RMGQ  672



>ref|XP_009802424.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=658

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/669 (53%), Positives = 467/669 (70%), Gaps = 34/669 (5%)
 Frame = -3

Query  2104  IHCPESFPSSSDQQ---EATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPV  1934
             ++C    P +S  +     T +   +E+ D+      +Q N Q       +  ++A  P+
Sbjct  3     VNCIAPKPENSGTEVMAAPTNLPNPSELHDMSCLAFPVQINSQ-------SFSQRALYPI  55

Query  1933  TLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkt  1754
             TLKFE +VYK++  + QG+    T   K   EK IL GVTGIV PGE+LAMLGPSGSGKT
Sbjct  56    TLKFEEIVYKIR-QETQGMCCGGTSNTK---EKTILNGVTGIVCPGEMLAMLGPSGSGKT  111

Query  1753  tlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRL  1574
             TLLTALGGRL G L+G ITYN +PFS ++KR TGFV QDD+LYPHLTV ETL+FTALLRL
Sbjct  112   TLLTALGGRLSGKLSGKITYNSQPFSGSIKRRTGFVAQDDVLYPHLTVIETLLFTALLRL  171

Query  1573  PRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLF  1394
             P++L+K+ K+   + VIT+LGL KC+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL 
Sbjct  172   PQSLSKEAKVRHVEHVITELGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLL  231

Query  1393  LDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFG  1214
             LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIHQPSSRL+++F KV+LL EG P+Y+G
Sbjct  232   LDEPTSGLDSTTALRILTTVKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIYYG  291

Query  1213  KGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDSQADQATVKETLVS  1061
               S  + YFS++GF  S+ +NP+D LLDLANGI          GD+++ ++  V+E L+S
Sbjct  292   PASSALDYFSSIGFPISITVNPADLLLDLANGIGPDSKHAIEQGDNTEQEKKFVREALIS  351

Query  1060  AFKTNLLENLKMELHELND------EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRK  899
             A++ N+   LK EL   ++      +DVS+    K   +W   W  QF VLL RGL++R+
Sbjct  352   AYEKNISTRLKSELCSSDNSNYSYKKDVSTRNGMKS-AQWCTSWSHQFKVLLLRGLRERR  410

Query  898   YESFSGLKVGQVLVVAFLTGALWWK--STDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             YE+F+ L++ QV+ VAFL G LWW   ++ ++D++ +LFF + FWGF+PL+ A+FTFP++
Sbjct  411   YETFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFPQE  470

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
             + ML KERSSGMY+LSS+FLA+TVGDLP+EL LPT F  I YWM GLK     F  +L  
Sbjct  471   RRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKADPTTFILSLLV  530

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +PSFI W+KY+S  
Sbjct  531   VLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQQIPSFIVWLKYLSYS  590

Query  364   QYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRL  185
              Y+YKLLL  QY   + Y C+ G   C V D PAIK IGL    I  V  + +ML+GYRL
Sbjct  591   YYSYKLLLGVQYNDSDYYECSKGV-YCQVADFPAIKSIGLNNMWI-DVSIMAVMLVGYRL  648

Query  184   LAYVALMRV  158
             +AY+AL RV
Sbjct  649   VAYLALTRV  657



>ref|XP_010324495.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum lycopersicum]
Length=671

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/639 (54%), Positives = 450/639 (70%), Gaps = 38/639 (6%)
 Frame = -3

Query  1987  QLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGI  1808
             Q++S  S    +KA  P+TLKFE +VYK+  + K G+    +   K   EK IL GVTG 
Sbjct  41    QIKSQQS--YLQKAMYPITLKFEEIVYKISQENK-GMCCGGSSNTK---EKTILNGVTGT  94

Query  1807  VFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDIL  1628
             V+PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYN +PFS ++KR TGFV+QDD+L
Sbjct  95    VYPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVL  154

Query  1627  YPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGE  1448
             YPHLTV ETL+FTALLRLP+ L + EK+   + VI +LGL KC+NS+IGG   RGISGGE
Sbjct  155   YPHLTVIETLLFTALLRLPQNLERDEKVRHVEHVIAELGLNKCRNSMIGGPLFRGISGGE  214

Query  1447  RKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLF  1268
             +KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIHQPS+RL+
Sbjct  215   KKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILNTVKRLASGGRTVITTIHQPSNRLY  274

Query  1267  YLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------  1115
             Y+F KV+LL EG P+Y+G  S  + YFS++GFS S+ +NP+D LLDLANGI         
Sbjct  275   YMFDKVVLLSEGCPIYYGPASTALEYFSSIGFSISITINPADLLLDLANGIGSDTKNGND  334

Query  1114  TGDDSQADQATVKETLVSAFKTNLLENLKMEL--HELNDEDVSSAGDQKQFKRWAIPWWE  941
              GD ++ ++  V+E L+SA++ N+   LK E+  +     DVS+    K  ++W   W  
Sbjct  335   QGDSTEQEKKLVREALISAYEMNISTRLKTEVCGNYSCTNDVSTRNGVK-LEQWCTSWMH  393

Query  940   QFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQV-----------  800
             QF VLL RGL++R++E+F+ L++ QV+ VAFL G LWW   ++ ++D+V           
Sbjct  394   QFKVLLMRGLRERRHETFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRVRYYPFTLSHLH  453

Query  799   -----GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPME  635
                   +LFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+E
Sbjct  454   IRKHIAMLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLE  513

Query  634   LVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGS  455
             L LPT F  I YWM GLKP    F  +L  +L  VLV Q LGLA GA +MD K ATTL S
Sbjct  514   LALPTAFTFILYWMGGLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLAS  573

Query  454   VIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVE  275
             V  L FL+AGG+Y++ +P+FI W+KY+S   Y+YKLLL  QY   + Y C+ G   C V 
Sbjct  574   VTTLVFLIAGGYYIQQIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGV-YCQVA  632

Query  274   DHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             + PAI+ +GL    I  V  + +ML+GYR++AY+AL RV
Sbjct  633   NLPAIESVGLNNMWI-DVSVMAVMLVGYRVVAYLALTRV  670



>ref|XP_010918656.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=648

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/618 (55%), Positives = 432/618 (70%), Gaps = 39/618 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PV LKFE VVYKVK                  AEK IL G++G+V PGE+LAMLGPSGSG
Sbjct  43    PVILKFEEVVYKVK----------VGGGGAGLAEKTILNGISGVVCPGEILAMLGPSGSG  92

Query  1759  kttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTALGGR         ITYNG PFS  MKR TGFV QDD+LYPHLTV ETLVFTAL
Sbjct  93    KTTLLTALGGRRLPGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAETLVFTAL  152

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLPR+L + EK+ QA  V+ +LGL +  +++IGG  +RG+SGGER+RVSIGQEMLINPS
Sbjct  153   LRLPRSLGRAEKVRQAHQVMAELGLARVAHTMIGGPLVRGVSGGERRRVSIGQEMLINPS  212

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLL-CEGN  1229
             LL LDEPTSGLDSTTA RIV+TL  L+ +GGRT+V TIHQPSSRL+++F KV++L  EG+
Sbjct  213   LLLLDEPTSGLDSTTAARIVTTLKRLATEGGRTVVTTIHQPSSRLYHMFDKVVVLSVEGS  272

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQAT-----------  1082
             P+Y+G+ +  + YF+++GFS  + +NP+D LLDLANGI   DSQ    T           
Sbjct  273   PIYYGRAAAALEYFASIGFSSPLTLNPADVLLDLANGIAPPDSQQAAETGEALVTIEREP  332

Query  1081  --VKETLVSAFKTNLLENLKMELHELN------DEDVSSAGDQKQFKRWAIPWWEQFSVL  926
               V+E L+SA+  N+   LK EL  ++        DV+ A  ++Q   W   W EQF VL
Sbjct  333   KAVREELISAYDRNIATRLKAELCSVDPTNYGYSRDVAIAARREQ---WCTSWCEQFKVL  389

Query  925   LKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLF  752
             L+RGLK+R+YE+F+ L++ QVL VA L G LWW +  + +QD+  LLFF S FWGFFPL+
Sbjct  390   LRRGLKERRYEAFNKLRIFQVLSVATLGGLLWWNTPPSHIQDKTALLFFFSVFWGFFPLY  449

Query  751   QAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTA  572
              A+FTFP+++ ML KERSSGMY LSS++LART GDLPMEL LPT FV+I YWM GLKP  
Sbjct  450   NAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYWMGGLKPHP  509

Query  571   GNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFI  392
               F  +L  +L  VLV Q LGLA+GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI
Sbjct  510   TAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIPPFI  569

Query  391   SWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVAL  212
              W+KY+S   Y YKLLL  Q+   ++Y C+ G  +C V + PAIK +GL  H+      +
Sbjct  570   VWLKYLSYSFYCYKLLLGVQFNENDSYECSPGV-MCPVVEFPAIKSVGL-NHLWVDASIM  627

Query  211   LLMLIGYRLLAYVALMRV  158
              LML+GYRL+AY+AL R+
Sbjct  628   ALMLMGYRLIAYLALHRL  645



>ref|XP_010918655.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=666

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/626 (55%), Positives = 433/626 (69%), Gaps = 37/626 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLS--------FLKTKKQKSEAEKIILKGVTGIVFPGEVLA  1784
             PV LKFE VVYKVK       S                  AEK IL G++G+V PGE+LA
Sbjct  43    PVILKFEEVVYKVKVGHHSSKSPGLFCCCCGGGGGGGAGLAEKTILNGISGVVCPGEILA  102

Query  1783  MLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVT  1607
             MLGPSGSGKTTLLTALGGR         ITYNG PFS  MKR TGFV QDD+LYPHLTV 
Sbjct  103   MLGPSGSGKTTLLTALGGRRLPGKLSGKITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVA  162

Query  1606  ETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIG  1427
             ETLVFTALLRLPR+L + EK+ QA  V+ +LGL +  +++IGG  +RG+SGGER+RVSIG
Sbjct  163   ETLVFTALLRLPRSLGRAEKVRQAHQVMAELGLARVAHTMIGGPLVRGVSGGERRRVSIG  222

Query  1426  QEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKV  1250
             QEMLINPSLL LDEPTSGLDSTTA RIV+TL  L+ +GGRT+V TIHQPSSRL+++F KV
Sbjct  223   QEMLINPSLLLLDEPTSGLDSTTAARIVTTLKRLATEGGRTVVTTIHQPSSRLYHMFDKV  282

Query  1249  LLL-CEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQAT---  1082
             ++L  EG+P+Y+G+ +  + YF+++GFS  + +NP+D LLDLANGI   DSQ    T   
Sbjct  283   VVLSVEGSPIYYGRAAAALEYFASIGFSSPLTLNPADVLLDLANGIAPPDSQQAAETGEA  342

Query  1081  ----------VKETLVSAFKTNLLENLKMELHELN------DEDVSSAGDQKQFKRWAIP  950
                       V+E L+SA+  N+   LK EL  ++        DV+ A  ++Q   W   
Sbjct  343   LVTIEREPKAVREELISAYDRNIATRLKAELCSVDPTNYGYSRDVAIAARREQ---WCTS  399

Query  949   WWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISS  776
             W EQF VLL+RGLK+R+YE+F+ L++ QVL VA L G LWW +  + +QD+  LLFF S 
Sbjct  400   WCEQFKVLLRRGLKERRYEAFNKLRIFQVLSVATLGGLLWWNTPPSHIQDKTALLFFFSV  459

Query  775   FWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYW  596
             FWGFFPL+ A+FTFP+++ ML KERSSGMY LSS++LART GDLPMEL LPT FV+I YW
Sbjct  460   FWGFFPLYNAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYW  519

Query  595   MAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFY  416
             M GLKP    F  +L  +L  VLV Q LGLA+GA +M+ K ATTL SV  L FL+AGG+Y
Sbjct  520   MGGLKPHPTAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYY  579

Query  415   VRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQH  236
             V+ +P FI W+KY+S   Y YKLLL  Q+   ++Y C+ G  +C V + PAIK +GL  H
Sbjct  580   VQQIPPFIVWLKYLSYSFYCYKLLLGVQFNENDSYECSPGV-MCPVVEFPAIKSVGL-NH  637

Query  235   VIFSVVALLLMLIGYRLLAYVALMRV  158
             +      + LML+GYRL+AY+AL R+
Sbjct  638   LWVDASIMALMLMGYRLIAYLALHRL  663



>ref|XP_010066762.1| PREDICTED: ABC transporter G family member 21 [Eucalyptus grandis]
 gb|KCW64799.1| hypothetical protein EUGRSUZ_G02369 [Eucalyptus grandis]
Length=679

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/631 (55%), Positives = 453/631 (72%), Gaps = 39/631 (6%)
 Frame = -3

Query  1963  AIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAE------KIILKGVTGIVF  1802
             +  +++  P+TLKFE+V Y +K         L+T +    A       + +L GVTG+  
Sbjct  59    SFLRRSLYPITLKFEDVGYNIK---------LRTNRNSCCAPNEPKLTRNVLNGVTGMAR  109

Query  1801  PGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYP  1622
             PGE+LAMLGPSGSGKTTLLTAL GRL G + G ITYNG PFS+++KR  GFV+QDD+LYP
Sbjct  110   PGELLAMLGPSGSGKTTLLTALAGRLPGKVTGAITYNGHPFSSSVKRKIGFVSQDDVLYP  169

Query  1621  HLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERK  1442
             HLTV ETL + ALLRLP+ LT+QEK +QA+ +I++LGL +C+ +++GG  +RG+SGGERK
Sbjct  170   HLTVLETLTYAALLRLPKELTRQEKADQAEMIISELGLGRCRTNVVGGPLVRGVSGGERK  229

Query  1441  RVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYL  1262
             RVSIG E+L+NPSLL LDEPTSGLDSTTAQRIV+ L  +++GGRT+V TIHQPSSRL+ +
Sbjct  230   RVSIGLELLVNPSLLLLDEPTSGLDSTTAQRIVAQLRAVARGGRTVVTTIHQPSSRLYRM  289

Query  1261  FHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGIT----GDDSQ  1097
             F KV++L EG  +Y G    VM YF ++G+SP    +NP+DFLLDLANGI      DD Q
Sbjct  290   FDKVVVLTEGCLIYSGSAGLVMEYFGSLGYSPGFDFINPADFLLDLANGIKPDLRHDDQQ  349

Query  1096  A---------DQATVKETLVSAFKTNLLENLKMELHELN-DEDVSSAGDQKQFKR----W  959
                       +Q ++K++L+S++K NL   LK E+ + + D+D   +      +R    W
Sbjct  350   EFHNKLEYHDEQNSIKQSLISSYKKNLYPALKAEIQQHSLDQDTHPSRKMSSLRRDESFW  409

Query  958   AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFF  785
                WWEQF+VLL RGL++RK+ES+SGL+V QV+ V+ L+G LWWKS  + +QDQVGLLFF
Sbjct  410   MTSWWEQFTVLLSRGLRERKHESYSGLRVFQVMSVSVLSGLLWWKSDTSHVQDQVGLLFF  469

Query  784   ISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVII  605
              S FWGFFPLF A+F FP ++ ML KERSSGMY+LSS++ AR  GDLPMELVLPT+FV +
Sbjct  470   FSIFWGFFPLFNAVFAFPLERPMLIKERSSGMYRLSSYYFARIAGDLPMELVLPTIFVTV  529

Query  604   SYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAG  425
             +YWM GLKP+ G F   L  IL  VLV QGLGLA+GA +MD K  TTL SV ML FLL G
Sbjct  530   TYWMGGLKPSLGTFVLTLLIILFNVLVSQGLGLALGAVLMDAKQGTTLASVTMLVFLLVG  589

Query  424   GFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGL  245
             G+Y++H+PSFI+W+KY+S   Y Y+LL+  QY   E Y C +G   C V D PAI  +GL
Sbjct  590   GYYIQHIPSFIAWLKYVSFSHYCYELLVGVQYSVNEVYDCGAGRQ-CRVMDFPAISCLGL  648

Query  244   GQHVIFSVVALLLMLIGYRLLAYVALMRVGR  152
               +++  V AL +ML+GYRLLAY+AL RVG+
Sbjct  649   -DNLLRDVAALAVMLVGYRLLAYMAL-RVGQ  677



>ref|XP_010910173.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=653

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/615 (56%), Positives = 440/615 (72%), Gaps = 24/615 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PVTL+FE V YKVK  Q    S        + AEK+IL G+TG+V PGE+LAMLGPSGSG
Sbjct  39    PVTLRFEEVAYKVKLGQPMWWSSCH-GSAAAAAEKVILNGITGMVPPGEILAMLGPSGSG  97

Query  1759  kttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTALGGRL       TITYNG+PFS AMKR TGFV QDD+LYPHLTV ETLVFTAL
Sbjct  98    KTTLLTALGGRLVTGKLSGTITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVHETLVFTAL  157

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLPR+L++ EK+  A+ V+ +LGL +  +++IGG  +RG+SGGERKRVSI QE+L+NPS
Sbjct  158   LRLPRSLSRAEKMRHAEKVMEELGLVRVAHTMIGGRLVRGVSGGERKRVSIAQELLVNPS  217

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNP  1226
             LL LDEPTSGLDSTTA RIV+ L  L+ +GGRT+V TIHQPS+RL+ +F KV+LL EG+P
Sbjct  218   LLLLDEPTSGLDSTTAARIVTMLRRLAAEGGRTVVTTIHQPSNRLYRMFDKVVLLSEGSP  277

Query  1225  LYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQA-------------  1085
             +Y+G  SD + YFS++GFS  + +NP++ +LDLANGI  D  + + A             
Sbjct  278   IYYGPASDALDYFSSIGFSSPLYVNPAELMLDLANGIAPDSFKENSAGEPNGSAERERKS  337

Query  1084  -TVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKR---WAIPWWEQFSVLLKR  917
               +++ L SA+  N+   LK +L  ++    S A D    +R   W   W EQF VLL+R
Sbjct  338   SVIRKELRSAYGRNIATRLKADLCRMDSSSHSHAKDASNTRRREDWCTSWLEQFLVLLRR  397

Query  916   GLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAI  743
             G+K+R+YESF+ L++ QV+ VA L G LWW ++   +QDQV LLFF S FWGFFPL+ A+
Sbjct  398   GIKERRYESFNKLRIFQVISVATLGGLLWWHTSPSHIQDQVALLFFFSVFWGFFPLYNAV  457

Query  742   FTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNF  563
             FTFP+++ ML KERSSGMY+LSS+FLART GDLPMEL LPT FV+I YWM GL+P A +F
Sbjct  458   FTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQPGASSF  517

Query  562   FSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
               +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+YV+H+PSFI W+
Sbjct  518   LLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIPSFIVWL  577

Query  382   KYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLM  203
             KY+S   Y YKLLL  Q++  + Y C+ G  +C V D PAIK +GL  H+   V  + LM
Sbjct  578   KYLSFSFYCYKLLLGVQFRDDDVYECSPGV-LCRVVDFPAIKSVGL-HHMWIDVCIMALM  635

Query  202   LIGYRLLAYVALMRV  158
             LI YRL+AY+AL R+
Sbjct  636   LIAYRLIAYLALHRL  650



>gb|KHN37813.1| ABC transporter G family member 21 [Glycine soja]
Length=666

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/671 (53%), Positives = 453/671 (68%), Gaps = 61/671 (9%)
 Frame = -3

Query  2056  TLMETATEMGDIEAPTTQLQANPQLESDTSA-------------------AIFKKANRPV  1934
             T  ET++   D E   T  +  P LE D +                    ++  ++ RP+
Sbjct  19    TRQETSSIHHDSEGSNTN-KIKPSLELDDNCIPAQQQTQPTPPPPTTSRFSVLHQSLRPI  77

Query  1933  TLKFENVVYKV--KPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             TLKFE+V Y +  +  +K+G       +++S+  + +L GVTG+V PGE+ AMLGPSGSG
Sbjct  78    TLKFEDVSYTITFESQKKKGCVL----RKESKLRRKVLTGVTGVVNPGELTAMLGPSGSG  133

Query  1759  kttlltalggrlgghla-gTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTAL GRL G ++  TITYNG+     +KR  GFV QDD+ YPHLTV ETL + AL
Sbjct  134   KTTLLTALAGRLAGKVSGTTITYNGQTDPTFVKRKVGFVPQDDVHYPHLTVLETLTYAAL  193

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGV--FLRGISGGERKRVSIGQEMLIN  1409
             LRLP++L+++EK E A+ VIT+LGLT+C+NS +GG     RGISGGERKRVSIGQEML+N
Sbjct  194   LRLPKSLSREEKKEHAEMVITELGLTRCRNSPVGGCMALFRGISGGERKRVSIGQEMLVN  253

Query  1408  PSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGN  1229
             PSLLF+DEPTSGLDSTTAQ IVS                  PSSRL+ +F KV++L +G+
Sbjct  254   PSLLFVDEPTSGLDSTTAQLIVS------------------PSSRLYRMFDKVIVLSDGH  295

Query  1228  PLYFGKGSDVMSYFSTVGFSPSVA-MNPSDFLLDLANGITGD-------DSQADQATVKE  1073
             P+Y G    VM Y  +VG+ P+   MNP+DFLLDLANG+  D       D   DQA+VK+
Sbjct  296   PIYSGHAGRVMDYLGSVGYVPAFNFMNPADFLLDLANGVVADVKHDDQIDHHEDQASVKQ  355

Query  1072  TLVSAFKTNLLENLKMELHELNDED--VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRK  899
             +L+S+FK NL   LK ++H+ N      +S   ++   +W   WWEQF VLLKRGL++R+
Sbjct  356   SLISSFKKNLYPALKEDIHQNNSHPSAFTSGTPRRSDNQWTSSWWEQFRVLLKRGLQERR  415

Query  898   YESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPED  725
             +ESFSGL++ QVL V+ L+G LWW S    +QDQVGLLFF S FWGFFPLF AIF FP +
Sbjct  416   HESFSGLRIFQVLSVSILSGLLWWHSDPAHVQDQVGLLFFFSIFWGFFPLFNAIFAFPLE  475

Query  724   KMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSA  545
             + ML KERSSGMYKLSS+++AR VGDLPMELVLPT+FV ISYWM GLKP+   F   L  
Sbjct  476   RPMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLKPSLVTFVLTLLI  535

Query  544   IllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIG  365
             +L  VLV QG+GLA+GA +MD K ATTL SV ML FLLAGG+Y++ +P+FI+W+KYIS  
Sbjct  536   MLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMPAFIAWLKYISFS  595

Query  364   QYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRL  185
              Y YKLL+  QY   E Y C  G   C V D PAIK +GL   +   V AL +MLIGYR+
Sbjct  596   HYCYKLLVGVQYSVNEVYECGPGLH-CRVRDFPAIKCMGLDDTMWGDVAALTVMLIGYRV  654

Query  184   LAYVALMRVGR  152
             +AY+AL R+G+
Sbjct  655   VAYLAL-RMGQ  664



>ref|XP_010324496.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum lycopersicum]
Length=639

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/621 (54%), Positives = 439/621 (71%), Gaps = 36/621 (6%)
 Frame = -3

Query  1933  TLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkt  1754
             T +FE +VYK+  + K G+    +   K   EK IL GVTG V+PGE+LAMLGPSGSGKT
Sbjct  25    TEEFEEIVYKISQENK-GMCCGGSSNTK---EKTILNGVTGTVYPGEMLAMLGPSGSGKT  80

Query  1753  tlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRL  1574
             TLLTALGGRL G L+G ITYN +PFS ++KR TGFV+QDD+LYPHLTV ETL+FTALLRL
Sbjct  81    TLLTALGGRLSGKLSGKITYNSQPFSGSIKRRTGFVSQDDVLYPHLTVIETLLFTALLRL  140

Query  1573  PRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLF  1394
             P+ L + EK+   + VI +LGL KC+NS+IGG   RGISGGE+KRVSIGQEMLINPSLL 
Sbjct  141   PQNLERDEKVRHVEHVIAELGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLL  200

Query  1393  LDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFG  1214
             LDEPTSGLDSTTA RI++T+  L+ GGRT++ TIHQPS+RL+Y+F KV+LL EG P+Y+G
Sbjct  201   LDEPTSGLDSTTALRILNTVKRLASGGRTVITTIHQPSNRLYYMFDKVVLLSEGCPIYYG  260

Query  1213  KGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGI---------TGDDSQADQATVKETLVS  1061
               S  + YFS++GFS S+ +NP+D LLDLANGI          GD ++ ++  V+E L+S
Sbjct  261   PASTALEYFSSIGFSISITINPADLLLDLANGIGSDTKNGNDQGDSTEQEKKLVREALIS  320

Query  1060  AFKTNLLENLKMEL--HELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESF  887
             A++ N+   LK E+  +     DVS+    K  ++W   W  QF VLL RGL++R++E+F
Sbjct  321   AYEMNISTRLKTEVCGNYSCTNDVSTRNGVK-LEQWCTSWMHQFKVLLMRGLRERRHETF  379

Query  886   SGLKVGQVLVVAFLTGALWWK--STDLQDQV----------------GLLFFISSFWGFF  761
             + L++ QV+ VAFL G LWW   ++ ++D+V                 +LFF + FWGF+
Sbjct  380   NRLRIFQVISVAFLAGLLWWHTPTSHIEDRVRYYPFTLSHLHIRKHIAMLFFFAVFWGFY  439

Query  760   PLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLK  581
             PL+ A+FTFP+++ ML KERSSGMY+LSS+FLA+TVGDLP+EL LPT F  I YWM GLK
Sbjct  440   PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  499

Query  580   PTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVP  401
             P    F  +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+Y++ +P
Sbjct  500   PDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQQIP  559

Query  400   SFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSV  221
             +FI W+KY+S   Y+YKLLL  QY   + Y C+ G   C V + PAI+ +GL    I  V
Sbjct  560   TFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGV-YCQVANLPAIESVGLNNMWI-DV  617

Query  220   VALLLMLIGYRLLAYVALMRV  158
               + +ML+GYR++AY+AL RV
Sbjct  618   SVMAVMLVGYRVVAYLALTRV  638



>emb|CBI18157.3| unnamed protein product [Vitis vinifera]
Length=645

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/617 (53%), Positives = 429/617 (70%), Gaps = 42/617 (7%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFL---------KTKKQKSEAE----KIILKGVTGIVFP  1799
             P++LKF ++ Y+VK ++K+    L         K+  + S  E    K IL GVTG+  P
Sbjct  40    PISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILNGVTGMACP  99

Query  1798  GEVLAMLGPSgsgkttlltalggrlgghl-agTITYNGKPFSNAMKRNTGFVTQDDILYP  1622
             GE+LA+LGPSGSGK+TLL AL GR+ GH   GT+  NG+  +  + R TGFVTQDDILYP
Sbjct  100   GEILAVLGPSGSGKSTLLNALAGRIQGHCFTGTVLANGRKLTKPVLRRTGFVTQDDILYP  159

Query  1621  HLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERK  1442
             HLTV ETL+F +LLRLP TLTKQEKI  AD+VI +LGL KC+N+IIG  F+RG+SGGERK
Sbjct  160   HLTVRETLIFCSLLRLPNTLTKQEKISLADSVIAELGLAKCENTIIGNSFIRGVSGGERK  219

Query  1441  RVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYL  1262
             RVSI  EMLINPSLL LDEPTSGLDST+A R+VSTL  L+  G+TIV ++HQPSSR++ +
Sbjct  220   RVSIAHEMLINPSLLILDEPTSGLDSTSAYRLVSTLVSLANKGKTIVTSMHQPSSRVYQM  279

Query  1261  FHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQ  1088
             FH VL+L EG  LYFGKGS  MSYF TVGF+PS  MNP+DFLLDLANG+   D  S+ ++
Sbjct  280   FHSVLVLSEGRCLYFGKGSQAMSYFETVGFTPSFPMNPADFLLDLANGVCHLDGVSEREK  339

Query  1087  ATVKETLVSAFKTNLLENLK----MELHELNDEDVSSAGDQKQFKRWAIP----WWEQFS  932
               +K+ LVS++ + L   +K    M+ +    ++  S   ++  +R +      W+ QFS
Sbjct  340   PNIKQALVSSYNSLLAPKVKDACNMDTNVTAPKETVSLASKECRRRCSYSGLSTWFNQFS  399

Query  931   VLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFP  758
             +LL+RGLK+RK+ESF+ L+V QV+  A L G +WW S   D+QD++GLLFFI+ FWG FP
Sbjct  400   ILLQRGLKERKHESFNSLRVFQVIAAALLAGLMWWHSDFLDIQDRLGLLFFIAIFWGVFP  459

Query  757   LFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKP  578
              F ++F FP+++ +  KER+SGMY LSS+F+AR VGD+PMEL+LP VF+ ++YWMAGLKP
Sbjct  460   SFNSVFAFPQERAIFMKERASGMYTLSSYFMARIVGDMPMELILPMVFLTVAYWMAGLKP  519

Query  577   TAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPS  398
               G F   L  +L  VLV QGLGLA+GA IMD K A+T+ +V MLAF+L GGFYV  +PS
Sbjct  520   EVGAFLLTLVILLGYVLVSQGLGLALGAAIMDAKKASTMVTVTMLAFVLTGGFYVHKMPS  579

Query  397   FISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVV  218
              ++WIKYIS   Y+Y+LL+  QY  G+      G  +      PA           F + 
Sbjct  580   CMTWIKYISTTFYSYRLLINVQYGEGKRISSLLGCQI-----SPA-----------FCIT  623

Query  217   ALLLMLIGYRLLAYVAL  167
             A++ M +GYRLLAY+AL
Sbjct  624   AMVFMFVGYRLLAYLAL  640



>ref|XP_010463057.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=574

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/525 (59%), Positives = 391/525 (74%), Gaps = 17/525 (3%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQ--KQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSg  1766
             P+TLKFE VVYKVK +Q   Q L   K+K      EK IL G+TG+V PGE+LAMLGPSG
Sbjct  50    PITLKFEEVVYKVKIEQTSSQCLGSWKSK------EKTILNGITGMVCPGEILAMLGPSG  103

Query  1765  sgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTA  1586
             SGKTTLL+ALGGRL    +G + YNG+PFS  +KR TGFV QDD+LYPHLTV ETL FTA
Sbjct  104   SGKTTLLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTA  163

Query  1585  LLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINP  1406
             LLRLP +LT+ EK E  D VI +LGL +C NS+IGG   RGISGGE+KRVSIGQEMLINP
Sbjct  164   LLRLPSSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINP  223

Query  1405  SLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNP  1226
             SLL LDEPTSGLDSTTA RI++T+  L+ GGRT+V TIHQPSSR++++F KV+LL EG+P
Sbjct  224   SLLLLDEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSP  283

Query  1225  LYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD----SQADQATVKETLVSA  1058
             +Y+G  S  M YFS++GFS S+ +NP+D LLDLANGI  D     ++ +Q TVKETLVSA
Sbjct  284   IYYGSASSAMEYFSSLGFSTSMTVNPADLLLDLANGIPPDSQKETTEQEQKTVKETLVSA  343

Query  1057  FKTNLLENLKMELHELNDED---VSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESF  887
             ++ N+   LK EL     +      +A    + ++W   WW QF+VLL+RG+++R++ESF
Sbjct  344   YEKNISAKLKAELCNAESQSYDYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESF  403

Query  886   SGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMML  713
             + L++ QV+ VAFL G LWW +  + +QD+  LLFF S FWGF+PL+ A+FTFP++K ML
Sbjct  404   NKLRIFQVISVAFLGGLLWWHTPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRML  463

Query  712   GKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllc  533
              KERSSGMY+LSS+F+AR VGDLP+EL LPT FV I YWM GLKP    F  +L  +L  
Sbjct  464   IKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYS  523

Query  532   vlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPS  398
             VLV QGLGLA GA +M+ K ATTL SV  L FL+AGG+YV+ +P+
Sbjct  524   VLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPT  568



>ref|XP_002268373.1| PREDICTED: ABC transporter G family member 25 [Vitis vinifera]
Length=664

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/620 (53%), Positives = 431/620 (70%), Gaps = 29/620 (5%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFL---------KTKKQKSEAE----KIILKGVTGIVFP  1799
             P++LKF ++ Y+VK ++K+    L         K+  + S  E    K IL GVTG+  P
Sbjct  40    PISLKFIDICYRVKLEKKKSRGGLCRPMLGGPTKSSDRGSTTETIQEKTILNGVTGMACP  99

Query  1798  GEVLAMLGPSgsgkttlltalggrlgghl-agTITYNGKPFSNAMKRNTGFVTQDDILYP  1622
             GE+LA+LGPSGSGK+TLL AL GR+ GH   GT+  NG+  +  + R TGFVTQDDILYP
Sbjct  100   GEILAVLGPSGSGKSTLLNALAGRIQGHCFTGTVLANGRKLTKPVLRRTGFVTQDDILYP  159

Query  1621  HLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERK  1442
             HLTV ETL+F +LLRLP TLTKQEKI  AD+VI +LGL KC+N+IIG  F+RG+SGGERK
Sbjct  160   HLTVRETLIFCSLLRLPNTLTKQEKISLADSVIAELGLAKCENTIIGNSFIRGVSGGERK  219

Query  1441  RVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYL  1262
             RVSI  EMLINPSLL LDEPTSGLDST+A R+VSTL  L+  G+TIV ++HQPSSR++ +
Sbjct  220   RVSIAHEMLINPSLLILDEPTSGLDSTSAYRLVSTLVSLANKGKTIVTSMHQPSSRVYQM  279

Query  1261  FHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQ  1088
             FH VL+L EG  LYFGKGS  MSYF TVGF+PS  MNP+DFLLDLANG+   D  S+ ++
Sbjct  280   FHSVLVLSEGRCLYFGKGSQAMSYFETVGFTPSFPMNPADFLLDLANGVCHLDGVSEREK  339

Query  1087  ATVKETLVSAFKTNLLENLK----MELHELNDEDVSSAGDQKQFKRWAIP----WWEQFS  932
               +K+ LVS++ + L   +K    M+ +    ++  S   ++  +R +      W+ QFS
Sbjct  340   PNIKQALVSSYNSLLAPKVKDACNMDTNVTAPKETVSLASKECRRRCSYSGLSTWFNQFS  399

Query  931   VLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFP  758
             +LL+RGLK+RK+ESF+ L+V QV+  A L G +WW S   D+QD++GLLFFI+ FWG FP
Sbjct  400   ILLQRGLKERKHESFNSLRVFQVIAAALLAGLMWWHSDFLDIQDRLGLLFFIAIFWGVFP  459

Query  757   LFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKP  578
              F ++F FP+++ +  KER+SGMY LSS+F+AR VGD+PMEL+LP VF+ ++YWMAGLKP
Sbjct  460   SFNSVFAFPQERAIFMKERASGMYTLSSYFMARIVGDMPMELILPMVFLTVAYWMAGLKP  519

Query  577   TAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPS  398
               G F   L  +L  VLV QGLGLA+GA IMD K A+T+ +V MLAF+L GGFYV  +PS
Sbjct  520   EVGAFLLTLVILLGYVLVSQGLGLALGAAIMDAKKASTMVTVTMLAFVLTGGFYVHKMPS  579

Query  397   FISWIKYISIGQYTYKLLLESQYKPGETYPC---TSGSGVCLVEDHPAIKKIGLGQHVIF  227
              ++WIKYIS   Y+Y+LL+  QY  G+        S  G+         + IG      F
Sbjct  580   CMTWIKYISTTFYSYRLLINVQYGEGKRISSLLGCSHHGINRASCKFIEEDIGGQISPAF  639

Query  226   SVVALLLMLIGYRLLAYVAL  167
              + A++ M +GYRLLAY+AL
Sbjct  640   CITAMVFMFVGYRLLAYLAL  659



>ref|XP_006841289.1| hypothetical protein AMTR_s00134p00069640 [Amborella trichopoda]
 gb|ERN02964.1| hypothetical protein AMTR_s00134p00069640 [Amborella trichopoda]
Length=633

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/628 (50%), Positives = 436/628 (69%), Gaps = 29/628 (5%)
 Frame = -3

Query  1981  ESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKK-------QKSEAEKIILK  1823
             E +T        + PVT+KF ++ Y++K    +  +             +KS  E+ +LK
Sbjct  13    ECETRVESLLSPSFPVTVKFVDITYRIKLQSTESTASSILSSIIGSKPPRKSIEERTVLK  72

Query  1822  GVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVT  1643
             G+TG+V PGE+LA+LGPSGSGKTT L+ LGG+L G  AGT+  NG+  + +++R TGFVT
Sbjct  73    GITGVVSPGEILAILGPSGSGKTTFLSFLGGKLDGKFAGTLLANGQKVTKSIRRKTGFVT  132

Query  1642  QDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRG  1463
             QDD+LYPHLTV ETL+++ALLRLP+T++K+EK+  A++V+++LGL  C +SI+G  F+RG
Sbjct  133   QDDLLYPHLTVRETLIYSALLRLPKTVSKREKVGLAESVLSELGLNGCGDSIVGSAFVRG  192

Query  1462  ISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQP  1283
             ISGGERKRVSIGQEML+NPSLL LDEPTSGLDST A ++V+TL  L++ G+ +V T+HQP
Sbjct  193   ISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTAAYKLVTTLRGLARKGKAVVATMHQP  252

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD-  1106
             SSR++ +FH VLLL +GN LYFGKGS+ M YFS++GFSP+ AMNP+DF++DLANG+T D 
Sbjct  253   SSRVYQIFHSVLLLSDGNCLYFGKGSEAMDYFSSIGFSPAFAMNPADFMIDLANGVTPDL  312

Query  1105  -------DSQAD--QATVKETLVSAFKTNLLENLKME-LHELNDEDVSSAGDQKQFKRWA  956
                    ++Q D  +  +K+ L+S+F  +L   +K   L  +  E   + G ++      
Sbjct  313   KLVAGQVETQGDAQKPKLKQFLISSFNKSLAPKVKANVLATITTEVAQNPGTKRHDSELC  372

Query  955   IPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFI  782
               W +QFSVLL+R LK+R++ESF GL++ QV   A L G++WW+S+  D+ D+VGLLFFI
Sbjct  373   TTWTDQFSVLLRRSLKERRHESFGGLRILQVGATAVLAGSMWWQSSACDVLDRVGLLFFI  432

Query  781   SSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIIS  602
             S FWG FP+F ++FTFP+++ +  KER +GMYKLS++  A+ +GDLPMELVLPT F I++
Sbjct  433   SIFWGVFPVFNSVFTFPQERPIFIKERGAGMYKLSAYVAAKAIGDLPMELVLPTAFTIVA  492

Query  601   YWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGG  422
             YWMAGL+  A +F   L  +L  VLV QGLGLA+GA IMD K AT + SV M+AFLL GG
Sbjct  493   YWMAGLRADAFSFLLTLGVVLYSVLVGQGLGLALGAAIMDAKRATAVASVTMMAFLLVGG  552

Query  421   FYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLG  242
             +YVR VP F+ W+KY S   Y + LL+  QY+  ++  C  G G   V + P        
Sbjct  553   YYVRKVPHFVRWLKYTSFTYYAFGLLIHIQYRGAQSQWCNGGGGGGAVMELPGPA-----  607

Query  241   QHVIFSVVALLLMLIGYRLLAYVALMRV  158
                   V AL  ML+GYRLLAY+AL RV
Sbjct  608   ----LCVGALAAMLVGYRLLAYIALRRV  631



>ref|XP_008237152.1| PREDICTED: ABC transporter G family member 25 [Prunus mume]
Length=669

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/657 (51%), Positives = 443/657 (67%), Gaps = 54/657 (8%)
 Frame = -3

Query  1993  NPQLESDTSAAIFKKANR-PVTLKFENVVYKVKPDQK----QGLSFLKTK-KQKSEA---  1841
             N  L SD S  +   +N  P+TLKF +V Y+VK D K     G  F K +  QK +    
Sbjct  17    NRDLPSDHSPFMINSSNCFPITLKFLDVCYRVKIDNKLQYKGGCCFSKGRLMQKGQPGQE  76

Query  1840  --EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAM  1667
               E+ IL G+TG+V PGE+LA+LGPSGSGK+TLL AL GRL     GT+  NG+  + A+
Sbjct  77    PQERTILHGITGMVSPGEILAILGPSGSGKSTLLNALAGRLTQRHHGTVLANGRSLTKAV  136

Query  1666  KRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSI  1487
              R TGFVTQDD+LYPHLTV ETLVF +LLRLP++++K++KI  A++VI++LGL KC+N+I
Sbjct  137   LRRTGFVTQDDVLYPHLTVRETLVFCSLLRLPQSVSKRDKISAAESVISELGLHKCENTI  196

Query  1486  IGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRT  1307
             IG  F+RG+SGGERKRVSIG EML+NPSLL LDEPTSGLDST A R+VSTL  L++ GRT
Sbjct  197   IGNTFIRGVSGGERKRVSIGHEMLMNPSLLILDEPTSGLDSTAAHRLVSTLESLAQKGRT  256

Query  1306  IVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDL  1127
             IV ++HQPSSR++ +   VL+L +G  LYFGKGS+ MSYF ++GFSP+  MNP+DFLLDL
Sbjct  257   IVTSMHQPSSRVYQMLESVLVLSDGKCLYFGKGSEAMSYFGSLGFSPAFPMNPADFLLDL  316

Query  1126  ANGITGDD--SQADQATVKETLVSAFKTNLL-----------------ENLKMELHELND  1004
             ANG+   +  S+ D   +KE LVS++ T L                  EN  +E H  N 
Sbjct  317   ANGVCQLNGVSERDTPNMKEILVSSYNTLLAPKVKAECLGNGLVVSTKENTYIENHSCNK  376

Query  1003  EDVSSAGDQKQFKRWAIP----WWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGA  836
             ++  + G  K      IP    W+ QF++LL+R LK+RK+E+F+ L+V QV   A L G 
Sbjct  377   DERRNIGLTK------IPGVSTWFNQFNILLQRSLKERKHEAFNSLRVFQVAAGALLAGL  430

Query  835   LWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLA  662
             +WW+S   D+QD++GLLFFIS FWG  P F ++F FP+++ +  KE++SGMY LSS+F+A
Sbjct  431   MWWQSDYLDVQDRLGLLFFISIFWGVLPSFNSVFAFPQERAIFLKEQASGMYTLSSYFMA  490

Query  661   RTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMD  482
             R VGDLPMEL+LPT+F+ I+YWMAGLKP  G F   L  +L  VLV QGLGLA+GA IMD
Sbjct  491   RLVGDLPMELILPTIFLTITYWMAGLKPDFGAFLLTLLVLLGYVLVSQGLGLALGAAIMD  550

Query  481   QKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT  302
              K A+T+ +V MLAF+L GG+YV  VPS ++WIKYIS   Y+Y+LL+  QY  GE    +
Sbjct  551   AKQASTVATVTMLAFVLTGGYYVHKVPSCLAWIKYISTTFYSYRLLINVQY--GEGPKIS  608

Query  301   SGSGVCLVEDHPA---------IKKIGLGQ-HVIFSVVALLLMLIGYRLLAYVALMR  161
             S  G      H A         +++   GQ   + SV  LL M   YRLLAY+ALMR
Sbjct  609   SLLGCSSQRRHHAGDHKVNCKFVEQDVAGQISPVVSVCVLLFMFFAYRLLAYLALMR  665



>ref|XP_010324497.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
 ref|XP_010324498.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
Length=598

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/590 (55%), Positives = 424/590 (72%), Gaps = 32/590 (5%)
 Frame = -3

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             EK IL GVTG V+PGE+LAMLGPSGSGKTTLLTALGGRL G L+G ITYN +PFS ++KR
Sbjct  11    EKTILNGVTGTVYPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGSIKR  70

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFV+QDD+LYPHLTV ETL+FTALLRLP+ L + EK+   + VI +LGL KC+NS+IG
Sbjct  71    RTGFVSQDDVLYPHLTVIETLLFTALLRLPQNLERDEKVRHVEHVIAELGLNKCRNSMIG  130

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G   RGISGGE+KRVSIGQEMLINPSLL LDEPTSGLDSTTA RI++T+  L+ GGRT++
Sbjct  131   GPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILNTVKRLASGGRTVI  190

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLAN  1121
              TIHQPS+RL+Y+F KV+LL EG P+Y+G  S  + YFS++GFS S+ +NP+D LLDLAN
Sbjct  191   TTIHQPSNRLYYMFDKVVLLSEGCPIYYGPASTALEYFSSIGFSISITINPADLLLDLAN  250

Query  1120  GI---------TGDDSQADQATVKETLVSAFKTNLLENLKMEL--HELNDEDVSSAGDQK  974
             GI          GD ++ ++  V+E L+SA++ N+   LK E+  +     DVS+    K
Sbjct  251   GIGSDTKNGNDQGDSTEQEKKLVREALISAYEMNISTRLKTEVCGNYSCTNDVSTRNGVK  310

Query  973   QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWK--STDLQDQV  800
               ++W   W  QF VLL RGL++R++E+F+ L++ QV+ VAFL G LWW   ++ ++D+V
Sbjct  311   -LEQWCTSWMHQFKVLLMRGLRERRHETFNRLRIFQVISVAFLAGLLWWHTPTSHIEDRV  369

Query  799   ----------------GLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFF  668
                              +LFF + FWGF+PL+ A+FTFP+++ ML KERSSGMY+LSS+F
Sbjct  370   RYYPFTLSHLHIRKHIAMLFFFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYF  429

Query  667   LARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFI  488
             LA+TVGDLP+EL LPT F  I YWM GLKP    F  +L  +L  VLV Q LGLA GA +
Sbjct  430   LAKTVGDLPLELALPTAFTFILYWMGGLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALL  489

Query  487   MDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             MD K ATTL SV  L FL+AGG+Y++ +P+FI W+KY+S   Y+YKLLL  QY   + Y 
Sbjct  490   MDVKQATTLASVTTLVFLIAGGYYIQQIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYE  549

Query  307   CTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             C+ G   C V + PAI+ +GL    I  V  + +ML+GYR++AY+AL RV
Sbjct  550   CSKGV-YCQVANLPAIESVGLNNMWI-DVSVMAVMLVGYRVVAYLALTRV  597



>ref|XP_009383524.1| PREDICTED: ABC transporter G family member 25-like [Musa acuminata 
subsp. malaccensis]
Length=639

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/616 (51%), Positives = 431/616 (70%), Gaps = 29/616 (5%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPD-----QKQGLSFLKTKKQKSEA---EKIILKGVTGIVFPGEVLA  1784
             P+TL+F +V Y+VK D       +G+  +      S A   EK+IL GV+G+V PGE+L 
Sbjct  29    PLTLQFMDVSYRVKLDPTLTSSGKGVKRMLNSASGSSAVPEEKVILNGVSGMVSPGEMLV  88

Query  1783  MLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTE  1604
             +LGPSGSGK+TLL+ L GRL G  +G +  NG+  +  + R TGFVTQDD+LYPHLTV E
Sbjct  89    VLGPSGSGKSTLLSILAGRLQGKHSGAVLANGRRLTKPVLRRTGFVTQDDVLYPHLTVRE  148

Query  1603  TLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQ  1424
             TLVF A+LRLPRT+ K+EK+  A+AV+++LGL KC ++ +G  F+RGISGGERKRVSIG 
Sbjct  149   TLVFCAMLRLPRTVAKEEKVAAAEAVMSELGLCKCADTPVGSPFVRGISGGERKRVSIGH  208

Query  1423  EMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLL  1244
             EML+NPSLL LDEPTSGLDST A  +V+TL  L++ GRT+V ++HQP+SR++ +F  VLL
Sbjct  209   EMLLNPSLLVLDEPTSGLDSTAASWLVATLSGLARKGRTVVTSVHQPASRVYQMFDSVLL  268

Query  1243  LCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQAD--QATVKET  1070
             L  G+ LYFGK  D M YF +VGF+P   +NP+DF+LDLANG+T  D Q D  ++TVK++
Sbjct  269   LSGGSCLYFGKAKDAMDYFGSVGFAPRFHVNPADFMLDLANGVTQIDYQGDAEKSTVKQS  328

Query  1069  LVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKR-----WAIPWWEQFSVLLKRGLKQ  905
             L+S++   L   +K  L      D +  G +  F+R      +I W+ QFS+LL+R LK+
Sbjct  329   LISSYNRLLAPQVKAGLSAAVARDAAQTGKEASFEREKRDHSSISWFSQFSILLQRSLKE  388

Query  904   RKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFP  731
             R++ESF+ L+V QV+  A L+G++WW S+  D+QD++GLLFF++ FWG F  F A+FTFP
Sbjct  389   RRHESFNSLRVFQVMAAAVLSGSMWWHSSIHDVQDRLGLLFFVAIFWGVFASFNAVFTFP  448

Query  730   EDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSAL  551
             +++ +  KE+SSGMY LSS+F+AR  GDLPMEL+LPTVF +I YWMAGL+     F   L
Sbjct  449   QERAIFVKEKSSGMYSLSSYFMARMAGDLPMELILPTVFTLILYWMAGLRAEPAAFLITL  508

Query  550   SAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYIS  371
             + +L  VLV QGLGL +GA IMD K A+T+ ++ MLAFLL GGFYV+++PSF++W+KY+S
Sbjct  509   AVLLGYVLVAQGLGLVVGAAIMDAKQASTVVTITMLAFLLTGGFYVQNIPSFLAWLKYVS  568

Query  370   IGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQ-----HVIFSVVALLL  206
                Y Y+LL+  QY+ GE      GS       H   ++   G+       + SV AL+ 
Sbjct  569   CTFYCYRLLVRIQYR-GEEMEYFLGS------SHQRSRREAEGEMAGEVSTLVSVGALIA  621

Query  205   MLIGYRLLAYVALMRV  158
             M +GYR+LAYVAL R+
Sbjct  622   MFVGYRILAYVALRRI  637



>ref|XP_008382026.1| PREDICTED: ABC transporter G family member 25-like [Malus domestica]
Length=654

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/623 (52%), Positives = 423/623 (68%), Gaps = 35/623 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQK---QGLSF-LKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGP  1772
             P+TLKF +V YKVK D K   +G  F  K K  + E E+ IL G+TG+VFPGE+LA+LGP
Sbjct  34    PITLKFVDVCYKVKIDNKSKYRGCLFGHKDKPGQEEQERTILHGITGMVFPGEILAILGP  93

Query  1771  SgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVF  1592
             SGSGK+TLL AL  RL     GT+  N +  + A  R TGFV QDD+ YPHLTV ETLVF
Sbjct  94    SGSGKSTLLNALADRLTHKHQGTVLANDQALTKAXLRRTGFVPQDDVXYPHLTVRETLVF  153

Query  1591  TALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLI  1412
              +LLRLPRTL+K++KI  A++VI++LGL KC+N+IIG  F+RG+SGGERKRVSI +EML+
Sbjct  154   CSLLRLPRTLSKKDKISAAESVISELGLHKCENTIIGNTFVRGVSGGERKRVSIAREMLM  213

Query  1411  NPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEG  1232
             NPSLL LDEPTSGLDST A R++STL  L+  G+TIV ++HQPSSR++ +F  VL++C+G
Sbjct  214   NPSLLILDEPTSGLDSTAAHRLLSTLGSLAHKGKTIVTSMHQPSSRVYQMFDSVLVMCDG  273

Query  1231  NPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSA  1058
               LYFG GS+ +SYF ++GF P+  MNP+DFLLDLANG+   +  S+ D+  +KE L+S+
Sbjct  274   KCLYFGXGSEAISYFGSIGFVPAFPMNPADFLLDLANGVCQLNGLSERDKPKMKEILISS  333

Query  1057  FKTNLLENLKMELHELND----EDVSSAGDQKQFKRWAI-----PWWEQFSVLLKRGLKQ  905
             + T L   +K E  E       E         + +R +I      W+ QFS+LL+R LK+
Sbjct  334   YNTLLSPKVKAECLETTSATTKEMTYVQSHCSRERRTSIGDVVSTWFNQFSILLQRSLKE  393

Query  904   RKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFP  731
             RK+ESF+ L++ QV+  A L G +WWKS   D+QD +GLLFFIS FWG  P F ++F FP
Sbjct  394   RKHESFNSLRIFQVVAAALLAGLMWWKSDYLDIQDHLGLLFFISIFWGVLPSFNSVFAFP  453

Query  730   EDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSAL  551
             +++ +  KE++SGMY LSS+F+AR VGDLPMEL+LPT+F+I+ YWMAGLKP  G F   L
Sbjct  454   QERAIFIKEQASGMYTLSSYFMARMVGDLPMELILPTIFLIMVYWMAGLKPDMGAFLITL  513

Query  550   SAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYIS  371
               +L  VLV QGLGLA+GA IMD K A+T+ +V MLAFLL GG+YV  VPS ++W+KYIS
Sbjct  514   LVLLGYVLVSQGLGLALGAAIMDAKRASTIATVTMLAFLLTGGYYVHKVPSCLAWVKYIS  573

Query  370   IGQYTYKLLLESQYKPGETYP----CTSGSGVCLVEDHPAIKKIGLG---QHV------I  230
                Y+Y+LL+  QY  G        C+S        DH    K       Q V       
Sbjct  574   TTFYSYRLLINVQYGEGSKISSLLGCSSHH-----HDHAGDHKASCNFVEQDVEGQISPA  628

Query  229   FSVVALLLMLIGYRLLAYVALMR  161
              S+  +L M   YRLLAY+AL R
Sbjct  629   TSICVMLFMFFAYRLLAYLALRR  651



>ref|XP_010910172.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=668

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/630 (55%), Positives = 440/630 (70%), Gaps = 39/630 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PVTL+FE V YKVK  Q    S        + AEK+IL G+TG+V PGE+LAMLGPSGSG
Sbjct  39    PVTLRFEEVAYKVKLGQPMWWSSCH-GSAAAAAEKVILNGITGMVPPGEILAMLGPSGSG  97

Query  1759  kttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTALGGRL       TITYNG+PFS AMKR TGFV QDD+LYPHLTV ETLVFTAL
Sbjct  98    KTTLLTALGGRLVTGKLSGTITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVHETLVFTAL  157

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLPR+L++ EK+  A+ V+ +LGL +  +++IGG  +RG+SGGERKRVSI QE+L+NPS
Sbjct  158   LRLPRSLSRAEKMRHAEKVMEELGLVRVAHTMIGGRLVRGVSGGERKRVSIAQELLVNPS  217

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNP  1226
             LL LDEPTSGLDSTTA RIV+ L  L+ +GGRT+V TIHQPS+RL+ +F KV+LL EG+P
Sbjct  218   LLLLDEPTSGLDSTTAARIVTMLRRLAAEGGRTVVTTIHQPSNRLYRMFDKVVLLSEGSP  277

Query  1225  LYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQA-------------  1085
             +Y+G  SD + YFS++GFS  + +NP++ +LDLANGI  D  + + A             
Sbjct  278   IYYGPASDALDYFSSIGFSSPLYVNPAELMLDLANGIAPDSFKENSAGEPNGSAERERKS  337

Query  1084  -TVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQK------------------QFKR  962
               +++ L SA+  N+   LK +L  ++    S A D                    + + 
Sbjct  338   SVIRKELRSAYGRNIATRLKADLCRMDSSSHSHAKDASNTQIPHAMWIYIYIHGTGRRED  397

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLF  788
             W   W EQF VLL+RG+K+R+YESF+ L++ QV+ VA L G LWW ++   +QDQV LLF
Sbjct  398   WCTSWLEQFLVLLRRGIKERRYESFNKLRIFQVISVATLGGLLWWHTSPSHIQDQVALLF  457

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             F S FWGFFPL+ A+FTFP+++ ML KERSSGMY+LSS+FLART GDLPMEL LPT FV+
Sbjct  458   FFSVFWGFFPLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVV  517

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I YWM GL+P A +F  +L  +L  VLV Q LGLA GA +MD K ATTL SV  L FL+A
Sbjct  518   IIYWMGGLQPGASSFLLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIA  577

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
             GG+YV+H+PSFI W+KY+S   Y YKLLL  Q++  + Y C+ G  +C V D PAIK +G
Sbjct  578   GGYYVQHIPSFIVWLKYLSFSFYCYKLLLGVQFRDDDVYECSPGV-LCRVVDFPAIKSVG  636

Query  247   LGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
             L  H+   V  + LMLI YRL+AY+AL R+
Sbjct  637   L-HHMWIDVCIMALMLIAYRLIAYLALHRL  665



>gb|ABR17189.1| unknown [Picea sitchensis]
Length=819

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/670 (49%), Positives = 451/670 (67%), Gaps = 39/670 (6%)
 Frame = -3

Query  2074  SDQQEATLMET-ATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK  1898
             +D QEA L  + A +  + E+   ++  N  L+S+      +    P+ LKF  V YKV 
Sbjct  154   NDLQEARLHASVALKKKETESKDVEMTVN--LDSELPQ---RDPPLPICLKFLEVQYKVI  208

Query  1897  PDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgg  1718
                K       +  +    EK IL GV+G + PGE+LAM+GPSGSGKTTL+  LGGR+  
Sbjct  209   LQGKPTSILTSSWTEPIFFEKDILYGVSGSIAPGEMLAMMGPSGSGKTTLINLLGGRIQQ  268

Query  1717  hlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQ  1538
             +++G+ITYN +P+S A+KR  GFVTQDD+L+PHLTV ETL +TALLRLPRTLTK ++ ++
Sbjct  269   NVSGSITYNDQPYSKALKRRIGFVTQDDVLFPHLTVRETLTYTALLRLPRTLTKHQREQR  328

Query  1537  ADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTT  1358
             A  V+ +LGL +C+++IIGG F+RGISGGERKRV IG E+LI+PSLLFLDEPTSGLDSTT
Sbjct  329   AQEVVRELGLERCQDTIIGGNFVRGISGGERKRVCIGCEILIDPSLLFLDEPTSGLDSTT  388

Query  1357  AQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTV  1178
             A RIV  L ++++ GRT+V TIHQPSSRLF+ F K++LL EG+ +YFGK SD M YFS+V
Sbjct  389   ALRIVQMLHDIARAGRTVVSTIHQPSSRLFHKFDKLILLGEGHSIYFGKASDAMEYFSSV  448

Query  1177  GFSPSVAMNPSDFLLDLANGITGD----------------DSQADQ-------ATVKETL  1067
             GFSP +AMNP+DFLLDLANG   D                D+  D+         V E L
Sbjct  449   GFSPFLAMNPADFLLDLANGNIHDISVPAELENTSHAEAEDNHGDKFPRSLSSHDVLEYL  508

Query  1066  VSAFKTNLLENLKMELHELND--EDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLKQRKYE  893
             + A++TN+    K +L  LN+  +D+ S+   K  + W   WW+QFS+L  RGLK+R++E
Sbjct  509   IEAYETNVAPMEKAKLITLNEVTDDLKSSVSAK--REWGATWWDQFSILFVRGLKERRHE  566

Query  892   SFSGLKVGQVLVVAFLTGALWWKST-----DLQDQVGLLFFISSFWGFFPLFQAIFTFPE  728
               S L++ QV + A + G LWW+S       LQDQ+GL+FFI+ FWGFFP+F AIFTFP+
Sbjct  567   YLSFLRIAQVFLTALILGLLWWQSNIDTPKGLQDQIGLIFFIAVFWGFFPVFTAIFTFPQ  626

Query  727   DKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALS  548
             ++ ML KER+  MY+LS++F+AR + DLP++L LP  F++I Y+MA L+ T   F   + 
Sbjct  627   ERAMLSKERAVDMYRLSAYFMARILSDLPLDLFLPIGFLLIVYFMAHLRMTVTAFLLTML  686

Query  547   AIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISI  368
                L ++  QGLGLAIGA  MD K ATTL SV M+AF+LAGGF+V+ V  FI WI+Y+S 
Sbjct  687   TTFLSIVASQGLGLAIGAAFMDLKKATTLASVTMMAFMLAGGFFVQRVHPFIKWIRYLSF  746

Query  367   GQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYR  188
               YTYK+LL+ QY   + Y C+S SG   +    +++ I L   +  + V +L+M+ GYR
Sbjct  747   NYYTYKILLKIQYDADQLYDCSSPSGCKSIATSSSLRGIPLDGGIKEATV-MLIMVFGYR  805

Query  187   LLAYVALMRV  158
             LLAY +L+R+
Sbjct  806   LLAYFSLLRM  815



>ref|XP_009406087.1| PREDICTED: ABC transporter G family member 25-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/634 (50%), Positives = 436/634 (69%), Gaps = 33/634 (5%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG------LSFLKTKKQKSEA--  1841
             A  ++ S TS+A    +  P TLKF +V Y++K D   G         L +    S A  
Sbjct  20    ATARVNSITSSA----SCFPFTLKFMDVSYRLKLDPMSGSGGNGIRRILHSAGGSSAAPE  75

Query  1840  EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKR  1661
             E++IL G++G+V PGE+LA+LGPSGSGK+TLL+ L GRL G   GT+  NG   + ++ R
Sbjct  76    ERVILNGISGMVSPGEMLAILGPSGSGKSTLLSILAGRLQGKHTGTVLANGHRLTKSVLR  135

Query  1660  NTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIG  1481
              TGFVTQDD+LYPHLTV ETLVF A+LRLPRT+ K +K+  A+AVI +LGL+KC ++ +G
Sbjct  136   RTGFVTQDDVLYPHLTVRETLVFCAMLRLPRTVEKTDKVASAEAVIAELGLSKCADTSVG  195

Query  1480  GVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIV  1301
             G F+RGISGGERKRV IG EML+NPSLL LDEPTSGLDST A R+V+TL  L++ GRT+V
Sbjct  196   GPFVRGISGGERKRVCIGHEMLVNPSLLLLDEPTSGLDSTAASRLVATLGGLARQGRTVV  255

Query  1300  MTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLAN  1121
              ++HQP+SR++ +F  VLLL EG+ LYFGK  D + YF +VGF+P   +NP+DF+LDLAN
Sbjct  256   TSVHQPASRVYQMFDSVLLLSEGSCLYFGKARDAVDYFGSVGFAPKFHVNPADFMLDLAN  315

Query  1120  GITGDDSQAD--QATVKETLVSAFKTNLLENLKMELHELNDEDVSSAG-----DQKQFKR  962
             G+T  D Q D  ++ VK++LVS++ + L   ++  L      + +  G     ++ + ++
Sbjct  316   GVTQTDYQGDAEKSAVKQSLVSSYNSVLAPKVRAGLTAAVPRNATHTGKDVCVERGRKEQ  375

Query  961   WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLF  788
              +I W  QFS+LL+R LK+R++ESF+ L+V QV+  A L+G++WW S+  D+QD++GLLF
Sbjct  376   RSISWCSQFSILLQRSLKERRHESFNSLRVFQVMAAAVLSGSMWWHSSIRDVQDRLGLLF  435

Query  787   FISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVI  608
             FI+ FWG F  F A+FTFP+++ +  KERSSGMY LSS+F+AR  GDLPMEL+LPTVF +
Sbjct  436   FITIFWGVFASFNAVFTFPQERAIFIKERSSGMYNLSSYFMARMAGDLPMELILPTVFTL  495

Query  607   ISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLA  428
             I YWMAGL+   G F   L+ +L  VLV QGLGL +GA IMD K A+T+ +V MLAFLL 
Sbjct  496   ILYWMAGLRTEPGAFLLTLAVLLGYVLVAQGLGLVLGAAIMDAKQASTIATVTMLAFLLT  555

Query  427   GGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIG  248
             GGFYV+++PS ++W+KYIS   Y Y+LL+  QY  G+           L   H   K+  
Sbjct  556   GGFYVQNIPSCLAWLKYISFTFYCYRLLIIIQYGGGQM-------DYLLASSHHRNKRDA  608

Query  247   LGQHVI-----FSVVALLLMLIGYRLLAYVALMR  161
              G+ V        + ALL M +GYR+LAY+AL R
Sbjct  609   DGELVAQVSTSVCIAALLAMFVGYRVLAYMALRR  642



>ref|XP_004250400.1| PREDICTED: ABC transporter G family member 25 [Solanum lycopersicum]
Length=666

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/658 (50%), Positives = 446/658 (68%), Gaps = 37/658 (6%)
 Frame = -3

Query  2020  EAPTTQLQANPQLESDTSAA---IFKKANRPVTLKFENVVYKVKPDQKQ----GLSFLK-  1865
             EA T  + A   ++ +T+     I   +  P+TLKF ++ Y++K D K       +F+K 
Sbjct  7     EATTITMNATTLMDEETNKDFPFIMSSSTYPITLKFMDISYRIKLDNKSTSGGSNNFIKM  66

Query  1864  ------------TKKQKS--EAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggr  1727
                          + Q +    E+ IL G+TG+V PGE+LA+LGPSGSGK+TLL AL GR
Sbjct  67    FSSSSGPTSSSDIENQTAVIHQERTILNGITGMVSPGEILAVLGPSGSGKSTLLNALAGR  126

Query  1726  lgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQE  1550
             L GH    TI  N +  +  + + TGFVTQDD+LYPHLTV ETL+F ALLRLP +L ++E
Sbjct  127   LHGHTYTGTILANNRKLTKQVLKRTGFVTQDDVLYPHLTVRETLIFCALLRLPNSLNRKE  186

Query  1549  KIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGL  1370
             KI   D+VI +LGL KC+++IIG  F+RG+SGGERKRVSI  EMLINPSLL LDEPTSGL
Sbjct  187   KITVTDSVIAELGLNKCEDTIIGNSFIRGVSGGERKRVSIAHEMLINPSLLILDEPTSGL  246

Query  1369  DSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSY  1190
             D+T A R+VSTL  LSK G+TI+ ++HQPSSR+F +FH VL+L EG  LYFGKG++ MSY
Sbjct  247   DATAAYRLVSTLDSLSKKGKTIITSVHQPSSRVFQMFHSVLVLSEGRCLYFGKGNEAMSY  306

Query  1189  FSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSAFKTNLLENLK---M  1025
             F +VGFSPS  MNP+DFLLDLANG+   D  S+ D+  VK+TL+S +   L   +K   +
Sbjct  307   FESVGFSPSFPMNPADFLLDLANGVCQFDGVSEKDKPNVKQTLISTYNNVLAPKVKAACL  366

Query  1024  ELHELNDEDVSSAGDQ--KQFKRWAIP-WWEQFSVLLKRGLKQRKYESFSGLKVGQVLVV  854
             E   +  +++ + G       KR  I  W+ QFS+LL+RGLK+R++E+F+ L+V QV+  
Sbjct  367   ESTNIVPKEIMNKGTYTCASSKRSCISNWFNQFSILLQRGLKERRHETFNYLRVFQVIAA  426

Query  853   AFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKL  680
             + L G++WW S   D+QD++GLLFFIS FWG FP F A+F FP+++ +  KER+SGMY L
Sbjct  427   SLLAGSMWWHSDYRDIQDRLGLLFFISIFWGVFPSFNAVFAFPQERAIFMKERASGMYTL  486

Query  679   SSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAI  500
             SS+F+AR VGDLPM+L+LPT+F+ I+YWMAGLKP    F   L  +L  V+V QGLGLA+
Sbjct  487   SSYFMARIVGDLPMDLILPTLFLTITYWMAGLKPQLLAFLLTLLVLLSYVIVSQGLGLAL  546

Query  499   GAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPG  320
             GA IMD K A+T+ +V MLAF+L GGFYV  VP+ ++WIKYIS   Y+Y+LL++ Q+  G
Sbjct  547   GAIIMDAKQASTVITVTMLAFVLTGGFYVHKVPACLAWIKYISTTFYSYRLLIDVQFGEG  606

Query  319   ETYPCTSGSGVCLVEDHPAIKKIG---LGQ-HVIFSVVALLLMLIGYRLLAYVALMRV  158
             +      G       D    K I    +GQ H   S+  LL+M +GYRL+AY+AL R+
Sbjct  607   KEISDLLGCSRIQGSDRANCKFIEQDIIGQIHPSMSLGILLIMFVGYRLIAYLALRRI  664



>ref|XP_009345933.1| PREDICTED: ABC transporter G family member 25-like [Pyrus x bretschneideri]
Length=654

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/623 (52%), Positives = 423/623 (68%), Gaps = 35/623 (6%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQK---QGLSF-LKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGP  1772
             P+TLKF +V YKVK D K   +G  F  K K    E E+ IL G+TG+V PGE+LA+LGP
Sbjct  34    PITLKFVDVCYKVKIDNKSKYRGCLFGHKDKPGLEEQERTILHGITGMVSPGEILAILGP  93

Query  1771  SgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVF  1592
             SGSGK+TLL AL GRL     GT+  N + F+ A+ R TGFV QDD+LYPHLTV ETLVF
Sbjct  94    SGSGKSTLLNALAGRLTYKHQGTVLANDRAFTKAVLRRTGFVPQDDVLYPHLTVRETLVF  153

Query  1591  TALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLI  1412
              +LLRLPRTL+K++KI  A+++I++LGL KC+N+IIG  F+RG+SGGERKRVSI  EML+
Sbjct  154   CSLLRLPRTLSKKDKISAAESIISELGLHKCENTIIGNTFVRGVSGGERKRVSIAHEMLM  213

Query  1411  NPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEG  1232
             NPSLL LDEPTSGLDST A R++STL  L+  G+TIV ++HQPSSR++ +   VL+LC+G
Sbjct  214   NPSLLILDEPTSGLDSTAAHRLLSTLGSLAHKGKTIVTSMHQPSSRVYQMLDSVLVLCDG  273

Query  1231  NPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSA  1058
               LYFGKG + +SYF ++GF+P+  MNP+DF+LDLANG+   +  S+ D+  VKE L+S+
Sbjct  274   KCLYFGKGCEAISYFGSIGFAPAFPMNPADFVLDLANGVCQLNGLSERDKPKVKEILISS  333

Query  1057  FKTNLLENLKMELHELND----EDVSSAGDQKQFKRWAI-----PWWEQFSVLLKRGLKQ  905
             + T L   +K+E  E       E         + +R +I      W+ QFS+LL+R LK+
Sbjct  334   YNTLLSPKVKVECLETTSATTKEMTYVQSHCSKERRTSIGDVVSTWFNQFSILLQRSLKE  393

Query  904   RKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTFP  731
             R++ESF+ L++ QV+  A L G +WWKS   D+QD +GLLFFIS FWG  P F ++F FP
Sbjct  394   RRHESFNSLRIFQVVAAALLAGLMWWKSDYLDIQDHLGLLFFISIFWGVLPSFNSVFAFP  453

Query  730   EDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSAL  551
             +++ +  KE++SGMY LSS+F+AR VGDLPMEL+LPT+F+I+ YWMAGLKP  G F   L
Sbjct  454   QERAIFIKEQASGMYTLSSYFMARMVGDLPMELILPTIFLIMVYWMAGLKPDLGAFLITL  513

Query  550   SAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYIS  371
               +L  VLV QGLGLA+GA IMD K   T+ +V MLAFLL GG+YV  VPS ++W+KYIS
Sbjct  514   LVLLGYVLVSQGLGLALGAAIMDAKRGPTIATVTMLAFLLTGGYYVHKVPSCLAWVKYIS  573

Query  370   IGQYTYKLLLESQYKPGETYP----CTSGSGVCLVEDHPAIKKIGLG---QHV------I  230
                Y+Y+LL+  QY  G        C+S        DH    K       Q V       
Sbjct  574   TTFYSYRLLINVQYGEGSKISSLLGCSSHH-----HDHAGDHKASCNFVEQDVEGQISPA  628

Query  229   FSVVALLLMLIGYRLLAYVALMR  161
              S+  +L M   YRLLAY+AL R
Sbjct  629   TSICVMLFMFFAYRLLAYLALRR  651



>ref|XP_001780064.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
 gb|EDQ55167.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
Length=584

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/584 (54%), Positives = 426/584 (73%), Gaps = 18/584 (3%)
 Frame = -3

Query  1870  LKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITY  1694
             +KT+ +  E    IL GV+G+V  GE+L MLGPSGSGKTTLL  LGGRL       TI Y
Sbjct  1     MKTQDKTKE----ILHGVSGVVRAGEMLVMLGPSGSGKTTLLNVLGGRLKSAKVKGTILY  56

Query  1693  NGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQL  1514
             N +  SN +KR TGFVTQDD+L+P+LTV ETLV+ A LRLP T T++ K+++A+++IT+L
Sbjct  57    NDETHSNFVKRRTGFVTQDDVLFPNLTVKETLVYAARLRLPDTYTREAKVQRAESIITEL  116

Query  1513  GLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTL  1334
             GL +CK++IIGG F RG+SGGERKRVSIG EML++PSLLFLDEPTSGLDSTTA RI+ TL
Sbjct  117   GLERCKDTIIGGPFKRGVSGGERKRVSIGHEMLVDPSLLFLDEPTSGLDSTTALRIIKTL  176

Query  1333  WELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAM  1154
              +++K G+TI+ TIHQPSS ++++F K++LL EG+ LY+G G   MSYF+++ FSP   M
Sbjct  177   QDMAKSGKTIITTIHQPSSTVYHMFDKMILLSEGHLLYYGDGHQAMSYFASIHFSPPFPM  236

Query  1153  NPSDFLLDLANG---ITGDDSQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSSA-  986
             NP+DFLLDLANG     G     D   V++ L+ A+K+NL   +  E+   +    + A 
Sbjct  237   NPADFLLDLANGSGAFEGKKHNEDPQAVRQVLIKAYKSNLEHKIDTEVASTSAPATAFAD  296

Query  985   -----GDQKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS  821
                    +    +W+  W EQFSVLL+RG K+R++E+FS LK+GQVL ++ + G LW+ S
Sbjct  297   KGMYSSKRTGLNKWSTSWREQFSVLLERGWKERRHEAFSPLKIGQVLAISIICGLLWYDS  356

Query  820   --TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGD  647
               + +QD+VGLLFF  +FWGFFP+F AIFTFP+++ ML KER+SGMY+LS++F+AR +GD
Sbjct  357   PESQVQDRVGLLFFFITFWGFFPVFSAIFTFPQERAMLIKERASGMYRLSAYFMARVIGD  416

Query  646   LPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSAT  467
             +P+ELVLPT+F+ I YWMAGLK T   F   L  IL  VLV QGLGL +GA +MD K AT
Sbjct  417   MPLELVLPTIFITIVYWMAGLKQTFLAFILTLLVILYTVLVSQGLGLTLGAALMDVKKAT  476

Query  466   TLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSG-SG  290
             TL SVIML  LLAGG+Y+++ P +I+WIKY+S+  ++YKL L +QY P +TY C++G SG
Sbjct  477   TLASVIMLTLLLAGGYYIQNTPKWIAWIKYLSVSYWSYKLQLAAQYSPDQTYACSTGSSG  536

Query  289   VCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              C + D+PA+  +GL Q  I + +A+ +ML+GYRL AY  L R+
Sbjct  537   RCRIADYPAVANVGLDQLGI-AAMAMAIMLVGYRLSAYFFLSRI  579



>ref|XP_006351917.1| PREDICTED: ABC transporter G family member 25-like [Solanum tuberosum]
Length=650

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/637 (50%), Positives = 429/637 (67%), Gaps = 36/637 (6%)
 Frame = -3

Query  1960  IFKKANRPVTLKFENVVYKVKPDQKQGL------------------SFLKTKKQKSEAEK  1835
             I   +  P+TLKF ++ Y++K + K                     S ++ +      E+
Sbjct  12    IMSSSTYPITLKFMDISYRIKLENKSTSGGSNNIIKMFSTSAGPTSSDIENQTAVIHQER  71

Query  1834  IILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRN  1658
              IL G+TG+V PGE+LA+LGPSGSGK+TLL AL GRL GH    TI  N +  +  + + 
Sbjct  72    TILNGITGMVSPGEILAVLGPSGSGKSTLLNALAGRLQGHNYTGTILANNRKLTKQVLKR  131

Query  1657  TGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGG  1478
             TGFVTQDD+LYPHLTV ETL+F ALLRLP +L + EKI   D+VIT+LGL KC+++IIG 
Sbjct  132   TGFVTQDDVLYPHLTVRETLIFCALLRLPNSLNRNEKITVTDSVITELGLNKCEDTIIGN  191

Query  1477  VFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVM  1298
              F+RG+SGGERKRVSI  EMLINPSLL LDEPTSGLD+T A R+VSTL  L+K G+TI+ 
Sbjct  192   SFIRGVSGGERKRVSIAHEMLINPSLLILDEPTSGLDATAAYRLVSTLGSLAKKGKTIIT  251

Query  1297  TIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANG  1118
             ++HQPSSR+F +F+ VL+L EG  LYFGKG++ MSYF +VGFSPS  MNP+DFLLDLANG
Sbjct  252   SVHQPSSRVFQMFNSVLVLSEGRCLYFGKGNEAMSYFESVGFSPSFPMNPADFLLDLANG  311

Query  1117  ITGDD--SQADQATVKETLVSAFKTNLLENLKMELHE---------LNDEDVSSAGDQKQ  971
             +   D  S+ D+  VK+TL+S +   L   +K    E         +N    + +  ++ 
Sbjct  312   VCQFDGVSEKDKPNVKQTLISTYNNVLALKVKAACLEATNIVPKEIMNKGTYTCSSSKRS  371

Query  970   FKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVG  797
                    W+ QFS+LL+RGLK+R++E+F+ L+V QV+  + L G++WW S   D+QD++G
Sbjct  372   CTSCISNWFNQFSILLQRGLKERRHETFNYLRVFQVIAASLLAGSMWWHSDYRDIQDRLG  431

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFFIS FWG FP F A+F FP+++ +  KER+SGMY LSS+F+AR VGDLPM+L+LPT+
Sbjct  432   LLFFISIFWGVFPSFNAVFAFPQERAIFMKERASGMYTLSSYFMARIVGDLPMDLILPTL  491

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             F+ I+YWMAGLKP    F   L  +L  V+V QGLGLA+GA IMD K A+T+ +V MLAF
Sbjct  492   FLTITYWMAGLKPQLLAFLLTLLVLLSYVIVSQGLGLALGAIIMDAKQASTVITVTMLAF  551

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIK  257
             +L GGFYV  VP+ ++WIKYIS   Y+Y+LL++ Q+  G+      G       D    K
Sbjct  552   VLTGGFYVHKVPACLAWIKYISTTFYSYRLLIDVQFGEGKEISDLLGCSHIQGSDRANCK  611

Query  256   KIG---LGQ-HVIFSVVALLLMLIGYRLLAYVALMRV  158
              I    +GQ H   S+  LL+M +GYRL+AY+AL R+
Sbjct  612   FIEQDIMGQIHPSMSLGILLIMFVGYRLIAYLALRRI  648



>ref|XP_011005152.1| PREDICTED: ABC transporter G family member 25-like [Populus euphratica]
Length=655

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/646 (49%), Positives = 430/646 (67%), Gaps = 20/646 (3%)
 Frame = -3

Query  2038  TEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTK  1859
             T  GD      Q +A P  +S    ++   +  P+TLKF  V Y+VK + +   S +K  
Sbjct  9     TTNGDSPDGPDQSKAPPPPDSRDLPSLMLSSCYPITLKFMEVGYRVKFENRNKGSNIKRI  68

Query  1858  KQKSEA------EKIILKGVTGIVFPGEVLAMLGPSgsgktt--lltalggrlgghlagT  1703
                  A      E+ IL G+TG+  PGE+LA+LGPSGSGK+T     A   +        
Sbjct  69    LGHEPAICDQVQERTILNGITGMASPGEILAVLGPSGSGKSTFLNALAGRIQSNSFTGTI  128

Query  1702  ITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVI  1523
             +  N KP    MKR TGFVTQDDILYPHLTV ETLVF +LLRLP++L+KQEK   A++VI
Sbjct  129   LANNRKPTKEIMKR-TGFVTQDDILYPHLTVRETLVFCSLLRLPKSLSKQEKTLVAESVI  187

Query  1522  TQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIV  1343
             ++LGLTKC+N+IIG  F+RGISGGERKRVSI  EMLINPSLL LDEPTSGLD+T A R+V
Sbjct  188   SELGLTKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDATAAYRLV  247

Query  1342  STLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPS  1163
              TL  L++ G+TIV ++HQPSSR++ +F  V++L EG  LYFGKGS+ MSYF T G+SPS
Sbjct  248   LTLGSLAQKGKTIVTSMHQPSSRVYQMFDSVMVLSEGRCLYFGKGSEAMSYFETTGYSPS  307

Query  1162  VAMNPSDFLLDLANGITGDD--SQADQATVKETLVSAFKTNLLENLKMELHELNDEDVSS  989
               MNP+DFLLDLANG+   D  S+ D+  VK++L++++ T L    +    E  +  + S
Sbjct  308   FPMNPADFLLDLANGVFQTDGVSERDKPNVKQSLIASYNTLLAPKARAAFMETTESSIGS  367

Query  988   --AGDQKQFKRWAI-PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-  821
               + + +   R +I  W+ QFS+LL+R LK+RK+ESF+ L++ QV++ A   G +WW S 
Sbjct  368   YNSKEHRSSDRISIDAWFNQFSILLQRSLKERKHESFNTLRIFQVIMAAVFAGLMWWHSD  427

Query  820   -TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDL  644
               D+QD++GLLFF+S FWG  P   ++F FP+++ +  KER+SGMY LSS+F++R VGDL
Sbjct  428   FRDVQDRLGLLFFMSIFWGVLPSSNSVFVFPQERAIFVKERASGMYTLSSYFMSRIVGDL  487

Query  643   PMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATT  464
             PMEL+LP +F+ ++YWMAGLKP  G F   L  +L  VLV QGLGLA+GA IMD K A+T
Sbjct  488   PMELILPAIFLSVTYWMAGLKPELGAFLLTLLVLLGYVLVSQGLGLALGAAIMDAKQAST  547

Query  463   LGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVC  284
             + ++ MLAF+L GGFYV  +PS ++WIKYIS   Y+YKLL+  QY  G+      G  + 
Sbjct  548   VVTITMLAFVLTGGFYVHKLPSCMAWIKYISTTFYSYKLLINVQYGEGKRLSSFLGCSLP  607

Query  283   LVEDHPAIKKIG---LGQ-HVIFSVVALLLMLIGYRLLAYVALMRV  158
                D  + K +     GQ   + SV  L+ M +GYRLLAY+AL R+
Sbjct  608   HGGDRASCKFVEQDVAGQISPVVSVSVLIFMFVGYRLLAYLALRRI  653



>ref|XP_009397435.1| PREDICTED: ABC transporter G family member 14 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/633 (56%), Positives = 452/633 (71%), Gaps = 38/633 (6%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGV  1817
             A+P      +AA+F     P+TLKFE VVYKVK     G  + +  +  S AEK IL G+
Sbjct  33    AHPGPRPPQAAAVF-----PITLKFEEVVYKVKVG---GGGWWR--RSSSPAEKTILNGI  82

Query  1816  TGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQD  1637
             TG+V PGE+LAMLGPSGSGKTTLLTALGGRLGG L+G ITYNG PFS A+KR TGFV QD
Sbjct  83    TGVVCPGEMLAMLGPSGSGKTTLLTALGGRLGGKLSGKITYNGHPFSGAIKRRTGFVAQD  142

Query  1636  DILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVF-LRGI  1460
             D+LYPHLTVTETL FTALLRLP TLT+ EK  QA  VI++LGL++  +S+IGG   +RG+
Sbjct  143   DVLYPHLTVTETLTFTALLRLPGTLTRAEKAHQAQQVISELGLSRVAHSMIGGARGVRGV  202

Query  1459  SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQP  1283
             SGGERKRVSIG E+L++PSLL LDEPTSGLDSTTA RIV TL  L+ + GRT+V TIHQP
Sbjct  203   SGGERKRVSIGLELLVDPSLLLLDEPTSGLDSTTAARIVGTLKRLAAEKGRTVVTTIHQP  262

Query  1282  SSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGF-SPSVAMNPSDFLLDLANGI---  1115
             SSRL+ +F K++LL EG+ +Y+G+ +  + YF+ VGF SP   +NP+D LLDLANGI   
Sbjct  263   SSRLYRMFDKLVLLSEGSAIYYGRAAAAVDYFAMVGFASPIDGVNPADLLLDLANGIAPE  322

Query  1114  ------TGDDS---QADQATVKETLVSAFKTNLLENLKMELH--ELND----EDVSSAGD  980
                    GD S   Q ++  VKE L+ A+  N+   LK EL   +LN+     ++++A  
Sbjct  323   SNYASENGDGSGGLQQEKKAVKEALIGAYDRNIATRLKAELCAVDLNNYGYTREMANAMK  382

Query  979   QKQFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQD  806
             ++Q   W   WWEQF+VLL RGLK+R++E+F+ L++ QVL VA L G LWW +  + +QD
Sbjct  383   REQ---WCTSWWEQFTVLLSRGLKERRHEAFNKLRIFQVLSVATLGGLLWWHTPTSHIQD  439

Query  805   QVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVL  626
             +  L+FF S FWGFFPL+ A+FTFP+++ ML KE++SGMY+LSS+FLART GDLPMEL L
Sbjct  440   RTALIFFFSVFWGFFPLYNAVFTFPQERPMLRKEQASGMYRLSSYFLARTAGDLPMELAL  499

Query  625   PTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIM  446
             PT F  I YWM GL+     F  +L  +L  VLV Q LGLA+GA +MD K ATTL SV  
Sbjct  500   PTAFTFIIYWMGGLRSDPVAFLLSLLVVLFSVLVAQSLGLAVGAILMDVKQATTLASVTT  559

Query  445   LAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHP  266
             L FL+AGG+YV+ +P F+ W+KY+S   Y YKLLL  Q+   + Y C+SG  +C V D+P
Sbjct  560   LVFLMAGGYYVQQIPPFVVWLKYLSYSFYCYKLLLGVQFSEHDAYECSSGV-MCPVIDYP  618

Query  265   AIKKIGLGQHVIFSVVALLLMLIGYRLLAYVAL  167
             AIK +GLG H+   V  + LML+GYRL+AY+AL
Sbjct  619   AIKSVGLG-HIWIDVCIMGLMLVGYRLVAYLAL  650



>ref|XP_008797958.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=649

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/612 (55%), Positives = 437/612 (71%), Gaps = 23/612 (4%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             PVTLKFE VVYK+K  +    S          AEK+IL G+TG+V PGE+LAMLGPSGSG
Sbjct  39    PVTLKFEEVVYKLKIGRPMWWS-GCCGSGAGGAEKVILNGITGMVGPGEMLAMLGPSGSG  97

Query  1759  kttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLLTALGGRL       TITYNG+PFS  MKR TGFV QDD+LYPHLTV ETL FTAL
Sbjct  98    KTTLLTALGGRLVAGKLSGTITYNGQPFSRGMKRRTGFVAQDDVLYPHLTVRETLAFTAL  157

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLPR+L++ EK+  A+ V+  LGL +  +++IGG  +RG+SGGERKRVSI  E+L+NPS
Sbjct  158   LRLPRSLSRAEKVRHAEKVMGDLGLARVAHTMIGGHLVRGVSGGERKRVSIALELLVNPS  217

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNP  1226
             LL LDEPTSGLDSTTA RIVS L  L+ +G RT+V TIHQPS+RL+ +F KV+LL EG+P
Sbjct  218   LLLLDEPTSGLDSTTAARIVSVLRRLAAEGRRTVVTTIHQPSARLYRMFDKVMLLSEGSP  277

Query  1225  LYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQADQAT------------  1082
             +Y+G+ SD + YFS++GF   +++NP++ +LDLANGI  D  + + AT            
Sbjct  278   IYYGRASDALHYFSSIGFLSPLSVNPAEVMLDLANGIAPDSCKENSATEPDNGSAERERK  337

Query  1081  --VKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFSVLLKRGLK  908
                +E L SA+  ++   LK +L  ++    S A  +++   W   W EQF VLL+RG+K
Sbjct  338   SLAREELRSAYARHIAARLKADLCRMDSSSHSQAKGRRE--EWCTSWLEQFLVLLRRGIK  395

Query  907   QRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAIFTF  734
             +R+YE+F+ L++ QV+ VA L G LWW ++   +QD+V LLFF S FWGFFPL+ A+FTF
Sbjct  396   ERRYEAFNKLRIFQVISVATLGGLLWWHTSPSHIQDRVALLFFFSVFWGFFPLYNAVFTF  455

Query  733   PEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSA  554
             P+++ ML KERSSG Y+LSS+FLART GDLPMEL LPT FV+I YWM GL+P+A +F  +
Sbjct  456   PQERSMLIKERSSGTYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQPSASSFLLS  515

Query  553   LSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYI  374
             L  +LL VLV Q LGLA GA +MD K ATTL SV  L FL+AGG+YV+H+P FI W+KY+
Sbjct  516   LLVVLLSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIPRFIVWLKYL  575

Query  373   SIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIG  194
             S   Y YKLLL  Q++  + Y C+ G  +C   D PAIK +GL  H+   V  ++LMLIG
Sbjct  576   SFSFYCYKLLLGVQFRDDDVYQCSPGV-LCRAADFPAIKSVGL-HHMWIDVCIMVLMLIG  633

Query  193   YRLLAYVALMRV  158
             YRL+AY+AL R+
Sbjct  634   YRLIAYLALHRL  645



>ref|XP_008805673.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=666

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/655 (53%), Positives = 444/655 (68%), Gaps = 33/655 (5%)
 Frame = -3

Query  2029  GDIEAP--TTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG--------  1880
             GD   P   T + A P   S+           PV LKFE VVYKVK  +           
Sbjct  11    GDPNEPAVNTTVVACPTPHSNPRHLPHAGVVFPVILKFEEVVYKVKVGRHSSKGPGLCCC  70

Query  1879  LSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttllta-lggrlgghlagT  1703
                         AEK+IL G+TG+V PGE+LAMLGPSGSGKTTLLTA  G RL G L+G 
Sbjct  71    CGRGGGGGGGGPAEKMILNGITGVVCPGEILAMLGPSGSGKTTLLTAFGGRRLSGKLSGK  130

Query  1702  ITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVI  1523
             ITYNG PFS  MKR TGFV QDD+LYPHLTV ETL FTALLRLPR+L + EK+ QA  V+
Sbjct  131   ITYNGLPFSGPMKRRTGFVAQDDVLYPHLTVAETLAFTALLRLPRSLDRTEKVRQAHQVM  190

Query  1522  TQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIV  1343
             ++LGL +  +++IGG  +RG+SGGER+RVSIGQEMLINPSLL LDEPTSGLDSTTA RIV
Sbjct  191   SELGLARVAHTMIGGPLVRGVSGGERRRVSIGQEMLINPSLLLLDEPTSGLDSTTAARIV  250

Query  1342  STLWELS-KGGRTIVMTIHQPSSRLFYLFHKVLLL-CEGNPLYFGKGSDVMSYFSTVGFS  1169
             +TL  L+ +GGRT+V TIHQPSSRL+++F KV++L  EG+P+Y+G+ +  + YF ++GFS
Sbjct  251   TTLKRLATEGGRTVVTTIHQPSSRLYHMFDKVVVLSAEGSPIYYGRAAAALEYFVSIGFS  310

Query  1168  PSVAMNPSDFLLDLANGITGDDSQA-------------DQATVKETLVSAFKTNLLENLK  1028
               + +NP+D LLDLANGI   DSQ              +   V+E L+SA+  N+   LK
Sbjct  311   SPLTLNPADLLLDLANGIAPPDSQQAIEGGEALGSMEREPKAVREELISAYDRNIATRLK  370

Query  1027  MELHELNDEDVSSAGDQK---QFKRWAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLV  857
              EL+ ++  +     D     + ++W   W EQF VLL+RGL++R+YE+F+ L++ QVL 
Sbjct  371   AELYSVDPTNYGYTRDAAIAAKREQWCTSWCEQFRVLLRRGLRERRYEAFNKLRIFQVLS  430

Query  856   VAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYK  683
             VA L G LWW +  + +QD+  LLFF S FWGFFPL+ A+FTFP+++ +L KERSSGMY 
Sbjct  431   VATLGGLLWWHTPPSHIQDKTALLFFFSVFWGFFPLYNAVFTFPQERPILIKERSSGMYH  490

Query  682   LSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLA  503
             LSS+FLART GDLPMEL LP  FV+I YWM GLKP   +F  +L  +L  VLV Q LGLA
Sbjct  491   LSSYFLARTAGDLPMELALPIAFVLIIYWMGGLKPHPASFILSLLIVLFSVLVSQSLGLA  550

Query  502   IGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKP  323
             +GA +M+ K ATTL SV  L FL+AGG+YV+ +P FI W+KY+S   Y YKLL+  Q+  
Sbjct  551   MGALLMNVKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSFYCYKLLIGVQFSE  610

Query  322   GETYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              + + C+ G  +C V + PAIK +GL  H+   V  + LML+GYRL+AY+AL R+
Sbjct  611   EDYFECSPGV-LCPVVEFPAIKSVGL-NHMWVDVCIMALMLLGYRLVAYLALHRL  663



>gb|KEH43567.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=669

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/668 (48%), Positives = 443/668 (66%), Gaps = 43/668 (6%)
 Frame = -3

Query  2044  TATEMGDIEAP---TTQLQANPQLESDTSAAI--FKKANRPVTLKFENVVYKVKPDQKQG  1880
             T    G +E+P   ++     P+  S  S  +     ++ P+TLKF +V Y++K + K  
Sbjct  4     TKEAFGGVESPNVDSSNTHTPPKHSSRESCDLPTLLSSSYPITLKFMDVGYRIKIENKSA  63

Query  1879  LSFLKTK----------KQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalgg  1730
                   K           Q+S  E+IIL  VTGI +PGE+LA+LGPSGSGK+TLL +L G
Sbjct  64    KGGCIKKLFTPLESSPSDQRSTQERIILNNVTGIAYPGEILAILGPSGSGKSTLLNSLAG  123

Query  1729  rlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQ  1553
             RL  H    TI  N       + R TGFVTQDDILYPHLTV ETLVF ++LRLPR LT++
Sbjct  124   RLHTHNLTGTILANSSKLDRTILRRTGFVTQDDILYPHLTVRETLVFCSMLRLPRQLTRE  183

Query  1552  EKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSG  1373
              K+  A++ I +LGLTKC+N+IIG  F+RG+SGGERKRVSI  EML++P+LL LDEPTSG
Sbjct  184   TKVAAAESAIAELGLTKCENTIIGNSFIRGVSGGERKRVSIAHEMLVDPALLILDEPTSG  243

Query  1372  LDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMS  1193
             LDST A R+VSTL  L++ G+T+V ++HQPSSR+F +F +VL+L EGN +Y+GKG++ M 
Sbjct  244   LDSTAAHRLVSTLGSLARKGKTVVTSVHQPSSRVFQMFDRVLVLSEGNCMYYGKGAEAMR  303

Query  1192  YFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSAFKTNL---LENLK  1028
             YF +VGF+PS  +NP+DF+LDLANG+   D   + D+  +K+ L++++ T L   +++L 
Sbjct  304   YFESVGFAPSFPVNPADFMLDLANGVCHVDGVGEKDRPNIKQNLINSYNTVLGPKVKSLC  363

Query  1027  MELHELNDED------VSSAGDQKQFKRWAI-PWWEQFSVLLKRGLKQRKYESFSGLKVG  869
             M+    + +D       SS+ +++   R  I  W+ QFS+LL+R LK+RKYESF+ L+V 
Sbjct  364   MDTTNASTKDNHHPSRTSSSKERRYNDRVNIFDWFYQFSILLQRSLKERKYESFNTLRVF  423

Query  868   QVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSS  695
             QV+  A L G +WW S   ++QD++GLLFFIS FWG FP F ++F FP+++ +  KER+S
Sbjct  424   QVVAAALLAGLMWWHSDYKNVQDRLGLLFFISIFWGVFPSFNSVFAFPQERAIFVKERAS  483

Query  694   GMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqg  515
             GMY LSS+F+AR VGDLPMEL+LPT+F++I+YWM GLKP   +F   L  +L  VLV QG
Sbjct  484   GMYTLSSYFMARIVGDLPMELLLPTIFLVITYWMGGLKPDLLSFLLTLLVVLGFVLVSQG  543

Query  514   lgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLES  335
             LGLA+GA IMD K A+T+ +V MLAF+L GG+YV  VPS ++WIKYIS   Y+Y+LL   
Sbjct  544   LGLALGAAIMDAKQASTVAAVTMLAFVLTGGYYVHKVPSCVAWIKYISTTFYSYRLLTRI  603

Query  334   QYKPGETYP----C-----TSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLL  182
             QY  G+       C     TS    C   D   + +IG     +  +  L  M + YRLL
Sbjct  604   QYGDGKKIANLIGCNHVGSTSDGANCKFLDEDVVGQIG----TMGCIGVLFFMFVFYRLL  659

Query  181   AYVALMRV  158
             AY+AL R+
Sbjct  660   AYLALRRI  667



>gb|KHG11002.1| ABC transporter G family member 25 [Gossypium arboreum]
Length=660

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/659 (50%), Positives = 439/659 (67%), Gaps = 45/659 (7%)
 Frame = -3

Query  2035  EMGDIEAPTTQLQAN-PQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQK--QGLSFLK  1865
             E  + + PT  L+ + P L S         ++ P+TLKF +V YKVK  Q   +G S  +
Sbjct  12    ETPNRDGPTRDLRDHLPSLMS---------SSYPITLKFIDVCYKVKIQQTNTRGRSIKR  62

Query  1864  TKKQKSEA--------EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghla  1709
                  S          EK ILK +TG+V PGE+LA+LGPSGSGK+TLL AL GR      
Sbjct  63    MLTHGSTPSDQISTIQEKTILKNITGVVSPGEILAILGPSGSGKSTLLNALAGRHQQQSR  122

Query  1708  g---TITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQ  1538
                 TI  N K  +  + + TGFVTQDD+LYPHLTV ETLVF +LLRLP+TLTK++KI  
Sbjct  123   AFSGTILANNKKSTKQIAKRTGFVTQDDVLYPHLTVRETLVFCSLLRLPKTLTKKDKISV  182

Query  1537  ADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTT  1358
             A+ V+++LGL+KC+N+IIG  F+RGISGGERKRVSI  EMLINPSLL LDEPTSGLDST 
Sbjct  183   AEMVLSELGLSKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDSTA  242

Query  1357  AQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTV  1178
             A R+VSTL  L++ G+TIV ++HQPSSR++ +F  VL+L EG  +YFGKGS+ M+YF ++
Sbjct  243   AFRLVSTLGSLAQKGKTIVTSMHQPSSRVYQMFDSVLVLSEGRSMYFGKGSEAMAYFESL  302

Query  1177  GFSPSVAMNPSDFLLDLANGITGDDSQADQAT--VKETLVSAFKTNLLENLK---MELHE  1013
             GFSPS  MNP+DFLLDLANG+   D   ++ T  +K++L++++ T L   ++   ME+  
Sbjct  303   GFSPSFPMNPADFLLDLANGVCKLDGVCERETPNIKQSLIASYNTLLAPKVRDACMEITT  362

Query  1012  LNDED---VSSAGDQKQFKRWAI---PWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVA  851
             +++ D   + S   ++     ++    W+ QF +LL+RGLK+RKYESF+ L+V QV+  +
Sbjct  363   VSERDSHLIGSHSCKQHTSSCSVDLSTWFYQFRILLQRGLKERKYESFNTLRVFQVITAS  422

Query  850   FLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLS  677
              L G +WW S   D+QD++GLLFFIS FWG  P F A+F FP+++ +  KER+SGMY LS
Sbjct  423   ILAGLMWWHSDYRDIQDRLGLLFFISIFWGVLPSFNAVFAFPQERAIFMKERASGMYTLS  482

Query  676   SFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIG  497
             S+F+AR +GDLPMEL+LPTVF+I++YWMAGLKP    F   L  +L  VLV QGLGLA G
Sbjct  483   SYFMARIIGDLPMELILPTVFLIVTYWMAGLKPDLVAFLLTLVVLLGYVLVSQGLGLAFG  542

Query  496   AFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGE  317
             A IMD K A+T+ +V MLAF+L GG+YV  VP+ ++WIKY+S   Y+YKL +  QY  G 
Sbjct  543   AVIMDAKQASTIVTVTMLAFVLTGGYYVHKVPACMAWIKYVSTTYYSYKLFVNVQYSQGN  602

Query  316   TYPCTSGSGVCLVEDHPAIKKIGLGQHVI------FSVVALLLMLIGYRLLAYVALMRV  158
                   G   C       +    + Q +        SV  LLLM +GYRLLAY+AL R+
Sbjct  603   KISSLLG---CPHHGSNRVSCKFIDQDIAGQISPKLSVGILLLMFVGYRLLAYLALRRI  658



>ref|XP_010256405.1| PREDICTED: ABC transporter G family member 25 [Nelumbo nucifera]
Length=663

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/626 (51%), Positives = 431/626 (69%), Gaps = 32/626 (5%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQ--------------GLSFLKTKKQKSEAEKIILKGVTGIVF  1802
             P+TLKF +V +++K ++K               G     T K     E+ IL GVTG+V 
Sbjct  36    PITLKFMDVYFRLKLERKNNGGGAIRRMLGGPTGSDQGTTMKTSMSEERTILNGVTGMVS  95

Query  1801  PGEVLAMLGPSgsgkttlltalggrlgghlag-TITYNGKPFSNAMKRNTGFVTQDDILY  1625
             PGE+LA+LGPSGSGK+TLL AL GRL G+    TI  NGK  +  + R TGFVTQDDILY
Sbjct  96    PGEILAILGPSGSGKSTLLNALAGRLQGNGLTGTILANGKKLTKPVLRRTGFVTQDDILY  155

Query  1624  PHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGER  1445
             PHLTV ETLVF +LLRLP +L+K+EK+  A++VI +LGL KC+++IIG  F+RG+SGGER
Sbjct  156   PHLTVKETLVFCSLLRLPNSLSKKEKVRVAESVIAELGLNKCQDTIIGNSFIRGVSGGER  215

Query  1444  KRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFY  1265
             KRVSI  EMLINPSLL LDEPTSGLDST A R+VSTL  L++ G+TIV ++HQPSSR++ 
Sbjct  216   KRVSIAHEMLINPSLLLLDEPTSGLDSTAAYRLVSTLGSLAQKGKTIVTSVHQPSSRVYQ  275

Query  1264  LFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQAD  1091
             +F  V++L EG+ +YFGKGS+ M+YF++VGFSP+  MNP+DFLLDLANG+   D  S+AD
Sbjct  276   MFDSVIVLSEGSCIYFGKGSEAMNYFASVGFSPTFPMNPADFLLDLANGVCHLDVSSEAD  335

Query  1090  QATVKETLVSAFKTNLLENLK---MELHELNDEDVSSAGDQK-------QFKRWAIPWWE  941
             +  VK+TLVS++ + L   +K   M+      +D++ +G  +        F+     W+ 
Sbjct  336   KPNVKQTLVSSYNSLLAPKVKAACMDGSTTMTKDIARSGSYRAHEEIKVSFRTSICNWFN  395

Query  940   QFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWG  767
             QFS+LL+R LK+R++ESF+ L+V QV+  A L G++WW S   ++QD++GLLFFI+ FWG
Sbjct  396   QFSILLQRSLKERRHESFNSLRVFQVMTSAVLAGSMWWHSDIRNVQDRLGLLFFIAIFWG  455

Query  766   FFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAG  587
               P F A+FTFP+++ +  KER+SGMY LSS+F+AR VGDLPMEL+LPTVF  ++YWM G
Sbjct  456   VMPSFNAVFTFPQERAVFIKERASGMYTLSSYFMARIVGDLPMELILPTVFSTVAYWMTG  515

Query  586   LKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRH  407
             L+P  G F   +  +L  VLV QGLGLA+GA IMD K A+T+ ++ MLAF+L GGFYV  
Sbjct  516   LRPDPGAFLLTILVLLGYVLVAQGLGLALGAIIMDAKQASTVVTITMLAFVLTGGFYVHK  575

Query  406   VPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVE--DHPAIKKIGLGQ-H  236
             +P  ++WIKY+S   Y Y+LL+  QY  G+      G      +  D   ++    GQ  
Sbjct  576   IPHCLAWIKYLSFTFYCYRLLIGIQYGDGKLISSLLGCSRIGSDRTDCGFVEGDVEGQIR  635

Query  235   VIFSVVALLLMLIGYRLLAYVALMRV  158
              + S+  + LM +GYRL+AY AL R+
Sbjct  636   PVVSIGIMFLMFVGYRLIAYAALRRI  661



>ref|XP_003555426.1| PREDICTED: ABC transporter G family member 25-like [Glycine max]
Length=670

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/673 (50%), Positives = 439/673 (65%), Gaps = 39/673 (6%)
 Frame = -3

Query  2077  SSDQQEATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVK  1898
             S+    A      T  GD        +  PQ   D S   F   + P+TLKF +V Y++K
Sbjct  2     STPTSTAAFAGVETPNGDSSNTNPHPKHTPQESRDLSP--FLSCSYPITLKFMDVAYRLK  59

Query  1897  PDQKQ--GLSFLK--------TKKQKSEA----EKIILKGVTGIVFPGEVLAMLGPSgsg  1760
              + KQ  G S  +           Q S A    E+ ILKGVTGI  PGE+LA+LGPSGSG
Sbjct  60    IEDKQKSGGSIKRFFTPHESSPSDQGSRAGAPKERTILKGVTGIAQPGEILAVLGPSGSG  119

Query  1759  kttlltalggrlgg-hlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             K+TLL AL GRL G  L GTI  N    +  + R TGFVTQDDILYPHLTV ETLVF A+
Sbjct  120   KSTLLHALAGRLHGPGLTGTILANSSKLTKPVLRRTGFVTQDDILYPHLTVRETLVFCAM  179

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLPR L + EK+  A+A I +LGL KC+N+IIG  F+RG+SGGERKRVSI  EML+NPS
Sbjct  180   LRLPRALLRSEKVAAAEAAIAELGLGKCENTIIGNSFIRGVSGGERKRVSIAHEMLVNPS  239

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LL LDEPTSGLDST A R+V TL  L+K G+T++ ++HQPSSR++ +F KV++L EG  L
Sbjct  240   LLILDEPTSGLDSTAAHRLVLTLGSLAKKGKTVITSVHQPSSRVYQMFDKVVVLTEGQCL  299

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDDSQA--DQATVKETLVSAFKT  1049
             YFGKGSD M YF +VGF+PS  MNP+DFLLDLANG+   D Q+  D+  +K++L+ ++ T
Sbjct  300   YFGKGSDAMRYFQSVGFAPSFPMNPADFLLDLANGVCHVDGQSEKDKPNIKQSLIHSYNT  359

Query  1048  NLLENLKMELHELNDEDVSS-----AGDQKQFKRWA----IPWWEQFSVLLKRGLKQRKY  896
              L   +K    +  +    +     +   K+F+R      + W+ QFS+LL+R LK+RK+
Sbjct  360   VLGPKVKAACMDTANVPTKNTHPWRSNSSKEFRRSNRVGFLDWFYQFSILLQRSLKERKH  419

Query  895   ESFSGLKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDK  722
             ESF+ L+V QV+  A L G +WW S   ++QD++GLLFFIS FWG FP F ++F FP+++
Sbjct  420   ESFNTLRVCQVIAAALLAGLMWWHSDYRNIQDRLGLLFFISIFWGVFPSFNSVFAFPQER  479

Query  721   MMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAI  542
              +  KER+SGMY LSS+F+AR VGDLPMEL+LPT+F+I++YWM GLKP    F   L  +
Sbjct  480   TIFMKERASGMYTLSSYFMARIVGDLPMELILPTIFLIVTYWMGGLKPDLWAFLLTLLVV  539

Query  541   llcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQ  362
             L  V+V QGLGLA+GA IMD K A+T+ +V MLAF+L GG+YV  VPS ++WIKYIS   
Sbjct  540   LGYVMVSQGLGLALGAAIMDAKQASTVAAVTMLAFVLTGGYYVHKVPSCMAWIKYISTTF  599

Query  361   YTYKLLLESQYKPGETYP----CTSGS-GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLI  197
             Y Y+LL   QY+ G+       C  G  G C   +   + +IG     +  +  LL M +
Sbjct  600   YCYRLLTRIQYEDGKKISYLLGCYHGDKGGCRFVEEDVVGQIG----TLGCIGVLLFMFV  655

Query  196   GYRLLAYVALMRV  158
              YRLLAY+AL R+
Sbjct  656   FYRLLAYLALRRI  668



>ref|XP_007019995.1| ATP-binding casette family G25 [Theobroma cacao]
 gb|EOY17220.1| ATP-binding casette family G25 [Theobroma cacao]
Length=671

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/671 (50%), Positives = 438/671 (65%), Gaps = 53/671 (8%)
 Frame = -3

Query  2029  GDIEAPTTQLQANPQLESDTSAAI-----FKKANRPVTLKFENVVYKVKPDQKQ------  1883
             G +EAPT      P    D S  +        +  P+TLKF +V YKVK  Q+       
Sbjct  5     GGVEAPTGDSLEGPDHSKDISRDLRDFPSLMSSCYPITLKFIDVCYKVKIQQQTNSSRGR  64

Query  1882  ---------GLSFLKTKKQKSEA---EKIILKGVTGIVFPGEVLAMLGPSgsgkttllta  1739
                      GLS   T  Q+S     E  IL  +TG+  PGE+LA+LGPSGSGK+TLL A
Sbjct  65    CIKRMFSHGGLS-AATSDQRSTGQVQETTILNNITGVASPGEILAILGPSGSGKSTLLNA  123

Query  1738  lggrlgghl--agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRT  1565
             L GRL      +GTI  N K  +  + + TGFVTQDD+LYPHLTV ETLVF +LLRLP+T
Sbjct  124   LAGRLQQGHGFSGTILANNKKPTKQIAKRTGFVTQDDVLYPHLTVRETLVFCSLLRLPKT  183

Query  1564  LTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDE  1385
             LT +EK   A+ V+++LGL+KC+N+IIG  F+RGISGGERKRVSI  EMLINPSLL LDE
Sbjct  184   LTTKEKTSIAEMVLSELGLSKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDE  243

Query  1384  PTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGS  1205
             PTSGLDST A R+VSTL  L++ G+TIV ++HQPSSR++ +F  VL+L EG  LYFGKGS
Sbjct  244   PTSGLDSTAAHRLVSTLGSLAQKGKTIVTSMHQPSSRVYQMFDSVLVLSEGKSLYFGKGS  303

Query  1204  DVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSAFKTNLLENL  1031
             + M+YF +VGFSPS  MNP+DFLLDLAN +   D  S+ ++  VK+TL++++   L   +
Sbjct  304   EAMAYFESVGFSPSFPMNPADFLLDLANDVCKLDGVSERERPNVKQTLIASYNALLAPKV  363

Query  1030  K---MELHELNDEDVSSAGDQKQFKRWA-------IPWWEQFSVLLKRGLKQRKYESFSG  881
             K   ME+  ++ ++    G    FK            W+ QFS+LL+R LK+RK+ESF+ 
Sbjct  364   KAACMEITIVSAKETRLIGSH-SFKEHRDSNTIDLCTWFHQFSILLQRSLKERKHESFNI  422

Query  880   LKVGQVLVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGK  707
             L+V QV+  A L G +WW S  +D+QD++GLLFFIS FWG  P F A+F FP+++ +  K
Sbjct  423   LRVFQVITAAILAGLMWWHSDYSDIQDRLGLLFFISIFWGVLPSFNAVFAFPQERAIFMK  482

Query  706   ERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvl  527
             ER+SGMY LSS+F+AR +GDLPMEL+LP VF+I++YWMAGLKP    F   L  +L  VL
Sbjct  483   ERASGMYTLSSYFMARIIGDLPMELILPVVFLIVTYWMAGLKPDLVAFLLTLLVLLGYVL  542

Query  526   vcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKL  347
             V QGLGLA+GA IMD K A+T+ +V MLAF+L GG+YV  VPS ++WIKYIS   Y+YKL
Sbjct  543   VSQGLGLALGAAIMDAKQASTIVTVTMLAFVLTGGYYVHKVPSCMAWIKYISTTYYSYKL  602

Query  346   LLESQYKPGE--------TYPCTSGSGVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGY  191
              +  QY  G+        ++   S +  C   D     +I        SV  LLLM +GY
Sbjct  603   FINVQYGEGKKISSMLGCSHHGRSNTVSCKFIDQDIAGQISPE----LSVAILLLMFVGY  658

Query  190   RLLAYVALMRV  158
             RLLAY+AL R+
Sbjct  659   RLLAYLALRRI  669



>ref|XP_010244001.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nelumbo nucifera]
Length=801

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/625 (51%), Positives = 413/625 (66%), Gaps = 57/625 (9%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+ LKF++V YKV  +           ++ S+AEK IL GVTG V PGEVLA++GPSG G
Sbjct  191   PICLKFQDVRYKVALN----------GRRSSDAEKYILHGVTGSVHPGEVLALMGPSGGG  240

Query  1759  kttlltalg-grlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLL  L        ++ +ITYN +P+S ++KR  GFV QDD+ +PHLTV ETL + AL
Sbjct  241   KTTLLNLLSGRVKTDDVSCSITYNDQPYSKSLKRRIGFVMQDDVAFPHLTVKETLTYAAL  300

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP TLTKQ+K E+A  VI++L L +C+N+IIGG F+RGISGGERKRV IG E+L+NPS
Sbjct  301   LRLPNTLTKQQKEERAMNVISELDLERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPS  360

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LLFLDEPTSGLDSTTA RIV  L  ++K G+T+V TIHQPSSRLF  F K++LL  GN L
Sbjct  361   LLFLDEPTSGLDSTTALRIVQMLHNIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSL  420

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD---------------------  1106
             YFGK S+ M YFS++G SP + MNP++FL+DLANG   D                     
Sbjct  421   YFGKASEAMLYFSSIGCSPLIVMNPAEFLIDLANGNINDKSIPSVLEDKILLGSQFPEKQ  480

Query  1105  DSQADQATVKETLVSAFKTNL--LENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFS  932
             D +     V E LV A++T +  +E  K+    + D +    G       W   WWEQ+S
Sbjct  481   DGRPSPVDVHEYLVGAYETRVANIEKQKLLKPVMVDSESEIQGMSHSID-WGASWWEQYS  539

Query  931   VLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-----TDLQDQVGLLFFISSFWG  767
             +L +RGLK+R++E  S L+V QV+  A + G LWW S       LQDQ GLLFFIS FWG
Sbjct  540   ILFRRGLKERRHEYLSCLRVTQVVSTAIIIGLLWWHSDASSPKRLQDQAGLLFFISVFWG  599

Query  766   FFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAG  587
             FFP+F AIFTFP+++ ML KER+ GMYKLS++F+AR   DLP++L+LP VF++I Y+M G
Sbjct  600   FFPVFTAIFTFPQERAMLAKERAVGMYKLSAYFIARNASDLPLDLILPIVFLVIVYFMVG  659

Query  586   LKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRH  407
             LK T   F  ++  + L ++  QGLGLAIGA  MD K ATTL SV+++ F+LAGGF+V+ 
Sbjct  660   LKQTFSAFSLSMLTLFLTIVSAQGLGLAIGAAFMDVKKATTLASVLVMTFMLAGGFFVQK  719

Query  406   VPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT---SGSGVCLVEDHPAIK--KIGLG  242
             VPSF+SWI+YISI  +TY+LLL+ QY       C+    GS  C   D P IK  KI  G
Sbjct  720   VPSFMSWIRYISINYHTYRLLLKIQYS------CSGSGHGSAAC---DSPFIKGLKIDDG  770

Query  241   QHVIFSVVALLLMLIGYRLLAYVAL  167
                     A++ M+ GYRLLAY+ L
Sbjct  771   GK---EAGAMITMIFGYRLLAYLFL  792



>ref|XP_010244004.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Nelumbo nucifera]
Length=797

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/625 (51%), Positives = 413/625 (66%), Gaps = 57/625 (9%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQKQGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsg  1760
             P+ LKF++V YKV  +           ++ S+AEK IL GVTG V PGEVLA++GPSG G
Sbjct  187   PICLKFQDVRYKVALN----------GRRSSDAEKYILHGVTGSVHPGEVLALMGPSGGG  236

Query  1759  kttlltalg-grlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTAL  1583
             KTTLL  L        ++ +ITYN +P+S ++KR  GFV QDD+ +PHLTV ETL + AL
Sbjct  237   KTTLLNLLSGRVKTDDVSCSITYNDQPYSKSLKRRIGFVMQDDVAFPHLTVKETLTYAAL  296

Query  1582  LRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPS  1403
             LRLP TLTKQ+K E+A  VI++L L +C+N+IIGG F+RGISGGERKRV IG E+L+NPS
Sbjct  297   LRLPNTLTKQQKEERAMNVISELDLERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPS  356

Query  1402  LLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPL  1223
             LLFLDEPTSGLDSTTA RIV  L  ++K G+T+V TIHQPSSRLF  F K++LL  GN L
Sbjct  357   LLFLDEPTSGLDSTTALRIVQMLHNIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSL  416

Query  1222  YFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGD---------------------  1106
             YFGK S+ M YFS++G SP + MNP++FL+DLANG   D                     
Sbjct  417   YFGKASEAMLYFSSIGCSPLIVMNPAEFLIDLANGNINDKSIPSVLEDKILLGSQFPEKQ  476

Query  1105  DSQADQATVKETLVSAFKTNL--LENLKMELHELNDEDVSSAGDQKQFKRWAIPWWEQFS  932
             D +     V E LV A++T +  +E  K+    + D +    G       W   WWEQ+S
Sbjct  477   DGRPSPVDVHEYLVGAYETRVANIEKQKLLKPVMVDSESEIQGMSHSID-WGASWWEQYS  535

Query  931   VLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKS-----TDLQDQVGLLFFISSFWG  767
             +L +RGLK+R++E  S L+V QV+  A + G LWW S       LQDQ GLLFFIS FWG
Sbjct  536   ILFRRGLKERRHEYLSCLRVTQVVSTAIIIGLLWWHSDASSPKRLQDQAGLLFFISVFWG  595

Query  766   FFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAG  587
             FFP+F AIFTFP+++ ML KER+ GMYKLS++F+AR   DLP++L+LP VF++I Y+M G
Sbjct  596   FFPVFTAIFTFPQERAMLAKERAVGMYKLSAYFIARNASDLPLDLILPIVFLVIVYFMVG  655

Query  586   LKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRH  407
             LK T   F  ++  + L ++  QGLGLAIGA  MD K ATTL SV+++ F+LAGGF+V+ 
Sbjct  656   LKQTFSAFSLSMLTLFLTIVSAQGLGLAIGAAFMDVKKATTLASVLVMTFMLAGGFFVQK  715

Query  406   VPSFISWIKYISIGQYTYKLLLESQYKPGETYPCT---SGSGVCLVEDHPAIK--KIGLG  242
             VPSF+SWI+YISI  +TY+LLL+ QY       C+    GS  C   D P IK  KI  G
Sbjct  716   VPSFMSWIRYISINYHTYRLLLKIQYS------CSGSGHGSAAC---DSPFIKGLKIDDG  766

Query  241   QHVIFSVVALLLMLIGYRLLAYVAL  167
                     A++ M+ GYRLLAY+ L
Sbjct  767   GK---EAGAMITMIFGYRLLAYLFL  788



>gb|KDP43365.1| hypothetical protein JCGZ_25470 [Jatropha curcas]
Length=668

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/654 (49%), Positives = 438/654 (67%), Gaps = 30/654 (5%)
 Frame = -3

Query  2029  GDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLSFLK-----  1865
             GD      Q +  P+   D  + +      P+TL+F +V Y++K +++   S ++     
Sbjct  13    GDSMDGPDQSKDCPRDSRDLPSLMLSSCYYPITLRFIDVCYRLKIEKRAKSSNIRRMMGH  72

Query  1864  --TKKQKSE----AEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlg--ghla  1709
               TK  ++      E+ IL G+TG+V PGE+LA+LGPSGSGK+TLL AL GRL       
Sbjct  73    GSTKSNQTSRGMIEERTILNGITGMVSPGEILAILGPSGSGKSTLLNALAGRLLPGHGFT  132

Query  1708  gTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADA  1529
             GTI  N K FS    + TGFVTQDDILYPHLTV ETL+F +LLRLP++L+++EK   A++
Sbjct  133   GTILANDKKFSKQTLKRTGFVTQDDILYPHLTVRETLIFCSLLRLPKSLSQKEKTSVAES  192

Query  1528  VITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQR  1349
             VI++LGLTKC+N+IIG  F+RG+SGGERKRVSI  EMLINPSLL LDEPTSGLDST A R
Sbjct  193   VISELGLTKCENTIIGNSFIRGVSGGERKRVSIAHEMLINPSLLILDEPTSGLDSTAAHR  252

Query  1348  IVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFS  1169
             +V TL  L++ G+TIV ++HQPSSR++ +F+ VL+L EG  +YFG+GS+ M+YF +VGFS
Sbjct  253   LVLTLSSLAQKGKTIVTSMHQPSSRVYQMFNSVLVLSEGRCVYFGQGSEAMAYFESVGFS  312

Query  1168  PSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSAFKTNLLENLKMELHELNDEDV  995
             PS  MNP+DFLLDLANG+   D  S+ ++  +K++L+S++ + L   +K    E      
Sbjct  313   PSFPMNPADFLLDLANGVCQMDGMSEREKPNIKQSLISSYNSMLAPKVKAACMEATIPPT  372

Query  994   SSAG--------DQKQFKRWAIP-WWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLT  842
                G        + + + +     W+ QF++LL+R LK+RKYESF+ L+V QVL  A L 
Sbjct  373   KETGLIGSHSSKENRCYNKIGFSNWFNQFTILLQRSLKERKYESFNMLRVFQVLTAALLA  432

Query  841   GALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFF  668
             G +WW S   D+QD++GLLFFIS FWG FP F ++F FP+++ +  KER+SGMY LSS+F
Sbjct  433   GLMWWHSDFRDIQDRLGLLFFISIFWGVFPSFNSVFAFPQERAIFMKERASGMYTLSSYF  492

Query  667   LARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFI  488
             ++R  GDLPMEL+LPT+F+ ++YWMAGLKP    F   L  +L  VLV QGLGLA+GA I
Sbjct  493   MSRITGDLPMELILPTIFLTVAYWMAGLKPDLVAFLLTLLVLLGYVLVSQGLGLALGAAI  552

Query  487   MDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYP  308
             MD K A+T+ +V MLAF+L GG+YV  VPS ++WIKYIS   Y+Y+LL+  QY  G+   
Sbjct  553   MDAKQASTIVTVTMLAFVLTGGYYVHKVPSCMAWIKYISTTFYSYRLLIRVQYGEGKQLS  612

Query  307   CTSGSGVCLVEDHPAIKKIG---LGQ-HVIFSVVALLLMLIGYRLLAYVALMRV  158
                G     + +  + K +    +GQ      V  L+ M +GYRLLAY+AL R+
Sbjct  613   QLLGCSHHGISEKASCKFLEDDIVGQISPTACVCVLIFMFVGYRLLAYLALRRI  666



>ref|XP_008380991.1| PREDICTED: ABC transporter G family member 25 [Malus domestica]
Length=651

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/627 (51%), Positives = 424/627 (68%), Gaps = 43/627 (7%)
 Frame = -3

Query  1939  PVTLKFENVVYKVKPDQK----QGLSFLKTKKQKSEAEKIILKGVTGIVFPGEVLAMLGP  1772
             P+TLKF +V YKVK D K      L   K K  + E E+ IL G+TG+   GE+LA+LGP
Sbjct  31    PITLKFVDVCYKVKIDNKSQYRDCLFGHKDKPGQEEQERTILHGITGMASSGEILAILGP  90

Query  1771  SgsgkttlltalggrlgghlagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVF  1592
             SGSGK+TLL AL GRL     GT+  NG+  +  + R TGFV QDDILYPHLTV ETLVF
Sbjct  91    SGSGKSTLLNALAGRLNRKHQGTVLANGRALTKTVLRRTGFVPQDDILYPHLTVRETLVF  150

Query  1591  TALLRLPRTLTKQEKIEQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLI  1412
              ALLRLPRTL+K+EK+  A++VI++LGL KCKN+IIG  F+RG+SGGERKRVSI  E+L+
Sbjct  151   CALLRLPRTLSKKEKVSAAESVISELGLHKCKNTIIGNTFVRGVSGGERKRVSIAHEVLM  210

Query  1411  NPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEG  1232
             NPSLL LDEPTSGLDST A R++STL  L+  G+TIV +IHQPSS+++ +   VL+LC+G
Sbjct  211   NPSLLILDEPTSGLDSTAAHRLLSTLGSLALKGKTIVTSIHQPSSQVYQMLDSVLVLCDG  270

Query  1231  NPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLDLANGITGDD--SQADQATVKETLVSA  1058
               LYFGKGS+ ++YF ++GF+P+  MNP+DFLLDLANG+   +   + D+  +KE LV +
Sbjct  271   RCLYFGKGSEAINYFGSIGFAPAFPMNPADFLLDLANGVCQLNGLGERDKPNMKEILVYS  330

Query  1057  FKTNLLENLKMELHELNDEDVSSAGDQKQF--------KRWAI-----PWWEQFSVLLKR  917
             + T L   +K E      ++ S+A  +  +        +R +I      W+ QF +LL+R
Sbjct  331   YNTLLAPKVKAECL----DNTSAATKETTYVQSHCSKERRTSIGDIVSTWFNQFHILLQR  386

Query  916   GLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVGLLFFISSFWGFFPLFQAI  743
              LK+RK+ESF+ L+V QV+  A L G +WW+S   D+QD++GLLFFIS FWG  P F ++
Sbjct  387   SLKERKHESFNSLRVLQVVAGALLAGLMWWQSDYLDIQDRLGLLFFISIFWGVLPSFNSV  446

Query  742   FTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNF  563
             F FP+++ +  KE++SGMY LSS+F+AR VGDLPMEL+LPT+F++++YWMAGLK   G F
Sbjct  447   FAFPQERAIFIKEQASGMYTLSSYFMARMVGDLPMELILPTIFLVMAYWMAGLKADMGAF  506

Query  562   FSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWI  383
                L  +L  VLV QGLGLA+GA IMD K A+T+ +V MLAF+L GG+YV  VPS  +W+
Sbjct  507   LLTLLVLLGYVLVSQGLGLALGAAIMDAKQASTIATVTMLAFVLTGGYYVHKVPSCFAWL  566

Query  382   KYISIGQYTYKLLLESQYKPGET----YPCTSGSGVCLVEDHPAIKKIG---LGQHVI--  230
             KYIS   Y+Y+LL+  QY  G        C+S        DH    K     + Q V+  
Sbjct  567   KYISTTFYSYRLLINIQYGEGSKLSSLLACSSHH-----HDHAGDHKASCKFVEQDVVGQ  621

Query  229   ----FSVVALLLMLIGYRLLAYVALMR  161
                  S+  +L M   YRL+AY+AL R
Sbjct  622   ISPATSICVMLFMFFAYRLVAYLALKR  648



>ref|XP_008791161.1| PREDICTED: ABC transporter G family member 25-like [Phoenix dactylifera]
Length=631

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/633 (49%), Positives = 430/633 (68%), Gaps = 37/633 (6%)
 Frame = -3

Query  1996  ANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQGLS-------FLKTKKQKSEA-  1841
             AN  ++S  S + +     P+TL+F ++ Y++K D K   +       F       S A 
Sbjct  14    ANRCMDSFISTSCY-----PLTLQFMDITYRIKLDPKVAATGSGIKRIFHAGGAANSPAA  68

Query  1840  ---EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghlagTITYNGKPFSNA  1670
                E+ IL GV+GIV PGE LA+LGPSGSGK+TLL+ + GRL G  +G +  NG+  +  
Sbjct  69    VPEERTILNGVSGIVSPGEFLAVLGPSGSGKSTLLSVIAGRLQGEHSGAVLANGRRLTKP  128

Query  1669  MKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQADAVITQLGLTKCKNS  1490
             + R TG+V QDD+LYPHLTV ETLVF+A+LRLPRT+   EK+  AD V+ +LGL KC ++
Sbjct  129   VLRRTGYVAQDDVLYPHLTVRETLVFSAMLRLPRTVAAAEKVAAADEVVAELGLEKCADT  188

Query  1489  IIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELSKGGR  1310
              +G  F+RGISGGERKRVSIG EML+NPSLL LDEPTSGLDST A R+V+TL  +++ GR
Sbjct  189   AVGNAFVRGISGGERKRVSIGHEMLVNPSLLVLDEPTSGLDSTAAYRLVATLTGIARKGR  248

Query  1309  TIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTVGFSPSVAMNPSDFLLD  1130
             +IV +IHQPSSR++ +F  VLLL EGN LYFG+G + M YF +VGF+P   MNP+DF+LD
Sbjct  249   SIVTSIHQPSSRVYQMFDSVLLLSEGNCLYFGRGREAMDYFGSVGFAPRFHMNPADFMLD  308

Query  1129  LANGITGDDSQAD--QATVKETLVSAFKTNLLENLKMELHELNDEDVSSAGDQKQFKR--  962
             LANG+   D QAD  ++ VK++L++++   L   +K  +      DV+  G ++   R  
Sbjct  309   LANGVAQIDYQADAEKSNVKQSLITSYNRVLAPKVKACISAAEAGDVAETGSERSTMREQ  368

Query  961   ---WAIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVLVVAFLTGALWWKST--DLQDQVG  797
                 +I W+ QF +LL+R LK+R++E+F+ L+V QV+  A L G++WW S   D++D++G
Sbjct  369   RNCRSISWFSQFGILLRRSLKERRHETFNSLRVFQVMAAAVLAGSMWWHSNIHDVRDRLG  428

Query  796   LLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMYKLSSFFLARTVGDLPMELVLPTV  617
             LLFFIS FWG F  F A+FTFP+++ +  KERS+GMY +SS+F+AR  GDLPMEL+LPTV
Sbjct  429   LLFFISIFWGVFASFNAVFTFPQERAIFIKERSAGMYAVSSYFMARMAGDLPMELILPTV  488

Query  616   FVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgLAIGAFIMDQKSATTLGSVIMLAF  437
             F +I YWMAGL+     F   L+ +L  VLV QGLGLA+GA I+D K A+T  +V+ML+F
Sbjct  489   FALIFYWMAGLREEPEAFMMTLAVLLGYVLVAQGLGLALGAAIVDAKKASTAVTVVMLSF  548

Query  436   LLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYKPGETYPCTSGSGVCLVEDHPAIK  257
             LL GGFYV++VPS I+W+KY S   Y Y+LL++ QY+  E           L+E++    
Sbjct  549   LLTGGFYVQNVPSCIAWMKYTSFTFYCYRLLIDVQYRGSEL-------ATILMEEN----  597

Query  256   KIGLGQHVIFSVVALLLMLIGYRLLAYVALMRV  158
              +G        +VAL+ M +GYRLLAY+AL R+
Sbjct  598   -LGGKAGSAACIVALVAMFVGYRLLAYLALRRI  629



>ref|XP_002325552.2| ABC transporter family protein [Populus trichocarpa]
 gb|EEE99933.2| ABC transporter family protein [Populus trichocarpa]
Length=665

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/660 (49%), Positives = 435/660 (66%), Gaps = 27/660 (4%)
 Frame = -3

Query  2059  ATLMETATEMGDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQG  1880
             +T +ET +         +++   P  +S    ++   +  P+TLKF +V Y+VK + K  
Sbjct  5     STGVETPSRHSPDGPDQSKVCPPPPRDSCDIPSLLLSSCYPITLKFMDVGYRVKFENKNK  64

Query  1879  LSFLKT------KKQKSEAEKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgg  1718
              S +K              E+ IL G+TG+  PGE+LA+LGPSGSGK+TLL A+ GR+  
Sbjct  65    GSNIKRIFGHGPTISDQFQERTILNGITGMASPGEILAILGPSGSGKSTLLNAIAGRIQA  124

Query  1717  h--lagTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKI  1544
             +      +T N KP    MKR  GFVTQDDILYPHLTV ETLVF +LLRLP++L+KQ+K 
Sbjct  125   NGFTGTVLTNNRKPAKQIMKR-IGFVTQDDILYPHLTVRETLVFCSLLRLPKSLSKQDKT  183

Query  1543  EQADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDS  1364
               A++VI++LGLTKC N+IIG  F+RGISGGERKRVSI  EMLINPSLL LDEPTSGLD+
Sbjct  184   LVAESVISELGLTKCGNTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDA  243

Query  1363  TTAQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFS  1184
             T A R++ TL  L++ G+TIV ++HQPSSR++ +F  VL+L EG  LYFGKGS+ M+YF 
Sbjct  244   TAAYRLLLTLGTLAQKGKTIVTSMHQPSSRVYQMFDSVLVLSEGRCLYFGKGSEAMAYFE  303

Query  1183  TVGFSPSVAMNPSDFLLDLANGITGDDSQA---DQATVKETLVSAFKTNLLENLKMELHE  1013
             +VG+SPS  MNP+DFLLDLANG+   D  +   DQ  VK++L++++ T L   +K    E
Sbjct  304   SVGYSPSFPMNPADFLLDLANGVCQLDGVSELRDQPNVKQSLIASYNTLLAPKVKAACME  363

Query  1012  LNDEDVSSAG--DQKQFKRW-------AIPWWEQFSVLLKRGLKQRKYESFSGLKVGQVL  860
                      G      FK            W+ QFS+LL+R LK+RK+ESF+ L++ QV+
Sbjct  364   TGSISAKENGFIGSHSFKEHRSSDRISISSWFNQFSILLQRSLKERKHESFNTLRISQVI  423

Query  859   VVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGMY  686
             + A L G +WW S   D+QD++GLLFF+S FWG FP   ++F FP+++ +  KER+SGMY
Sbjct  424   MAAVLAGLMWWHSDFRDIQDRLGLLFFMSIFWGVFPSSNSVFVFPQERAIFVKERASGMY  483

Query  685   KLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglgL  506
              LSS+F++R VGDLPMEL+LPT+F+ ++YWMAGLKP  G F   L  +L  VLV QGLGL
Sbjct  484   TLSSYFMSRIVGDLPMELILPTIFLSVTYWMAGLKPELGAFLLTLLVLLGYVLVSQGLGL  543

Query  505   AIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQYK  326
             A+GA IMD K A+T+ ++ MLAF+L GGFYV  +P  ++WIKYIS   Y YKLL+ +QY 
Sbjct  544   ALGAAIMDAKQASTIVTITMLAFVLTGGFYVHKLPPCMAWIKYISTTFYVYKLLINAQYG  603

Query  325   PGETYPCTSGSGVCLVEDHPAIKKIG---LGQ-HVIFSVVALLLMLIGYRLLAYVALMRV  158
              G+      G  +    D  + K +     GQ     SV AL+ M +GYRLLAY+AL R+
Sbjct  604   GGKNLSSLLGCSLPHGSDRASCKFVEQDVAGQISPAISVCALIFMFVGYRLLAYLALRRI  663



>emb|CDP16843.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/661 (49%), Positives = 427/661 (65%), Gaps = 51/661 (8%)
 Frame = -3

Query  2029  GDIEAPTTQLQANPQLESDTSAAIFKKANRPVTLKFENVVYKVKPDQKQ--GLSFLKTKK  1856
             G  E   T+    P + S         ++ P+TLKF  V Y+VK   K   G S  K   
Sbjct  5     GQAENSNTE---EPSINSPHHLPPIMSSSFPITLKFMEVCYRVKLKGKNSGGGSLRKMLT  61

Query  1855  QKSEA------------EKIILKGVTGIVFPGEVLAMLGPSgsgkttlltalggrlgghl  1712
                              E+ IL G+TG+V PGE+LA+LGPSGSGK+TLL AL GRL    
Sbjct  62    SNGPTSSDVENPTAVIQERTILSGITGMVSPGEILAILGPSGSGKSTLLNALAGRLQHSH  121

Query  1711  --agTITYNGKPFSNAMKRNTGFVTQDDILYPHLTVTETLVFTALLRLPRTLTKQEKIEQ  1538
                GT+  N +  S  + R TGFV QDD+LYPHLTV ETLVF +LLRLP +LTK+EKI  
Sbjct  122   GLTGTVLANNRKLSKPVLRRTGFVAQDDVLYPHLTVRETLVFCSLLRLPNSLTKKEKISI  181

Query  1537  ADAVITQLGLTKCKNSIIGGVFLRGISGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTT  1358
             AD+V+++LGL KC+N+IIG  F+RGISGGERKRVSI  EMLINPSLL LDEPTSGLDST 
Sbjct  182   ADSVMSELGLVKCENTIIGNSFIRGISGGERKRVSIAHEMLINPSLLILDEPTSGLDSTA  241

Query  1357  AQRIVSTLWELSKGGRTIVMTIHQPSSRLFYLFHKVLLLCEGNPLYFGKGSDVMSYFSTV  1178
             A R+VSTL  L++ G+TIV ++HQPSSR++ +F  VL+L EG  +YFGKG+D M+YF +V
Sbjct  242   AFRLVSTLGSLARKGKTIVTSVHQPSSRVYQMFDSVLVLSEGRSVYFGKGNDAMNYFESV  301

Query  1177  GFSPSVAMNPSDFLLDLANGITG-DDSQADQATVKETLVSAFKTNLLENLKMELHELNDE  1001
             GF+PS  MNP+DFLLDLANG+    ++  ++ +VK+TLVS++   L  N+K    E +  
Sbjct  302   GFAPSFPMNPADFLLDLANGVCHLGNNDKERPSVKQTLVSSYNRLLAPNVKAACLETS--  359

Query  1000  DVSSAGDQKQFKRWAIP--------------WWEQFSVLLKRGLKQRKYESFSGLKVGQV  863
               +S G ++   R   P              W+ QFS+LL+R LK+R++E+F+ L+V QV
Sbjct  360   --TSTGPREMMVRICSPKDQFRSSWTSNVSTWFNQFSILLERSLKERRHETFNSLRVFQV  417

Query  862   LVVAFLTGALWWKS--TDLQDQVGLLFFISSFWGFFPLFQAIFTFPEDKMMLGKERSSGM  689
             +  + L G +WW S   ++QD++GLLFFI+ FWG  P F A F FP+++ +  KER+SGM
Sbjct  418   IAASLLAGFMWWHSDFRNIQDRLGLLFFIAIFWGVLPSFNATFVFPQERAIFMKERASGM  477

Query  688   YKLSSFFLARTVGDLPMELVLPTVFVIISYWMAGLKPTAGNFFSALSAIllcvlvcqglg  509
             Y LSS+F++R VGD+PMEL+LP +FV I+YWMAGLKP    F   L   L  VLV QGLG
Sbjct  478   YTLSSYFMSRIVGDMPMELILPAIFVTITYWMAGLKPELAAFILTLMVALGYVLVSQGLG  537

Query  508   LAIGAFIMDQKSATTLGSVIMLAFLLAGGFYVRHVPSFISWIKYISIGQYTYKLLLESQY  329
             LA+GA IMD K A+T+ +V MLAF+L GGFYV  VPS ++WIKYIS   Y Y+LL+  QY
Sbjct  538   LALGALIMDAKQASTVVTVTMLAFVLTGGFYVHKVPSCMAWIKYISSTFYAYRLLINIQY  597

Query  328   KPGETYPCTSGS-------GVCLVEDHPAIKKIGLGQHVIFSVVALLLMLIGYRLLAYVA  170
               G+      G         +C   D    + IG   H + S   LLLM +GYRL+AY+A
Sbjct  598   GEGKEISSLMGCLQHGSDRAICNFID----EDIGGQIHPLTSSAILLLMFLGYRLVAYLA  653

Query  169   L  167
             L
Sbjct  654   L  654



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6551454660308