BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81202_g1_i1 len=971 path=[949:0-970]

Length=971
                                                                      Score     E

ref|XP_010673726.1|  PREDICTED: F-box protein At1g30200-like          96.3    3e-19   
ref|XP_006352970.1|  PREDICTED: F-box protein At5g46170-like          95.1    6e-19   
ref|XP_009115183.1|  PREDICTED: F-box protein At1g30200               94.4    2e-18   
emb|CDX99890.1|  BnaC05g23120D                                        94.0    2e-18   
ref|XP_002279458.1|  PREDICTED: F-box protein At5g46170-like          93.2    2e-18   Vitis vinifera
ref|XP_006836365.1|  hypothetical protein AMTR_s00092p00114580        93.2    4e-18   
ref|XP_010247412.1|  PREDICTED: F-box protein At5g46170               92.8    6e-18   
ref|XP_004233124.1|  PREDICTED: F-box protein At5g46170-like          92.0    8e-18   
ref|XP_009131656.1|  PREDICTED: F-box protein At4g18380               91.3    2e-17   
ref|XP_010651665.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  92.4    2e-17   
ref|XP_006836201.1|  hypothetical protein AMTR_s00101p00078790        89.7    4e-17   
emb|CBI30928.3|  unnamed protein product                              90.1    6e-17   
emb|CDY33458.1|  BnaA06g36150D                                        88.6    1e-16   
ref|XP_010270680.1|  PREDICTED: F-box protein At4g18380-like          88.2    2e-16   
ref|XP_002456519.1|  hypothetical protein SORBIDRAFT_03g037710        88.2    2e-16   Sorghum bicolor [broomcorn]
ref|XP_011080388.1|  PREDICTED: F-box protein At4g18380-like          87.8    3e-16   
ref|XP_007147928.1|  hypothetical protein PHAVU_006G166500g           87.8    3e-16   
emb|CAN73778.1|  hypothetical protein VITISV_042179                   87.8    3e-16   Vitis vinifera
ref|XP_003546077.1|  PREDICTED: F-box protein At5g46170-like          87.8    3e-16   
ref|XP_002278480.1|  PREDICTED: F-box protein At5g46170               87.8    4e-16   Vitis vinifera
ref|XP_011085237.1|  PREDICTED: F-box protein At4g18380-like          87.4    4e-16   
ref|XP_003542943.1|  PREDICTED: F-box protein At5g46170-like isof...  87.4    5e-16   
gb|EYU33385.1|  hypothetical protein MIMGU_mgv1a008110mg              87.0    6e-16   
ref|XP_003564454.1|  PREDICTED: F-box protein At5g46170-like          86.7    6e-16   
ref|XP_011096601.1|  PREDICTED: F-box protein At4g18380-like          87.0    6e-16   
ref|XP_008792446.1|  PREDICTED: F-box protein At4g18380-like          85.5    1e-15   
ref|NP_001044594.1|  Os01g0812200                                     85.5    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EYU43254.1|  hypothetical protein MIMGU_mgv1a008300mg              85.9    2e-15   
ref|XP_004137366.1|  PREDICTED: F-box protein At5g46170-like          85.9    2e-15   
ref|XP_004244968.1|  PREDICTED: F-box protein At5g46170-like          85.5    2e-15   
ref|XP_008444512.1|  PREDICTED: F-box protein At5g46170-like          85.9    2e-15   
gb|EAY76237.1|  hypothetical protein OsI_04173                        85.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001130615.1|  uncharacterized LOC100191714                     85.1    2e-15   Zea mays [maize]
ref|XP_006355407.1|  PREDICTED: F-box protein At5g46170-like          85.5    2e-15   
ref|XP_009625759.1|  PREDICTED: F-box protein At5g46170-like          85.5    2e-15   
gb|ACG44263.1|  F-box domain containing protein                       84.7    3e-15   Zea mays [maize]
gb|KHG27594.1|  hypothetical protein F383_11279                       85.5    3e-15   
emb|CDX87738.1|  BnaC02g32110D                                        85.1    3e-15   
ref|XP_009128847.1|  PREDICTED: F-box protein At5g46170-like          85.1    3e-15   
ref|XP_010923814.1|  PREDICTED: F-box protein At5g46170-like          85.5    3e-15   
gb|ABK24885.1|  unknown                                               84.7    3e-15   Picea sitchensis
ref|XP_010538543.1|  PREDICTED: F-box protein At5g46170-like          84.7    3e-15   
ref|XP_010922958.1|  PREDICTED: F-box protein At4g18380-like          84.3    4e-15   
emb|CDY43956.1|  BnaA02g24340D                                        84.3    4e-15   
ref|XP_006654574.1|  PREDICTED: F-box protein At4g18380-like          84.0    5e-15   
ref|XP_010538256.1|  PREDICTED: F-box protein At1g30200-like          84.3    5e-15   
ref|XP_001770045.1|  predicted protein                                84.0    5e-15   
dbj|BAB90386.1|  P0432B10.4                                           84.7    6e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EPS70457.1|  hypothetical protein M569_04296                       84.3    6e-15   
gb|EYU46210.1|  hypothetical protein MIMGU_mgv1a008386mg              84.0    7e-15   
ref|NP_193573.1|  F-box protein                                       83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAT69637.1|  unknown protein, contains f-box domain                83.2    1e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KHG16115.1|  hypothetical protein F383_22310                       84.0    1e-14   
ref|XP_004970320.1|  PREDICTED: F-box protein At1g30200-like          82.4    2e-14   
emb|CBI24218.3|  unnamed protein product                              82.4    2e-14   
ref|XP_002441291.1|  hypothetical protein SORBIDRAFT_09g023970        82.4    2e-14   Sorghum bicolor [broomcorn]
ref|XP_009758227.1|  PREDICTED: F-box protein At4g18380-like          82.8    2e-14   
ref|XP_002313372.1|  hypothetical protein POPTR_0009s05230g           82.4    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010046705.1|  PREDICTED: F-box protein At4g18380-like          82.4    3e-14   
ref|XP_007025034.1|  F-box family protein                             82.4    3e-14   
ref|XP_008786757.1|  PREDICTED: F-box protein At4g18380-like          81.6    3e-14   
ref|XP_003568140.1|  PREDICTED: F-box protein At5g46170-like          82.4    3e-14   
ref|NP_001055899.2|  Os05g0490300                                     82.4    3e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225507.1|  PREDICTED: F-box protein At5g46170-like          82.0    3e-14   
ref|XP_010518768.1|  PREDICTED: F-box protein At5g46170               82.0    4e-14   
ref|XP_008777014.1|  PREDICTED: F-box protein At4g18380-like          81.6    4e-14   
ref|XP_009607720.1|  PREDICTED: F-box protein At4g18380-like          81.6    4e-14   
gb|KCW87201.1|  hypothetical protein EUGRSUZ_B03721                   82.4    4e-14   
ref|XP_006644887.1|  PREDICTED: F-box protein At4g18380-like          81.3    5e-14   
ref|XP_009393903.1|  PREDICTED: F-box protein At4g18380-like          81.3    6e-14   
ref|XP_010907825.1|  PREDICTED: F-box protein At4g18380-like          80.9    7e-14   
ref|XP_010904742.1|  PREDICTED: F-box protein At4g18380-like          80.9    7e-14   
ref|XP_007212265.1|  hypothetical protein PRUPE_ppa006658mg           81.3    7e-14   
ref|XP_011035442.1|  PREDICTED: F-box protein At5g46170-like          81.3    8e-14   
dbj|BAJ85411.1|  predicted protein                                    80.5    9e-14   
ref|XP_003568215.1|  PREDICTED: F-box protein At5g46170-like          80.5    1e-13   
ref|XP_009410458.1|  PREDICTED: F-box protein At5g46170-like          80.1    1e-13   
ref|XP_011032098.1|  PREDICTED: F-box protein At4g18380-like          80.1    1e-13   
ref|XP_003593894.1|  F-box family protein                             79.7    2e-13   
ref|XP_008804990.1|  PREDICTED: F-box protein At4g18380-like isof...  79.3    2e-13   
ref|XP_010113152.1|  F-box protein                                    79.3    3e-13   
ref|XP_009101540.1|  PREDICTED: F-box protein At5g46170               79.3    3e-13   
ref|XP_010907539.1|  PREDICTED: F-box protein At4g18380-like          79.0    3e-13   
ref|XP_008804989.1|  PREDICTED: F-box protein At4g18380-like isof...  79.0    4e-13   
ref|XP_007015207.1|  F-box family protein, putative                   78.2    6e-13   
ref|XP_010246617.1|  PREDICTED: F-box protein At4g18380-like          78.2    7e-13   
gb|KHG20859.1|  hypothetical protein F383_03969                       78.2    7e-13   
ref|XP_009408533.1|  PREDICTED: F-box protein At5g46170               78.2    7e-13   
gb|ACR36872.1|  unknown                                               77.8    9e-13   Zea mays [maize]
ref|XP_002992968.1|  hypothetical protein SELMODRAFT_136272           77.8    9e-13   
gb|ACG36557.1|  F-box domain containing protein                       77.4    1e-12   Zea mays [maize]
gb|EMT09581.1|  hypothetical protein F775_20146                       77.4    1e-12   
ref|XP_010940976.1|  PREDICTED: F-box protein At5g46170-like          77.8    1e-12   
ref|XP_010439863.1|  PREDICTED: F-box protein At4g18380-like          77.8    1e-12   
emb|CDM84680.1|  unnamed protein product                              77.0    1e-12   
ref|XP_010052048.1|  PREDICTED: F-box protein At5g46170               77.4    1e-12   
ref|XP_008654796.1|  PREDICTED: uncharacterized protein LOC100279...  77.0    1e-12   
gb|ACG24953.1|  F-box domain containing protein                       77.0    2e-12   Zea mays [maize]
ref|NP_001145883.1|  uncharacterized protein LOC100279399             77.0    2e-12   Zea mays [maize]
ref|NP_001182880.1|  hypothetical protein                             76.3    2e-12   
emb|CDX77641.1|  BnaC07g18950D                                        76.6    2e-12   
ref|XP_004486009.1|  PREDICTED: F-box protein At5g46170-like          76.3    3e-12   
ref|XP_010277597.1|  PREDICTED: F-box protein At4g18380-like          76.3    4e-12   
ref|XP_011007418.1|  PREDICTED: F-box protein At5g46170-like          76.3    4e-12   
ref|XP_009399020.1|  PREDICTED: F-box protein At5g46170-like          76.3    4e-12   
dbj|BAJ87191.1|  predicted protein                                    75.9    4e-12   
ref|XP_008794503.1|  PREDICTED: F-box protein At5g46170               76.3    4e-12   
ref|XP_004961674.1|  PREDICTED: F-box protein At4g18380-like          75.5    5e-12   
ref|XP_009406821.1|  PREDICTED: F-box protein At5g46170-like          73.6    2e-11   
ref|NP_001044377.1|  Os01g0770400                                     73.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71551.1|  hypothetical protein OsI_03898                        73.6    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_004134599.1|  PREDICTED: F-box protein At5g46170-like          73.2    4e-11   
ref|XP_006415502.1|  hypothetical protein EUTSA_v10007915mg           72.8    5e-11   
ref|XP_009381361.1|  PREDICTED: F-box protein At4g18380-like          72.4    6e-11   
ref|NP_564350.1|  F-box protein                                       72.0    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009804959.1|  PREDICTED: F-box protein At1g30200-like          71.6    1e-10   
ref|XP_004163869.1|  PREDICTED: F-box protein At5g46170-like          70.9    2e-10   
ref|XP_002317281.1|  F-box family protein                             70.5    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010478400.1|  PREDICTED: F-box protein At1g30200-like          70.1    5e-10   
ref|XP_010460807.1|  PREDICTED: F-box protein At1g30200               69.7    6e-10   
ref|XP_002890858.1|  F-box family protein                             68.9    9e-10   
ref|XP_009610193.1|  PREDICTED: F-box protein At4g18380-like          67.8    2e-09   
ref|XP_008784858.1|  PREDICTED: F-box protein At5g46170-like          66.2    9e-09   
ref|XP_006470730.1|  PREDICTED: F-box protein At4g18380-like          65.9    9e-09   
ref|XP_010499543.1|  PREDICTED: F-box protein At1g30200-like isof...  65.5    1e-08   
ref|XP_009360916.1|  PREDICTED: F-box protein At5g46170-like          65.1    2e-08   
ref|XP_006446248.1|  hypothetical protein CICLE_v10015553mg           63.5    6e-08   
ref|XP_010517545.1|  PREDICTED: F-box protein At4g18380               63.5    6e-08   
gb|AEX97082.1|  F-box family protein                                  63.5    7e-08   
emb|CBI24219.3|  unnamed protein product                              63.2    7e-08   
ref|XP_010434544.1|  PREDICTED: F-box protein At4g18380-like          63.2    1e-07   
ref|XP_010052049.1|  PREDICTED: F-box protein At5g46170-like          62.8    1e-07   
ref|XP_008371620.1|  PREDICTED: F-box protein At5g46170-like          62.8    1e-07   
gb|KDP37998.1|  hypothetical protein JCGZ_04641                       62.8    1e-07   
ref|XP_009774076.1|  PREDICTED: F-box protein At4g18380-like          62.4    1e-07   
gb|KHG06780.1|  hypothetical protein F383_00742                       62.0    2e-07   
ref|XP_002519646.1|  conserved hypothetical protein                   61.6    3e-07   Ricinus communis
ref|XP_002531125.1|  conserved hypothetical protein                   61.2    3e-07   Ricinus communis
ref|XP_002863421.1|  F-box family protein                             60.8    5e-07   
ref|XP_006654629.1|  PREDICTED: F-box protein At5g46170-like          60.5    7e-07   
ref|XP_006307474.1|  hypothetical protein CARUB_v10009099mg           60.5    8e-07   
ref|XP_010441616.1|  PREDICTED: F-box protein At5g46170-like          59.3    2e-06   
ref|XP_002305042.1|  hypothetical protein POPTR_0004s06450g           59.3    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010494785.1|  PREDICTED: F-box protein At5g46170-like          59.3    2e-06   
ref|XP_006279647.1|  hypothetical protein CARUB_v10026571mg           59.3    2e-06   
gb|ADE76154.1|  unknown                                               58.9    2e-06   
ref|NP_199429.1|  F-box protein                                       58.9    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481487.1|  PREDICTED: F-box protein At5g46170               58.5    2e-06   
ref|XP_010687117.1|  PREDICTED: F-box protein At4g18380               58.2    4e-06   
ref|XP_010549497.1|  PREDICTED: F-box protein At1g30200               57.0    8e-06   
ref|XP_002974774.1|  hypothetical protein SELMODRAFT_102245           56.6    1e-05   
ref|XP_006449020.1|  hypothetical protein CICLE_v10015378mg           55.8    2e-05   
ref|XP_006468035.1|  PREDICTED: F-box protein At5g46170-like isof...  55.8    2e-05   
ref|XP_010086997.1|  hypothetical protein L484_005892                 55.5    3e-05   
ref|XP_006646370.1|  PREDICTED: F-box protein At5g46170-like          54.7    3e-05   
emb|CDP21114.1|  unnamed protein product                              54.3    6e-05   
ref|XP_006283811.1|  hypothetical protein CARUB_v10004910mg           53.9    9e-05   
ref|XP_006854457.1|  hypothetical protein AMTR_s00039p00227540        53.1    1e-04   
ref|XP_002870048.1|  F-box family protein                             53.1    2e-04   
ref|XP_006414111.1|  hypothetical protein EUTSA_v10025383mg           52.8    2e-04   
gb|EEE55450.1|  hypothetical protein OsJ_03607                        52.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006398302.1|  hypothetical protein EUTSA_v10000919mg           52.4    3e-04   
emb|CDX78847.1|  BnaA01g09140D                                        50.8    4e-04   
emb|CDX99469.1|  BnaC01g10830D                                        50.8    5e-04   



>ref|XP_010673726.1| PREDICTED: F-box protein At1g30200-like [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 91/351 (26%), Positives = 164/351 (47%), Gaps = 51/351 (15%)
 Frame = +1

Query  13   MEDLEHRNS---SDSDGAHIHDL-PDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIH  180
            M DL +  S   ++ +G    DL PD +LLLI+ +L DAKSLCRC LVSKRF+SL+  + 
Sbjct  1    MADLSYNQSMIENEIEGIDYFDLIPDPILLLIINKLFDAKSLCRCLLVSKRFSSLVSEVD  60

Query  181  NVIFsipdpdsspinsysnpsisdnnGETQKNFPKN-VLNLLSKPFHYLRQ-Itggpslp  354
            ++       +++   S      S  +    K+F KN +   + KP H L+Q I       
Sbjct  61   SI---SIKMNNNLPKSKKPIEDSSKSSTGSKSFLKNPIFKFIFKPIHLLQQAILSKKMNS  117

Query  355  spsstpAFNSVAFVNGIRFLKKFREIQRLEIQTPCFHAQ-----DPSLLKWEAGLGKdsi  519
               +    + + +V  +  LK F++IQ + ++ PC+  +     +  LLKWEA  GK+  
Sbjct  118  LSKNVGGLDILKWV--VNTLKNFQDIQSINLELPCYGGEIGINKNIPLLKWEAEFGKELE  175

Query  520  fcvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWR  699
             C  L ++S     +    E+      G  N+ + F  +++ L+ R+     C + +  R
Sbjct  176  NCAILGATSIVERKEKKGLEI----DEGIENDVQVF--SDDELKLRIIWIISCLIASSSR  229

Query  700  RHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDL------------------  825
             ++++ +V    K L +   +D    GK+ +  +Q+ +L+D                   
Sbjct  230  HNLVKKMVGQCPK-LSKVVISDAGKQGKLSMNPKQIKDLRDSIKITSTITNNNDKIENPS  288

Query  826  ----------RAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
                       A + + +  A    MK+W+V E++ P +G++++G T V+I
Sbjct  289  LELTQQSTSEVAADSISMVYAGNLVMKLWYVKELELPNSGKIVKGATLVMI  339



>ref|XP_006352970.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=367

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 98/324 (30%), Positives = 157/324 (48%), Gaps = 30/324 (9%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL I  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S  +
Sbjct  9    HFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISDDESSSPS  68

Query  238  psisdnnGETQ---KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF--------NS  384
             S   ++ +++    +  + V + L KPF  + Q        + SS+ A         NS
Sbjct  69   SSTGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAASSSAAVVDGDDFEKNS  128

Query  385  VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            V   +  + L+ F EI+ L I+ P       +  LLKW A  G     C+ L +SS    
Sbjct  129  VTHHSPTQVLRNFNEIKLLRIELPSGELGIDEGVLLKWRADFGSTLDNCIILGASSVIQP  188

Query  559  nddfsdELLAE-NGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVA  726
                S   L   +G G+ +N   P++F  TN  L+ RV       + A  R ++L+ ++A
Sbjct  189  VTSTSGCSLPNIDGNGENDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIA  247

Query  727  DHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHV  888
            +H KTL+    TD  G G + + KEQ   L++LR K P+   +A       A  M++W+ 
Sbjct  248  EH-KTLDSLVLTDADGQGVLCMNKEQ---LEELRVK-PLSASSASKRTLVPALNMRLWYA  302

Query  889  SEVQTPKTGRVMRGVTAVLIGVSE  960
            + ++ P  G V++G T V I  SE
Sbjct  303  AHLELPD-GTVLKGATLVAIRPSE  325



>ref|XP_009115183.1| PREDICTED: F-box protein At1g30200 [Brassica rapa]
 emb|CDY26286.1| BnaA09g26370D [Brassica napus]
Length=374

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 97/328 (30%), Positives = 147/328 (45%), Gaps = 24/328 (7%)
 Frame = +1

Query  25   EHRNSSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipd  204
            E + S D+D  H   LPD +LLLI  ++ D K L RC +VS+RF SL+P + NV+  +  
Sbjct  16   EPQPSDDTD--HFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDC  73

Query  205  pdsspi-----------nsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpsl  351
              S              +  +      + G +     + V   + KPF  L Q  G    
Sbjct  74   VISDDDSSASGDDDRRFSLNTASISDASAGGSFSALFRLVFAPIFKPFQALGQFLGPRRS  133

Query  352  pspsstpAFNS-VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsif  522
             S        S V   +  + LK F EI+ L I+ P      +D  LLKW A  G     
Sbjct  134  SSSLEDEVDQSGVTHHSPTQVLKNFAEIRFLRIELPTGELGIEDGILLKWRADFGSTLDN  193

Query  523  cvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRR  702
            C+ L +SS +    D    LL ++ G   N PE+F  TN  L+ RV       + A  R 
Sbjct  194  CMILGASSVTRSTSDLESPLLDDDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARH  249

Query  703  HVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMK  876
            ++L+ ++ +H KTL+    +D  G G + + +EQ+  L+   L A          A  M+
Sbjct  250  YLLQPIITEH-KTLDRLVLSDADGQGVLSMNREQLEELRVTPLSASSASKRTLVPALNMR  308

Query  877  VWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +W+  ++  P  G V++G T V I  SE
Sbjct  309  LWYAPQLDLPD-GTVLKGATLVAIRPSE  335



>emb|CDX99890.1| BnaC05g23120D [Brassica napus]
Length=367

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 94/313 (30%), Positives = 142/313 (45%), Gaps = 15/313 (5%)
 Frame = +1

Query  49   DGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspi--  222
            D  H   LPD +LLLI  ++ D K L RC +VS+RF SL+P + NV+  +    S     
Sbjct  22   DIDHFDHLPDSLLLLIFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDDR  81

Query  223  --nsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS-VAF  393
              +  +      + G +     + V   + KPF  L Q  G     S        S V  
Sbjct  82   RFSLNTASISDASAGGSFSALFRLVFAPIFKPFQALGQFLGPRRSLSSLEDETDQSGVTH  141

Query  394  VNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdndd  567
             +  + LK F EI+ L I+ P      +D  LLKW A  G     C+ L +SS +  + D
Sbjct  142  HSPTQVLKNFAEIRFLRIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVTRSSSD  201

Query  568  fsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLE  747
                LL ++ G   N PE+F  TN  L+ RV       + A  R ++L+ ++ +H KTL+
Sbjct  202  LESPLLDDDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KTLD  256

Query  748  EARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRV  921
                +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G V
Sbjct  257  RLVLSDADGQGVLSMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-GTV  315

Query  922  MRGVTAVLIGVSE  960
            + G T V I  SE
Sbjct  316  LTGATLVAIRPSE  328



>ref|XP_002279458.1| PREDICTED: F-box protein At5g46170-like [Vitis vinifera]
Length=341

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 139/308 (45%), Gaps = 29/308 (9%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   L DE++ LI  ++ DAKSLCRC +VSKRFASLIP   NV           +   S+
Sbjct  10   HFDRLSDELVTLIFNKVLDAKSLCRCSVVSKRFASLIPQTDNV----------SLIVPSS  59

Query  238  psisdnnGETQKNFPKNVL-NLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             +     G     F K ++   ++KP  +L Q        +      +     V     L
Sbjct  60   NNSKPKRGTFFIVFLKYLVGKFITKPLQFLYQTVVPKLSVNSDEDETYQFTTEV-----L  114

Query  415  KKFREIQRLEIQTPCFHAQDPS-----LLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + F  I+RL IQ PC   +  S      L+W+A  G++   CV L ++S    +   S  
Sbjct  115  RNFINIKRLSIQLPCHGDELGSKGTDYFLRWKAEFGRELESCVVLGATSFHRSSSTPS--  172

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
              +      L+ P   + T+E L+ RV       + A  R  +L+ ++AD     +    
Sbjct  173  --SHKKHKQLHEP--MSATDE-LKTRVVWMISSLIAASTRHWLLKQIIADIPMNPQSVMI  227

Query  760  TDQKGNGKVYLRKEQVANL-QDLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVT  936
            +D    G++ + +EQ   L + +    PV+     A  +K+WHV  ++ P +GRVM G T
Sbjct  228  SDSSKQGRLIMGEEQFKELRRSMNPTAPVERTMVPAVRVKLWHVPVLELPASGRVMNGAT  287

Query  937  AVLIGVSE  960
             ++I  +E
Sbjct  288  LIVIRPAE  295



>ref|XP_006836365.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
 gb|ERM99218.1| hypothetical protein AMTR_s00092p00114580 [Amborella trichopoda]
Length=393

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 149/333 (45%), Gaps = 35/333 (11%)
 Frame = +1

Query  10   KMEDLEHRNSSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            K+  +  + S  S   H   LPD +LLL+  ++ D K+L RC +VSKRF +LIP + NV+
Sbjct  41   KISVVTGKPSPSSQLDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSKRFHALIPQVDNVV  100

Query  190  FsipdpdsspinsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsst  369
              +    S+     S             +F K  +   SKP   L+ + G          
Sbjct  101  VKVDCVISNEETGISGKGKGVF-----SSFLKFFVCSFSKPLQVLQHLLGPRKT------  149

Query  370  pAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfss  543
                 V+  +    LK F EIQ L I  P      ++  LLKW+A  G     CV L +S
Sbjct  150  -GLTEVSHHSPNEVLKNFNEIQSLRIVLPGGELGIEEGVLLKWKADFGTTLESCVILGAS  208

Query  544  ssssdnddfsd----ELLAENGGGDL----NNPEAFALTNEMLRDRVEIAYQCFMEALWR  699
            S ++             ++EN  G +    N P+ F  TN  L+ RV       + A  R
Sbjct  209  SVTNQEKTTVSFEEDGFVSENNPGAIEDGANFPDPF-YTNGGLKLRVVWTISSLIAASAR  267

Query  700  RHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------  861
             ++L+ +++DH  TLE    TD  G G + + KEQ   L +LR K P+   A+       
Sbjct  268  HYLLQQIISDH-PTLENLVLTDSDGQGVLSMNKEQ---LHELRVK-PLSPCASSSRTQVP  322

Query  862  AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            A  MK+W+   ++ P  G V++G T V I  SE
Sbjct  323  ALNMKLWYAPYMELPG-GMVLKGATLVAIRPSE  354



>ref|XP_010247412.1| PREDICTED: F-box protein At5g46170 [Nelumbo nucifera]
Length=398

 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 101/337 (30%), Positives = 147/337 (44%), Gaps = 44/337 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL++  ++ D K+L RC +VS+RF  L+P + NV+  +    S    S   
Sbjct  26   HFDRLPDSLLLIVFNKIGDVKALGRCCVVSRRFHGLVPQVDNVVVRVDCVISDDDASSGT  85

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
             +     G    N  + V   + KP   L Q  G     S SS                 
Sbjct  86   AASDKTRG-VFSNLVRLVFGGIVKPLQALGQFLGPKKSSSASSLNGGSGGGGGGGGVGDD  144

Query  379  -----NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAG----------LG  507
                   V   +  + LK F EI+RL I+ P      +D  LLKW A           LG
Sbjct  145  EEMEAGGVTHHSPTQVLKNFNEIRRLRIELPGGELGIEDGVLLKWRADFGSTLDTCVILG  204

Query  508  KdsifcvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFME  687
              S+       SSS  +N   +D L   NG  + N PE+F  TN  L+ RV       + 
Sbjct  205  ASSVLSPGTTKSSSVQENGVGNDGLCVGNGDDNGNIPESF-YTNGGLKLRVVWTISSLIA  263

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++A+HH TLE    TD  G G + + +EQ   L++LR K P+    A   
Sbjct  264  ASARHYLLQPIIAEHH-TLESLVLTDADGQGVLCMNREQ---LEELRVK-PLSASTASRR  318

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+   ++ P  G V++G T V I  SE
Sbjct  319  TLVPALNMRLWYAPHLELPN-GMVLKGATLVAIRPSE  354



>ref|XP_004233124.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=369

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 96/326 (29%), Positives = 149/326 (46%), Gaps = 32/326 (10%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL I  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S  +
Sbjct  9    HFDRLPDSILLFIFNKIGDVKALGRCSVVSRRFNSLVPEVDNVLVRVDCVISDDESSPPS  68

Query  238  psisdnnGETQKNFPKN-----VLNLLSKPFHYLRQItggpslpspsstpAF--------  378
             S S      +   P +     V + L KPF  + Q        + SS+ A         
Sbjct  69   SSSSSGYSSDKSRHPISSLFRLVFSGLLKPFQSITQFISISPRRAASSSAAVVDGDDFEK  128

Query  379  NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsif-cvslfssss  549
            NSV   +  + LK F EI+ L I+ P       +  LLKW A  G       +   SS  
Sbjct  129  NSVTHHSPTQVLKNFNEIKLLRIELPSGELGIDEGVLLKWRADFGSTLDNCIILGASSVI  188

Query  550  ssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
                      L   +G G+ +N   P++F  TN  L+ RV       + A  R ++L+ +
Sbjct  189  QPVTSTSGCSLPNTDGNGENDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLLQPI  247

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVW  882
            +A+ HKTL+    TD    G + + K+Q   L++LR K P+   +A       A  M++W
Sbjct  248  IAE-HKTLDSLVLTDADEQGVLCMNKDQ---LEELRVK-PLSASSASKRTLVPALNMRLW  302

Query  883  HVSEVQTPKTGRVMRGVTAVLIGVSE  960
            + + ++ P  G V++G T V I  SE
Sbjct  303  YAAHLELPD-GTVLKGATLVAIRPSE  327



>ref|XP_009131656.1| PREDICTED: F-box protein At4g18380 [Brassica rapa]
Length=377

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 97/322 (30%), Positives = 151/322 (47%), Gaps = 35/322 (11%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD +LLL+  R+ D K+L RC +VSKRF SL+P + NV+  +    S   +  S     
Sbjct  27   LPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENVVVRVDCVISDDDDPSSLSPDK  86

Query  250  dnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG---------  402
              +  +  +    +  L+ KP H L Q+       S SS+P+ +S   + G         
Sbjct  87   PRSSASPFS---AIFRLIFKPLHALTQLLSTKRSSSSSSSPSPSSSLSITGGGEDGEIEQ  143

Query  403  --------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsssss  552
                     + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS +
Sbjct  144  GGVTHHSPTQVLKNFNEIRLLRIELPAGELGIDDGVLLKWRAEFGSTLENCVILGASSVA  203

Query  553  sdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH  732
            +D      +  A     + + PE+F  TN  L+ RV       + A  R ++L+ ++A+H
Sbjct  204  TDPPPSDGDSAAAAVEDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH  262

Query  733  HKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSE  894
             KTL+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   
Sbjct  263  -KTLDSLVLTDTDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPS  317

Query  895  VQTPKTGRVMRGVTAVLIGVSE  960
            ++ P  G V++G T V I  SE
Sbjct  318  LELPD-GTVLKGATLVAIRPSE  338



>ref|XP_010651665.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At1g30200-like 
[Vitis vinifera]
Length=638

 Score = 92.4 bits (228),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 92/314 (29%), Positives = 141/314 (45%), Gaps = 56/314 (18%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   L DEVL LI  R+ DAKSLCRCY VSKRF++LIP     I+               
Sbjct  333  HFECLSDEVLPLIFNRVLDAKSLCRCYAVSKRFSALIP--QTTIY---------------  375

Query  238  psisdnnGETQKNFPKNV---------LNLLSKPFHYLRQItggpslpspsstpAFNSVA  390
                   G  +   PK++         L +L +P  +L+QI    S  +   +   +SV 
Sbjct  376  -------GSFESCPPKSIPNQGLFVDFLKILVRPLQFLQQIVLQKSSGTLDLSE--DSVH  426

Query  391  FVNGIRFLKKFREIQRLEIQTPCFHA------QDPSLLKWEAGLGKdsifcvslfsssss  552
             + G+  LK F EI  L IQ PC            SLLKW+A  G++   CV L ++S  
Sbjct  427  QIAGV--LKHFSEINCLHIQLPCHGGGLRSSNSADSLLKWKAEFGRELESCVLLGATSFQ  484

Query  553  sdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH  732
                         +    ++     +LT + L+ RV         A  R  +L+  V ++
Sbjct  485  R-----------NDTISSIHEEYYKSLTADELKLRVMWMISSLFAASARHCLLKQFVDNN  533

Query  733  -HKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAEAGYMKVWHVSEVQTPK  909
             HK L      D    G++++R+E +  L+       ++     A  +K+ +VS ++ P+
Sbjct  534  DHKMLRGVVIADASKQGRLWMRQELLEELRTC-VNSSMERTRVPALRVKLXYVSVLELPE  592

Query  910  TGRVMRGVTAVLIG  951
            +GRVM+G T V+IG
Sbjct  593  SGRVMQGATLVIIG  606


 Score = 82.0 bits (201),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 139/317 (44%), Gaps = 54/317 (17%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   L DE+L LI  ++ DA+SLCRC  VSKRFASLIP +  V+ +IP P S P      
Sbjct  10   HFDGLSDELLSLIFSKVLDAESLCRCSAVSKRFASLIPLVDAVLLTIPPPKSKPNRGLFL  69

Query  238  psisdnnGETQKNFPKN--VLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVN----  399
                        NF  +  V N ++K   +L QI               +SV+F +    
Sbjct  70   ------------NFGNSLQVTNFIAKLLQFLHQIVLPQ-----------SSVSFHSNEGS  106

Query  400  ----GIRFLKKFREIQRLEIQTPCFHAQ-----DPSLLKWEAGLGKdsifcvslfss---  543
                    LK F  I  L IQ P    +       SLLKWEA  G++   CV L ++   
Sbjct  107  IHHFSSEVLKNFSHITSLHIQLPSHGGELGANGTGSLLKWEAEFGRELESCVVLGATYFE  166

Query  544  -ssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
             S+         + L E+           +L  + L+ RV     C   A  R  +L+ +
Sbjct  167  RSNKISRIPKRQDRLHES-----------SLATDELKLRVAWMISCLFAASARHCLLKQI  215

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQD-LRAKEPVDLRAAEAGYMKVWHVSEV  897
            +AD+   L      D    G++ + ++Q   L+  +  + P++     A  +K+W+V  +
Sbjct  216  IADNPMMLRSLVIEDGSKQGRLRMGEDQFKELRKCVNTRPPLERTKLPAICIKLWYVPLL  275

Query  898  QTPKTGRVMRGVTAVLI  948
            + P +G VM+G T ++I
Sbjct  276  ELPASGCVMKGATLIVI  292



>ref|XP_006836201.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
 gb|ERM99054.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda]
Length=348

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 92/304 (30%), Positives = 134/304 (44%), Gaps = 21/304 (7%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL+I  +LED KSL RC+ VSKRF SLIP +HNV+       S   +   N
Sbjct  17   HFDRLPDSLLLIIFNKLEDVKSLGRCFAVSKRFNSLIPEVHNVLVKFDCVISGTDDDDPN  76

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
             SI         +F K +L    KPFH LR           ++ P F  +A  +  + L+
Sbjct  77   SSILPRPRNLFSHFFKLMLGAFLKPFHSLRT---------NNNKPLFPQLAHHSPAQVLR  127

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
             F  +  L I  P       D  LLKW+A  G  ++    +   +          E L +
Sbjct  128  NFHHVHHLRIVLPTGDLGTDDGVLLKWKAEFGS-TLHSCVILGGTKMEKKPVSDHEPLDD  186

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            NG    + PE+F  TN  L+ RV       + A  R + L+ ++ + H TL+    TD  
Sbjct  187  NG----SFPESF-YTNGGLKLRVVWTISSLIAASARHYFLQQIIRE-HPTLKSLVLTDAD  240

Query  772  GNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVL  945
            G G + +  EQ+   ++  L A          A  MK+ +   ++ P  G  M+G T V 
Sbjct  241  GQGTLSMGIEQLREFREKPLAASAGSSRTQVPALNMKLRYAPYLELPD-GMGMQGATLVA  299

Query  946  IGVS  957
            I  S
Sbjct  300  IKPS  303



>emb|CBI30928.3| unnamed protein product [Vitis vinifera]
Length=398

 Score = 90.1 bits (222),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 92/309 (30%), Positives = 145/309 (47%), Gaps = 25/309 (8%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF +L+P + NV+  +    S   +S + 
Sbjct  65   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHTLVPQVENVVVRVDCVISDDESSSAA  124

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
             S+  + G     F + V   + KP   L Q   G              V   +  + LK
Sbjct  125  GSLEKSRGPFSHLF-RLVFGGIVKPLQALGQFLDGDVDHQT------GGVTHHSPTQVLK  177

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
             F EI+ L I+ P      +D  LLKW A  G     CV L ++S           +  +
Sbjct  178  NFNEIRFLRIELPSGELGIEDGVLLKWRADFGSTLDNCVILGAASVICPGPTKGSGV-QD  236

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            N  G +  PE+F  TN  L+ RV       + A  R ++L+ ++A+H KTL+    TD  
Sbjct  237  NDNGSI--PESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KTLDSLVLTDAD  292

Query  772  GNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRVMRGV  933
            G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ P  G V++G 
Sbjct  293  GQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPHLELPD-GIVLKGA  347

Query  934  TAVLIGVSE  960
            T V I  SE
Sbjct  348  TLVAIRPSE  356



>emb|CDY33458.1| BnaA06g36150D [Brassica napus]
Length=360

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 92/311 (30%), Positives = 142/311 (46%), Gaps = 17/311 (5%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D KSL RC +VS+RF SL+  + NV+  +    S   NS  +
Sbjct  19   HFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENVLIRVDCVISDDDNSSLS  78

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
               S +       N  + V+  + KP   L Q  G               V   +  + L
Sbjct  79   SIKSRSAASAPFSNLFRLVVGGIVKPLQALGQFLGARRSGDEGGEIEQGGVTHHSPTQVL  138

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            K F EI+ L I+ P       D  LLKW A  G     CV L +SS    +     + + 
Sbjct  139  KNFEEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDHCVILGASSVIQPSPTRVSQPV-  197

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+     + PE+F  TN  L+ RV       + A  R ++L+ ++A+ HKTL     +D 
Sbjct  198  ESSDDTGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAE-HKTLRSLVLSDS  255

Query  769  KGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRVMRG  930
             G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ P  G V++G
Sbjct  256  DGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLELPD-GTVLKG  310

Query  931  VTAVLIGVSED  963
             T V I  SE 
Sbjct  311  ATLVAIRPSES  321



>ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010270681.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 142/316 (45%), Gaps = 28/316 (9%)
 Frame = +1

Query  37   SSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdss  216
            S+D D      +PD V+L+IL +L D +SL RC  V KRF SL+P++H+V   I +  + 
Sbjct  12   SNDVDQGEFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSLVPYVHDVYIKIDEVVTI  71

Query  217  pinsysnpsisdnnGETQKNFPKNV-----LNLLSKPFHYLRQItggpslpspsstpAFN  381
              +S  +   S       +NF  N+     LNLL KPFH+LR         S ++     
Sbjct  72   NGDSDESSYSSS---HKPRNFFSNLLKYMFLNLL-KPFHHLRN-------NSNTNKTLLP  120

Query  382  SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssss  555
             V+     + L+ F  I  L I+ P      +D  LLKW+A  G     CV L  +    
Sbjct  121  QVSQCTLDQVLRNFHHIHNLCIELPTADVETEDGVLLKWKAEFGSTLQNCVILGGTQIER  180

Query  556  dnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH  735
                     L +NG    + PE+F  TN  L+ RV       + A  R ++L  ++ D H
Sbjct  181  KPVTDQGS-LEDNG----SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLEPIIKD-H  233

Query  736  KTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPK  909
             TL    FTD  G G + +  EQ+   ++  L A          A  MK+ +   +  P+
Sbjct  234  PTLRTVVFTDAAGQGTLSMGIEQLKEFREKPLAASASSRRTQVPASNMKLRYAPYLDLPE  293

Query  910  TGRVMRGVTAVLIGVS  957
             G  M+G T V+I  S
Sbjct  294  -GLGMQGATLVVIRTS  308



>ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
 gb|EES01639.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor]
Length=354

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 145/303 (48%), Gaps = 18/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL +LED +SL RC  VSKRF+ L+P +H+V   I    +   +S    ++S
Sbjct  21   LPDSLVLLILNKLEDVRSLGRCSAVSKRFSGLVPLVHDVCVKIDHVVTVDGDSDDALNLS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +  K +L  ++KPFH +R        PS +  P F  ++  + ++ LK F 
Sbjct  81   SPKPHNIISHLFKLMLFAIAKPFHDMRS-------PSSTGRPLFPQLSQHSPVQVLKNFS  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++ L+++ P      ++  LLKW A  G     CV L  +           E  +++ G
Sbjct  134  HVRNLQVELPSGDVAVEEGVLLKWRAEYGSTLQNCVILGGTLVDRKAAGNGHEPSSDDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV     C + A  R ++LR ++ DH  TL      D +G G
Sbjct  194  ---SMPESF-YTNGGLKLRVVWTISCLIAASTRHYLLRSIINDH-PTLRSLVLADAEGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+ + ++  L A    +     A  MK+ +   ++ P  G  ++G T ++I  
Sbjct  249  ALSMGAEQLKDFREHQLSASPCSNRTQVPACNMKLKYAQYLELPG-GLALQGATLLVIKP  307

Query  955  SED  963
            + D
Sbjct  308  ASD  310



>ref|XP_011080388.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=371

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 88/325 (27%), Positives = 154/325 (47%), Gaps = 41/325 (13%)
 Frame = +1

Query  34   NSSDSDGAHIHD----LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsip  201
            N+ DS  A   D    LPDEV+L I  +L+DAKSLC    V KRF S+IP ++ V   +P
Sbjct  9    NNMDSRVAGSDDFFDRLPDEVVLSIFDQLQDAKSLCLSMSVCKRFHSIIPQVNQVFLPLP  68

Query  202  dpdsspinsysnpsisdnnGETQKN-FPKNVLNLLSKPFHYLRQItggpslpspsstpAF  378
               S+   S           ET++  F   V+  L KPF+++ Q+       +  +   F
Sbjct  69   QKKSAERESGQ---------ETRRGLFRSAVIRALKKPFYFVSQM-IKSKPKNEENDLEF  118

Query  379  NSVAFVNGIRFLKKFREIQRLEIQTPCFHAQDPSL------------LKWEAGLGKdsif  522
             S    N +  LK F+EI+   ++ PC+  Q   L            L+W+A  G++   
Sbjct  119  YSHYVPNQV--LKSFQEIRAFHLRLPCYGTQKQGLKTGENSMNPTNFLRWKAEFGRELQS  176

Query  523  cvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRR  702
            CV L + S    ++   + +  +         E+  + +E L+ R+     C + A  R 
Sbjct  177  CVILGAKSWRDKSEGEENSVYPDQ--------ESRIMADEELKLRIVWTISCLIAASARH  228

Query  703  HVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAK--EPVDLRA-AEAGYM  873
            ++++  V    KT++    +D+   G++ + K Q+  ++ +  K  E ++ R+   A  M
Sbjct  229  YLIQETVKG-LKTIDSIVVSDESNQGRLCMNKGQIEEVRKMERKGDELLEYRSRVPALRM  287

Query  874  KVWHVSEVQTPKTGRVMRGVTAVLI  948
            K+W++  ++ P +G+VM G T V+I
Sbjct  288  KMWYLERLELPDSGKVMEGGTLVVI  312



>ref|XP_007147928.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
 gb|ESW19922.1| hypothetical protein PHAVU_006G166500g [Phaseolus vulgaris]
Length=379

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 97/321 (30%), Positives = 149/321 (46%), Gaps = 28/321 (9%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S S+
Sbjct  23   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDDSSSSS  82

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQI-----------tggpslpspsstpAFNS  384
             S   + G    N  + V   + KP   L Q            +   SL   +   +   
Sbjct  83   ASSDKSRGPFW-NLLRLVFGGIVKPIQTLGQFLGPKRPSSSSPSPSSSLAVGTDDDSDAG  141

Query  385  VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            V   +  + LK F EI+ L I+ P      +D  LLKW A  G     CV L +SS    
Sbjct  142  VTHHSPTQVLKNFNEIRLLRIELPSGELGIEDGVLLKWRADFGSTLDNCVVLGASSVFHP  201

Query  559  nddfsdELLAENGGGDLNN-PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH  735
             D       A N   D  + P++F  TN  L+ RV       + A  R ++L+ ++++H 
Sbjct  202  KDLTDSSATATNCTDDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLLQPIISEH-  259

Query  736  KTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEV  897
             TL+    TD  G G +Y+ +EQ   L++LR K P+   +A       A  M++W+   +
Sbjct  260  GTLDNLVLTDADGQGVLYMNREQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPHL  315

Query  898  QTPKTGRVMRGVTAVLIGVSE  960
            + P  G V++G T V I  SE
Sbjct  316  ELPD-GVVLKGATLVAIRPSE  335



>emb|CAN73778.1| hypothetical protein VITISV_042179 [Vitis vinifera]
Length=399

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 149/337 (44%), Gaps = 48/337 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF +L+P + NV+  +    S   +S + 
Sbjct  33   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHTLVPQVENVVVRVDCVISDDESSSAA  92

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG-----  402
             S+  + G     F + V   + KP   L Q  G       +S    +S+A   G     
Sbjct  93   GSLEKSRGPFSHLF-RLVFGGIVKPLQALGQFLGPKRSAPTTS----SSLAVGGGSEEDG  147

Query  403  --------------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd-------  513
                           + LK F EI+ L I+ P      +D  LLKW A  G         
Sbjct  148  DVDHQTGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIEDGVLLKWRADFGSTLDNCVIL  207

Query  514  sifcvslfssssssdnddfsdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFME  687
                V     +  S   D   +    + GGD N   PE+F  TN  L+ RV       + 
Sbjct  208  GAASVICPGPTKGSGVQDSGXDAFCVSNGGDDNGSIPESF-YTNGGLKLRVVWTISSLIA  266

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++A+H KTL+    TD  G G + + ++Q   L++LR K P+   +A   
Sbjct  267  ASARHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNRDQ---LEELRVK-PLSASSASKR  321

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+   ++ P  G V++G T V I  SE
Sbjct  322  TLVPALNMRLWYAPHLELPD-GIVLKGATLVAIRPSE  357



>ref|XP_003546077.1| PREDICTED: F-box protein At5g46170-like [Glycine max]
Length=385

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 101/343 (29%), Positives = 155/343 (45%), Gaps = 37/343 (11%)
 Frame = +1

Query  19   DLEHRNSSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsi  198
            DLE R   + +  H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +
Sbjct  7    DLECRIFPEPEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRV  66

Query  199  pdpdsspinsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQI---------------  333
                S   +S S+ +   + G    N  + V   + KP   L Q                
Sbjct  67   DCVISDDDSSSSSAASDKSRGPFW-NLLRLVFGGIVKPIQTLGQFLGPKRPSSSAAATAT  125

Query  334  -----tggpslpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKW  492
                 +   SL   S   +   V   +  + LK F EI+ L I+ P      +D  LLKW
Sbjct  126  AATSPSSTSSLAVGSDEDSDGGVTHHSPTQVLKNFNEIRLLRIELPSGELGIEDGVLLKW  185

Query  493  EAGLGKdsifcvslfssssssdnddfsdELLAENGGGDLNN-PEAFALTNEMLRDRVEIA  669
             A  G     CV L +SS     D         N   D  + P++F  TN  L+ RV   
Sbjct  186  RADFGSTLDNCVILGASSVFHPKDLTDPTTTNCNANDDNGSIPDSF-YTNGGLKLRVVWT  244

Query  670  YQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDL  849
                + A  R ++L+ ++++H  TL+    TD  G G +Y+ +EQ   L++LR K P+  
Sbjct  245  ISSLIAASARHYLLQPIISEH-ATLDNLLLTDADGQGVLYMNREQ---LEELRVK-PLSA  299

Query  850  RAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
             +A       A  M++W+   ++ P TG V++G T V I  SE
Sbjct  300  SSASKRTLVPALNMRLWYAPHLELP-TGVVLKGATLVAIRPSE  341



>ref|XP_002278480.1| PREDICTED: F-box protein At5g46170 [Vitis vinifera]
Length=399

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 150/337 (45%), Gaps = 48/337 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF +L+P + NV+  +    S   +S + 
Sbjct  33   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHTLVPQVENVVVRVDCVISDDESSSAA  92

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG-----  402
             S+  + G     F + V   + KP   L Q  G       +S    +S+A   G     
Sbjct  93   GSLEKSRGPFSHLF-RLVFGGIVKPLQALGQFLGPKRSAPTTS----SSLAVGGGSEEDG  147

Query  403  --------------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd-------  513
                           + LK F EI+ L I+ P      +D  LLKW A  G         
Sbjct  148  DVDHQTGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIEDGVLLKWRADFGSTLDNCVIL  207

Query  514  sifcvslfssssssdnddfsdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFME  687
                V     +  S   D  ++    + GGD N   PE+F  TN  L+ RV       + 
Sbjct  208  GAASVICPGPTKGSGVQDSGNDAFCVSNGGDDNGSIPESF-YTNGGLKLRVVWTISSLIA  266

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++A+H KTL+    TD  G G + + ++Q   L++LR K P+   +A   
Sbjct  267  ASARHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNRDQ---LEELRVK-PLSASSASKR  321

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+   ++ P  G V++G T V I  SE
Sbjct  322  TLVPALNMRLWYAPHLELPD-GIVLKGATLVAIRPSE  357



>ref|XP_011085237.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=388

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 103/336 (31%), Positives = 159/336 (47%), Gaps = 43/336 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLI  ++ D K+L RC +VS+RF SL+P + +VI  +    S   +S ++
Sbjct  19   HFDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDDVIVRVDCVISDDDSSGTS  78

Query  238  psisdnnGETQKNFPKNVL-----NLLSKPFHYLRQItggpslpspsstpAF------NS  384
             S +    +  + +P + L     + + +P   L Q+    S   PS           NS
Sbjct  79   SSSASAASDKSR-YPISSLFRIFFSGIFRPLQSLTQLITPSSRRLPSLNDDVDSETEQNS  137

Query  385  VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            V   +  + LK F EI+ L I+ P       D  LLKW+A  G     CV L +SS   +
Sbjct  138  VTHHSPTQVLKNFNEIKFLRIELPSGELGIDDGILLKWKADFGSTLDNCVILGASSIVQN  197

Query  559  nddfsdELLA------ENGGGDLNN----------PEAFALTNEMLRDRVEIAYQCFMEA  690
             +   D L A      +NG    N+          PE+F  TN  L+ RV       + A
Sbjct  198  MNSGCDFLGACNVNNTDNGTNGYNSNGVENDNGSIPESF-YTNGGLKLRVVWTISSLIAA  256

Query  691  LWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE---  861
              R ++L+ ++A+H KTLE    TD  G G + + KEQ   L++LR K P+   +A    
Sbjct  257  SARHYLLQPIIAEH-KTLENLVLTDADGQGVLSMDKEQ---LEELRVK-PLSASSASKRT  311

Query  862  ---AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
               A  M++W+  +++ P  G V++G T V I  SE
Sbjct  312  LVPALNMRLWYAPQLELPN-GMVLKGATLVAIRPSE  346



>ref|XP_003542943.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Glycine max]
 ref|XP_006594509.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Glycine max]
Length=387

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 97/329 (29%), Positives = 152/329 (46%), Gaps = 36/329 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S S 
Sbjct  23   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDDSSSSA  82

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQI-----------------tggpslpspss  366
             +   + G    N  + V   + KP   L Q                  T    L   + 
Sbjct  83   AASDKSRGPFW-NLLRLVFGGIVKPIQTLGQFLGPKRPSSSSVTSPSSTTSSSPLAVGTD  141

Query  367  tpAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfs  540
              +   V   +  + LK F EI+ L I+ P      +D  LLKW A  G     CV L +
Sbjct  142  DDSDAGVTHHSPTQVLKNFNEIRLLRIELPSGELGIEDGVLLKWRADFGSTLDNCVILGA  201

Query  541  sssssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALWRRHVL  711
            SS     D+ +D +   N   + +N   P++F  TN  L+ RV       + A  R ++L
Sbjct  202  SSVFHPKDNLTDPIPTTNCNANDDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLL  260

Query  712  RHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYM  873
            + ++++H  TL+    TD  G G +Y+ +EQ   L++LR K P+   +A       A  M
Sbjct  261  QPIISEH-ATLDNLVLTDADGQGVLYMNREQ---LEELRVK-PLSASSASKRTLVPALNM  315

Query  874  KVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            ++W+   ++ P TG V++G T V I  SE
Sbjct  316  RLWYAPHLELP-TGVVLKGATLVAIRPSE  343



>gb|EYU33385.1| hypothetical protein MIMGU_mgv1a008110mg [Erythranthe guttata]
Length=384

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 102/335 (30%), Positives = 154/335 (46%), Gaps = 45/335 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLI  ++ D K+L RC +VSKRF SL+P + NVI  +    S    S ++
Sbjct  19   HFDRLPDSLILLIFNQIGDVKALGRCCVVSKRFHSLVPQVDNVIVRVDCVISDDDPSATS  78

Query  238  psisdnnGETQK------NFPKNVLNLLSKPFHYLRQItggpslpspsst-----pAFNS  384
             S S  +  + K      +  + V + L KP   L Q+    +   P S         N+
Sbjct  79   SSSSATSAASDKLRHPISSLFRFVFSGLFKPLQSLSQLIVPSTRRLPLSEDFDGETEQNT  138

Query  385  VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            V   +  + LK F EI+ L I+ P       D  LLKW+A  G     CV L +SS   +
Sbjct  139  VTHHSPTQVLKNFNEIKLLRIELPSGELGIDDGVLLKWKADFGSTLDNCVILGASSVVQN  198

Query  559  nddfsdE---------------LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEAL  693
             +                    +  +NG    + PE+F  TN  L+ RV       + A 
Sbjct  199  MNSNLSSSGTCQNIDNVGNNNGVENDNG----SIPESF-YTNGGLKLRVVWTISSLIAAS  253

Query  694  WRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE----  861
             R ++L+ ++A+H KTLE    TD  G G + + KEQ   L++LR K P+   +A     
Sbjct  254  ARHYLLQPIIAEH-KTLESLVLTDSDGQGVLSMNKEQ---LEELRVK-PLSASSASKRTL  308

Query  862  --AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
              A  M++W+   ++ P  G V++G T V I  SE
Sbjct  309  VPALNMRLWYAPHLELPN-GLVLKGATLVAIRPSE  342



>ref|XP_003564454.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=354

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 141/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
             I  LPD ++LLIL +LED +SL RC  VSKRF  L+P +H+V   I    ++  ++   
Sbjct  17   QIDCLPDALVLLILNKLEDVRSLGRCSAVSKRFNELVPLVHDVYVKIDRVVTADGDADDA  76

Query  238  psisdnnGE-TQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S         +F K +L  + KPFH +R        PS +  P F  +A  + ++ L
Sbjct  77   FNLSSPKARHIFSHFIKLMLFTIVKPFHSMRN-------PSGTGRPVFPQLAQHSPVQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            K F  ++ L ++ P      +    LKW A  G     CV L  +           +   
Sbjct  130  KNFSHVRNLRVELPSGDVGTEAGVFLKWRAMYGSTLQNCVILGGTLVDRKTVAVGHDPST  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++L+ ++ DH  TL     TD 
Sbjct  190  EDSG---SMPESF-YTNGGLKLRVVWTISTLIAASTRHYLLQSIIKDH-PTLRSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  EQ+   ++  L A    +     A  MK+ + + ++ P  G  M+G T V
Sbjct  245  DGQGTISMGMEQLKEFRENQLPASACSNRTQVPACSMKLKYAAYLELPD-GLAMQGATLV  303

Query  943  LIGVSED  963
            +I  S D
Sbjct  304  VIKPSAD  310



>ref|XP_011096601.1| PREDICTED: F-box protein At4g18380-like [Sesamum indicum]
Length=392

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 108/344 (31%), Positives = 155/344 (45%), Gaps = 55/344 (16%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD V+LLI  ++ D K+L RC +VS+RF SL+P + NVI  +    S    S ++
Sbjct  19   HFDRLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDNVIVRVDCVISDEDPSATS  78

Query  238  psisdnnGETQKN-FPKNVL-----NLLSKPFHYLRQItggpslpspsstpAF------N  381
             S +  +  + K+  P + L     + L KP   L Q+    S   PS +  F      N
Sbjct  79   SSSAAASAASDKSRHPISSLFRILFSGLFKPLQSLSQLISPSSRRIPSLSEDFDFETEQN  138

Query  382  SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssss  555
            SV   +  + LK F EI+ L I+ P       +  LLKW+A  G     CV L +SS   
Sbjct  139  SVTHHSPTQVLKNFNEIKLLRIELPSGELGIDEGVLLKWKAQFGSTLDNCVILGASSVVQ  198

Query  556  dnddfsdELLAENGGGDLNN------------------------PEAFALTNEMLRDRVE  663
              D   D L      G  NN                        PE+F  TN  L+ RV 
Sbjct  199  KMDSDYDCL------GTCNNYDSVNNDNSSSNNNNGVENDNGSIPESF-YTNGGLKLRVV  251

Query  664  IAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPV  843
                  + A  R ++L+ ++A+H KTLE    TD  G G + + KEQ   L++LR K   
Sbjct  252  WTISSLIAASARHYLLQPIIAEH-KTLENLVLTDSDGQGVLSMNKEQ---LEELRVKPLS  307

Query  844  DLRAAE-----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
               AA+     A  M++W+   ++ P  G V++G T V I  SE
Sbjct  308  PSSAAKRTLVPALNMRLWYAPHLELP-NGLVLKGATLVAIKPSE  350



>ref|XP_008792446.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008792447.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 134/298 (45%), Gaps = 18/298 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLIL ++ D +SL RC  VSKRF SL+P +H+V   I    +         ++S
Sbjct  21   IPDSLVLLILNKIADVRSLGRCSAVSKRFNSLVPLVHDVYVKIDRVVTVDGEYDDAFNLS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K ++  LSKPFH+LR   GG           F  ++  +  + LK F 
Sbjct  81   SPKPRNLFSHFLKLMIFTLSKPFHHLRNTNGGLKPL-------FPQLSHYSPAQVLKNFT  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             IQ L I+ P      +   LLKW A  G     CV L  +           +   E+ G
Sbjct  134  HIQNLRIELPAGDVGTEGGVLLKWRAEFGSTLQNCVILGGTRVDRKPASTEQQTGLEDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F + N  L+ RV       + A  R ++LR ++ DH  TL+    TD  G G
Sbjct  194  ---SIPESFYI-NGGLKLRVVWTISSLIAASTRHYLLRPIIKDH-PTLKSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I
Sbjct  249  TLSMGLEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELPG-GMGLQGATLVAI  305



>ref|NP_001044594.1| Os01g0812200 [Oryza sativa Japonica Group]
 dbj|BAD68209.1| F-box protein family-like [Oryza sativa Japonica Group]
 dbj|BAF06508.1| Os01g0812200 [Oryza sativa Japonica Group]
 gb|EAZ13910.1| hypothetical protein OsJ_03835 [Oryza sativa Japonica Group]
 dbj|BAG93081.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96606.1| unnamed protein product [Oryza sativa Japonica Group]
Length=353

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 138/303 (46%), Gaps = 19/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD V+LLIL +LED +SL RC  VSKRF+ L+P + +V   I    ++  ++    ++S
Sbjct  21   LPDPVVLLILNKLEDVRSLGRCAAVSKRFSGLVPLVSDVYVKIDRVVATDGDADDALNLS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                +    +F K +L  + KPFH +R + G               +A  + +  L+ F 
Sbjct  81   SAKPKNIFSHFFKLMLFTIVKPFHSMRNLNGTGR--------PLFPLAQHSPVHVLRNFS  132

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
            ++  L ++ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  133  DVWNLRVELPSGDVGTEEGVLLKWRAEYGSTLRNCVILGGTLVDRKPIGAEHESSVEDNG  192

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL      D  G G
Sbjct  193  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLRSLVLADADGQG  247

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             +Y+  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V+I  
Sbjct  248  TLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPG-GMTLQGATLVVIKP  306

Query  955  SED  963
            S D
Sbjct  307  SND  309



>gb|EYU43254.1| hypothetical protein MIMGU_mgv1a008300mg [Erythranthe guttata]
Length=378

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 153/327 (47%), Gaps = 35/327 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD V+LLI  ++ D K+L RC +VS+RF SL+P + +VI  +    S    S ++
Sbjct  19   HFDHLPDSVILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDDVIVRVDCVISDDDPSAAS  78

Query  238  psisdnnGETQKNFPK--NVLNLLSKPFHYLRQItggps------lpspsstpAFNSVAF  393
             + S  + + +        + + L KP   L Q+    +           S    +SV  
Sbjct  79   SASSAASDKFRHPISSLLRIFSGLFKPLQSLTQLITPSARRLPSHSTDFDSDSDQSSVTH  138

Query  394  VNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAG----------LGKdsifcvslf  537
             +  + LK F+EI+ L I+ P       D  LLKW+A           LG  S+      
Sbjct  139  HSPTQVLKNFKEIKFLRIELPSGELGIDDGILLKWKADFGSTLDNCVILGASSVVQNINN  198

Query  538  ssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRH  717
                +++N++ ++  + EN  G +  PE+F  TN  L+ RV       + A  R  +L+ 
Sbjct  199  GRDCNNNNNNNTNNAVVENDNGSI--PESF-YTNGGLKLRVVWTISSLIAASARHFLLQP  255

Query  718  VVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKV  879
            ++A+H KTLE    TD  G G + + KEQ   L++LR K P+    A       A  M++
Sbjct  256  IIAEH-KTLENLILTDADGQGVLSMNKEQ---LEELRVK-PLSASLASKRTLVPALNMRL  310

Query  880  WHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            W+   ++ P  G V++G T V I  SE
Sbjct  311  WYAPHLELPN-GMVLKGATLVAIRPSE  336



>ref|XP_004137366.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 ref|XP_004167064.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN63909.1| hypothetical protein Csa_1G025900 [Cucumis sativus]
Length=406

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 149/337 (44%), Gaps = 44/337 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  ++ D K+L RC +VS+RF  L+P + NV+  +    S   +S S+
Sbjct  36   HFDRLPDSLLLLIFNKIGDVKALGRCCVVSRRFHCLVPQVENVVVRVDCVISDDESSSSS  95

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVN------  399
             S   + G     F + V   + KP   L Q  G     S  ++ +  S   V       
Sbjct  96   SSSGKSRGPFFNIF-RFVFGGIVKPLQALGQFLGQTRASSTLASSSSTSSLAVGTDEDGE  154

Query  400  ----GI------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd---------s  516
                G+      + LK F EI+ L I+ P       D  LLKW A  G           S
Sbjct  155  IDQGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAS  214

Query  517  ifcvslfssssssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFME  687
                      S + ++         NGG   +N   PE+F  TN  L+ RV       + 
Sbjct  215  SVIQPGSIKPSIAQDNGTDGGFCMGNGGASDDNGSIPESF-YTNGGLKLRVVWTISSLIA  273

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++ADH KTL+    TD  G G + + K+Q   L++LR K P+   +A   
Sbjct  274  ASARHYLLQPIIADH-KTLDSLVLTDADGQGVLCMNKDQ---LEELRVK-PLSASSASKR  328

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+ + ++ P  G +++G T V I  SE
Sbjct  329  TLVPALNMRLWYATHLELPN-GLILKGATLVAIRPSE  364



>ref|XP_004244968.1| PREDICTED: F-box protein At5g46170-like [Solanum lycopersicum]
Length=384

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 99/334 (30%), Positives = 154/334 (46%), Gaps = 42/334 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H + LPD VLLLI  ++ D K+L RC  V +RF SL+P + NV+  +    S   ++ S+
Sbjct  19   HFNQLPDPVLLLIFNKIGDVKTLGRCCGVCRRFHSLVPQVDNVVVRVDCVISDDDDASSS  78

Query  238  psisdnnGETQK------NFPKNVLNLLSKPFHYLRQItggpslpspsstpAFN------  381
             S S     + K      +  + V   L KPF  L Q+    S    +S+   +      
Sbjct  79   SSSSSAAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLISISSRRCTASSSLVDDDFEKY  138

Query  382  SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssss  555
            SV   +  + LK F EI+ L I+ P       + +LLKW A  G        +   +SS 
Sbjct  139  SVTHHSPTQVLKNFDEIKLLRIELPSGELGIDEGALLKWRADFGS--TLDNCVILGASSV  196

Query  556  dnddfsdELLAE----------NGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALW  696
                  D+L+ E          +G G+ +N   PE+F  TN  L+ RV       + A  
Sbjct  197  IQPVSIDDLVEEQCGNGSNSLGDGNGETDNGSIPESF-YTNGGLKLRVVWTISSLIAASA  255

Query  697  RRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-----  861
            R ++L+ ++A+H K L     TD  G G + + +EQ   L++LR K P+   +A      
Sbjct  256  RHYLLQPIIAEHKK-LASLVLTDVDGQGVLCMNREQ---LEELRVK-PLSASSASKRTMV  310

Query  862  -AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
             A  M++W+   ++ P  G V++G T V I  SE
Sbjct  311  PALNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  343



>ref|XP_008444512.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
 ref|XP_008444520.1| PREDICTED: F-box protein At5g46170-like [Cucumis melo]
Length=406

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 148/337 (44%), Gaps = 44/337 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  ++ D K+L RC +VS+RF  L+P + NV+  +    S   +S S+
Sbjct  36   HFDRLPDSLLLLIFNKIGDVKALGRCCVVSRRFHCLVPQVENVVVRVDCVISDDESSSSS  95

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVN------  399
             S   + G     F + V   + KP   L Q  G     S  ++ +  S   V       
Sbjct  96   SSSGKSRGPFFNIF-RFVFGGIVKPLQALGQFLGQTRASSSLASSSSTSSLAVGTDEDGE  154

Query  400  ----GI------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd---------s  516
                G+      + LK F EI+ L I+ P       D  LLKW A  G           S
Sbjct  155  IDQGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAS  214

Query  517  ifcvslfssssssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFME  687
                      S   ++         NGG   +N   PE+F  TN  L+ RV       + 
Sbjct  215  SVIQPGSIKPSIGQDNGTDGGFCIGNGGASDDNGSIPESF-YTNGGLKLRVVWTISSLIA  273

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++ADH KTL+    TD  G G + + K+Q   L++LR K P+   +A   
Sbjct  274  ASARHYLLQPIIADH-KTLDSLVLTDADGQGVLCMNKDQ---LEELRVK-PLSASSASKR  328

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+ + ++ P  G +++G T V I  SE
Sbjct  329  TLVPALNMRLWYATHLELPN-GLILKGATLVAIRPSE  364



>gb|EAY76237.1| hypothetical protein OsI_04173 [Oryza sativa Indica Group]
Length=353

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 138/303 (46%), Gaps = 19/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD V+LLIL +LED +SL RC  VSKRF+ L+P + +V   I    ++  ++    ++S
Sbjct  21   LPDPVVLLILNKLEDVRSLGRCAAVSKRFSGLVPLVSDVYVKIDRVVATDGDADDALNLS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                +    +F K +L  + KPFH +R + G               +A  + +  L+ F 
Sbjct  81   SAKPKNIFSHFFKLMLFTIVKPFHSMRNLNGTGR--------PLFPLAQHSPVHVLRNFS  132

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
            ++  L ++ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  133  DVWNLRVELPSGDVGTEEGVLLKWRAEYGSTLRNCVILGGTLVDRKPIGAEHESSVEDNG  192

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL      D  G G
Sbjct  193  ---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLRSLVLADADGQG  247

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             +Y+  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V+I  
Sbjct  248  TLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPG-GMTLQGATLVVIKP  306

Query  955  SED  963
            S D
Sbjct  307  SND  309



>ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays]
 gb|ACF78905.1| unknown [Zea mays]
 gb|ACF81071.1| unknown [Zea mays]
 gb|ACL52912.1| unknown [Zea mays]
 gb|ACR35595.1| unknown [Zea mays]
 gb|AFW78474.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW78475.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 88/307 (29%), Positives = 138/307 (45%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+P +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVPLVHDVYVKIDRVVAVDGDAEDA  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S         +F K +L  + KPFH +R        P+ +    F  ++  +  + L
Sbjct  77   LNLSSPKPRNIFSHFLKLMLFTIIKPFHNMRN-------PNGTGRSLFPQLSHHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  I+ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHIRNLRIELPSGDVGTEEGVLLKWRAEYGSTLQSCVILGGTRVDRKPVGGEHEQSL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ D H TL     TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIND-HSTLLSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V
Sbjct  245  DGQGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S D
Sbjct  304  AIKPSPD  310



>ref|XP_006355407.1| PREDICTED: F-box protein At5g46170-like [Solanum tuberosum]
Length=389

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 101/338 (30%), Positives = 156/338 (46%), Gaps = 46/338 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLLLI  ++ D K+L RC  V  RF SL+P + NV+  +    S   ++ S+
Sbjct  19   HFDQLPDPVLLLIFNKIGDVKTLGRCCGVCSRFHSLVPQVDNVVVRVDCVISDDDDASSS  78

Query  238  psisdnnGETQKNFPKNVLNLL--------SKPFHYLRQItggpslpspsstpAF-----  378
             S S ++     +  ++ ++ L         KPF  L Q+    S    +S+        
Sbjct  79   SSSSSSSSAASSDKSRHPISSLFRLVFLGLVKPFQSLTQLISISSRRCTASSSLVDDDFE  138

Query  379  -NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssss  549
             NSV   +  + LK F EI+ L I+ P       + +LLKW A  G     CV L +SS 
Sbjct  139  QNSVTHHSPTQVLKNFDEIKLLRIELPSGELGIDEGALLKWRADFGSTLDNCVILGASSV  198

Query  550  ssdnddfsdELLAE------------NGGGDLNN---PEAFALTNEMLRDRVEIAYQCFM  684
                     +L+ E            +G G+ +N   PE+F  TN  L+ RV       +
Sbjct  199  IQPVSIG--DLVEEQCGIGSNSNILGDGNGETDNGSIPESF-YTNGGLKLRVVWTISSLI  255

Query  685  EALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-  861
             A  R ++L+ ++A+H K LE    TD  G G + + +EQ   L++LR K P+   +A  
Sbjct  256  AASARHYLLQPIIAEHKK-LESLVLTDVDGQGVLCMNREQ---LEELRVK-PLSASSASK  310

Query  862  -----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                 A  M++W+   ++ P  G V++G T V I  SE
Sbjct  311  RTMVPALNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  347



>ref|XP_009625759.1| PREDICTED: F-box protein At5g46170-like [Nicotiana tomentosiformis]
Length=385

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 97/332 (29%), Positives = 154/332 (46%), Gaps = 38/332 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NVI  +    S      S+
Sbjct  19   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVIVRVDCVISDEDGGSSS  78

Query  238  psisdnnGETQKNFPKNVLNLL--------SKPFHYLRQItggpslpspsstpAF----N  381
               +   G    +  ++ ++ L         KP   L Q+    S  S  S+       N
Sbjct  79   SGATSAAGAGSTSKSRHPISSLLRFLFLGLVKPIQSLTQLISISSRRSAGSSLDDGYDQN  138

Query  382  SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd--------sifcvs  531
             V   +  + LK F EI+ L I+ P       + +LL+W A  G          +   V 
Sbjct  139  DVTHHSPTQVLKNFDEIKLLRIELPSGELGIDEGALLRWRADFGSTLDNCVILGASSVVH  198

Query  532  lfssssssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALWRR  702
              S +S ++N   +   +  +G G+L+N   PE+F  TN  L+ RV       + A  R 
Sbjct  199  PVSDTSINNNITNTSSNIVGDGNGELDNGSIPESF-YTNGGLKLRVVWTISSLIAASARH  257

Query  703  HVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------A  864
            ++L+ ++A+H K LE    TD  G G + + KEQ   L++LR K P+   +A       A
Sbjct  258  YLLQPIIAEHKK-LESLVLTDVDGQGVLCMNKEQ---LEELRVK-PLSASSASKRTMVPA  312

Query  865  GYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
              M++W+   ++ P  G V++G T V I  SE
Sbjct  313  LNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  343



>gb|ACG44263.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 88/307 (29%), Positives = 138/307 (45%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+P +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVPLVHDVYVKIDRVVAVDGDAEDA  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S         +F K +L  + KPFH +R        P+ +    F  ++  +  + L
Sbjct  77   LNLSSPKPRNIFSHFLKLMLFTIIKPFHNMRN-------PNGTGRSLFPQLSHHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  I+ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHIRNLRIELPSGDVGTEEGVLLKWRAEYGSTLQSCVILGGTRVDRKPVGGEHEQSL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ D H TL     TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIND-HPTLLSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V
Sbjct  245  DGQGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S D
Sbjct  304  AIKPSPD  310



>gb|KHG27594.1| hypothetical protein F383_11279 [Gossypium arboreum]
Length=411

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 100/346 (29%), Positives = 155/346 (45%), Gaps = 52/346 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +L L+  ++ D K+L RC +VS+RF SL+P + NV+  +    S    S S+
Sbjct  19   HFDRLPDSLLPLVFNKIGDVKALGRCCVVSRRFRSLVPQVENVVVRVDCVISDDDCSPSS  78

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQ--------ItggpslpspsstpAFNSVA  390
             S   +       N  + +L  + KPF  L Q        I    +    SS+ +    A
Sbjct  79   SSYDKSRAAGPISNLLRILLGGIVKPFQALVQFLGPKRPVINETLNTHPVSSSLSVGPGA  138

Query  391  FVNG-------------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifc  525
             VNG              + L+ F EI+ L I+ P       D  LLKW A  G     C
Sbjct  139  DVNGGEMEQGGVTHHSPTQVLRNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNC  198

Query  526  vslfssssssdnddfsdELLAEN-------------GGGDLNN--PEAFALTNEMLRDRV  660
            V L ++S + + +    E   +              G GD N   PE+F  TN  L+ RV
Sbjct  199  VILGAASVTKNVNLQVAECGNDGFCPNNNIANGLNVGNGDDNGSIPESF-YTNGGLKLRV  257

Query  661  EIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEP  840
                   + A  R ++L+ ++A+H KTL+    TD  G G + + ++Q   L++LR K P
Sbjct  258  VWTISSLIAASARHYLLQPIIAEH-KTLDSLVLTDSDGQGVLCMNRDQ---LEELRVK-P  312

Query  841  VDLRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +   +A       A  M++W+  +++ P  G V++G T V I  SE
Sbjct  313  LSASSASKRTLVPALNMRLWYAPQLELPD-GVVLKGATLVAIRPSE  357



>emb|CDX87738.1| BnaC02g32110D [Brassica napus]
Length=373

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 96/319 (30%), Positives = 150/319 (47%), Gaps = 25/319 (8%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+L R+ D KSL RC  VS+RF SL+P + NV+  +    S   NS  +
Sbjct  25   HFDRLPDSILLLVLNRIADVKSLGRCCAVSRRFHSLVPQVENVVVRVDCVISDDDNSSLS  84

Query  238  psisdnnGETQKNFPKN-VLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIR--  408
                 +   +  +   + V+  + KP   L Q+  G +  S +S+ + N      G++  
Sbjct  85   SVKPPSAASSSFSAVFSLVVGGIVKPLQALGQL-LGTNRSSSASSLSMNGEIEQGGVKHH  143

Query  409  ----FLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddf  570
                 L+ F EI+ L I+ P       +  LLKW A  G     CV L +SS    +   
Sbjct  144  SPTQVLRNFDEIRYLRIELPSGELGIDEGVLLKWRAEFGSTLDNCVILGASSVIQPSPME  203

Query  571  sdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTL  744
                L      + N   PE+F  TN  L+ RV       + A  R ++L+ ++++ HKTL
Sbjct  204  ISHTLEAPDASEDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIISE-HKTL  261

Query  745  EEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTP  906
            +    TD  G G + + K+Q   L++LR K P+   +A       A  M++W+   ++ P
Sbjct  262  KSLVLTDSDGQGVLCMNKDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPSLELP  317

Query  907  KTGRVMRGVTAVLIGVSED  963
              G V++G T V I  SE 
Sbjct  318  D-GTVLKGATLVAIRPSES  335



>ref|XP_009128847.1| PREDICTED: F-box protein At5g46170-like [Brassica rapa]
Length=371

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 96/316 (30%), Positives = 148/316 (47%), Gaps = 19/316 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+L R+ D KSL RC  VS+RF SL+P + NV+  +    S   NS  +
Sbjct  25   HFDRLPDSILLLVLNRIADVKSLGRCRAVSRRFHSLVPQVENVVVRVDCVISDDDNSSLS  84

Query  238  psisdnnGETQKNFPKN-VLNLLSKPFHYLRQItggpslpspsstpA---FNSVAFVNGI  405
                 +   +  +   + V+  + KP   L Q+ G  S  S  ST        V   +  
Sbjct  85   SIKPPSAASSSFSAVFSLVVGGIVKPLQALGQLLGTTSRSSSLSTSGEIEQGGVTHHSPT  144

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + L+ F EI+ L I+ P       +  LLKW A  G     CV L +SS    +     +
Sbjct  145  QVLRNFDEIRYLRIELPSGELGIDEGVLLKWRAEFGSTLDNCVILGASSVIQPSPMHISQ  204

Query  580  LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEA  753
             L      + N   PE+F  TN  L+ RV       + A  R ++L+ ++++ HKTL+  
Sbjct  205  TLEAPDASEDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIISE-HKTLKSL  262

Query  754  RFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-----AGYMKVWHVSEVQTPKTGR  918
              TD  G G + + K+Q   L++LR K  +   A++     A  M++W+   +  P  G 
Sbjct  263  VLTDSDGQGVLSMNKDQ---LEELRVKPLLASSASKRTLVPALNMRLWYAPSLVLPD-GT  318

Query  919  VMRGVTAVLIGVSEDD  966
            V++G T V I  SE +
Sbjct  319  VLKGATLVAIRPSESN  334



>ref|XP_010923814.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=401

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 99/323 (31%), Positives = 153/323 (47%), Gaps = 28/323 (9%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLLL+  R+ D K L RC +V +RF +L+P + +V+  +    S      S 
Sbjct  40   HFDRLPDSVLLLVFNRIGDVKVLGRCCVVCRRFQALVPVVDDVVVRVDCVISDDATPSSA  99

Query  238  psisdnnGETQ-----KNFPKNVLNLLSKPFHYLRQI------tggpslpspsstpAFNS  384
             + +   G  +      +  + VL+ L KP   L Q+          S  S +S+ + + 
Sbjct  100  AAAAGGCGPDKGRGVLSHLARLVLDGLVKPLQALGQMLISASGASRRSSASSASSSSSSE  159

Query  385  VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            V+  +    LK F+EI+RL I+ P       D  LLKW+A  G     CV L ++S  S 
Sbjct  160  VSHHSPTEVLKNFKEIRRLRIELPAGELGVDDGVLLKWKADFGSTLDSCVILGAASVLSY  219

Query  559  nddfsdELLAENGGGD--LNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH  732
            +    +  + +  GGD   + PE+F  TN  L+ RV       + A  R ++L+ ++ADH
Sbjct  220  DSSNPNPSIQDACGGDDSGSTPESF-YTNGSLKLRVVWTISSLIAASARHYLLQPIIADH  278

Query  733  HKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSE  894
              TLE    TD  G G + + + Q   LQ+L+ K PV            A  M++W+   
Sbjct  279  -GTLESLDLTDADGQGVLAMNRGQ---LQELQVK-PVSASGNSQRTLLPALSMRLWYAPH  333

Query  895  VQTPKTGRVMRGVTAVLIGVSED  963
            ++ P  G V++G T V I  SED
Sbjct  334  LELPD-GVVLKGATLVAIRPSED  355



>gb|ABK24885.1| unknown [Picea sitchensis]
 gb|ABR16398.1| unknown [Picea sitchensis]
Length=361

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 92/317 (29%), Positives = 141/317 (44%), Gaps = 34/317 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LP+ ++L+I  +L D K+L RC  VSKRF  L+P + +V+  +    SS  +   +
Sbjct  24   HFDRLPNSLVLVIFNKLGDIKALGRCSAVSKRFNCLVPQVEDVVVKVDCVISSEESGSLS  83

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
                   G     F K V+  + KP   L+QI         +       V+  +    LK
Sbjct  84   GRSRGFIGL----FVKLVIGSIVKPLQALQQI-------LGTKKVVLAEVSHHSPGEVLK  132

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss------------sss  555
             F+EIQ L I+ P      +D  LL+W A  G     CV L S+S            S+ 
Sbjct  133  NFKEIQNLRIELPGGELGVEDGVLLRWRAEFGSTLESCVILGSTSYFCEKNSRKNPRSAI  192

Query  556  dnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH  735
               +  +E L +NG    N PE+F  T+  L+ RV       + A  R ++L+ +++D H
Sbjct  193  QRTEEFNEGLDDNG----NIPESF-YTDGGLKLRVVWTISSLIAASARHYLLQQIISD-H  246

Query  736  KTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPK  909
             TL+    TD  G G + + K Q+   +D  L A          A  MK+W+   ++ P+
Sbjct  247  PTLQNLVLTDADGQGMLCMGKAQLREFRDKPLAASATASRTQVPALNMKLWYAPYLELPE  306

Query  910  TGRVMRGVTAVLIGVSE  960
             G  M G T V I  S+
Sbjct  307  GGG-MEGATLVSIRPSD  322



>ref|XP_010538543.1| PREDICTED: F-box protein At5g46170-like [Tarenaya hassleriana]
Length=378

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 98/326 (30%), Positives = 146/326 (45%), Gaps = 35/326 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VSKRF SL+P + NV+  +    S   +S  +
Sbjct  24   HFDRLPDAILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVDNVVVRVDCVISDDDSSSPS  83

Query  238  -----psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsst-----------  369
                    +   G     F + V   + KP   L Q  G     + +S+           
Sbjct  84   SDKRRSVTAVAAGPVSAIF-RLVFGGIVKPIQALGQFLGTKRSCATASSSSLSISGDDDG  142

Query  370  -pAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfs  540
              A   V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +
Sbjct  143  EIAQGGVTHHSPTQVLKNFNEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGA  202

Query  541  sssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
            SS    N D + +       G +  PE+F  TN  L+ RV       + A  R ++L+ +
Sbjct  203  SSVIHTNPDTAIDPSGAEDNGSI--PESF-YTNGGLKLRVVWTISSLIAASARHYLLQPI  259

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVW  882
            +A+H KTL     TD  G G + + K+Q   L++LR K P+   +A       A  M++W
Sbjct  260  IAEH-KTLGNLLLTDADGQGVLCMNKDQ---LEELRIK-PLSASSASKRTLVPALNMRLW  314

Query  883  HVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +   ++ P  G V+ G T V I  SE
Sbjct  315  YAPHLELPD-GTVLNGATLVAIRPSE  339



>ref|XP_010922958.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922959.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922960.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922961.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010922962.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 88/298 (30%), Positives = 133/298 (45%), Gaps = 18/298 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLIL ++ D +SL RC  VSKRF SLIP +H+V   I    +   +     + S
Sbjct  21   IPDSLVLLILNKIADVRSLGRCSAVSKRFNSLIPLVHDVYVKIDRVVTVDGDYDDAFNPS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K ++  L KPFH+LR   GG           F  ++  +  + LK F 
Sbjct  81   SPKARNLFSHFLKLLIFTLLKPFHHLRNTHGGNKPL-------FPQLSHHSPAQVLKNFS  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I  L I+ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  134  HIHNLRIELPAGDVGTEEGVLLKWRAEFGSTLQNCVILGGTWVDRKPASTEHETRLEDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ D H TL+    TD  G G
Sbjct  194  ---SIPESF-YTNGGLKLRVVWTISSLIAASIRHYLLRPIIKD-HPTLKSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I
Sbjct  249  TLSMGVEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELPG-GMGLQGATLVAI  305



>emb|CDY43956.1| BnaA02g24340D [Brassica napus]
Length=373

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 97/316 (31%), Positives = 147/316 (47%), Gaps = 19/316 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLLL+L R+ D KSL RC  VS+RF SL+P + NV+  +    S   NS  +
Sbjct  27   HFDRLPDSVLLLVLNRIADVKSLGRCRAVSRRFHSLVPQVENVVVRVDCVISDDDNSSLS  86

Query  238  psisdnnGETQKNFPKN-VLNLLSKPFHYLRQItggpslpspsstpA---FNSVAFVNGI  405
                 +   +  +   + V+  + KP   L Q+ G  S  S  ST        V   +  
Sbjct  87   SIKPPSAASSSFSAVFSLVVGGIVKPLQALGQLLGTTSRSSSLSTSGEIEQGGVTHHSPT  146

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + L+ F EI  L I+ P       +  LLKW A  G     CV L +SS    +     +
Sbjct  147  QVLRNFDEILYLRIELPSGELGIDEGVLLKWRAEFGSTLDNCVILGASSVIQPSPMHISQ  206

Query  580  LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEA  753
             L      + N   PE+F  TN  L+ RV       + A  R ++L+ ++++ HKTL+  
Sbjct  207  TLEAPDASEDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIISE-HKTLKSL  264

Query  754  RFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-----AGYMKVWHVSEVQTPKTGR  918
              TD  G G + + K+Q   L++LR K  +   A++     A  M++W+   +  P  G 
Sbjct  265  VLTDSDGQGVLSMNKDQ---LEELRVKPLLASSASKRTLVPALNMRLWYAPSLVLPD-GT  320

Query  919  VMRGVTAVLIGVSEDD  966
            V++G T V I  SE +
Sbjct  321  VLKGATLVAIRPSESN  336



>ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=352

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 138/304 (45%), Gaps = 18/304 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++L+IL  +ED +SL RC  VSKRF  L+P +H+V   I    +   ++    ++S
Sbjct  21   LPDSLVLVILNNVEDVRSLGRCSAVSKRFYGLVPLVHDVYVKIDRVVTVDGDAEDMLNLS  80

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH +R        P+ +  P F  +A  +  + L  F 
Sbjct  81   APKPRNILSHFLKMMLFTIIKPFHGMRG-------PNGAGRPLFPQLAQHSPAQVLHNFT  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L I+ P      +D  LLKW A  G     CV L  +           EL +E+ G
Sbjct  134  HIRSLRIELPSGDVGTEDGVLLKWRAEYGSTLQNCVILGGTQVDRKPVGAEHELYSEDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL     TD  G G
Sbjct  194  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLTSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I  
Sbjct  249  TLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GIALQGATLVAIKP  307

Query  955  SEDD  966
            S  +
Sbjct  308  STSN  311



>ref|XP_010538256.1| PREDICTED: F-box protein At1g30200-like [Tarenaya hassleriana]
Length=384

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 96/325 (30%), Positives = 153/325 (47%), Gaps = 31/325 (10%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LL+L ++ D K L RC LVS+RF SL+P   NV+  +    S   +S + 
Sbjct  28   HFDRLPDSLILLVLEKIADVKVLGRCCLVSRRFHSLVPLAENVLVCVDCVISDDDSSSAE  87

Query  238  psisdnnGE-----TQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS------  384
               S   G+     +     + V   + KPF  L Q  G       SS+   ++      
Sbjct  88   DPGSSAFGDAVVGGSLSALFRVVFGPIFKPFQALGQFLGPKRSYLRSSSFGEDNGRGEIE  147

Query  385  ---VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssss  549
               V   +  + L+ F +I+ L I+ P       D  LLKW A  G     CV L +SS 
Sbjct  148  QGEVTHHSPTQVLRNFNKIRFLRIELPSGELGIDDGVLLKWRADFGSTLENCVILGASSV  207

Query  550  ssdnddfsdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVV  723
            +  N   + E  A++   D N   PE+F  TN  L+ RV       + A  R ++L+ ++
Sbjct  208  TRANPAGNHENSADSASIDDNGNIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPII  266

Query  724  ADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWH  885
             +H KTL+    +D  G G + + + Q   L++LR K P+ + +A       A  M++W+
Sbjct  267  REH-KTLDRLVLSDADGQGVLSMNRGQ---LEELRVK-PLSISSASKRTLVPALNMRLWY  321

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSE  960
              +++ P  G V++G T V+I  SE
Sbjct  322  APQLELPD-GMVLKGATLVVIRPSE  345



>ref|XP_001770045.1| predicted protein [Physcomitrella patens]
 gb|EDQ65221.1| predicted protein [Physcomitrella patens]
Length=348

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 140/319 (44%), Gaps = 33/319 (10%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL+I  ++ D K L RC  VSKRF SL P + NV+  +    S   N  + 
Sbjct  6    HFDRLPDSLLLVIFNKVADIKVLGRCCAVSKRFHSLAPLVDNVVVKVDCVISGEENGLNA  65

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
                        +F + V+  L KP   L  + G               V+  +    LK
Sbjct  66   RGRGII-----SHFVRFVVGTLVKPLQALTHLLGPKKTI-------LAEVSHHSPSEVLK  113

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssss------dnddfs  573
             F+EIQ L I+ P      +D  LLKW A  G     CV L ++S           DD +
Sbjct  114  NFKEIQNLRIELPGGELGIEDGVLLKWRAEFGSTLESCVILGAASLGVRPWFLNGRDDGA  173

Query  574  dELLAENGGGDLNN--------PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVAD  729
             ++ AE+     +N        PE+F  T+  L+ RV       + A  R ++L+ +++D
Sbjct  174  SQVAAEDNSETPSNLVDESGTIPESF-YTDGGLKVRVVWTISSLIAASARHYLLQQIISD  232

Query  730  HHKTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQT  903
            H  TLE    TD  G G + + KEQ+   +D  L A    +     A  MK+W+   ++ 
Sbjct  233  H-PTLESLVLTDADGQGMLCMNKEQLREFRDKPLAASASSNRTQVPALNMKLWYAPYLEL  291

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P+ G  ++G T V I  SE
Sbjct  292  PE-GTGLKGATLVAIRPSE  309



>dbj|BAB90386.1| P0432B10.4 [Oryza sativa Japonica Group]
Length=451

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 86/303 (28%), Positives = 138/303 (46%), Gaps = 19/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD V+LLIL +LED +SL RC  VSKRF+ L+P + +V   I    ++  ++    ++S
Sbjct  113  LPDPVVLLILNKLEDVRSLGRCAAVSKRFSGLVPLVSDVYVKIDRVVATDGDADDALNLS  172

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                +    +F K +L  + KPFH +R + G               +A  + +  L+ F 
Sbjct  173  SAKPKNIFSHFFKLMLFTIVKPFHSMRNLNGTGR--------PLFPLAQHSPVHVLRNFS  224

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
            ++  L ++ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  225  DVWNLRVELPSGDVGTEEGVLLKWRAEYGSTLRNCVILGGTLVDRKPIGAEHESSVEDNG  284

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL      D  G G
Sbjct  285  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLRSLVLADADGQG  339

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             +Y+  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V+I  
Sbjct  340  TLYMGMEQLREFRENKLSASACSNRTQVPACNMKLKYAPYLELPG-GMTLQGATLVVIKP  398

Query  955  SED  963
            S D
Sbjct  399  SND  401



>gb|EPS70457.1| hypothetical protein M569_04296 [Genlisea aurea]
Length=381

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 101/330 (31%), Positives = 154/330 (47%), Gaps = 38/330 (12%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H+  LPD ++LLI  ++ D K+L RC +VS+RF SL+P + +VI  +    S    S ++
Sbjct  19   HLDRLPDSLILLIFNKIGDVKALGRCCVVSRRFHSLVPQVDHVIVRVDCVISDDEPSATS  78

Query  238  psisdnnGETQKN-FPKNVL-----NLLSKPFHYLRQItggpslpspsstpAFNSVAFVN  399
             S + +     K+  P + L     + + KP   L QI          S   FN  A  N
Sbjct  79   SSSASSASAAHKSRHPISSLFRIFFSGIFKPLQSLSQIIAPSHRRLSLSEE-FNVEADQN  137

Query  400  GI------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssss  555
             +      + LK F EI+ L I+ P       +  LLKW+A  G     C  L +SS  +
Sbjct  138  IVTHHSPTQVLKNFNEIKVLRIELPGGELGIDEGVLLKWKANFGSTLDNCAILGASSIVN  197

Query  556  dnddfsdELLAEN---------GGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHV  708
             +D    E   +N         G  D N PE+F  TN  L+ RV       + A  R ++
Sbjct  198  ISDKNC-EFAGDNDYANSNTNAGESDGNIPESF-YTNGGLKLRVVWTISSLIAASARHYL  255

Query  709  LRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGY  870
            L+ ++++H KTLE    TD  G G + + +EQ   L++LR K P+    A       A  
Sbjct  256  LQSIISEH-KTLESLVLTDLDGQGVLSMNREQ---LEELRVK-PLSASLASKRTLVPALN  310

Query  871  MKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            M++W+   ++ P  G V++G T V I  SE
Sbjct  311  MRLWYAPHLELPN-GIVLKGATLVAIRPSE  339



>gb|EYU46210.1| hypothetical protein MIMGU_mgv1a008386mg [Erythranthe guttata]
Length=375

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 82/308 (27%), Positives = 144/308 (47%), Gaps = 35/308 (11%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPDEV+L I  +L+DA+SLC      KRF S+ P +  +   +P    S I         
Sbjct  24   LPDEVVLSIFEKLQDARSLCLSMAACKRFRSIAPQVGEIFLPVPHQKKSAIKESDL----  79

Query  250  dnnGETQKNFPKN-VLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                +T + F +N V+  L KP++++ QI    S    ++   F S    N I  LK F 
Sbjct  80   ----QTPRGFFRNLVIKALMKPYNFISQIVRFKSKSDDNNDLDFYSYYVPNEI--LKSFE  133

Query  427  EIQRLEIQTPCFHAQD----------PSLLKWEAGLGKdsifcvslfssssssdnddfsd  576
            EI+ L ++ PC   Q            + LKW+A  G++   CV L + S +        
Sbjct  134  EIRALHLRLPCHGNQKHGSKRNVRNPATFLKWKAEFGRELHSCVILGAKSWTEKP-----  188

Query  577  ELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEAR  756
              L E      +  E+  ++++ L+ R+     C + A  R ++++  V    K++    
Sbjct  189  --LKEENSTASDQEESRFMSDDDLKIRIVWTISCLIAASARHYLIQETVKT-QKSIANVV  245

Query  757  FTDQKGNGKVYLRKEQVANLQDLRAK---EPVDLRA-AEAGYMKVWHVSEVQTPKTGRVM  924
             +D+   G++ + +EQ+   ++L+A    E  + R+   A  MK+W++  ++   +G+VM
Sbjct  246  VSDETDQGRLCMNREQIEETRELKANRSGEVSEYRSRVPALRMKMWYLERLEL--SGKVM  303

Query  925  RGVTAVLI  948
             G T V+I
Sbjct  304  EGATLVVI  311



>ref|NP_193573.1| F-box protein [Arabidopsis thaliana]
 ref|NP_001190761.1| F-box protein [Arabidopsis thaliana]
 sp|O49508.1|FB237_ARATH RecName: Full=F-box protein At4g18380 [Arabidopsis thaliana]
 emb|CAA16718.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78840.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABL66803.1| At4g18380 [Arabidopsis thaliana]
 gb|AEE84037.1| F-box protein [Arabidopsis thaliana]
 gb|AEE84038.1| F-box protein [Arabidopsis thaliana]
Length=380

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 96/327 (29%), Positives = 143/327 (44%), Gaps = 35/327 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H  +LPD +LLLI   + D K+L RC +VSKRF SLIP + NV   +    S   +S   
Sbjct  24   HFDNLPDSILLLIFNNIGDVKALGRCSVVSKRFHSLIPQVENVFVRVDCVISDDDSSSLL  83

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG-----  402
                 +           +  L+ KP   L Q        S  S  + +S+    G     
Sbjct  84   SDKPRSASAASPF--SAIFRLVFKPLQALGQFLKRSGSSSLPSGSSPSSLLISGGDDGEI  141

Query  403  ----------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                       + LK F EI+ L+I+ P       D  LLKW A  G     CV L +SS
Sbjct  142  EQGGVTHHSPTQVLKNFDEIKFLKIELPSGELGIDDGVLLKWRAEFGSTLENCVILGASS  201

Query  547  sssdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRH  717
                 +    E  +       +N   PE+F  TN  L+ RV       + A  R ++L+ 
Sbjct  202  VIPPTNSDKTEASSAPVAAVEDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQP  260

Query  718  VVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKV  879
            ++A+H KTL+    TD  G G + + ++Q   L++LR K P+   +A       A  M++
Sbjct  261  IIAEH-KTLDSLVLTDVDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRL  315

Query  880  WHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            W+   ++ P  G V++G T V I  SE
Sbjct  316  WYAPSLELPD-GTVLKGATLVAIRPSE  341



>gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sativa Japonica 
Group]
 gb|EAY98512.1| hypothetical protein OsI_20423 [Oryza sativa Indica Group]
 dbj|BAG92711.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64186.1| hypothetical protein OsJ_19018 [Oryza sativa Japonica Group]
Length=351

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 87/303 (29%), Positives = 138/303 (46%), Gaps = 18/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++L+IL  +ED +SL RC  VSKRF  L+P +H+V   I    +    +    ++S
Sbjct  18   LPDSLVLVILNNVEDVRSLGRCSAVSKRFYGLVPLVHDVYVKIDRVVTVDGEAEDALNLS  77

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH +R        P+ +  P F  +A  +  + L+ F 
Sbjct  78   SPKPRNILSHFLKMMLFTIIKPFHSMRG-------PNGAGRPLFPQLAQHSPAQVLRNFT  130

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L ++ P      ++  LLKW A  G     CV L  +           EL +E+ G
Sbjct  131  HIRNLRVELPSGDVGTEEGVLLKWRAEYGSTLQNCVILGGTQVDRKPVGAEHELYSEDNG  190

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL     TD  G G
Sbjct  191  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLTSLVLTDADGQG  245

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I  
Sbjct  246  TLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GIALQGATLVAIKP  304

Query  955  SED  963
            S +
Sbjct  305  SPE  307



>gb|KHG16115.1| hypothetical protein F383_22310 [Gossypium arboreum]
Length=432

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 98/339 (29%), Positives = 151/339 (45%), Gaps = 45/339 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  ++ D K+L RC LVS+RF SL+P + NV+  +    S   +S S+
Sbjct  19   HFDRLPDSLLLLIFNKIGDVKALGRCCLVSRRFHSLVPQVENVLVRVDCVISDDDSSPSS  78

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFV------  396
             S   +       N  + V   + KP   L Q  G        +  A ++ + V      
Sbjct  79   SSSDKSCPAGPFSNLLRLVFGGIVKPLQALGQFLGPKRSLLDETLSAPSTSSSVGRAADD  138

Query  397  -------------NGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                         +  + L+ F EI+ L I+ P       D  LLKW A  G     C+ 
Sbjct  139  DDPEMGQTGVTHHSPTQVLRNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCII  198

Query  532  lfssssssdnddfsdELLAE--------NGGGDLNN--PEAFALTNEMLRDRVEIAYQCF  681
            L ++S  +D      E   +         G GD N   PE+F  TN  L+ RV       
Sbjct  199  LGAASVINDVHSQVPEYGNDGFCSNNCITGNGDDNGSIPESF-YTNGGLKLRVVWTISSL  257

Query  682  MEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE  861
            + A  R ++L+ ++A+H +TL+    TD  G G + + +EQ   L++LR K P+   +A 
Sbjct  258  IAASARHYLLQPIIAEH-RTLDTLVLTDADGQGVLRMNREQ---LEELRVK-PLSASSAS  312

Query  862  ------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                  A  M++W+   ++ P  G V++G T V I  SE
Sbjct  313  KRTQVPALNMRLWYAPHLELPN-GVVLKGATLVAIRPSE  350



>ref|XP_004970320.1| PREDICTED: F-box protein At1g30200-like [Setaria italica]
Length=354

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 83/305 (27%), Positives = 143/305 (47%), Gaps = 32/305 (10%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL +LED +SL RC  VS+RF+ L+P +H+V   I    +   +S    ++S
Sbjct  21   LPDSLVLLILNKLEDVRSLGRCSAVSRRFSCLVPLVHDVCVKIDRVVTVDGDSDDALNLS  80

Query  250  dnnGETQKNFPKNVLNLL--------SKPFHYLRQItggpslpspsstpAFNSVAFVNGI  405
                      P+N+L+ L        +KPFH +R        P+    P F  ++  +  
Sbjct  81   SPK-------PQNILSHLFKLMLFAITKPFHDIRN-------PNGVGRPLFPQLSQHSPA  126

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F +++ L ++ P      ++  LL W A  G     CV L  +  +        E
Sbjct  127  QVLKNFSDVRNLRVELPSGDVGIEEGVLLNWRAEYGSTLQNCVILGGTLLNHKAVGNEHE  186

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
              +++ G   + PE+F  TN  L+ R+     C + A  R ++LR ++ +HH TL     
Sbjct  187  PSSDDNG---SMPESF-YTNGGLKLRIVWTISCLIAASTRHYLLRSII-NHHPTLRSLVL  241

Query  760  TDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGV  933
             D  G G + +  EQ+ + ++  L A    +     A  MK+ +   ++ P  G  ++G 
Sbjct  242  ADADGQGALCMGAEQLKDFREHQLSASACSNRTQVPACNMKLNYAPYLELPG-GLALQGA  300

Query  934  TAVLI  948
            T ++I
Sbjct  301  TLLVI  305



>emb|CBI24218.3| unnamed protein product [Vitis vinifera]
Length=342

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 139/317 (44%), Gaps = 54/317 (17%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   L DE+L LI  ++ DA+SLCRC  VSKRFASLIP +  V+ +IP P S P      
Sbjct  10   HFDGLSDELLSLIFSKVLDAESLCRCSAVSKRFASLIPLVDAVLLTIPPPKSKPNRGLFL  69

Query  238  psisdnnGETQKNFPKN--VLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVN----  399
                        NF  +  V N ++K   +L QI               +SV+F +    
Sbjct  70   ------------NFGNSLQVTNFIAKLLQFLHQIVLPQ-----------SSVSFHSNEGS  106

Query  400  ----GIRFLKKFREIQRLEIQTPCFHAQ-----DPSLLKWEAGLGKdsifcvslfss---  543
                    LK F  I  L IQ P    +       SLLKWEA  G++   CV L ++   
Sbjct  107  IHHFSSEVLKNFSHITSLHIQLPSHGGELGANGTGSLLKWEAEFGRELESCVVLGATYFE  166

Query  544  -ssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
             S+         + L E+           +L  + L+ RV     C   A  R  +L+ +
Sbjct  167  RSNKISRIPKRQDRLHES-----------SLATDELKLRVAWMISCLFAASARHCLLKQI  215

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQD-LRAKEPVDLRAAEAGYMKVWHVSEV  897
            +AD+   L      D    G++ + ++Q   L+  +  + P++     A  +K+W+V  +
Sbjct  216  IADNPMMLRSLVIEDGSKQGRLRMGEDQFKELRKCVNTRPPLERTKLPAICIKLWYVPLL  275

Query  898  QTPKTGRVMRGVTAVLI  948
            + P +G VM+G T ++I
Sbjct  276  ELPASGCVMKGATLIVI  292



>ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
 gb|EES19721.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor]
Length=354

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 87/307 (28%), Positives = 139/307 (45%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+P +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVPLVHDVYVKIDRVVAVDGDAEDT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S         +F K +L  + KPFH +R        P+ +  P F  ++  +  + L
Sbjct  77   LNLSSPKPRNIFSHFLKLMLLTIIKPFHSMRN-------PNGTGRPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLQNCVILGGTRVDRKPVGGEHEPSL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ D H TL     TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIND-HPTLRSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V
Sbjct  245  DGQGTLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>ref|XP_009758227.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=396

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 152/343 (44%), Gaps = 49/343 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NVI  +    S      S+
Sbjct  19   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVIVRVDCVISDEDGGSSS  78

Query  238  psisdnnGETQKNFPKNVLNLL--------SKPFHYLRQItggpslpspsstp----AFN  381
               +   G    N  ++ ++ L         KP   L Q+    S  S  S+       N
Sbjct  79   SGATSAAGAGSTNKSRHPISSLLRFLFLGLVKPIQSLTQLISISSRRSAGSSLDDGYEQN  138

Query  382  SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsssss-  552
             V   +  + LK F EI+ L I+ P       + +LL+W A  G     CV L +SS   
Sbjct  139  DVTHHSPTQVLKNFDEIKVLRIELPSGELGIDEGALLRWRADFGSTLDNCVILGASSVIH  198

Query  553  ------------------sdnddfsdELLAENGGGDLNN---PEAFALTNEMLRDRVEIA  669
                                N   S   +  +  G+L+N   PE+F  TN  L+ RV   
Sbjct  199  PVSNSSINSNITNSSSNIVGNIANSSSNIVGDSNGELDNGSIPESF-YTNGGLKLRVVWT  257

Query  670  YQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDL  849
                + A  R ++L+ ++A+H K LE    TD  G G + + KEQ   L++LR K P+  
Sbjct  258  ISSLIAASARHYLLQPIIAEHKK-LESLVLTDVDGQGVLCMNKEQ---LEELRVK-PLSA  312

Query  850  RAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
             +A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  313  SSASKRTMVPALNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  354



>ref|XP_002313372.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
 gb|EEE87327.1| hypothetical protein POPTR_0009s05230g [Populus trichocarpa]
Length=361

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 81/310 (26%), Positives = 144/310 (46%), Gaps = 36/310 (12%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD +LL+I  ++ DAKSL RC  VSKRFASL+     V  SIP    +P          
Sbjct  31   LPDALLLVIFNKVGDAKSLTRCISVSKRFASLVFEADTVFLSIPPRKHNPKADNR-----  85

Query  250  dnnGETQKNFPKNVLN-LLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                  ++N  K +++ L++KP H+  +     S           +V+F +    LK F+
Sbjct  86   ----SLRRNLFKILISTLIAKPLHFFHRFIADRSDTDR------KTVSFYSPKEVLKHFQ  135

Query  427  EIQRLEIQTPCFHAQ-----DPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
            + + + ++ P          + SL+KW+A  G +    V L ++S        S +  +E
Sbjct  136  QAKTMHMELPSDGGMTGLEGNDSLIKWKARFGSEIKNFVILSATSFQKRMQPLSSDEFSE  195

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            N G          LT+  ++ ++     C + A  R ++++ V+ +HH  LE    +D  
Sbjct  196  NNGE--------VLTDGQMKLQIVQTIYCLLAASARHYLMKQVLEEHH-ALENIIASDVC  246

Query  772  GNGKVYLRKEQVA----NLQDLRAKEPVDLRAAEAG--YMKVWHVSEVQTPKTGRVMRGV  933
              G+V + K++VA    +++ + A     L         MK+W+V  ++ P+ G +MRG 
Sbjct  247  KQGRVCMGKDEVAEIRNSMKSMVASTDSSLERTRVPDLSMKLWYVPVLELPENGYIMRGA  306

Query  934  TAVLIGVSED  963
            T  ++  ++D
Sbjct  307  TLAVLRPNDD  316



>ref|XP_010046705.1| PREDICTED: F-box protein At4g18380-like [Eucalyptus grandis]
Length=403

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 94/328 (29%), Positives = 146/328 (45%), Gaps = 34/328 (10%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD++LL IL R+ DA+SL RC  VSKR +SL+P    V  S P P   P +S S     
Sbjct  24   LPDDLLLHILDRVHDARSLARCLAVSKRLSSLVPLTPTVSLSFPRPRLLPASSESESESE  83

Query  250  dnnGETQKNFPKNVLN-LLSKPFHYLRQItggpslpspsstpA--------FNSVAFVNG  402
                  +  F   +++  +  P  +L ++    S                 ++S      
Sbjct  84   PGRWRRRSGFLSRLVDRFVRGPLRFLHRVASAKSASRSGGGGDDDCDCDCDYDSRPAPGE  143

Query  403  IRFLKKFREIQRLEIQTP-CFHA----QDPSLLKWEAGLGKdsifcvslfssssssdndd  567
            +  LK FR I+ L ++ P C  A       ++L+W A  G +   CV L ++S     D 
Sbjct  144  V--LKPFRGIESLRVELPSCVDAVGLNGKRTVLRWTARFGGEMKSCVVLGANSLRRREDG  201

Query  568  fsdELLAENGGGDLNNPEAF---------ALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
             +     E G  +L  P A           +  E L+ RV     C + A  R ++LR +
Sbjct  202  AAAS--GEEGALELR-PRAVEEVELEPGPVIAEEELKLRVVWIISCLIAASARHYLLRQI  258

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAEAGY-----MKVWH  885
            VADH   L+     D    GKV + +E++A ++     E  D  +AE        MK+W+
Sbjct  259  VADH-PMLKSVAIVDSDKQGKVRMLEEEIAEMRRSFDSEAADSSSAERIRVPDLRMKLWY  317

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSEDDD  969
              E++ P++G VMRG T VLI  + + +
Sbjct  318  APELELPESGYVMRGATMVLIAPASEAE  345



>ref|XP_007025034.1| F-box family protein [Theobroma cacao]
 gb|EOY27656.1| F-box family protein [Theobroma cacao]
Length=397

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 97/346 (28%), Positives = 149/346 (43%), Gaps = 54/346 (16%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H+  LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S    S S+
Sbjct  19   HVDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDDCSSSS  78

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG----  402
             S   +       N  + V   + KP   L Q  G        +    +S +   G    
Sbjct  79   SSSDKSRATGPFSNLFRLVFGGIVKPLQALGQFLGPKRPTLNETLNTPSSSSLSVGPGGD  138

Query  403  ---------------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                            + L+ F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  139  DDGEMDQGGVTHHSPTQVLRNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVI  198

Query  532  lfssssssdnddfsdELLAENGGGDLNN-----------------PEAFALTNEMLRDRV  660
            L ++S  ++      E    N G  +NN                 PE+F  TN  L+ RV
Sbjct  199  LGAASVINNVHLQVSEY--GNDGFCINNNITSGSNVGNSDDNGSIPESF-YTNGGLKLRV  255

Query  661  EIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEP  840
                   + A  R ++L+ ++AD HKTL+    TD  G G + + ++Q   L++LR K P
Sbjct  256  VWTISSLIAASARHYLLQPIIAD-HKTLDSLVLTDADGQGVLCMNRDQ---LEELRVK-P  310

Query  841  VDLRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +   +A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  311  LSASSASKRTLVPALNMRLWYAPYLELPD-GVVLKGATLVAIRPSE  355



>ref|XP_008786757.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
 ref|XP_008786758.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 86/298 (29%), Positives = 135/298 (45%), Gaps = 18/298 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLIL ++ D +SL RC  VSKRF +L+P +H+V   I    +   +S    + S
Sbjct  21   IPDSLVLLILNKIADVRSLGRCSAVSKRFNALVPLVHDVYVKIDRVVTVDGDSDDALNPS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K ++  L KP H+LR   GG           F  ++  +  + LK F 
Sbjct  81   SLRPRNLFSHFLKLMIFTLLKPIHHLRSTNGGNKPL-------FPQLSHHSPAQVLKNFI  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L I+ P      ++  LLKW A  G     CV L  +           E+  ++ G
Sbjct  134  HIRNLRIELPAGDVGIEEGVLLKWRAEFGSTLQNCVILGGTWVDRKPASAEQEIALDDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R H+LR ++ DH  TL+    TD  G G
Sbjct  194  ---SIPESF-YTNGGLKLRVVWTINSLIAASTRHHLLRPIIKDH-PTLKSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I
Sbjct  249  TLSMGVEQLKEFREKSLAASASSNRTQVPASSMKLRYAPYLELPG-GMGLQGATLVAI  305



>ref|XP_003568140.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=420

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 99/360 (28%), Positives = 155/360 (43%), Gaps = 54/360 (15%)
 Frame = +1

Query  25   EHRNSSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipd  204
            EHR S+ +       LPD +LL+I  R+ D K+L RC LVS+RF +L+P + +V+  +  
Sbjct  21   EHRLSAAAGEDRFDGLPDPLLLVIFNRIGDVKALGRCSLVSRRFHALVPLVDSVLVRVDC  80

Query  205  pdsspinsysnpsisdnnGETQKNFP------KNVLNLLS--------KPFHYLRQItg-  339
                  +S    + + +   +  + P      +NV++ ++        KP   L QI   
Sbjct  81   VIPDDASSAGAAAAAGDFSLSAPSSPTASARARNVVSQIARMVIGGIVKPIQALGQILSH  140

Query  340  ---------------gpslpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQTP-CFHAQ  471
                                   S+P    V+  +    L+ F+E++RL I+ P C H  
Sbjct  141  GNSDSDFPASSSSASRRFASLSPSSPPSGDVSHHSPSEVLRSFKELRRLRIELPACEHGM  200

Query  472  DPS-LLKWEAGLGKdsif-------cvslfssssssdnddfsdELLAENGGGDLNN--PE  621
            D   LLKW+A  G              S  S+         +    A+ G  D +   PE
Sbjct  201  DDGVLLKWKADFGSTLGSCVILGAASASPSSAGKDGAGTAAAAAAAADCGESDESGSIPE  260

Query  622  AFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKE  801
            +F  TN  L+ RV       + A  R ++L+ +++D HKTLE    TD  G G + + K 
Sbjct  261  SF-YTNGGLKLRVVWTISSLIAASARHYLLQPIISD-HKTLESLDLTDADGQGVLTMDKW  318

Query  802  QVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSED  963
            Q   LQ+LR + PV            A  M++W+   ++ P  G V+ G T V I  SED
Sbjct  319  Q---LQELRVR-PVSASDGSHRTLMPALSMRLWYAPHIELPG-GTVLNGATLVAIKPSED  373



>ref|NP_001055899.2| Os05g0490300 [Oryza sativa Japonica Group]
 dbj|BAF17813.2| Os05g0490300, partial [Oryza sativa Japonica Group]
Length=450

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 87/303 (29%), Positives = 138/303 (46%), Gaps = 18/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++L+IL  +ED +SL RC  VSKRF  L+P +H+V   I    +    +    ++S
Sbjct  117  LPDSLVLVILNNVEDVRSLGRCSAVSKRFYGLVPLVHDVYVKIDRVVTVDGEAEDALNLS  176

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH +R        P+ +  P F  +A  +  + L+ F 
Sbjct  177  SPKPRNILSHFLKMMLFTIIKPFHSMRG-------PNGAGRPLFPQLAQHSPAQVLRNFT  229

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L ++ P      ++  LLKW A  G     CV L  +           EL +E+ G
Sbjct  230  HIRNLRVELPSGDVGTEEGVLLKWRAEYGSTLQNCVILGGTQVDRKPVGAEHELYSEDNG  289

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL     TD  G G
Sbjct  290  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLTSLVLTDADGQG  344

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I  
Sbjct  345  TLSMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GIALQGATLVAIKP  403

Query  955  SED  963
            S +
Sbjct  404  SPE  406



>ref|XP_008225507.1| PREDICTED: F-box protein At5g46170-like [Prunus mume]
Length=402

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 152/337 (45%), Gaps = 47/337 (14%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S S+ S S
Sbjct  29   LPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDESSPSSASSS  88

Query  250  dnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAF--------------  378
             ++ +++  F    + VL  + KP   L Q  G     +  S  A               
Sbjct  89   SSSDKSRTPFSALFRLVLGGIVKPLQALGQFLGPTRRSTNGSHSALAVDDPDSSAADSSS  148

Query  379  ---NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfss  543
               + V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +S
Sbjct  149  FDQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAS  208

Query  544  ssssdnddfsdELLAENGGGDLNN------------PEAFALTNEMLRDRVEIAYQCFME  687
            S          ++      G   N            P++F  TN  L+ RV       + 
Sbjct  209  SVIHPGPTKFSDVQDNGSDGFYANTNGAVSDDNGSIPDSF-YTNGGLKLRVVWTISSLIA  267

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++++H KTL+    TD  G G +Y+ ++Q   L++LR K P+   +A   
Sbjct  268  ASARHYLLQPIISEH-KTLDSLVLTDADGQGVLYMNRDQ---LEELRVK-PLSASSASKR  322

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+   ++ P  G V++G T V I  SE
Sbjct  323  TLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSE  358



>ref|XP_010518768.1| PREDICTED: F-box protein At5g46170 [Tarenaya hassleriana]
Length=385

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 91/340 (27%), Positives = 147/340 (43%), Gaps = 36/340 (11%)
 Frame = +1

Query  28   HRNSSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdp  207
            H      D  H   LPD + LL+  ++ D K+L RC +VSKRF SL+P + NV+  +   
Sbjct  14   HPEPQTLDIDHFDRLPDSIFLLVFNKIGDVKALGRCCVVSKRFHSLVPQVDNVVVRVDCV  73

Query  208  dsspinsysnpsisdnnGETQKNFPKNVLNL----LSKPFHYLRQItggpslpspsstpA  375
             S   +S  +     +           +  L    + KP   L Q  G     + +S+  
Sbjct  74   ISDDDSSSPSSDKPRSAAAVSAGPFSAIFRLVFGGIVKPLQALGQFLGTKRSCASASSSY  133

Query  376  FNSVAFVNG------------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd  513
             +     +G             + LK F EI+ L I+ P       D  LLKW A  G  
Sbjct  134  LSISGDDDGEIEQGGVTHHSPTQVLKNFNEIRYLRIELPSGELGIDDGVLLKWRAEFGST  193

Query  514  s---ifcvslfssssssdnddfsdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQC  678
                +   +     SS +    + +   ++ G D +   PE+F  TN  L+ RV      
Sbjct  194  LDNCVILGASSVIHSSPEKTSHAVDTAVDSSGTDDSGSIPESF-YTNGGLKLRVVWTISS  252

Query  679  FMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAA  858
             + A  R ++L+ ++A+ HKTL+    TD  G G + + ++Q   L++LR K P+   +A
Sbjct  253  LIAASARHYLLQPIIAE-HKTLDSLVLTDADGQGVLCMNRDQ---LEELRVK-PLSASSA  307

Query  859  E------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                   A  M++W+   ++ P  G V++G T V I  SE
Sbjct  308  SKRTLVPALNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  346



>ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera]
Length=354

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 89/320 (28%), Positives = 133/320 (42%), Gaps = 54/320 (17%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD ++LLI  +L D +SL RC  VSKRF SL+P +H+V   I             
Sbjct  17   HFDQIPDSLVLLIFNKLADVRSLGRCSAVSKRFNSLVPLVHDVYVRIDRVV---------  67

Query  238  psisdnnGETQKNFPKNVLNLLS-------------------KPFHYLRQItggpslpsp  360
                     T    P + LNL S                   KPFH+L+        P+ 
Sbjct  68   ---------TVDGDPNDPLNLSSPKPRNLLSQLLKLMLFTILKPFHHLQN-------PNG  111

Query  361  sstpAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvsl  534
             +      ++  +  + LK F +I+ L I+ P      +D  LLKW+A  G     CV L
Sbjct  112  GNKSFLPQLSHHSPAQVLKNFTDIRNLRIELPAGDVGTEDGVLLKWKAEFGSTLQNCVIL  171

Query  535  fssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLR  714
              +         + E  AE+ G   + PE+F  TN  L+ RV       + A  R ++L 
Sbjct  172  GGTRMDRKPASSNQEQSAEDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLC  227

Query  715  HVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHV  888
             ++ DH  TL     TD  G G + +  EQ+   ++  L A          A  MK+ + 
Sbjct  228  QIIKDH-PTLRSLVLTDADGQGTLTMGLEQLREFREKPLAASASSSRTQVPASNMKLRYA  286

Query  889  SEVQTPKTGRVMRGVTAVLI  948
              ++ P+ G  M+G T V I
Sbjct  287  PYLELPE-GMGMQGATLVAI  305



>ref|XP_009607720.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=392

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 101/344 (29%), Positives = 151/344 (44%), Gaps = 52/344 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD VLLL+   + D K+L RC LVSKRF SL+P + +VI  +    S   +S  +
Sbjct  19   HFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDSVIVRVDCVISDDDSSSPS  78

Query  238  psisdnnGETQ-------KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS----  384
             S +  +  T         +  + V + L KPF  + Q     S  + +S  A +     
Sbjct  79   ASNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISVSSRHAGASASADDVDGDF  138

Query  385  ----VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS
Sbjct  139  DHTFVTHHSPTQVLKNFNEIKFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGASS  198

Query  547  sssdnddfsdE--------------------LLAENGGGDLNNPEAFALTNEMLRDRVEI  666
               +N+    E                       E   G +  PE+F  TN  L+ RV  
Sbjct  199  VIHNNNSVRTEDEQCRNGWENENNNDNNVGEGNVETDNGSI--PESF-YTNGGLKLRVVW  255

Query  667  AYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVD  846
                 + A  R ++L+ ++A+ HKTL+    TD  G G + + +EQ   L++LR K P+ 
Sbjct  256  TISSLIAASARHYLLQPIIAE-HKTLDSLVLTDGDGQGVLCMNREQ---LEELRVK-PLS  310

Query  847  LRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
               A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  311  ASLASKRTLVPALNMRLWYAPHLELPN-GAVLKGATLVAIRPSE  353



>gb|KCW87201.1| hypothetical protein EUGRSUZ_B03721 [Eucalyptus grandis]
Length=503

 Score = 82.4 bits (202),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 94/328 (29%), Positives = 146/328 (45%), Gaps = 34/328 (10%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD++LL IL R+ DA+SL RC  VSKR +SL+P    V  S P P   P +S S     
Sbjct  124  LPDDLLLHILDRVHDARSLARCLAVSKRLSSLVPLTPTVSLSFPRPRLLPASSESESESE  183

Query  250  dnnGETQKNFPKNVLN-LLSKPFHYLRQItggpslpspsstpA--------FNSVAFVNG  402
                  +  F   +++  +  P  +L ++    S                 ++S      
Sbjct  184  PGRWRRRSGFLSRLVDRFVRGPLRFLHRVASAKSASRSGGGGDDDCDCDCDYDSRPAPGE  243

Query  403  IRFLKKFREIQRLEIQTP-CFHA----QDPSLLKWEAGLGKdsifcvslfssssssdndd  567
            +  LK FR I+ L ++ P C  A       ++L+W A  G +   CV L ++S     D 
Sbjct  244  V--LKPFRGIESLRVELPSCVDAVGLNGKRTVLRWTARFGGEMKSCVVLGANSLRRREDG  301

Query  568  fsdELLAENGGGDLNNPEAF---------ALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
             +     E G  +L  P A           +  E L+ RV     C + A  R ++LR +
Sbjct  302  AAAS--GEEGALELR-PRAVEEVELEPGPVIAEEELKLRVVWIISCLIAASARHYLLRQI  358

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAEAGY-----MKVWH  885
            VADH   L+     D    GKV + +E++A ++     E  D  +AE        MK+W+
Sbjct  359  VADH-PMLKSVAIVDSDKQGKVRMLEEEIAEMRRSFDSEAADSSSAERIRVPDLRMKLWY  417

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSEDDD  969
              E++ P++G VMRG T VLI  + + +
Sbjct  418  APELELPESGYVMRGATMVLIAPASEAE  445



>ref|XP_006644887.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha]
Length=353

 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 82/303 (27%), Positives = 136/303 (45%), Gaps = 19/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD V+ LIL +LED +SL RC  VSKRF++L+P + +V   I    ++   +    ++S
Sbjct  21   LPDPVVQLILNKLEDVRSLGRCAAVSKRFSALVPLVSDVYLKIDRVLATDGEADDALNLS  80

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                +    +F K +L  + KPFH +             +      +A  + +  L+ F+
Sbjct  81   SAKPQNIISHFFKLMLFTIVKPFHSMHH--------PNGTGRPLFPLAQHSPVHVLRNFK  132

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
            ++  L ++ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  133  DVWNLRVELPSGDVGTEEGVLLKWRAEYGSTLRNCVILGGTPVDRKPVGSEHEPPVEDNG  192

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR +++D H TL      D  G G
Sbjct  193  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIISD-HPTLRSLVLADADGQG  247

Query  781  KVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             +Y+  EQ+   +  +L      +     A  MK+ +   ++ P  G  ++G T V+I  
Sbjct  248  ALYMGMEQLREFRENNLSTSACFNRTQVPACSMKLKYAPYLELPG-GLALQGATLVVIKP  306

Query  955  SED  963
            S D
Sbjct  307  SND  309



>ref|XP_009393903.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 88/306 (29%), Positives = 138/306 (45%), Gaps = 26/306 (8%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD ++LLI  +L D +SL RC  VSKRF +L+P +HNV   I    S   +S+  
Sbjct  26   HFDRIPDSLVLLIFNKLADVRSLGRCSAVSKRFNALVPLVHNVYVKIDRVVSIDGDSFDA  85

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
              +S     T   +  K +L  + +P HYL+ + G               ++  +  + L
Sbjct  86   LDLSLPKPRTLFAHLLKLILFAILQPLHYLQNVHGWNKPL-------LPQLSHHSPRQVL  138

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            K F  ++ L ++ P      +D   LKW A  G     CV L  +         + E   
Sbjct  139  KNFTHVRNLRMELPAGDVKTEDGVFLKWRAEFGSTLQNCVILGGTMMDYRPASANLEGGM  198

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL     TD 
Sbjct  199  EDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRQII-EEHPTLSSLVLTDA  253

Query  769  KGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRVMRG  930
             G G + +  EQ   L++ R K P+ + A+       A YMK+ +   ++ P  G  M+G
Sbjct  254  DGQGTLTMGVEQ---LKEFREK-PLAMSASSNRTQVPASYMKLRYAPFLELPD-GMGMQG  308

Query  931  VTAVLI  948
             T V I
Sbjct  309  ATLVAI  314



>ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 132/320 (41%), Gaps = 54/320 (17%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD ++LLI  +L D +SL RC  VSKRF SL+P + +V   I             
Sbjct  17   HFDRIPDPLVLLIFNKLADVRSLGRCSAVSKRFNSLVPLVDDVYVRIDRVV---------  67

Query  238  psisdnnGETQKNFPKNVLNLLS-------------------KPFHYLRQItggpslpsp  360
                     T    P   LNL S                   +PFH+L+        PS 
Sbjct  68   ---------TVDGDPDEPLNLSSPKPRNLLSHLLKLMLFTILRPFHHLQN-------PSG  111

Query  361  sstpAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvsl  534
             +      ++  +  + LK F  I+ L I+ P      +D SLLKW+A  G     CV L
Sbjct  112  GNKSLLPQLSHHSPAQVLKNFAHIRNLRIELPAGDVGTEDGSLLKWKAEFGSTLQNCVIL  171

Query  535  fssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLR  714
              +         + E  AE+ G   + PE+F  TN  L+ RV       + A  R ++LR
Sbjct  172  GGTRMDGKPASSNQEQPAEDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLR  227

Query  715  HVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHV  888
             ++ DH  TL     TD  G G + +  EQ+   ++  L A          A  MK+ + 
Sbjct  228  QIIKDH-PTLRSLVLTDADGQGTLTMGVEQLREFREKPLAASASSSRTQVPASNMKLRYA  286

Query  889  SEVQTPKTGRVMRGVTAVLI  948
              ++ P+ G  M+G T V I
Sbjct  287  PYLELPE-GMGMQGATLVAI  305



>ref|XP_010904742.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 135/301 (45%), Gaps = 24/301 (8%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLIL ++ D +SL RC  VSKRF  L+P +H+V   I    +   +S    + S
Sbjct  21   IPDSLVLLILNKIADVRSLGRCSAVSKRFNFLVPLVHDVYVKIDRVVTVDGDSDDALNPS  80

Query  250  dnnGETQKNFPKNVLNLLS----KPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
                   +NF  + L L+     KPFH+L    GG           F  ++  +  + LK
Sbjct  81   SLK---PRNFFSHFLKLMMFTILKPFHHLHNTNGGNKPL-------FPQLSHHSPAQVLK  130

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
             F  I+ L I+ P      ++  LL+W A  G     C+ L  +           E   E
Sbjct  131  NFTHIRNLRIELPAGDVGTEEGVLLRWRAEFGSTLQNCMILGGTRVDRKPASAEQETALE  190

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            + G   + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL+    TD  
Sbjct  191  DNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRPIIKDH-PTLKSLVLTDAD  245

Query  772  GNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVL  945
            G G + +  EQ+   ++  L A    +     A  MK+ +   ++ P +G  ++G T V 
Sbjct  246  GQGTLSMGVEQLKEFREKPLAASASSNRTQVPASNMKLRYAPYLELP-SGMGLQGATLVT  304

Query  946  I  948
            I
Sbjct  305  I  305



>ref|XP_007212265.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
 gb|EMJ13464.1| hypothetical protein PRUPE_ppa006658mg [Prunus persica]
Length=401

 Score = 81.3 bits (199),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 95/337 (28%), Positives = 153/337 (45%), Gaps = 47/337 (14%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S S+ S S
Sbjct  28   LPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDESSPSSASSS  87

Query  250  dnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAF--------------  378
             ++ +++  F    + V+  + KP   L Q  G     +  + PA               
Sbjct  88   SSSDKSRTPFSALFRLVIGGIVKPLQALGQFLGPTRRSTNGAHPALAVDDPDSSAADSSS  147

Query  379  ---NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfss  543
               + V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +S
Sbjct  148  FDQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAS  207

Query  544  ssssdnddfsdELLAENGGGDLNN------------PEAFALTNEMLRDRVEIAYQCFME  687
            S          ++      G   N            P++F  TN  L+ RV       + 
Sbjct  208  SVIHPGPTKISDVQDNGSDGFCANTNAAVSDDNGSIPDSF-YTNGGLKLRVVWTISSLIA  266

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE--  861
            A  R ++L+ ++++H KTL+    TD  G G +Y+ ++Q   L++LR K P+   +A   
Sbjct  267  ASARHYLLQPIISEH-KTLDSLVLTDADGQGVLYMNRDQ---LEELRVK-PLSASSASKR  321

Query  862  ----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                A  M++W+   ++ P  G V++G T V I  SE
Sbjct  322  TLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSE  357



>ref|XP_011035442.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
 ref|XP_011035443.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=394

 Score = 81.3 bits (199),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 154/338 (46%), Gaps = 42/338 (12%)
 Frame = +1

Query  40   SDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp  219
            S S   H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S  
Sbjct  26   SSSKIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCVISDD  85

Query  220  insysnpsisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAFN---  381
                S+ SI  ++  +   F    + V   +SKPF  L Q+ G        + P+ +   
Sbjct  86   DTPSSSSSIKSHSSSSSSGFSSIFRLVFGGISKPFQALSQMFGPKVNSRNGNGPSLSVAT  145

Query  382  ---------SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd-----  513
                      V   +  + LK F EI+ L I+ P       D  LLKW A  G       
Sbjct  146  DDDMELDQAGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCV  205

Query  514  ---sifcvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFM  684
               +   ++    SS+   ++ +     +NG    + PE+F  TN  L+ RV       +
Sbjct  206  ILGAASVITNNKISSAMQQENAAAADDDDNG----SIPESF-YTNGGLKLRVVWTISSLI  260

Query  685  EALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-  861
             A  R ++L+ ++A+ HKTL+     D  G G + + +EQ   L++LR K P+   +A  
Sbjct  261  AASARHYLLQPIIAE-HKTLDSLVLADADGQGVLCMNREQ---LEELRVK-PLSASSASK  315

Query  862  -----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                 A  M++W+   ++ P  G V++G T V I  SE
Sbjct  316  RTLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSE  352



>dbj|BAJ85411.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=353

 Score = 80.5 bits (197),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 84/303 (28%), Positives = 134/303 (44%), Gaps = 21/303 (7%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL ++ED +SL RC   SKRF  L+P +H+V   I    +   ++     +S
Sbjct  23   LPDSIVLLILNKVEDVRSLGRCSAASKRFNGLVPLVHDVCVKIDHVVAVDGDAEDPLDLS  82

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH  R                F  +A  +  + L+ F 
Sbjct  83   SPKPRNILSHFLKLMLFTIIKPFHNARGAGRPL----------FPQLAHHSPAQVLRSFT  132

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++ L I+ P      +D  LLKW A  G     CV L  +           E  +E+ G
Sbjct  133  HVRNLHIELPSGDVGTEDGVLLKWRAEYGSTLQNCVILGGTRVDRKPVGAEHEPSSEDNG  192

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ +H  TL     TD  G G
Sbjct  193  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKEH-PTLVSLVLTDADGQG  247

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+ + ++  L A    +     A  MK+ +   ++ P+ G  ++G T V I  
Sbjct  248  TLTMGAEQLKDFRENQLSASACSNRTHVPACNMKLKYAPYLELPE-GIALQGATLVAIKP  306

Query  955  SED  963
            S +
Sbjct  307  STE  309



>ref|XP_003568215.1| PREDICTED: F-box protein At5g46170-like [Brachypodium distachyon]
Length=356

 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 85/298 (29%), Positives = 134/298 (45%), Gaps = 18/298 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL ++ED +SL RC   SKRF  L+P +H+V   I    +   +S    ++S
Sbjct  23   LPDSLVLLILNKVEDVRSLGRCSAASKRFYGLVPLVHDVCVKIDRVVTVDGDSEDPLNLS  82

Query  250  dnnGET-QKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH +R   G            F  +A  +  + L+ F 
Sbjct  83   SPKPRNILSHFLKLMLFTIIKPFHNMRSANGAGRPL-------FPQLAQHSPAQVLRNFT  135

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L+I+ P      +D  LLKW A  G     CV L  +           E  +++ G
Sbjct  136  HIRNLQIELPSGDVGTEDGILLKWRAEYGSTLQNCVILGGTRVDRKPVGAEHEPSSDDNG  195

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++L+ ++ DH  TL     TD  G G
Sbjct  196  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLQSIIKDH-PTLASLVLTDADGQG  250

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I
Sbjct  251  TLCMGAEQLKEFRENQLSASACSNRTQVPACSMKLKYAPYLELPG-GIALQGATLVAI  307



>ref|XP_009410458.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009410459.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 134/298 (45%), Gaps = 18/298 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL +L D +SL RC  VSKRF SL+  +H+V   I    +   +S    S S
Sbjct  21   LPDSIVLLILNKLADVRSLGRCSAVSKRFNSLVFLVHDVYVKIDRVVTVDGDSDDPLSQS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     NF K +L  L KPFH LR         +  + P F  ++  +  + LK F 
Sbjct  81   SPRHRNLFCNFLKLMLFTLLKPFHNLRST-------NCGNKPVFPQLSHHSPAQVLKNFT  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++ L I+ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  134  HVRNLRIELPAGDVGTEEGVLLKWRAEFGSTLQSCVILGGTRIDRKLVSPEHESPVEDSG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + P++F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD  G G
Sbjct  194  ---SIPDSF-YTNGGLKLRVFWTISSLIAASTRHYLLRPIIKE-HPTLKSLALTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             + + +EQ+   ++  + A    +     A  MK+ +   +  P  G  ++G T V I
Sbjct  249  TLSMGEEQLKEFREKPVAASASTNRTQVPACNMKLKYAPYLDIPG-GMALQGATVVTI  305



>ref|XP_011032098.1| PREDICTED: F-box protein At4g18380-like [Populus euphratica]
Length=342

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 79/310 (25%), Positives = 143/310 (46%), Gaps = 36/310 (12%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD +LL+I  ++ DAKSL RC  VSKRFASL+     V  SIP    +           
Sbjct  12   LPDALLLVIFNKVVDAKSLTRCISVSKRFASLVFEADTVFLSIPPRKHNSKADNR-----  66

Query  250  dnnGETQKNFPKNVLN-LLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                  ++N  K +++ L++KP H+  +     S           +V+F +    LK F+
Sbjct  67   ----SLRRNLFKILISKLIAKPLHFFHRFIADRSDTDR------KTVSFYSPKEVLKHFQ  116

Query  427  EIQRLEIQTPCFHAQ-----DPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
            + + + ++ P          + SLLKW+A  G +    V L ++S        S +  +E
Sbjct  117  QAKTMHMELPSDDVMTGLEGNDSLLKWKARFGSEIKNFVILSATSFQKRMQPLSSDDFSE  176

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            N G          LT+  ++ ++     C + A  R ++++ V+ +HH  LE+   +D  
Sbjct  177  NNGE--------VLTDGQMKLQIVRTISCLLAASARHYLIKQVLEEHH-ALEDIIASDVC  227

Query  772  GNGKVYLRKEQVA----NLQDLRAKEPVDLRAAEAG--YMKVWHVSEVQTPKTGRVMRGV  933
              G+V + K++VA    +++ + A     L         +K+W V  ++ P+ G +M+G 
Sbjct  228  KQGRVCMGKDEVAEIRNSMKSMVANTDSSLERTRVPDLSLKLWFVPVLELPENGYIMKGA  287

Query  934  TAVLIGVSED  963
            T  ++  ++D
Sbjct  288  TLAVLRPNDD  297



>ref|XP_003593894.1| F-box family protein [Medicago truncatula]
 gb|AES64145.1| F-box plant-like protein [Medicago truncatula]
Length=389

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 141/329 (43%), Gaps = 36/329 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   ++ S 
Sbjct  25   HFDRIPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDDSNSSV  84

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG-----  402
             S   + G    N  + V   ++KP   L Q  G     + S      S     G     
Sbjct  85   NSSDKSRGPFW-NLLRLVFGGIAKPIQTLGQFLGPKRGSNSSVNSGSGSSPLAVGSEEDG  143

Query  403  ---------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd------sifcvs  531
                      + LK F EI+ L I+ P      +D  LLKW A  G              
Sbjct  144  DGGVTHHSPTQVLKNFNEIRLLRIELPSGELGIEDGVLLKWRADFGSTLDNCVILGASSV  203

Query  532  lfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVL  711
                S                G  + + P++F  TN  L+ RV       + A  R ++L
Sbjct  204  FQPKSQDGVVAVDGGGANNNGGDDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLL  262

Query  712  RHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYM  873
            + ++++ HKTL+    TD  G G +Y+ ++Q   L++LR K P+   +A       A  M
Sbjct  263  QPIISE-HKTLDNLVLTDADGQGVLYMNRDQ---LEELRVK-PLSASSASKRTLVPALNM  317

Query  874  KVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            ++W+   ++ P  G V++G T V I  SE
Sbjct  318  RLWYAPHLELPD-GVVLKGATLVAIRPSE  345



>ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isoform X2 [Phoenix dactylifera]
Length=354

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 88/316 (28%), Positives = 128/316 (41%), Gaps = 54/316 (17%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLI   L D +SL RC  VSKRF SL+P +H++   I                 
Sbjct  21   IPDSLVLLIFNNLADVQSLGRCSAVSKRFNSLVPLVHDIYVKIDRVV-------------  67

Query  250  dnnGETQKNFPKNVLNLLS-------------------KPFHYLRQItggpslpspsstp  372
                 T    P   LNL S                   KPFH+L+  +GG          
Sbjct  68   -----TVDGDPDEALNLSSPKPRNLLSHLLKLMLLTVLKPFHHLQNTSGGNKPL------  116

Query  373  AFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                ++  +  + LK F  I+ L I+ P      +D  LLKW A  G     CV L  + 
Sbjct  117  -LPQLSHHSPAQVLKNFTHIRNLRIELPAGDVGTEDGVLLKWRAEFGSTLQNCVILGGTR  175

Query  547  sssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVA  726
                    + E   E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ 
Sbjct  176  MDGKPASSNQEQPVEDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRQIIK  231

Query  727  DHHKTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQ  900
            D H TL     TD  G G + +  EQ+   ++  L A          A  MK+ +   ++
Sbjct  232  D-HPTLRSLVLTDADGQGTLSMGVEQLKEFREKPLAASASSSRTQVPASNMKLRYAPYLE  290

Query  901  TPKTGRVMRGVTAVLI  948
             P+ G  M+G T V I
Sbjct  291  LPE-GMGMQGATLVAI  305



>ref|XP_010113152.1| F-box protein [Morus notabilis]
 gb|EXC68150.1| F-box protein [Morus notabilis]
Length=352

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 131/319 (41%), Gaps = 54/319 (17%)
 Frame = +1

Query  37   SSDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdss  216
            +SD    +   LPD +L LI  ++ DAK+L RC  VSKRF SLI     V   +      
Sbjct  16   TSDHRRDYFDQLPDPLLHLIFNKILDAKTLVRCLPVSKRFNSLISQTDAVFLPL------  69

Query  217  pinsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFV  396
                             QKN P     L+   F +L +I       S     A  +V + 
Sbjct  70   ---------------PPQKNKPA---KLVRSFFRFLHKI------VSKKPRNAHRNVFYH  105

Query  397  NGIRFLKKFREIQRLEIQTP-C-----FHAQDPSLLKWEAGLGKdsifcvslfssssssd  558
            +    LK F E++ L ++ P C     F  +D SLLKW+A  G           +     
Sbjct  106  SPCEVLKGFNELKSLHLELPRCKGEMGFAGKD-SLLKWKAEFGS-------NLRNCVILG  157

Query  559  nddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHK  738
             +    E +A+N      N    AL+++ L+ R+     C + A  R ++L+ VV+D   
Sbjct  158  ANSLKKEKIAKNDNLAKENDNQNALSDDELKLRIVWMISCLIAASARHYLLKRVVSD-FP  216

Query  739  TLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAEAGY---------MKVWHVS  891
            TL     +D    GKV +  E++A L+           A E+           MK+W+V 
Sbjct  217  TLTNVVVSDGDRRGKVLIGGEELAELRSESVSGDSSDVALESSLERSLIPDLGMKMWYVP  276

Query  892  EVQTPKTGRVMRGVTAVLI  948
             +  P  G V+ G T V+I
Sbjct  277  RMVLPTCGWVLEGATLVVI  295



>ref|XP_009101540.1| PREDICTED: F-box protein At5g46170 [Brassica rapa]
Length=374

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 95/325 (29%), Positives = 146/325 (45%), Gaps = 31/325 (10%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D KSL RC +VS+RF SL+  + NV+  +    S   NS  +
Sbjct  19   HFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENVLIRVDCVISDDDNSSLS  78

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF------------  378
               S +       N  + V+  + KP   L Q  G       SS+ +             
Sbjct  79   SIKSRSAASGPFSNLFRLVVGGIVKPLQALGQFLGARRSCGSSSSSSSSLSISGDEGGEI  138

Query  379  --NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS
Sbjct  139  EQGGVTHHSPTQVLKNFEEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDHCVILGASS  198

Query  547  sssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVA  726
                N     + + E+     + PE+F  TN  L+ RV       + A  R ++L+ ++A
Sbjct  199  VIQPNPIRVSQPV-ESSDDTGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIA  256

Query  727  DHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHV  888
            +H KTL     +D  G G + + ++Q   L++LR K P+   +A       A  M++W+ 
Sbjct  257  EH-KTLRSLVLSDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYA  311

Query  889  SEVQTPKTGRVMRGVTAVLIGVSED  963
              ++ P  G V++G T V I  SE 
Sbjct  312  PTLELPD-GTVLKGATLVAIRPSES  335



>ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
 ref|XP_010907541.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis]
Length=354

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 88/309 (28%), Positives = 135/309 (44%), Gaps = 32/309 (10%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD ++LLI  +L D +SL R   VSKRF SL+P +H+V       D         
Sbjct  17   HFDWIPDPLVLLIFNKLADVRSLGRASAVSKRFNSLVPLVHDVYV---KIDRVVTVDGDL  73

Query  238  psisdnnGETQKNFPKNVLNLLS----KPFHYLRQItggpslpspsstpAFNSVAFVNGI  405
                + +    +N   ++L L+     KPFH+L+  + G              ++  +  
Sbjct  74   DEALNLSSPKPRNLLSHLLKLMFLTVLKPFHHLQNTSSGNKPL-------LPQLSHHSPA  126

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F  I+ L I+ P      +D  LLKW A  G     CV L  +         + E
Sbjct  127  QVLKNFTHIRNLRIELPAGDVGTEDGVLLKWRAEFGSTLQNCVILGGTQMDRKPASSNQE  186

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
               E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ D H TL     
Sbjct  187  QSVEDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRQIIKD-HPTLRSLVL  241

Query  760  TDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRV  921
            TD  G G + +  EQ   L++ R K P+   A+       A  MK+ +   ++ P+ G  
Sbjct  242  TDADGQGTLSMGMEQ---LKEFREK-PLAASASSCRTQVPASNMKLRYAPYLELPE-GMG  296

Query  922  MRGVTAVLI  948
            M+G T V I
Sbjct  297  MQGATLVAI  305



>ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isoform X1 [Phoenix dactylifera]
Length=421

 Score = 79.0 bits (193),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 88/316 (28%), Positives = 128/316 (41%), Gaps = 54/316 (17%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++LLI   L D +SL RC  VSKRF SL+P +H++   I                 
Sbjct  88   IPDSLVLLIFNNLADVQSLGRCSAVSKRFNSLVPLVHDIYVKIDRVV-------------  134

Query  250  dnnGETQKNFPKNVLNLLS-------------------KPFHYLRQItggpslpspsstp  372
                 T    P   LNL S                   KPFH+L+  +GG          
Sbjct  135  -----TVDGDPDEALNLSSPKPRNLLSHLLKLMLLTVLKPFHHLQNTSGGNKPL------  183

Query  373  AFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                ++  +  + LK F  I+ L I+ P      +D  LLKW A  G     CV L  + 
Sbjct  184  -LPQLSHHSPAQVLKNFTHIRNLRIELPAGDVGTEDGVLLKWRAEFGSTLQNCVILGGTR  242

Query  547  sssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVA  726
                    + E   E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ 
Sbjct  243  MDGKPASSNQEQPVEDNG---SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRQIIK  298

Query  727  DHHKTLEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQ  900
            D H TL     TD  G G + +  EQ+   ++  L A          A  MK+ +   ++
Sbjct  299  D-HPTLRSLVLTDADGQGTLSMGVEQLKEFREKPLAASASSSRTQVPASNMKLRYAPYLE  357

Query  901  TPKTGRVMRGVTAVLI  948
             P+ G  M+G T V I
Sbjct  358  LPE-GMGMQGATLVAI  372



>ref|XP_007015207.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY32826.1| F-box family protein, putative [Theobroma cacao]
Length=354

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 93/317 (29%), Positives = 142/317 (45%), Gaps = 34/317 (11%)
 Frame = +1

Query  43   DSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspi  222
            DS   +   LPD +LL I  +L+DAKSL  C LVSKRF SL P    +  SIP P     
Sbjct  8    DSYSDNFDRLPDALLLFIFNKLQDAKSLGNCLLVSKRFFSLTPFTDTIFVSIPTPHHLSK  67

Query  223  nsysnpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAF-VN  399
               +   I+         F K +     K FH++            S+T +F+S     N
Sbjct  68   PWTAASYINTLRLLVHSLFLKPL-----KCFHHI--------TAPKSATRSFDSSHHQPN  114

Query  400  GIRFLKKFREIQRLEIQTPCFHAQD------PSLLKWEAGLGKdsifcvslfssssssdn  561
             +  LK F+EI+ L ++ P  H  D       S LKW+A  G +   C+ L ++S    N
Sbjct  115  AV--LKNFKEIKSLHLELPS-HGDDLGSDCGASFLKWKAEFGSNLETCIILGATSFERSN  171

Query  562  ddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH-K  738
               S     +    +        LT++ L+ RV     C + A  R    + ++ADH   
Sbjct  172  KFSSSSFCFQQKEQECMEQ---TLTDDELKLRVIWTISCLIAASTRHCWFKKILADHPIP  228

Query  739  TLEEARFTDQKGNGKVYLRKEQVANLQDL--RAKEPVDLRAAEAG-----YMKVWHVSEV  897
             L+    +D    GK+Y+  E++  L++     KE ++    E        MK+W++  +
Sbjct  229  ILQRLLISDANKQGKLYMGTEKLVQLRNSMNSQKETLESSTLERTPVPELSMKLWYLPVL  288

Query  898  QTPKTGRVMRGVTAVLI  948
            + P++G VMRG T VLI
Sbjct  289  ELPESGYVMRGATLVLI  305



>ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246618.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246619.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246620.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
 ref|XP_010246621.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=351

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 90/311 (29%), Positives = 138/311 (44%), Gaps = 28/311 (9%)
 Frame = +1

Query  43   DSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspi  222
            D D      +PD V+L+IL +L D +SL RC  V KRF SL+P++ +V  +I +  +   
Sbjct  14   DVDQGEFDKIPDSVVLIILNKLADIRSLGRCTAVCKRFNSLVPYVQDVYINIDEVVTING  73

Query  223  nsysnpsisdnnGETQKNFPKNVL-----NLLSKPFHYLRQItggpslpspsstpAFNSV  387
            +S  +   S       +NF  N+L     NLL KP ++LR         + ++      V
Sbjct  74   DSDDSSYSSS---HKPRNFFSNLLKYMFFNLL-KPLYHLRN-------SNNTNKTLLPQV  122

Query  388  AFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdn  561
            +     + L+ F  I  L I+ P      +D  LLKW+A  G     CV L  +      
Sbjct  123  SQCTLDQILRNFHHIHNLWIELPTADVETEDGVLLKWKAEFGSTLQNCVILGGTQIERKP  182

Query  562  ddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
                   L +NG    + PE+F  TN  L+ RV       + A  R ++L  ++ + H T
Sbjct  183  VTDQGS-LEDNG----SIPESF-YTNGGLKLRVVWTISSLIAASTRHYLLEPIIKN-HAT  235

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTG  915
            L+   FTD  G G + +  EQ+   ++  L A          A  MK+ +   +  PK G
Sbjct  236  LKAVIFTDAAGQGTLSMGIEQLKEFREKPLAASASSRRTQVPASNMKLRYAPYLDLPK-G  294

Query  916  RVMRGVTAVLI  948
              M+G T V I
Sbjct  295  LGMQGATLVAI  305



>gb|KHG20859.1| hypothetical protein F383_03969 [Gossypium arboreum]
Length=391

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 95/339 (28%), Positives = 145/339 (43%), Gaps = 46/339 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+   + D K+L RC +VS+RF SL+P + NV+  +    S    S S+
Sbjct  19   HFDRLPDSLLLLVFNMIGDVKALGRCCVVSRRFHSLVPQVENVVVRVDCVISDDDCSPSS  78

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
               S  +G     F + V   + KP   L Q  G        +                 
Sbjct  79   SVKSRADGPFSTLF-RLVFGGIVKPLQALGQFLGPERPSLNKTLNTSSSSSLSVGLGGGE  137

Query  379  ------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvsl  534
                    V   +  + L+ F E++ L I+ P       D  LLKW A  G     CV L
Sbjct  138  DGEMDQGGVTHHSPTQVLRNFNELRFLRIELPGGELGIDDGVLLKWRADFGSTLDSCVIL  197

Query  535  fssssssdnddfs----dELLAENGGGDLNN-------PEAFALTNEMLRDRVEIAYQCF  681
             ++S  ++         ++    N G ++ N       PE+F  TN  L+ RV       
Sbjct  198  GAASVFNNVHFQVPDHGNDGFCINNGSNVGNGDDNGSIPESF-YTNGGLKLRVVWTISSL  256

Query  682  MEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE  861
            + A  R ++L+ ++A+H KTL+    TD  G G + +  EQ   LQ+LR K P+   +A 
Sbjct  257  IAASARHYLLQSIIAEH-KTLDSLVLTDADGQGVLCMNGEQ---LQELRVK-PLSASSAS  311

Query  862  ------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                  A  M++W+   +  P  G V++G T V I  SE
Sbjct  312  KRTLVPALNMRLWYAPHLDLPD-GVVLQGATLVAIRPSE  349



>ref|XP_009408533.1| PREDICTED: F-box protein At5g46170 [Musa acuminata subsp. malaccensis]
Length=402

 Score = 78.2 bits (191),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 88/332 (27%), Positives = 145/332 (44%), Gaps = 36/332 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLL++  R+ D K+L RC +VS+RF +L+  + +++  +    S   + + +
Sbjct  30   HFDRLPDSVLLVVFNRVGDIKALGRCCIVSRRFHALVRLVDDIVVRVDCVVSDEPSLFPD  89

Query  238  psisdnnGETQK------NFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFV-  396
                       K      +  + VL  L KP H L Q+    S    ++     +     
Sbjct  90   TEADSAAAGPDKPRGVFFHLARVVLGGLVKPLHALGQLFSSSSSSLATADAVSAAARKSA  149

Query  397  ----------------NGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsif  522
                            +    LK F+EI+RL I+ P       D  LLKW A  G     
Sbjct  150  SPSSSSSTPSSDVSHHSPAEVLKNFKEIRRLRIELPDSELGVDDGVLLKWRADFGSTLES  209

Query  523  cvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRR  702
            CV L +SS +  +    +      G    + PE+F   +  L+ RV       + A  R 
Sbjct  210  CVILGASSVALSSSVPPNSSNVCGGDDCRSIPESF-YNDGSLKRRVVWTISSLIAASARH  268

Query  703  HVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-----AG  867
            ++L  +VAD H+TLE     D  G G + + + Q   LQ+L+ K  +  R+++     A 
Sbjct  269  YLLHPIVAD-HETLESLDLIDADGQGLLTMDRRQ---LQELKMKPWMASRSSQRTLLPAL  324

Query  868  YMKVWHVSEVQTPKTGRVMRGVTAVLIGVSED  963
             M++W+  +++ P  G V+RG T + I  SE+
Sbjct  325  SMRLWYADQLELPN-GMVLRGATLLAIRPSEE  355



>gb|ACR36872.1| unknown [Zea mays]
Length=354

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 141/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+  +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVSLVHDVYVKIDRVVAVDGDAEGT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S     +   +F + +L  + KPFH +R        P+ ++ P F  ++  +  + L
Sbjct  77   LNLSSPKPRSIFSHFLRLMLFTIIKPFHNMRS-------PNGTARPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLENCVILGGTRVDRKPVGGEHEPAL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSII-NGHPTLQSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  +Q+   ++  L A    +     A  MK+ +   V+ P  G  ++G T V
Sbjct  245  DGQGTLCMGAKQLEEFRENQLSASACSNRTQVPACNMKLKYAPYVELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>ref|XP_002992968.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
 gb|EFJ05914.1| hypothetical protein SELMODRAFT_136272 [Selaginella moellendorffii]
Length=373

 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 137/311 (44%), Gaps = 19/311 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LL I  ++ + K+L +C  VSKRF S+   + NV+  +    S    + S+
Sbjct  33   HFERLPDSLLLTIFNKIAEIKALGKCCAVSKRFNSVASQVDNVVVRVDCVLSGEDTNCSS  92

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstp---AFNSVAFVNGIR  408
             +          +  K V   L +PF  L+Q+    +    SS     +   V+  +   
Sbjct  93   KASKGLV----SSLVKLVYGSLLRPFQVLQQMLSFSAGGKKSSGSRPVSATEVSHHSPGE  148

Query  409  FLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfs--sssssdnddfsd  576
             L+ F+EIQ L I+ P      ++  +LKW+A  G     CV L +     +      S 
Sbjct  149  VLRNFKEIQTLRIELPGGELGLEEDIVLKWKAEFGSTVQSCVMLGAYREKVADVKPLESK  208

Query  577  ELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEAR  756
            E   E+  G +  PE F  T+  L+ RV       + A  R  +L+ ++A+H  TLE   
Sbjct  209  EAAEEDDNGSI--PETF-YTDGSLKSRVVWTISSLIAASARHFLLQQIIAEH-PTLERLL  264

Query  757  FTDQKGNGKVYLRKEQVANLQD---LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMR  927
             TD  G G + + KEQ+   +D     A    +     A  MK+W+   +  P  G ++R
Sbjct  265  LTDADGQGTLCMSKEQLCEFRDSPIAAASVSSNRTQVPALNMKLWYAPLLPLPD-GTLLR  323

Query  928  GVTAVLIGVSE  960
            G T V I  S+
Sbjct  324  GATLVAIRPSD  334



>gb|ACG36557.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 141/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+  +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVSLVHDVYVKIDRVVAVDGDAEGT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S     +   +F + +L  + KPFH +R        P+ ++ P F  ++  +  + L
Sbjct  77   LNLSSPKPRSIFSHFLRLMLFTIIKPFHNMRS-------PNGTARPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLENCVILGGTRVDRKPVGGEHEPAL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSII-NGHPTLQSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  +Q+   ++  L A    +     A  MK+ +   V+ P  G  ++G T V
Sbjct  245  DGQGTLCMGAKQLEEFRENQLSASACSNRTQVPACNMKLKYAPYVELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>gb|EMT09581.1| hypothetical protein F775_20146 [Aegilops tauschii]
Length=356

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 133/314 (42%), Gaps = 40/314 (13%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL ++ED +SL RC   SKR   L+PH+H+V                     
Sbjct  23   LPDSLVLLILNKVEDVRSLGRCSAASKRLNGLVPHVHDVCV-----------KIDRVVAV  71

Query  250  dnnGETQKNF----PKNVLN--------LLSKPFHYLRQItggpslpspsstpAFNSVAF  393
            D +GE   N     P+N+L+         + KPFH  R      +    S   A +S A 
Sbjct  72   DGDGEDALNLTSPKPRNILSHFLKLMLFTIIKPFHNARG--PNGAGRPLSPQLAHHSPAQ  129

Query  394  VNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdndd  567
            V      + F  ++ L I+ P      +D  LLKW A  G     CV L  +        
Sbjct  130  VR-----RSFTHVRTLHIELPSGDVGTEDGVLLKWRAEYGSTLQNCVILGGTRVDRKPVG  184

Query  568  fsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLE  747
               E  +E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL 
Sbjct  185  AEHEPSSEDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKE-HPTLV  239

Query  748  EARFTDQKGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRV  921
                TD  G G + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  
Sbjct  240  SLVLTDADGQGTLTMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYAPYLELPG-GIA  298

Query  922  MRGVTAVLIGVSED  963
            ++G T V I  S +
Sbjct  299  LQGATLVAIKPSTE  312



>ref|XP_010940976.1| PREDICTED: F-box protein At5g46170-like [Elaeis guineensis]
Length=412

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 98/338 (29%), Positives = 143/338 (42%), Gaps = 44/338 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIP-------HIHNVIFsipdpdss  216
            H   LPD +LL +  R+ D K+L RC +V +RF SL+P       H+  VI   P P SS
Sbjct  33   HFDRLPDALLLDVFNRIGDVKALGRCCVVCRRFHSLVPLVDYVVVHVDCVISDDPGPSSS  92

Query  217  pinsysnpsisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAF  393
                        + G     +  + V   L KP   L QI    +  +   +   +  + 
Sbjct  93   SAPGCGGGGAGPDKGRGVFSHLARLVFGSLVKPLQALGQILSPAASATSRRSSGSSLSSS  152

Query  394  VNG----------IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslf  537
             +              LK F+EI+RL I+ P      +D   LKW+A  G     CV L 
Sbjct  153  SSSSSSEVSHHSPTEVLKNFKEIRRLRIELPAGELRVEDGIFLKWKADFGSTLDTCVILG  212

Query  538  ssssssdnddfsdEL---------LAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFM  684
            ++S  S +                  +  GGD +   PE+F  TN  L+ RV       +
Sbjct  213  AASVLSSSSSPLSPKSSNPDPNPSFQDACGGDDSGTIPESF-YTNGSLKLRVVWTISSLI  271

Query  685  EALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAA--  858
             A  R ++L+ ++ADH +TLE    TD  G G + + K Q   L+DLR K PV       
Sbjct  272  AASARHYLLQQIIADH-ETLESLDLTDADGQGVLTMNKGQ---LRDLRVK-PVSPSGTLQ  326

Query  859  ----EAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                 A  M++W+   ++ P  G V+ G T V I  SE
Sbjct  327  RTLVPALSMRLWYAPHLELPG-GVVLEGATLVAIRPSE  363



>ref|XP_010439863.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=419

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 96/346 (28%), Positives = 145/346 (42%), Gaps = 54/346 (16%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLIL  + D KSL RC +VSKRF SLIP + NV+  +    S   +S   
Sbjct  46   HFDHLPDSILLLILNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDCVISDDDSSSLV  105

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
                 +           +  L+ KP   L Q        S S + A              
Sbjct  106  SDKPRSVASVAATPFFAIFRLVIKPLQALGQFLKRSGSSSSSPSSASSSASSLLISGGIG  165

Query  379  --------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcv  528
                      V   +  + LK F E++ L I+ P       D  LLKW A  G     CV
Sbjct  166  GDDGEIEQGGVTHHSPTQVLKNFDELRFLRIELPSGELGIDDGVLLKWRAEFGSTLENCV  225

Query  529  slfssssssdnddf---------------sdELLAENGGGDLNNPEAFALTNEMLRDRVE  663
             L +SS     +                 ++ ++ E+ G   + PE+F  TN  L+ RV 
Sbjct  226  ILGASSVIPATNSVDLGTSNNNNNNNNNNNNAVVVEDNG---SIPESF-YTNGGLKLRVV  281

Query  664  IAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPV  843
                  + A  R ++L+ ++ + HKTL+    TD  G G + + ++Q   L++LR K P+
Sbjct  282  WTISSLIAASARHYLLQPIITE-HKTLDSLVLTDVDGQGVLCMNRDQ---LEELRVK-PL  336

Query  844  DLRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSED  963
               +A       A  M++W+   ++ P  G V++G T V I  SE 
Sbjct  337  SASSASKRTLVPALNMRLWYAPTLELPD-GSVLKGATLVAIRPSES  381



>emb|CDM84680.1| unnamed protein product [Triticum aestivum]
Length=354

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 87/306 (28%), Positives = 138/306 (45%), Gaps = 19/306 (6%)
 Frame = +1

Query  61   IHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnp  240
            I  LPD ++LLIL +LED  SL RC  VSKRF  L+P +H+V   I    +   +     
Sbjct  19   IDCLPDSLVLLILNKLEDVHSLGRCAAVSKRFNDLVPLVHDVYVKIDRVVAVDGDPDDAL  78

Query  241  sisdnnGE-TQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
            ++S         +  K +L  ++KPFH +R   G    P       F  +A  + ++ L+
Sbjct  79   NLSSAKPRHIFSHLFKLMLFTIAKPFHGMRGPGGAGGRPL------FPRLAQHSPVQVLR  132

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAE  591
             F  ++ L ++ P      ++  LLKW A  G        +    +  D      E  AE
Sbjct  133  GFSHVRNLRVELPSGDVGTEEGVLLKWRARYGS--TLQSCVILGGTLVDRKPAGHEPSAE  190

Query  592  NGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQK  771
            +GG   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL      D  
Sbjct  191  DGG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKE-HPTLRSLVLADAD  245

Query  772  GNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVL  945
            G G + +  EQ+A  ++  L A    +     A  MK+ +   ++ P  G  ++G T V+
Sbjct  246  GQGTLCMGAEQLAEFRENRLSASACSNRTQVPACSMKLKYAPYLELPG-GLGLQGATLVV  304

Query  946  IGVSED  963
            I  S D
Sbjct  305  IKPSGD  310



>ref|XP_010052048.1| PREDICTED: F-box protein At5g46170 [Eucalyptus grandis]
 gb|KCW75903.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
 gb|KCW75904.1| hypothetical protein EUGRSUZ_D00284 [Eucalyptus grandis]
Length=407

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 98/331 (30%), Positives = 146/331 (44%), Gaps = 40/331 (12%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  R+ D K+L RC  VS+RF  L+P +  V+  +    S   ++   
Sbjct  45   HFDRLPDSLLLLIFNRVADVKALGRCGAVSRRFRQLVPQVDAVLVRVDCVISDDESASPA  104

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYL---------RQItggpslpspsstpAFNSVA  390
             S          +F + VL  + KP   L          Q     S  S +     +  A
Sbjct  105  LSDKGRG--PLASFVRAVLGNIVKPLQALGLFSGGARRAQAGASSSSSSLAVGSECDGEA  162

Query  391  FVNGI------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
               G+      + LK F+EI+ L I+ P          LLKW A  G     CV L +SS
Sbjct  163  DQGGVTHHSPTQVLKNFKEIRFLRIELPSGELGIDGGILLKWRADFGSTLDNCVILGASS  222

Query  547  sssdnddfsdELLAENG--GGDLNN-----PEAFALTNEMLRDRVEIAYQCFMEALWRRH  705
                    +  +  ENG   G  N+     PE+F  TN  L+ RV       + A  R +
Sbjct  223  VVRPEPLKN-SVGFENGTDAGCANDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHY  280

Query  706  VLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AG  867
            +L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+   +A       A 
Sbjct  281  LLQPIIAEH-KTLDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTMVPAL  335

Query  868  YMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
             M++W+   ++ P  G V++G T V I  SE
Sbjct  336  NMRLWYAPHLEMPD-GVVLKGATLVAIRPSE  365



>ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279399 isoform X1 [Zea 
mays]
 gb|ACF85349.1| unknown [Zea mays]
 gb|AFW82355.1| F-box domain containing protein isoform 1 [Zea mays]
 gb|AFW82356.1| F-box domain containing protein isoform 2 [Zea mays]
Length=354

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 140/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+  +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVSLVHDVYVKIDRVVAVDGDAEGT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S     +   +F K +L  + KPFH +R        P+ ++ P F  ++  +  + L
Sbjct  77   LNLSSPKPRSIFSHFLKLMLFTIIKPFHNMRS-------PNGTARPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLENCVILGGTRVDRKPVGGEHEPAL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSII-NGHPTLQSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  +Q+   ++  L      +     A  MK+ +   V+ P  G  ++G T V
Sbjct  245  DGQGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>gb|ACG24953.1| F-box domain containing protein [Zea mays]
Length=354

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 140/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+  +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVSLVHDVYVKIDRVVAVDGDAEGT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S     +   +F K +L  + KPFH +R        P+ ++ P F  ++  +  + L
Sbjct  77   LNLSSPKPRSIFSHFLKLMLFTIIKPFHNMRS-------PNGTARPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLENCVILGGTRVDRKPVGGEHEPAL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSII-NGHPTLQSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  +Q+   ++  L      +     A  MK+ +   V+ P  G  ++G T V
Sbjct  245  DGQGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea mays]
 gb|ACL52786.1| unknown [Zea mays]
Length=354

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 140/307 (46%), Gaps = 18/307 (6%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD ++LLIL ++ED +SL RCY VSKR   L+  +H+V   I    +   ++   
Sbjct  17   HFDCLPDSLVLLILNKVEDVRSLGRCYAVSKRLCGLVSLVHDVYVKIDRVVAVDGDAEGT  76

Query  238  psisdnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFL  414
             ++S     +   +F K +L  + KPFH +R        P+ ++ P F  ++  +  + L
Sbjct  77   LNLSSPKPRSIFSHFLKLMLFTIIKPFHNMRS-------PNGTARPLFPQLSQHSPAQVL  129

Query  415  KKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            + F  ++ L I+ P      ++  LLKW A  G     CV L  +           E   
Sbjct  130  RNFTHVRNLRIELPSGDVGTEEGVLLKWRAEYGSTLENCVILGGTRVDRKPVGGEHEPAL  189

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
            E+ G   + PE+F  TN  L+ RV       + A  R ++LR ++ + H TL+    TD 
Sbjct  190  EDNG---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSII-NGHPTLQSLVLTDA  244

Query  769  KGNGKVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAV  942
             G G + +  +Q+   ++  L      +     A  MK+ +   V+ P  G  ++G T V
Sbjct  245  DGQGTLCMGAKQLEEFRENQLSTSACSNRTQVPACNMKLKYAPYVELPG-GMALQGATLV  303

Query  943  LIGVSED  963
             I  S +
Sbjct  304  AIKPSPE  310



>ref|NP_001182880.1| hypothetical protein [Zea mays]
 gb|ACR35006.1| unknown [Zea mays]
 tpg|DAA57163.1| TPA: hypothetical protein ZEAMMB73_107043 [Zea mays]
Length=350

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 79/303 (26%), Positives = 135/303 (45%), Gaps = 18/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNV-IFsipdpdsspinsysnpsi  246
            L D ++LLIL +LED +SL RC  VSKRF+ L+  +H+V +              +    
Sbjct  21   LHDSLVLLILNKLEDVRSLGRCSAVSKRFSGLVLLVHDVRVKIDHVVTVDGGADDALNLS  80

Query  247  sdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
            S        +  K +L  ++KPFH +R        P  +    F  ++  + ++ LK F 
Sbjct  81   SPKPHNIISHLFKMMLFAIAKPFHDMRS-------PISAGRLLFPQLSQHSPVQVLKNFS  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++ L+++ P      ++  LLKW A  G     CV L  +           E   ++ G
Sbjct  134  HVRNLQVELPSGDVAVEEGVLLKWRAEYGSTLQSCVILGGTLVDRKAAGSGHEPSPDDKG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV     C + A  R ++LR ++ DH  TL      D +G G
Sbjct  194  ---SMPESF-YTNGGLKLRVVWTISCLIAASTRHYLLRSIINDH-PTLRSLVLADAEGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+ + ++  L A    +     A  MK+ +   ++ P  G  ++G T ++   
Sbjct  249  ALSMGAEQLNDFREHQLSASPCSNRTQVPACNMKLKYAQYLELPG-GLALQGATLLVTKP  307

Query  955  SED  963
            + D
Sbjct  308  ASD  310



>emb|CDX77641.1| BnaC07g18950D [Brassica napus]
Length=362

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 92/318 (29%), Positives = 142/318 (45%), Gaps = 34/318 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsi--pdpdsspinsy  231
            H   LPD +LLL+  ++ D KSL RC +VS+RF SL+  + NV+  +     D    +  
Sbjct  24   HFDHLPDSILLLVFNKISDVKSLGRCCVVSRRFHSLVTQVENVLIRVDCVISDDDNSSLS  83

Query  232  snpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRF  411
            S  S S  +G     F + V+  + KP     +                  V   +  + 
Sbjct  84   SIKSRSSASGPFSSIF-RLVVGGIVKPLQAGDEGGEIEQ----------GGVTHHSPTQV  132

Query  412  LKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELL  585
            LK F EI+ L I+ P       +  LLKW A  G     CV L +SS    N     + +
Sbjct  133  LKNFEEIRYLRIELPSGELGIDEGVLLKWRAEFGSTLDHCVILGASSVIQPNPMRVSQAI  192

Query  586  A----ENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLE  747
                 E+   D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H KTL 
Sbjct  193  VTTTVESPASDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KTLR  250

Query  748  EARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPK  909
                +D  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ P 
Sbjct  251  SLVLSDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLELPD  306

Query  910  TGRVMRGVTAVLIGVSED  963
             G V++G T V I  SE 
Sbjct  307  -GTVLKGATLVAIRPSES  323



>ref|XP_004486009.1| PREDICTED: F-box protein At5g46170-like [Cicer arietinum]
Length=402

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 94/338 (28%), Positives = 152/338 (45%), Gaps = 45/338 (13%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S   +S S 
Sbjct  28   HFDRIPDSLLLLVFNKIADVKALGRCCVVSRRFHSLVPQVENVLVRVDCVISDEDSSSST  87

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGI----  405
             S   + G    N  + V   ++KP   L Q  G     S  +  + +S +  + +    
Sbjct  88   ASSDKSRGPFW-NLLRLVFGGIAKPIQTLGQFLGPKRPSSNLNLTSSSSNSNSSPLTVGT  146

Query  406  --------------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslf  537
                          + LK F EI+ L I+ P      +D  LLKW A  G     CV L 
Sbjct  147  DDDGDGGVTHHSPTQVLKNFNEIRLLRIELPSGELGIEDGVLLKWRADFGSTLDNCVILG  206

Query  538  ssssssdnddfsdELLAENG-----------GGDLNNPEAFALTNEMLRDRVEIAYQCFM  684
            +SS           + A  G             + + P++F  TN  L+ RV       +
Sbjct  207  ASSVFHPKSQDGVVVDASCGVIAGGGNNGGVDDNGSIPDSF-YTNGGLKLRVVWTISSLI  265

Query  685  EALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-  861
             A  R ++L+ ++++H KTL+    TD  G G +Y+ ++Q   L++LR K P+   +A  
Sbjct  266  AASARHYLLQPIISEH-KTLDNLVLTDADGQGVLYMNRDQ---LEELRVK-PLSASSASK  320

Query  862  -----AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
                 A  M++W+   ++ P  G V++G T V I  SE
Sbjct  321  RTLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSE  357



>ref|XP_010277597.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera]
Length=372

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 84/316 (27%), Positives = 139/316 (44%), Gaps = 24/316 (8%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   L D +L LI  +++DAK+L RC  V KRF+SL+  + +++  +   D S      N
Sbjct  12   HFDRLHDSLLCLIFNKIQDAKTLGRCLAVCKRFSSLVRQVDSLVVKVDCVDDSVDADDRN  71

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
             S S  +  +       +  ++SK F +L++        S S    F+     + ++ LK
Sbjct  72   SSESHGSSLSIGLAKFLLYRIISKSFRFLQRTLLFNQKKSISDGSPFH----YSPVQVLK  127

Query  418  KFREIQRLEIQTPCFHAQDPSLL-----KWEAGLGKdsifcvslfssssssdnddfsdE-  579
            +F EI+ L IQ P               KW A  G     CV L ++S         ++ 
Sbjct  128  RFNEIRALRIQLPDDSGGYGGGGDGLLLKWRAEFGSSLQSCVFLGATSFQKTKLTCIEKG  187

Query  580  ------LLAENGGGDLNNPEAFA--LTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH  735
                  + + + GG+  +  +     TN  L+ R+     C + A  R H+L+ ++AD H
Sbjct  188  DRNDCSMSSASVGGEETSHGSHGSFCTNGKLKLRIVWTITCLIAASARHHLLQQIIAD-H  246

Query  736  KTLEEARFTDQKGNGKVYLRKEQVAN----LQDLRAKEPVDLRA-AEAGYMKVWHVSEVQ  900
             TL     TD  G G + + +EQ+A     L   R    +  R    A  +K+W+V  ++
Sbjct  247  PTLRSVVITDSCGQGTLCMGEEQIAESRQCLDSSRTSAALPGRTRVPAVNVKLWYVPRLE  306

Query  901  TPKTGRVMRGVTAVLI  948
             P +G VM G T + I
Sbjct  307  LPGSGYVMEGATLMAI  322



>ref|XP_011007418.1| PREDICTED: F-box protein At5g46170-like [Populus euphratica]
Length=405

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 98/342 (29%), Positives = 151/342 (44%), Gaps = 48/342 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +V  RF SL+P + NV+  +    S    S S+
Sbjct  29   HFDRLPDSLLLLVFNKIGDVKALGRCCVVCHRFHSLVPQVDNVVVRVDCVISDDDTSSSS  88

Query  238  psisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFV----  396
             S   ++  +   F    + V   + KPF  L Q+ G           +  SV       
Sbjct  89   SSTKSHSPSSSSGFSSIFRLVFGGIVKPFQALGQLLGPKVNSRNGFFNSSLSVGTTTTTD  148

Query  397  -------------NGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                         +  + LK F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  149  DDTEADQGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVI  208

Query  532  lfssssssdnddf-----------sdELLAENGGGDLNN--PEAFALTNEMLRDRVEIAY  672
            L ++S  ++N +            S   +  N G D N   PE+F  TN  L+ RV    
Sbjct  209  LGAASVFTNNKNSYVMQENDSICNSATAINNNSGVDDNGSIPESF-YTNGGLKLRVVWTI  267

Query  673  QCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLR  852
               + A  R ++L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+   
Sbjct  268  SSLIAASARHYLLQPIIAEH-KTLDSLVLTDADGQGVLRMNREQ---LEELRVK-PLSAS  322

Query  853  AAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +A       A  M++W+   ++ P  G V++G T V I  S+
Sbjct  323  SASKRTLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSD  363



>ref|XP_009399020.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=397

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 96/324 (30%), Positives = 146/324 (45%), Gaps = 28/324 (9%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLL+I  R+ D K+L RC  V +RF  L P + +V+  +    S   +  + 
Sbjct  30   HFDRLPDSVLLVIFNRIGDVKTLGRCCAVYRRFHDLAPLVDDVVVRVDCVISDDPSPSAP  89

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpA--FNS----VAFVN  399
                D       +F + VL  L KP   L Q+    S     +  +  F+S    V+  +
Sbjct  90   GGGFDKPHSVFSHFARFVLGGLVKPLEALCQMLSPASCADALARKSGLFSSSSPEVSHHS  149

Query  400  GIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfs  573
                LK F+EI+RL I+ P       D  LLKW+A  G     CV L +SS  S     +
Sbjct  150  PTEVLKNFKEIRRLRIELPYGELGVDDGVLLKWKADFGCTLESCVILGASSVVSSCSMSA  209

Query  574  dELLAEN--------GGGDLNN-PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVA  726
                 +         GG D  N PE+F   +  L+ RV       + A  R ++L  +VA
Sbjct  210  KSSEPDPNPSFQDACGGDDCGNIPESF-YADGSLKRRVVWTISSLIAASARHYLLHPIVA  268

Query  727  DHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAA-----EAGYMKVWHVS  891
            D ++TLE    TD  G G + L + Q   LQ+LR K  +   ++      A  M++W+  
Sbjct  269  D-NETLERLDLTDADGQGLLTLNRRQ---LQELRTKPVMSSGSSHRTLLPALNMRLWYAH  324

Query  892  EVQTPKTGRVMRGVTAVLIGVSED  963
            +++ P    V++G T + I  SE+
Sbjct  325  QLELPGE-MVLKGATLLAIRPSEE  347



>dbj|BAJ87191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 87/303 (29%), Positives = 138/303 (46%), Gaps = 19/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL +LED  SL RC  VS+RF  L+P +H+V   I    +   +     ++S
Sbjct  22   LPDSLVLLILNKLEDVHSLGRCSAVSRRFNELVPLVHDVYVKIDRVVAVDGDPDDALNLS  81

Query  250  dnnGE-TQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +  K +L  ++KPFH +R   G    P       F  +A  + ++ L+ F 
Sbjct  82   SPKPRHIFSHLFKLMLFTIAKPFHGMRGPGGAGGRPL------FPRLAQHSPVQVLRSFS  135

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++ L ++ P      ++  LLKW A  G     CV L  +    +      EL A   G
Sbjct  136  HVRNLRVELPSGDVGTEEGVLLKWRARYGSTLQSCVILGGTLVDRNGGH---ELPATEDG  192

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            G +  PE+F  TN  L+ RV       + A  R ++LR ++ +H  TL      D  G G
Sbjct  193  GSM--PESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKEH-PTLRSLVLADADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+A  ++  L A    +     A  MK+ +   ++ P  G  ++G T V+I  
Sbjct  249  TLCMGTEQLAEFRENRLSASACSNRTQVPACSMKLKYAPYLELPG-GLGLQGATLVVIKP  307

Query  955  SED  963
            S D
Sbjct  308  SGD  310



>ref|XP_008794503.1| PREDICTED: F-box protein At5g46170 [Phoenix dactylifera]
Length=396

 Score = 76.3 bits (186),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 95/318 (30%), Positives = 146/318 (46%), Gaps = 24/318 (8%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLL++  R+ D K L RC +V +RF +L+P + +V+  +    S      S 
Sbjct  41   HFDRLPDSVLLVVFNRIGDVKGLGRCCVVCRRFQALVPLVDDVVVRVDCVISDDATPSSV  100

Query  238  psisdnnGETQKN------FPKNVLNLLSKPFHYLRQ--ItggpslpspsstpAFNSVAF  393
             + + +     K         + VL+ L KP   L Q  I    +    S++ + + V+ 
Sbjct  101  AAAASSGCGLDKGRGVLSHLARLVLDGLVKPLQALGQMLIPASAAARRSSASSSSSEVSH  160

Query  394  VNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdndd  567
             +    LK F+EI+RL I+ P       D  LLKW+A  G     CV L +SS  S N  
Sbjct  161  HSPTEVLKNFKEIRRLRIELPAGELGVDDGVLLKWKADFGSTLDSCVILGASSIVSPNSS  220

Query  568  fsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLE  747
              +  + +   GD  +  +    N  L+ RV       + A  R ++L+ ++ADH +TLE
Sbjct  221  NPNPSIQDACSGD--DSGSIPEFNGTLKLRVLWTISSLIAASARHYLLQPIIADH-ETLE  277

Query  748  EARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPK  909
                TD  G G + + K Q   LQDLR K PV            A  M++ +   ++ P 
Sbjct  278  SLDLTDADGQGVLAMNKGQ---LQDLRVK-PVSASGTSQRTLLPALTMRLCYAPHLELPG  333

Query  910  TGRVMRGVTAVLIGVSED  963
             G +++G T V I  SED
Sbjct  334  -GVLLKGATLVAIRPSED  350



>ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Setaria italica]
Length=354

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 85/303 (28%), Positives = 136/303 (45%), Gaps = 18/303 (6%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLIL ++ED +SL RC  VSKRF  L+  +H+V   I        ++    ++S
Sbjct  21   LPDSLVLLILNKVEDVRSLGRCSAVSKRFCGLVSLVHDVYVKIDRVVGVDGDAEDALNLS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     +F K +L  + KPFH +R        P+ +  P F  ++  +  + L+ F 
Sbjct  81   SPKPRNIFSHFLKLMLFTIIKPFHNMRN-------PNGNGRPLFAQLSQHSPAQVLRNFT  133

Query  427  EIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             I+ L ++ P      ++  LLKW A  G     CV L  +           E   E+ G
Sbjct  134  HIRNLRVELPSGDVGTEEGVLLKWRAEYGSTLQNCVILGGTRVDRRPVGGEHEPSLEDNG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + PE+F  TN  L+ RV       + A  R ++LR ++ DH  TL     TD  G G
Sbjct  194  ---SMPESF-YTNGGLKLRVVWTISSLIAASTRHYLLRSIIKDH-PTLTSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQD--LRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGV  954
             + +  EQ+   ++  L A    +     A  MK+ +   ++ P  G  ++G T V I  
Sbjct  249  TLCMGAEQLKEFRENQLSASACSNRTQVPACNMKLKYSPYLELPG-GMALQGATLVAIKP  307

Query  955  SED  963
            S +
Sbjct  308  STE  310



>ref|XP_009406821.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009406822.1| PREDICTED: F-box protein At5g46170-like [Musa acuminata subsp. 
malaccensis]
Length=353

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 141/306 (46%), Gaps = 22/306 (7%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            +PD ++L+I  +L DA+SL RC  VS+RF SL+P + +V   I    +   +S  + ++S
Sbjct  21   IPDPLILVIFNKLADARSLGRCAAVSRRFRSLVPLVDDVYVKIDRVVTVDGDSCRSLTLS  80

Query  250  dnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFRE  429
                  +K F  + L L+   F  LR I    +            V+  +  + LK FR 
Sbjct  81   FP--RPRKCF-SHFLKLML--FAILRPIRNLHNPHCGGKRF-LPQVSHRSPAQVLKNFRH  134

Query  430  IQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGGG  603
            ++RL I+ P      +D  LL+W A  G     CV L  + +            AE+ G 
Sbjct  135  VRRLRIELPAGDVRTEDGVLLRWRAEFGSTLESCVILGGTPTDRLPPSSGRAGKAEDDG-  193

Query  604  DLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGK  783
              + PE+F  TN  L+ RV  A    + A  R ++L+ ++ DH  TLE    TD    G 
Sbjct  194  --SMPESF-YTNGGLKLRVVWAIGTLIAASTRHYLLQEIIEDH-PTLESLVLTDADEQGT  249

Query  784  VYLRKEQVANLQDLRAKEPVDLRAAE-----AGYMKVWHVSEVQTPKTGRVMRGVTAVLI  948
            + +  EQ   L++ R K  V   ++      A  MK+ +   ++ P+ G  M+G T V I
Sbjct  250  LSMGIEQ---LKEFREKPLVASASSTRTHLPASNMKLRYAPYLELPE-GMAMQGATLVAI  305

Query  949  GVSEDD  966
              + DD
Sbjct  306  SPATDD  311



>ref|NP_001044377.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAB56069.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06291.1| Os01g0770400 [Oryza sativa Japonica Group]
 dbj|BAG88022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 92/337 (27%), Positives = 140/337 (42%), Gaps = 45/337 (13%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPDEVLL +  R+ D K+L RC LVS+RF +L+P + +V   +    S      S  S  
Sbjct  19   LPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSSAGSAQ  78

Query  250  dnnGETQ-----------KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS----  384
                               +  + VL  + +P   L QI    +      + A  +    
Sbjct  79   AAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVSRRSAAPPAAPAP  138

Query  385  ----VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                V+  +    L+ F+E++RL I+ P      +D  LLKW+A  G     CV L +SS
Sbjct  139  AAADVSHHSPSEVLRSFKELRRLHIELPTGELGIEDGVLLKWKADFGSTLGSCVILGASS  198

Query  547  sssdnddfsdELLAENGGG------------DLNNPEAFALTNEMLRDRVEIAYQCFMEA  690
             +S                            +L N      TN  L+ RV       + A
Sbjct  199  VTSKPPPPPAAPPPTAADSSAASPDSSREPDELGNIPESLYTNGGLKLRVVWTISSLIAA  258

Query  691  LWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA-----  855
              R ++L+ ++ADH  TLE    TD  G G + + K Q   LQ+LR + PV         
Sbjct  259  SARHYLLQPIIADH-STLESLDLTDADGQGVLTMDKRQ---LQELRVR-PVSASGNSHRT  313

Query  856  -AEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSED  963
               A  M++W+   ++ P  G++++G T V I  SED
Sbjct  314  LMPALSMRLWYAPHIELPG-GQLLKGATLVAIRPSED  349



>gb|EEC71551.1| hypothetical protein OsI_03898 [Oryza sativa Indica Group]
Length=396

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 94/338 (28%), Positives = 143/338 (42%), Gaps = 47/338 (14%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPDEVLL +  R+ D K+L RC LVS+RF +L+P + +V   +    S      S  S  
Sbjct  19   LPDEVLLDVFGRIGDVKALGRCALVSRRFHALVPLVDSVFVRVDCVISDDPPPSSAGSAQ  78

Query  250  dnnGETQ-----------KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS----  384
                               +  + VL  + +P   L QI    +      + A  +    
Sbjct  79   AAAAAEGGPPAARGRGALAHLARLVLGGIVRPIQALGQILSPAAATVSRRSAAPPAAPAP  138

Query  385  ----VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                V+  +    L+ F+E++RL I+ P      +D  LLKW+A  G     CV L +SS
Sbjct  139  AAADVSHHSPSEVLRSFKELRRLHIELPTGELGIEDGVLLKWKADFGSTLGSCVILGASS  198

Query  547  sssdnddfsdELLAENGGG------------DLNN-PEAFALTNEMLRDRVEIAYQCFME  687
             +S                            +L N PE+   TN  L+ RV       + 
Sbjct  199  VTSKPPPPPAAPPPTAADSSAASPDSSREPDELGNIPESL-YTNGGLKLRVVWTISSLIA  257

Query  688  ALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA----  855
            A  R ++L+ ++ADH  TLE    TD  G G + + K Q   LQ+LR + PV        
Sbjct  258  ASARHYLLQPIIADH-STLESLDLTDADGQGVLTMDKRQ---LQELRVR-PVSASGNSHR  312

Query  856  --AEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSED  963
                A  M++W+   ++ P  G++++G T V I  SED
Sbjct  313  TLMPALSMRLWYAPHIELPG-GQLLKGATLVAIRPSED  349



>ref|XP_004134599.1| PREDICTED: F-box protein At5g46170-like [Cucumis sativus]
 gb|KGN49409.1| hypothetical protein Csa_6G523990 [Cucumis sativus]
Length=407

 Score = 73.2 bits (178),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 97/341 (28%), Positives = 144/341 (42%), Gaps = 50/341 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  R+ D K+L RC  VS+RF S++  + NV+  +    S    S ++
Sbjct  35   HFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDNVVVRVDCVISDDDFSSAS  94

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
             S   +       F + VL  + KP   L Q  G   + S     A              
Sbjct  95   SSSDKSRSGFSNLF-RMVLGGIVKPLQALGQFLGPKRVTSSGLGSASSSLSTSSLAVGRE  153

Query  379  -------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                   + V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  154  EDGESGQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGILLKWRADFGSTLDNCVI  213

Query  532  lfssssssdnddfsdELLAENGGGDLNN------------PEAFALTNEMLRDRVEIAYQ  675
            L ++S            + ENG     +            PE+F  TN  L+ RV     
Sbjct  214  LGAASVIHVGSFNKH--VQENGTDGFCSGNGPAADDSGSIPESF-YTNGGLKLRVVWTIS  270

Query  676  CFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA  855
              + A  R ++L+ ++A+H KTL+    TD  G G + + K+Q   L++LR K P+    
Sbjct  271  SLIAASARHYLLQPIIAEH-KTLDNLVLTDADGQGMLCMNKDQ---LEELRVK-PLSAST  325

Query  856  AE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  326  ASKRTLVPALNMRLWYAPHLELPG-GIVLKGATLVAIRPSE  365



>ref|XP_006415502.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
 gb|ESQ33855.1| hypothetical protein EUTSA_v10007915mg [Eutrema salsugineum]
Length=382

 Score = 72.8 bits (177),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 87/313 (28%), Positives = 133/313 (42%), Gaps = 30/313 (10%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsi--------pdpdsspinsysnpsis  249
            I  ++ D K L RC +VS+RF SL+P + NV+  +                +  S     
Sbjct  37   IFDKVADVKDLGRCSIVSRRFHSLVPFVENVLVRVDCVISDDDSSAADRRFSLNSASITD  96

Query  250  dnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGI--------  405
               G +     + V   + KPF  L Q  G     S SS    +  A  + I        
Sbjct  97   ATAGGSFSALFRLVFAPIFKPFQALGQFLGPKRSSSSSSLFHASFSALEDEIGSEIGVTH  156

Query  406  ----RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdndd  567
                + LK F EI+ L I+ P       D  LLKW A  G     C+ L +SS +  N +
Sbjct  157  HSPTQVLKNFAEIRLLRIELPTGELGIDDGILLKWRADFGSTLDNCMILGASSVTRSNPN  216

Query  568  fsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLE  747
                 + ++ G   N PEAF  TN  L+ RV       + A  R ++L+ ++ +H K+L+
Sbjct  217  LVKNPVDDDNG---NIPEAF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KSLD  271

Query  748  EARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRV  921
                +D  G G + + +EQ+  L+   L A          A  M++W+  E+  P  G V
Sbjct  272  RLVLSDADGQGVLSMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPELDLPD-GTV  330

Query  922  MRGVTAVLIGVSE  960
            ++G T V I  SE
Sbjct  331  LKGATLVAIRPSE  343



>ref|XP_009381361.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 72.4 bits (176),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 86/306 (28%), Positives = 131/306 (43%), Gaps = 24/306 (8%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++LLI  ++ D +SL RC  VSKRF SL+  +H+V        +   +     S S
Sbjct  21   LPDSIVLLIFNKVADVRSLGRCSAVSKRFNSLVFLVHDVYLKFDHVVTIDGDCDDPLSPS  80

Query  250  dnnGETQ-KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFR  426
                     NF K +L+ L KPFH L    GG     P        ++  +  + LK F 
Sbjct  81   SPRHRRLFSNFVKLILSTLLKPFHNLHSTNGGNKPIVP-------QLSHHSPAQILKNFA  133

Query  427  EIQ--RLEIQTPCFHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGG  600
             ++  R+E+       ++  +LKW A  G     CV    +           E   E+ G
Sbjct  134  HVRNLRIELLAGEVATEEGVILKWRAEFGSTIQNCVIFGGTRVDRKPVFSEHESPVEDSG  193

Query  601  GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
               + P++F  TN  L+ RV       + A  R + L+ ++ D H TL+    TD  G G
Sbjct  194  ---SIPDSF-YTNGGLKLRVVWTINSLIAASTRHYFLQPIIKD-HPTLKSLVLTDADGQG  248

Query  781  KVYLRKEQVANLQDLRAKEPVDLRAAE-----AGYMKVWHVSEVQTPKTGRVMRGVTAVL  945
             + +    V  L++ R K PV   A+      A  MK+ +   +  P  G  ++G T V 
Sbjct  249  TLNM---GVGQLKEFREKPPVASAASNRTQVPASNMKLKYSPYLDLPG-GMALQGATLVT  304

Query  946  IGVSED  963
            I  S D
Sbjct  305  IKPSSD  310



>ref|NP_564350.1| F-box protein [Arabidopsis thaliana]
 ref|NP_973940.1| F-box protein [Arabidopsis thaliana]
 sp|Q9C534.1|FB19_ARATH RecName: Full=F-box protein At1g30200 [Arabidopsis thaliana]
 gb|AAG50568.1|AC073506_10 hypothetical protein [Arabidopsis thaliana]
 gb|AAG50853.1|AC074176_2 hypothetical protein [Arabidopsis thaliana]
 gb|AAK59838.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAL24254.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AAN18072.1| At1g30200/F12P21_1 [Arabidopsis thaliana]
 gb|AEE31190.1| F-box protein [Arabidopsis thaliana]
 gb|AEE31191.1| F-box protein [Arabidopsis thaliana]
Length=379

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 135/309 (44%), Gaps = 25/309 (8%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp-----------insysnp  240
            I  ++ D K L RC +VS+RF SL+P + NV+  +    S               + ++ 
Sbjct  37   IFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDSSSSDENHRFSLNTASI  96

Query  241  sisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFN-----SVAFVNGI  405
            S +   G +     + V   + KPF  L QI G     S              V   +  
Sbjct  97   SDAGGAGGSFSALFRLVFAPIFKPFQMLGQILGPKRSSSSFDASFSAINDEIGVTHHSPT  156

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L+I+ P      +D  LLKW A  G     C+ L +SS    N   + E
Sbjct  157  QVLKNFGEIRFLKIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVIQSNSVKNHE  216

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
               +   G++  PE+F  TN  L+ RV       + A  R ++L+ ++ + HK+L+    
Sbjct  217  NSVDEDNGNI--PESF-YTNGGLKLRVVWTISSLIAASARHYLLQPII-NEHKSLDRLVL  272

Query  760  TDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGV  933
            +D  G G + + +EQ+  L+   L A          A  M++W+  E+  P  G V++G 
Sbjct  273  SDADGQGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPELDLPD-GTVLKGA  331

Query  934  TAVLIGVSE  960
            T V I  SE
Sbjct  332  TLVAIRPSE  340



>ref|XP_009804959.1| PREDICTED: F-box protein At1g30200-like [Nicotiana sylvestris]
Length=362

 Score = 71.6 bits (174),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 129/326 (40%), Gaps = 54/326 (17%)
 Frame = +1

Query  67   DLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsi  246
             LPD ++L I  +++D KSLC    + KRF SLI    N+                    
Sbjct  16   SLPDAIVLTIFDKVQDCKSLCIFSSLCKRFHSLITKTQNI-----------------SLT  58

Query  247  sdnnGETQKNFPKNVL-----NLLSKPFHYLRQItggpslpspsstpAFN---SVAFVNG  402
                   + N   N L      +  KPF +L +     +         +N   + ++ + 
Sbjct  59   IPPQNHHKSNSNTNQLFRFFNRVFLKPFQFLLRQITKWNPICIQKNDGYNCNCTFSYTSP  118

Query  403  IRFLKKFREIQRLEIQTPC-----FHAQDPSLLKWEAGLGKdsifcvslfssssssdndd  567
               L+ F EI++LEI+         +    SLLKW+A  G     C+ +  +S S     
Sbjct  119  AEILRNFSEIKQLEIRLAAGENIGLNNSGDSLLKWKAEFGSQLKHCLIVGGTSISR----  174

Query  568  fsdELLAENGGGDL--------------NNPEAFALTNEMLRDRVEIAYQCFMEALWRRH  705
                 + EN GG+               ++ E+  +TN+ L+ R+     C + A   RH
Sbjct  175  -----IHENQGGEETETETENFGIIQRGDSVESLRMTNDELKLRIVWIISCLIAAS-TRH  228

Query  706  VLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAEAGYMKVWH  885
             L        K LE+   TD  G G   +  EQV  ++        +     A  +K+W+
Sbjct  229  CLLEETIKEKKMLEKVVITDDIGQGICSMNCEQVEEMRRNTRVFSSNRSKVPALKVKMWY  288

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSED  963
            V E++ P  G VM+G T V++   E+
Sbjct  289  VPELELPAKGCVMKGATLVVVKPVEE  314



>ref|XP_004163869.1| PREDICTED: F-box protein At5g46170-like, partial [Cucumis sativus]
Length=421

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 99/341 (29%), Positives = 144/341 (42%), Gaps = 50/341 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI  R+ D K+L RC  VS+RF S++  + N +    D   S  +  S 
Sbjct  49   HFDRLPDSLLLLIFNRIGDVKALGRCCAVSRRFHSIVSQVDN-VVVRVDCVISDDDFSSA  107

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
             S SD +     N  + VL  + KP   L Q  G   + S     A              
Sbjct  108  SSSSDKSRSGFSNLFRMVLGGIVKPLQALGQFLGPKRVTSSGLGSASSSLSTSSLAVGRE  167

Query  379  -------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                   + V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  168  EDGESGQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGILLKWRADFGSTLDNCVI  227

Query  532  lfssssssdnddfsdELLAENGGGDLNN------------PEAFALTNEMLRDRVEIAYQ  675
            L ++S            + ENG     +            PE+F  TN  L+ RV     
Sbjct  228  LGAASVIHVGSFNKH--VQENGTDGFCSGNGPAADDSGSIPESF-YTNGGLKLRVVWTIS  284

Query  676  CFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA  855
              + A  R ++L+ ++A+H KTL+    TD  G G + + K+Q   L++LR K P+    
Sbjct  285  SLIAASARHYLLQPIIAEH-KTLDNLVLTDADGQGMLCMNKDQ---LEELRVK-PLSAST  339

Query  856  AE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  340  ASKRTLVPALNMRLWYAPHLELPG-GIVLKGATLVAIRPSE  379



>ref|XP_002317281.1| F-box family protein [Populus trichocarpa]
 gb|EEE97893.1| F-box family protein [Populus trichocarpa]
Length=405

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 95/344 (28%), Positives = 151/344 (44%), Gaps = 52/344 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLL+  ++ D K+L RC +V  RF SL+P + NV+  +    S    S S+
Sbjct  29   HFDRLPDSLLLLVFNKIGDVKALGRCCVVCLRFHSLVPQVDNVVVRVDCVISDDDTSSSS  88

Query  238  psisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFV----  396
             S   ++  +   F    + V   + KPF  L Q+ G           +  SV       
Sbjct  89   SSTKSHSPSSSSGFSSIFRLVFGGIVKPFQVLGQLLGPKVNSRNGFLNSSLSVGTTTSTD  148

Query  397  -------------NGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                         +  + LK F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  149  DDTEPDQGGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVI  208

Query  532  lfssssssdnddfsdELLAENGG---------------GDLNNPEAFALTNEMLRDRVEI  666
            L ++S  ++N +    ++ EN                  + + PE+F  TN  L+ RV  
Sbjct  209  LGAASVFTNNKNSF--VMQENDAICNSTAAINNNNGVDDNGSIPESF-YTNGGLKLRVVW  265

Query  667  AYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVD  846
                 + A  R ++L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+ 
Sbjct  266  TISSLIAASARHYLLQPIIAEH-KTLDSLVLTDADGQGVLRMNREQ---LEELRVK-PLS  320

Query  847  LRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
              +A       A  M++W+   ++ P  G V++G T V I  S+
Sbjct  321  ASSASKRTLVPALNMRLWYAPHLELPD-GVVLKGATLVAIRPSD  363



>ref|XP_010478400.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
 ref|XP_010478401.1| PREDICTED: F-box protein At1g30200-like [Camelina sativa]
Length=383

 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 84/314 (27%), Positives = 137/314 (44%), Gaps = 31/314 (10%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp--------------insy  231
            I  ++ D K L RC +VS+RF SL+P + NV+  +    S                  + 
Sbjct  37   IFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDSSSSDDNNNNRRFSLNA  96

Query  232  snpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------NSVA  390
            ++ S +   G +     + V   + KPF  L Q  G     S  ++ +          V 
Sbjct  97   ASISDAVAVGGSFSALFRLVFAPIFKPFQALGQFLGPKRSSSFDASFSSIDGEIEQGGVT  156

Query  391  FVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnd  564
              +  + LK F EI+ L I+ P      +D  LLKW A  G     C+ L +SS     +
Sbjct  157  HHSPTQVLKNFNEIRFLRIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVIRSKN  216

Query  565  dfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTL  744
              +  ++ E+ G   N PE+F  TN  L+ RV       + A  R ++L+ ++ +H KTL
Sbjct  217  LENCVVVDEDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KTL  271

Query  745  EEARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGR  918
            +    +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G 
Sbjct  272  DRLVLSDADGQGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-GS  330

Query  919  VMRGVTAVLIGVSE  960
            V++G T V I  SE
Sbjct  331  VLKGATLVAIRPSE  344



>ref|XP_010460807.1| PREDICTED: F-box protein At1g30200 [Camelina sativa]
Length=384

 Score = 69.7 bits (169),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 84/315 (27%), Positives = 134/315 (43%), Gaps = 32/315 (10%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp--------------insy  231
            I  ++ D K L RC +VS+RF SL+P + NV+  +    S                  + 
Sbjct  37   IFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDSSSSDDNNNNRRFSLNA  96

Query  232  snpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF--------NSV  387
            ++ S +   G +     + V   + KPF  L Q  G     S                 V
Sbjct  97   ASISDAVAVGGSFSALFRLVFAPIFKPFQALGQFLGPKRSSSSFDASFSSIDGEIEQGGV  156

Query  388  AFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdn  561
               +  + LK F EI+ L I+ P      +D  LLKW A  G     C+ L +SS     
Sbjct  157  THHSPTQVLKNFNEIRFLRIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVIRSK  216

Query  562  ddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
            +  +  ++ E+ G   N PE+F  TN  L+ RV       + A  R ++L+ ++ +H KT
Sbjct  217  NLENCVVVDEDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KT  271

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTG  915
            L+    +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G
Sbjct  272  LDRLVLSDADGQGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-G  330

Query  916  RVMRGVTAVLIGVSE  960
             V++G T V I  SE
Sbjct  331  SVLKGATLVAIRPSE  345



>ref|XP_002890858.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67117.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score = 68.9 bits (167),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 86/311 (28%), Positives = 135/311 (43%), Gaps = 27/311 (9%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp-----------insysnp  240
            I  ++ D K L RC +VS+RF SL+P + NV+  +    S               + ++ 
Sbjct  37   IFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDSSSSDENRRFSLNAASI  96

Query  241  sisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFN-------SVAFVN  399
            S +   G +     + V   + KPF  L Q        S SS  A          V   +
Sbjct  97   SDAAGAGGSFSALFRLVFAPIFKPFQALGQFLVPKRSSSSSSFDASFSAINDEIGVTHHS  156

Query  400  GIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfs  573
              + LK F EI+ L I+ P      +D  LLKW A  G     C+ L +SS    N   +
Sbjct  157  PTQVLKNFGEIRFLRIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVILSNQVKN  216

Query  574  dELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEA  753
             E   +   G++  PE+F  TN  L+ RV       + A  R ++L+ ++ +H KTL+  
Sbjct  217  LENSVDEDNGNI--PESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KTLDRL  272

Query  754  RFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMR  927
              +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G V++
Sbjct  273  VLSDADGQGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-GTVLK  331

Query  928  GVTAVLIGVSE  960
            G T V I  SE
Sbjct  332  GATLVAIRPSE  342



>ref|XP_009610193.1| PREDICTED: F-box protein At4g18380-like [Nicotiana tomentosiformis]
Length=371

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 131/317 (41%), Gaps = 39/317 (12%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsis  249
            LPD ++L I  +++D KSLC    + KRF SLI    N+            +    P   
Sbjct  17   LPDAIVLTIFDKVQDCKSLCIFSSLCKRFHSLITQTQNI------------SLKIPPQNH  64

Query  250  dnnGETQKNFPKNVLN-LLSKPFHY-LRQItg------gpslpspsstpAFN---SVAFV  396
              +  + +N      N +  KPF + LRQIT                T  +N   + ++ 
Sbjct  65   HKSSNSNRNQLFRFFNRVFLKPFRFFLRQITKWNPICIPIPYTFSQKTAGYNCNCTCSYT  124

Query  397  NGIRFLKKFREIQRLEIQTPC-----FHAQDPSLLKWEAGLG---Kdsifcvslfsssss  552
            +    L+ F EI++L+I+            D  LLKW+A  G   K  +       S   
Sbjct  125  SPAEILRNFSEIKQLDIRLAAGENIGLKNSDEPLLKWKAEFGSQLKHCLIVGGTSISPIH  184

Query  553  sdnddfsdELLAENGG----GDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHV  720
             ++     E  +EN G    GD +  E   ++N+ L+ R+     C + A   RH L   
Sbjct  185  ENHSGGETETESENFGIIQRGD-SVEETLRMSNDELKLRIVWIISCLIAAS-TRHCLLEE  242

Query  721  VADHHKTLEEARFTDQKGNGKVYLRKEQVANL-QDLRAKEPVDLRAAEAGYMKVWHVSEV  897
                 K LE+   TD  G G   +  EQV  + ++ R   P +     A  +K+W+V E+
Sbjct  243  TIKEKKMLEKVAITDDIGQGICSMNCEQVEEMRRNTRVFSP-NRSKVPALKVKMWYVPEL  301

Query  898  QTPKTGRVMRGVTAVLI  948
            + P  G   +G T V+I
Sbjct  302  ELPAKGCTTKGATLVVI  318



>ref|XP_008784858.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
 ref|XP_008784859.1| PREDICTED: F-box protein At5g46170-like [Phoenix dactylifera]
Length=410

 Score = 66.2 bits (160),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 97/328 (30%), Positives = 140/328 (43%), Gaps = 46/328 (14%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIP-------HIHNVIFsipdpdsspinsysnpsisd  252
            +  R+ D K+L RC +VS RF SL+P       H+  VI   P P SS   +        
Sbjct  45   VFNRIGDVKALGRCCVVSHRFHSLVPLVDYVVVHVDCVISDDPAPSSSSTTAAGCGGGGA  104

Query  253  nnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNG-------  402
               + +  F    + V   L KP   L QI    +  +   +   +S +  +        
Sbjct  105  GPDKGRGVFSHLTRLVFGSLVKPLQALGQILAPAASAASRRSSVSSSSSSSSSSSSSEVS  164

Query  403  ----IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnd  564
                   LK F+EI+RL I+ P      +D   LKW+A  G     CV L +SS  S + 
Sbjct  165  HHSPTEVLKNFKEIRRLRIELPSGEIRVEDGVFLKWKADFGSTLDNCVILCASSVLSSSS  224

Query  565  dfsdELLAEN---------GGGDLNN-PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLR  714
              S +    +         GG D  N PE+F  TN  L+ RV       + A  R ++L+
Sbjct  225  LLSPKSSNPDPNPSFQDACGGDDSGNIPESF-YTNGRLKLRVVWTISSLIAASARHYLLQ  283

Query  715  HVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA------AEAGYMK  876
             ++A+H +TLE    TD  G G + L K Q   LQ+LR K PV            A  M+
Sbjct  284  PIIANH-ETLESLDLTDADGQGVLTLSKGQ---LQELRVK-PVSASGMSQRTLVPALSMR  338

Query  877  VWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +W+   ++ P  G V+ G T V I  SE
Sbjct  339  LWYAPHLELPG-GVVLEGATLVAIRPSE  365



>ref|XP_006470730.1| PREDICTED: F-box protein At4g18380-like [Citrus sinensis]
Length=345

 Score = 65.9 bits (159),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 111/246 (45%), Gaps = 26/246 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            +   LPD +LL I  +L DAKSL RC +V KRF+SLIP I+N+            +    
Sbjct  14   YFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSLIPQINNLFL----------SIIPR  63

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
            P      G + K   ++VL +        R++       S ++  +  +  +   +    
Sbjct  64   PRRQVLIGNSSK---RSVLRIFFSKLKCFRRLFIITPKSSTANKDSIATTVWCPALSN-S  119

Query  418  KFREIQRLEIQTPCF---HAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            KFREI+ + +Q P +   +  D   +KW+A  G++   C+ L ++     N       LA
Sbjct  120  KFREIKYMNVQFPVYGNGNDDDYCFIKWKAAFGRELKSCIILGATLFCKKN-------LA  172

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
                  +   E F LT++ L+ R+     C + +  R   L+ +V++H + L+    +D 
Sbjct  173  WERIAPVQEEEHF-LTDDQLKLRIVWTISCLISSSARHQFLKPIVSEHSQ-LQRVVLSDC  230

Query  769  KGNGKV  786
            K  G++
Sbjct  231  KNQGQL  236



>ref|XP_010499543.1| PREDICTED: F-box protein At1g30200-like isoform X1 [Camelina 
sativa]
 ref|XP_010499544.1| PREDICTED: F-box protein At1g30200-like isoform X2 [Camelina 
sativa]
Length=383

 Score = 65.5 bits (158),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 85/314 (27%), Positives = 135/314 (43%), Gaps = 31/314 (10%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp--------------insy  231
            I  ++ D K L RC +VS+RF SL+P + NV+  +    S                  + 
Sbjct  37   IFDKVADVKDLGRCCIVSRRFHSLVPFVENVLVRVDCVISDDDSSSDDDDNNNRRFSLNA  96

Query  232  snpsisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpA---FNSVAFVNG  402
            ++ S +  +G +     + V   + KPF  L Q  G     S SS         V   + 
Sbjct  97   ASISDAVADGGSFSALFRLVFAPIFKPFQALGQFLGPKRSSSSSSFDGEIEQGGVTHHSP  156

Query  403  IRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd----sifcvslfssssssdnd  564
             + LK F EI+ L I+ P      +D  LLKW A  G       I   S    S+    +
Sbjct  157  TQVLKNFNEIRFLRIELPTGELGVEDGILLKWRADFGSTLDNCMILGASSVIRSNQVKKN  216

Query  565  dfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTL  744
              +  ++ E+ G   N PE+F  TN  L+ RV       + A  R ++L+ ++ + HKTL
Sbjct  217  LENCVVVDEDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITE-HKTL  271

Query  745  EEARFTDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGR  918
            +    +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G 
Sbjct  272  DRLVLSDADGQGVLCMDREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-GS  330

Query  919  VMRGVTAVLIGVSE  960
            V++G T V I  SE
Sbjct  331  VLKGATLVAIRPSE  344



>ref|XP_009360916.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
 ref|XP_009360917.1| PREDICTED: F-box protein At5g46170-like [Pyrus x bretschneideri]
Length=436

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 82/282 (29%), Positives = 124/282 (44%), Gaps = 38/282 (13%)
 Frame = +1

Query  40   SDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp  219
            S  D  H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S  
Sbjct  53   SSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCVISDD  112

Query  220  insysnpsisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAF----  378
             +S S+ S S ++ +++  F    + VL  + KP   L Q  G        S  A     
Sbjct  113  DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQALGQFLGPNRRSPNGSHSALSVDD  172

Query  379  --NSVAFVNGI-----------RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd  513
              +S A  N +           + LK F EI+ L I+ P       D  LLKW A  G  
Sbjct  173  PDSSAADSNSLDQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGS-  231

Query  514  sifcvslfssssssdnddfsdELLAENGGGDL---NN----------PEAFALTNEMLRD  654
            ++    +  +SS          LL + G   L   NN          P++F  TN  L+ 
Sbjct  232  TLDNCVILGASSVIHPGPTKASLLPDTGSDGLCATNNAAVTEDNGSIPDSF-YTNGGLKL  290

Query  655  RVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            RV       + A  R ++L+ ++++ HKTL+    TD  G G
Sbjct  291  RVVWTISSLIAASARHYLLQPIISE-HKTLDSLVLTDADGQG  331



>ref|XP_006446248.1| hypothetical protein CICLE_v10015553mg [Citrus clementina]
 gb|ESR59488.1| hypothetical protein CICLE_v10015553mg [Citrus clementina]
Length=389

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 111/246 (45%), Gaps = 26/246 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            +   LPD +LL I  +L DAKSL RC +V KRF+SLIP I+N+            +    
Sbjct  59   YFDSLPDAILLDIFNKLLDAKSLTRCLVVCKRFSSLIPQINNLFL----------SIIPR  108

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
            P      G + K   ++VL +        R++       S ++  +  +  +   +    
Sbjct  109  PRRQVLIGNSSK---RSVLRIFLSKLKCFRRLFIITPKSSAANKDSIATTVWCPALSN-S  164

Query  418  KFREIQRLEIQTPCF---HAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLA  588
            KFR+I+ + +Q P +   +  D   +KW+A  G++   C+ L ++     N       LA
Sbjct  165  KFRDIKYMNVQFPVYGNGNDDDYCFIKWKAAFGRELKSCIILGATLFCKKN-------LA  217

Query  589  ENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQ  768
                  +   E F LT++ L+ R+     C + +  R   L+ +V++H + L+    +D 
Sbjct  218  WERIAPVQEEEHF-LTDDQLKLRIVWTISCLISSSARHQFLKPIVSEHSQ-LQRVVLSDC  275

Query  769  KGNGKV  786
            K  G++
Sbjct  276  KNQGQL  281



>ref|XP_010517545.1| PREDICTED: F-box protein At4g18380 [Camelina sativa]
Length=391

 Score = 63.5 bits (153),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 73/273 (27%), Positives = 110/273 (40%), Gaps = 37/273 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI   + D KSL RC +VSKRF SLIP + NV+  +    S   +S   
Sbjct  24   HFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDCVISDDDSSSLV  83

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAF-------------  378
                 +           +  L+ KP   L Q        S SS  +              
Sbjct  84   SDKPRSVASVAATPFSAIFRLVIKPLQALGQFLKRSGSSSSSSASSASSSSSSASSLLIS  143

Query  379  ---------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd----  513
                       V   +  + LK F E++ L I+ P       D  LLKW A  G      
Sbjct  144  GGSDGEIEQGGVTHHSPTQVLKNFDELRFLRIELPSGELGIDDGVLLKWRAEFGSTLENC  203

Query  514  ----sifcvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCF  681
                +   +   +S     +++ +  ++ E+ G   + PE+F  TN  L+ RV       
Sbjct  204  VILGASSVIPATNSVDLGTSNNNNAAVVVEDNG---SIPESF-YTNGGLKLRVVWTISSL  259

Query  682  MEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            + A  R ++L+ ++A+ HKTL+    TD  G G
Sbjct  260  IAASARHYLLQPIIAE-HKTLDSLVLTDVDGQG  291



>gb|AEX97082.1| F-box family protein [Malus domestica]
Length=403

 Score = 63.5 bits (153),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 122/282 (43%), Gaps = 38/282 (13%)
 Frame = +1

Query  40   SDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp  219
            S  D  H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S  
Sbjct  20   SSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCVISDD  79

Query  220  insysnpsisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAF----  378
             +S S+ S S ++ +++  F    + VL  + KP   L Q+ G        S  A     
Sbjct  80   DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQALGQLLGPNRRSPNGSHSALSVDD  139

Query  379  -------------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd  513
                         + V   +  + LK F EI+ L I+ P       D  LLKW A  G  
Sbjct  140  PDSSATDSNSLDQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGS-  198

Query  514  sifcvslfssssssdnddfsdELLAENGGGDL---NN----------PEAFALTNEMLRD  654
            ++    +  +SS          L  + G   L   NN          P++F  TN  L+ 
Sbjct  199  TLDNCVILGASSVIHPGPTKASLFPDTGSDGLCATNNAAVTEDNGSIPDSF-YTNGGLKL  257

Query  655  RVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            RV       + A  R ++L+ ++++ HKTL+    TD  G G
Sbjct  258  RVVWTISSLIAASARHYLLQPIISE-HKTLDSLVLTDADGQG  298



>emb|CBI24219.3| unnamed protein product [Vitis vinifera]
Length=326

 Score = 63.2 bits (152),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 106/237 (45%), Gaps = 27/237 (11%)
 Frame = +1

Query  286  NVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQTPCFH  465
            + L +L +P  +L+QI    S  +   +   +SV  + G+  LK F EI  L IQ PC  
Sbjct  46   DFLKILVRPLQFLQQIVLQKSSGTLDLSE--DSVHQIAGV--LKHFSEINCLHIQLPCHG  101

Query  466  A------QDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGGGDLNNPEAF  627
                      SLLKW+A  G++   CV L ++S               +    ++     
Sbjct  102  GGLRSSNSADSLLKWKAEFGRELESCVLLGATSFQR-----------NDTISSIHEEYYK  150

Query  628  ALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH-HKTLEEARFTDQKGNGKVYLRKEQ  804
            +LT + L+ RV         A  R  +L+  V ++ HK L      D    G++++R+E 
Sbjct  151  SLTADELKLRVMWMISSLFAASARHCLLKQFVDNNDHKMLRGVVIADASKQGRLWMRQEL  210

Query  805  VANLQ-----DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +  L+      +    PV+     A  +K+WHV  ++ P +GRVM G T ++I  +E
Sbjct  211  LEELRTCLRRSMNPTAPVERTMVPAVRVKLWHVPVLELPASGRVMNGATLIVIRPAE  267



>ref|XP_010434544.1| PREDICTED: F-box protein At4g18380-like [Camelina sativa]
Length=393

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/275 (25%), Positives = 109/275 (40%), Gaps = 39/275 (14%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD +LLLI   + D KSL RC +VSKRF SLIP + NV+  +    S   +S   
Sbjct  24   HFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVVVRVDCVISDDDSSSLV  83

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQ------------------------Itggp  345
                 +           +  L+ KP   L Q                        +    
Sbjct  84   SDKPRSVASVAATPFSAIFRLVIKPLQALGQFLKRSGSSSSSSSSASSSSSSASSLLISG  143

Query  346  slpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd--  513
             +           V   +  + LK F E++ L I+ P       D  LLKW A  G    
Sbjct  144  GIGGDDGEIEQGGVTHHSPTQVLKNFDELRFLRIELPSGELGIDDGVLLKWRAEFGSTLE  203

Query  514  ------sifcvslfssssssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQ  675
                  +   +   +S     +++ ++ ++ E+ G   + PE+F  TN  L+ RV     
Sbjct  204  NCVILGASSVIPATNSVDLGTSNNNNNAVVVEDNG---SIPESF-YTNGGLKLRVVWTIS  259

Query  676  CFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
              + A  R ++L+ ++A+ HKTL+    TD  G G
Sbjct  260  SLIAASARHYLLQPIIAE-HKTLDTLVLTDVDGQG  293



>ref|XP_010052049.1| PREDICTED: F-box protein At5g46170-like [Eucalyptus grandis]
 gb|KCW75905.1| hypothetical protein EUGRSUZ_D00286 [Eucalyptus grandis]
Length=384

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 89/319 (28%), Positives = 141/319 (44%), Gaps = 39/319 (12%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsisdnnGETQK  273
            I  R+ D K+L RC +VS+RF  L+P +  V+  +    S   ++               
Sbjct  34   IFNRIADVKALGRCGVVSRRFRQLVPQVDAVLVRVDCVISDDESASPAALSDKARNPFAS  93

Query  274  NFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVN---------GI------R  408
             F   + N++ KP   L   +G        S+ + +S+A  +         G+      +
Sbjct  94   FFQAFLGNIV-KPLQALGLFSGAKRAQLGPSSSSSSSLAVGSERDGEMDQGGVTHHSPTQ  152

Query  409  FLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdEL  582
             LK F EI+ L I+ P          LLKW A  G     CV L +SS        +  +
Sbjct  153  VLKNFNEIRFLRIELPSGELGIDGGILLKWRADFGSTLDNCVILGASSVVQSGPVKNL-V  211

Query  583  LAENG--GGDLNN-----PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
             +ENG   G  N+     PE+F  TN  L+ RV       + A  R ++L+ ++A+H KT
Sbjct  212  GSENGTDAGCANDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KT  269

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQT  903
            L+    TD  G G + + +EQ   L++LR K P+   +A       A  M++W+   ++ 
Sbjct  270  LDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPHLEL  325

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P  G V++G T V I  SE
Sbjct  326  PD-GVVLKGATLVAIRPSE  343



>ref|XP_008371620.1| PREDICTED: F-box protein At5g46170-like [Malus domestica]
Length=403

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 121/282 (43%), Gaps = 38/282 (13%)
 Frame = +1

Query  40   SDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp  219
            S  D  H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+  +    S  
Sbjct  20   SSVDDDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCVISDD  79

Query  220  insysnpsisdnnGETQKNFP---KNVLNLLSKPFHYLRQItggpslpspsstpAF----  378
             +S S+ S S ++ +++  F    + VL  + KP   L Q+ G        S  A     
Sbjct  80   DSSPSSASSSSSSDKSRAPFSALFRLVLGGIVKPLQALGQLLGPNRRSPNGSHSALSVDD  139

Query  379  -------------NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd  513
                         + V   +  + LK F EI+ L I+ P       D  LLKW A  G  
Sbjct  140  PDSSATDSNSLDQSGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGS-  198

Query  514  sifcvslfssssssdnddfsdELLAENGGGDL---NN----------PEAFALTNEMLRD  654
            ++    +  +SS          L  + G   L   NN          P++F  TN  L+ 
Sbjct  199  TLDNCVILGASSVIHPGPTKASLFPDTGSDGLCATNNAAVTEDNGSIPDSF-YTNGGLKL  257

Query  655  RVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            RV       + A  R ++L+ ++ + HKTL+    TD  G G
Sbjct  258  RVVWTISSLIAASARHYLLQPIIXE-HKTLDSLVLTDADGQG  298



>gb|KDP37998.1| hypothetical protein JCGZ_04641 [Jatropha curcas]
Length=429

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/215 (32%), Positives = 99/215 (46%), Gaps = 37/215 (17%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L ++S  ++    S  
Sbjct  180  QVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVINNGHGKSFS  239

Query  580  LLAENGG--------------------GDLNN--PEAFALTNEMLRDRVEIAYQCFMEAL  693
            LL ENG                     GD N   PE+F  TN  L+ RV       + A 
Sbjct  240  LLQENGADVACGNINNNSNAVANVNSVGDDNGSIPESF-YTNGGLKLRVVWTISSLIAAS  298

Query  694  WRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE----  861
             R ++L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+   +A     
Sbjct  299  ARHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTL  353

Query  862  --AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
              A  M++W+   ++ P  G V++G T V I  SE
Sbjct  354  VPALNMRLWYAPHLELPD-GIVLKGATLVAIRPSE  387


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  23   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  66



>ref|XP_009774076.1| PREDICTED: F-box protein At4g18380-like [Nicotiana sylvestris]
Length=392

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 117/278 (42%), Gaps = 41/278 (15%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   +PD VLLL+   + D K+L RC LVSKRF SL+P + +VI  +    S   +S  +
Sbjct  19   HFDRIPDSVLLLVFNNIGDVKALGRCCLVSKRFNSLVPLVDSVIVRVDCVISDDDSSSPS  78

Query  238  psisdnnGETQ-------KNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNS----  384
             S +  +  T         +  + V + L KPF  + Q     S  + +S  A +     
Sbjct  79   TSNAVTSAVTSDKSRHPISSLFRLVFSGLLKPFQSISQFISVSSRHAGASASADDVDGDF  138

Query  385  ----VAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsss  546
                V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS
Sbjct  139  DHTFVTHHSPTQVLKNFNEIKFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGASS  198

Query  547  sssdnddfsdE--------------------LLAENGGGDLNNPEAFALTNEMLRDRVEI  666
                N+    E                       E   G +  PE+F  TN  L+ RV  
Sbjct  199  VIHSNNSVRTEDEQCRNGWENENNNDNNVGEGNVEMDNGSI--PESF-YTNGGLKLRVVW  255

Query  667  AYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
                 + A  R ++L+ ++A+ HKTL+    TD  G G
Sbjct  256  TISSLIAASARHYLLQPIIAE-HKTLDSLVLTDGDGQG  292



>gb|KHG06780.1| hypothetical protein F383_00742 [Gossypium arboreum]
Length=378

 Score = 62.0 bits (149),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 94/193 (49%), Gaps = 17/193 (9%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + L+ F EI+ L I+ P       D  LLKW A  G     CV L ++S  ++      E
Sbjct  153  QVLRNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVINNGISP--E  210

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
                NG  + + PE F  TN  L+ RV       + A  R ++L+ ++ADH KTL+    
Sbjct  211  FGVGNGDDNGSIPETF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIADH-KTLDSLVL  268

Query  760  TDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRV  921
            TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ P  G V
Sbjct  269  TDADGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPYLELPD-GFV  323

Query  922  MRGVTAVLIGVSE  960
            ++G T V I  SE
Sbjct  324  LKGATLVAIRPSE  336


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD VLLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  16   HFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVENVV  59



>ref|XP_002519646.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42619.1| conserved hypothetical protein [Ricinus communis]
Length=414

 Score = 61.6 bits (148),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 97/205 (47%), Gaps = 27/205 (13%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L ++S  ++  +    
Sbjct  175  QVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVINNAHNSKSS  234

Query  580  LLAENGGGDLNN------------PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVV  723
             L +    D NN            PE+F  TN  L+ RV       + A  R ++L+ ++
Sbjct  235  HLLQETVPDCNNGNSSSGDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPII  293

Query  724  ADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWH  885
            A+H KTL+    TD  G G + + +EQ   L++LR K P+   +A       A  M++W+
Sbjct  294  AEH-KTLDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTLVPALNMRLWY  348

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSE  960
              +++ P  G V++G T V I  SE
Sbjct  349  APQLELPD-GIVLKGATLVAIRPSE  372


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  24   HFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  67



>ref|XP_002531125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31259.1| conserved hypothetical protein [Ricinus communis]
Length=356

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 134/299 (45%), Gaps = 32/299 (11%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsisdnnGETQK  273
            I  +L D++SL +C LVSKRF+SL+    NV  SIP P     +S+             +
Sbjct  26   IFNKLCDSRSLAQCLLVSKRFSSLVFQADNVFLSIPTPKPKSASSHR--------NRASR  77

Query  274  NFPKNVLN-LLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQ  450
            N  + +++  ++KP  +   +    S  +         +++ +    LK F+ ++ L I+
Sbjct  78   NLLRTLVHKFIAKPLQFFPCVAAPKSPGNS------GCISYYSPNEVLKHFKNVKSLHIK  131

Query  451  TPCFHAQ------DPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGGGDLN  612
             P F  +        SLLKW+A    +   CV L ++S    N +     +     G   
Sbjct  132  VP-FQCEKIGLECSNSLLKWQAEFSGELKNCVVLSATSIQECNKNHC--CINHVEEGGGG  188

Query  613  NPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYL  792
                  L ++ L+ R+     C + A  R  +L+ ++A+HH  LE    +D    G++ +
Sbjct  189  GTVGQILNDDELKLRIVTTISCLIAASARHLLLKQILAEHH-MLENVTISDVNKQGRLCV  247

Query  793  RKEQVANLQDLRAKEPVDLRAAEAG-------YMKVWHVSEVQTPKTGRVMRGVTAVLI  948
             K+Q+  +++      V   ++           MK+W+V  ++ P TG +M+G T V+I
Sbjct  248  GKDQIVEMRNAMKSLAVSESSSSIERTPVPDLSMKLWYVPVLELPATGYLMKGATLVVI  306



>ref|XP_002863421.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39680.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score = 60.8 bits (146),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 95/202 (47%), Gaps = 24/202 (12%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N     +
Sbjct  159  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGASSVIQPNPMRISQ  218

Query  580  LL-------AENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH  732
             +       A   G D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H
Sbjct  219  AVDTSTVVEASGSGSDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH  277

Query  733  HKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSE  894
             KTL+    TD  G G + + +EQ   L++LR K P+   +A       A  M++W+   
Sbjct  278  -KTLDSLVLTDSDGQGVLCMNREQ---LEELRVK-PLAASSASKRTLVPALNMRLWYAPT  332

Query  895  VQTPKTGRVMRGVTAVLIGVSE  960
            ++ P  G V++G T V I  SE
Sbjct  333  LELPD-GTVLKGATLVAIRPSE  353


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>ref|XP_006654629.1| PREDICTED: F-box protein At5g46170-like [Oryza brachyantha]
Length=420

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 92/196 (47%), Gaps = 18/196 (9%)
 Frame = +1

Query  412  LKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELL  585
            L+ F+E++RL I+ P       +  LLKW+A  G     CV L +SS+  D    +  + 
Sbjct  184  LRSFKELRRLRIELPAGELSMDEGVLLKWKADFGSTLGSCVILGASSAGKDGAGAAPAVD  243

Query  586  AENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTD  765
                    + PE+F  TN  L+ RV       + A  R ++L+ ++ADH  TLE    TD
Sbjct  244  CGESDETGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIADH-ATLESLDLTD  301

Query  766  QKGNGKVYLRKEQVANLQDLRAK----EPVDLRAAE------AGYMKVWHVSEVQTPKTG  915
              G G + + K Q   LQ+LR K    +PV            A  M++W+   ++ P  G
Sbjct  302  ADGQGVLTMDKWQ---LQELRGKPLRVKPVSASGGSHRTLMPALSMRLWYAPHIELPG-G  357

Query  916  RVMRGVTAVLIGVSED  963
             V+ G T V I  SE+
Sbjct  358  LVLNGATLVAIKPSEE  373



>ref|XP_006307474.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
 gb|EOA40372.1| hypothetical protein CARUB_v10009099mg [Capsella rubella]
Length=453

 Score = 60.5 bits (145),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 91/190 (48%), Gaps = 12/190 (6%)
 Frame = +1

Query  412  LKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE--  579
            LK F EI+ L I+ P      +D  LLKW A  G     C+ L +SS    N   + E  
Sbjct  232  LKNFNEIRFLRIELPTGELGIEDGILLKWRADFGSTLDNCMILGASSVIPSNQVKNLENC  291

Query  580  LLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
            ++ E+ G   N PE+F  TN  L+ RV       + A  R ++L+ ++ +H KTL+    
Sbjct  292  VVDEDNG---NIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KTLDRLVL  346

Query  760  TDQKGNGKVYLRKEQVANLQ--DLRAKEPVDLRAAEAGYMKVWHVSEVQTPKTGRVMRGV  933
            +D  G G + + +EQ+  L+   L A          A  M++W+  ++  P  G V++G 
Sbjct  347  SDADGQGVLCMNREQLEELRVTPLSASSASKRTLVPALNMRLWYAPQLDLPD-GTVLKGA  405

Query  934  TAVLIGVSED  963
            T V I  SE 
Sbjct  406  TLVAIRPSES  415



>ref|XP_010441616.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 95/199 (48%), Gaps = 21/199 (11%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N   + +
Sbjct  159  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLENCVILGASSVIQPNPMRNSQ  218

Query  580  ----LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
                 + E    D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H KT
Sbjct  219  ACDTTIVEASASDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KT  276

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQT  903
            L+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ 
Sbjct  277  LDSLVLTDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLEL  332

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P  G V++G T V I  SE
Sbjct  333  PD-GTVLKGATLVAIRPSE  350


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>ref|XP_002305042.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 ref|XP_006384083.1| F-box family protein [Populus trichocarpa]
 gb|EEE85553.1| hypothetical protein POPTR_0004s06450g [Populus trichocarpa]
 gb|ERP61880.1| F-box family protein [Populus trichocarpa]
Length=398

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 121/273 (44%), Gaps = 31/273 (11%)
 Frame = +1

Query  40   SDSDGAHIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdssp  219
            S S   H   LPD +LL +  ++ D K+L RC +VS+RF SL+P + NV+  +    S  
Sbjct  28   SSSKIDHFDRLPDSLLLFVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVVVRVDCVISDD  87

Query  220  insysnpsisdnnGETQKNFP--KNVLNLLSKPFHYLRQItggpslpspsstpAFN----  381
              S S+ SI  ++  +       + V   +SKPF  L Q+ G        + P+ +    
Sbjct  88   DTSSSSSSIKSHSSSSSGFSSIFRLVFGGISKPFQALSQMFGTKVNSRNGNGPSLSVAAD  147

Query  382  --------SVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvs  531
                     V   +  + LK F EI+ L I+ P       D  LLKW A  G     CV 
Sbjct  148  DDMELDQAGVTHHSPTQVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVI  207

Query  532  lfssssssdnddfsdELLAEN----------GGGDLNNPEAFALTNEMLRDRVEIAYQCF  681
            L ++S  ++N   S  +  EN            G +  PE+F  TN  L+ RV       
Sbjct  208  LGAASVITNNKISSA-MQQENAAAAAAADDDDNGSI--PESF-YTNGGLKLRVVWTISSL  263

Query  682  MEALWRRHVLRHVVADHHKTLEEARFTDQKGNG  780
            + A  R ++L+ ++A+ HKTL+     D  G G
Sbjct  264  IAASARHYLLQPIIAE-HKTLDSLVLADADGQG  295



>ref|XP_010494785.1| PREDICTED: F-box protein At5g46170-like [Camelina sativa]
Length=389

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 95/199 (48%), Gaps = 21/199 (11%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N   + +
Sbjct  159  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGASSVIQPNPMRNSQ  218

Query  580  ----LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
                 + E    D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H KT
Sbjct  219  ACDTTIVEASASDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KT  276

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQT  903
            L+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ 
Sbjct  277  LDSLVLTDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLEL  332

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P  G V++G T V I  SE
Sbjct  333  PD-GTVLKGATLVAIRPSE  350


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>ref|XP_006279647.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
 gb|EOA12545.1| hypothetical protein CARUB_v10026571mg [Capsella rubella]
Length=388

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 94/199 (47%), Gaps = 21/199 (11%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N     +
Sbjct  158  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGASSVIQPNPMRISQ  217

Query  580  ----LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
                 + E    D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H KT
Sbjct  218  AVDTTIVEASASDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KT  275

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQT  903
            L+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ 
Sbjct  276  LDSLVLTDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLEL  331

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P  G V++G T V I  SE
Sbjct  332  PD-GTVLKGATLVAIRPSE  349


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>gb|ADE76154.1| unknown [Picea sitchensis]
Length=348

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 105/257 (41%), Gaps = 28/257 (11%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H+  +PD +LLLI  ++ D K+L RC  VSKRF  L+P + NV+  +    S      + 
Sbjct  6    HLDRIPDSLLLLIFNKVADIKALGRCCAVSKRFNFLVPQVENVVVKVDCVISGEDGGLNA  65

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLK  417
                        +  + ++  + KP   L+   G               V+  +    LK
Sbjct  66   KGKGII-----GHLVRFMIGSIVKPLQALQHFIGPRKAI-------LAEVSHHSPAEVLK  113

Query  418  KFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsif----cvslfssssssdnddfsdE  579
             F+EIQ L I+ P      +D  LLKW+A  G           +   S           +
Sbjct  114  NFKEIQHLRIELPGGELGVEDGVLLKWKAEFGSTLESCVIFGAASVLSKGLKTGSRRKIQ  173

Query  580  LLAEN------GGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHH  735
            L++++      G  D N   P++F + N  L+ RV       + A  R  +L+ ++ D H
Sbjct  174  LVSDDEPEGLEGLEDDNGSIPDSFYI-NSWLKLRVVWTISSLIAASARHFLLKEIIHD-H  231

Query  736  KTLEEARFTDQKGNGKV  786
             TL+    TD  G G +
Sbjct  232  PTLQNLVLTDADGQGTL  248



>ref|NP_199429.1| F-box protein [Arabidopsis thaliana]
 sp|Q9FNK5.1|FB285_ARATH RecName: Full=F-box protein At5g46170 [Arabidopsis thaliana]
 dbj|BAB08262.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL49842.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13195.1| unknown protein [Arabidopsis thaliana]
 gb|AED95349.1| F-box protein [Arabidopsis thaliana]
Length=395

 Score = 58.9 bits (141),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 64/202 (32%), Positives = 94/202 (47%), Gaps = 24/202 (12%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N     +
Sbjct  162  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGASSVIPPNPMRVSQ  221

Query  580  LL-------AENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADH  732
                     A   G D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H
Sbjct  222  ACDTTTVVEAPGSGSDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH  280

Query  733  HKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSE  894
             KTL+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   
Sbjct  281  -KTLDSLVLTDSDGQGVLCMNRDQ---LEELRVK-PLAASSASKRTLVPALNMRLWYAPT  335

Query  895  VQTPKTGRVMRGVTAVLIGVSE  960
            ++ P  G V++G T V I  SE
Sbjct  336  LELPD-GTVLKGATLVAIRPSE  356


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDHLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>ref|XP_010481487.1| PREDICTED: F-box protein At5g46170 [Camelina sativa]
Length=388

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 94/199 (47%), Gaps = 21/199 (11%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L +SS    N     +
Sbjct  158  QVLKNFDEIRYLRIELPSGELGIDDGVLLKWRAEFGSTLDNCVILGASSVIQPNPMRISQ  217

Query  580  ----LLAENGGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKT  741
                 + E    D N   PE+F  TN  L+ RV       + A  R ++L+ ++A+H KT
Sbjct  218  ACDTTVVEASASDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KT  275

Query  742  LEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQT  903
            L+    TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ 
Sbjct  276  LDSLFLTDSDGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPTLEL  331

Query  904  PKTGRVMRGVTAVLIGVSE  960
            P  G V++G T V I  SE
Sbjct  332  PD-GTVLKGATLVAIRPSE  349


 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  26   HFDRLPDSILLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  69



>ref|XP_010687117.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
 ref|XP_010687118.1| PREDICTED: F-box protein At4g18380 [Beta vulgaris subsp. vulgaris]
Length=408

 Score = 58.2 bits (139),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 93/196 (47%), Gaps = 18/196 (9%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKds---ifcvslfssssssdnddf  570
            + LK F EI+ L I+ P       D  LLKW A  G      +   +      S  +   
Sbjct  176  QVLKNFHEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGASSVVHVSKSSQMN  235

Query  571  sdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEE  750
             +E ++ N   + + PE+F  TN  L+ RV       + A  R ++L+ ++A+H +TL+ 
Sbjct  236  ENEQMSSNNDDNGSIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-QTLDS  293

Query  751  ARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKT  912
               TD  G G + + ++Q   L++LR K P+   +A       A  M++W+   ++ P  
Sbjct  294  LVLTDADGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPHLELPD-  348

Query  913  GRVMRGVTAVLIGVSE  960
            G +++G T V I  SE
Sbjct  349  GVILKGATLVAIRPSE  364


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +1

Query  49   DGA-HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            DG  H   LPD VLLL+  ++ D K+L RC +VS+RF +L+P + NV+
Sbjct  36   DGVDHFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFQTLVPQVENVV  83



>ref|XP_010549497.1| PREDICTED: F-box protein At1g30200 [Tarenaya hassleriana]
Length=398

 Score = 57.0 bits (136),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 96/202 (48%), Gaps = 23/202 (11%)
 Frame = +1

Query  412  LKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELL  585
            L+ F EI+ L I+ P       D  LLKW A  G     CV L +SS S  N   + E  
Sbjct  171  LRNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGASSVSRANPVKNHENS  230

Query  586  AENGGGD--LNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARF  759
             ++   D   N PE+F  TN  L+ RV       + A  R ++L+ ++ +H KTL+    
Sbjct  231  VDSSSIDDIGNIPESF-YTNGGLKLRVVWTISSLIAASARHYLLQPIITEH-KTLDRLIL  288

Query  760  TDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRV  921
            +D  G G + + +EQ   L++LR K P+   +A       A  M++W+  ++  P  G V
Sbjct  289  SDADGQGVLSMNREQ---LEELRVK-PLSASSASKRTLVPALNMRLWYSPQLDLPD-GTV  343

Query  922  MRGVTAVLIGVSE------DDD  969
             +G T V I  SE      DDD
Sbjct  344  FKGATLVAIRPSESKEEACDDD  365


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  R+ D K+L RC LVS+RF SL+P + NV+
Sbjct  28   HFDRLPDSLLLLVFDRISDIKALGRCCLVSRRFHSLVPLVENVL  71



>ref|XP_002974774.1| hypothetical protein SELMODRAFT_102245 [Selaginella moellendorffii]
 gb|EFJ24294.1| hypothetical protein SELMODRAFT_102245 [Selaginella moellendorffii]
Length=343

 Score = 56.6 bits (135),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 76/294 (26%), Positives = 128/294 (44%), Gaps = 28/294 (10%)
 Frame = +1

Query  94   ILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysnpsisdnnGETQK  273
            I  ++ D KSL RC  VSKRF SL   + NV+  +    S     + +       G   K
Sbjct  19   IFNKVSDVKSLGRCCAVSKRFYSLARTVDNVVVKVDCVISGDEAGHLSARGKGFFGHLLK  78

Query  274  NFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIRFLKKFREIQRLEIQT  453
             F   V  L  +   +L          + ++T A   V+  +    LK FR+++ L I+ 
Sbjct  79   FFGSMVRPL--QALQHLLVPKRALVASTSAATTAAADVSHHSPGEVLKNFRDLEHLRIEL  136

Query  454  PC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdELLAENGGGDLNNPEAF  627
            P      +D  LLKW+A  G     CV L +S+  +  D  + E        D N P+A 
Sbjct  137  PGGELEIEDGFLLKWKARYGSTLESCVILGASALINSGDQSTAE-------DDGNLPDA-  188

Query  628  ALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQV  807
               +   + RV       + A  R ++L++++A+ H +L+    TD  G G + + KEQ+
Sbjct  189  ---DGGFKLRVVWTISSLIAASGRHYLLQNIIAE-HPSLQSLVLTDADGQGMLCMDKEQL  244

Query  808  ANLQDLRAKEPVDLRAAEAG-------YMKVWHVSEVQTPKTGRVMRGVTAVLI  948
               +D    +P+   +A +         +K+W+   ++ P  G  ++G T V I
Sbjct  245  QQSRD----KPLPPSSASSNRTQVPSLNVKLWYAPHIELPG-GVALKGATLVSI  293



>ref|XP_006449020.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 ref|XP_006449021.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62260.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
 gb|ESR62261.1| hypothetical protein CICLE_v10015378mg [Citrus clementina]
Length=418

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 98/215 (46%), Gaps = 37/215 (17%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L ++S  ++      +
Sbjct  169  QVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVMNNVLAKPLD  228

Query  580  LLAEN-------------------GGGDLNN---PEAFALTNEMLRDRVEIAYQCFMEAL  693
            + A +                   GG   +N   PE+F  TN  L+ RV       + A 
Sbjct  229  IGATDLPCVSSNNNNSNNNNTNVNGGATDDNGSIPESF-YTNGGLKLRVVWTISSLIAAS  287

Query  694  WRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE----  861
             R ++L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+   +A     
Sbjct  288  ARHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTL  342

Query  862  --AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
              A  M++W+   ++ P  G V++G T V I  SE
Sbjct  343  VPALNMRLWYAPYLELPD-GVVLKGATLVAIRPSE  376


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD VLLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  20   HFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  63



>ref|XP_006468035.1| PREDICTED: F-box protein At5g46170-like isoform X1 [Citrus sinensis]
 ref|XP_006468036.1| PREDICTED: F-box protein At5g46170-like isoform X2 [Citrus sinensis]
 gb|KDO75441.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75442.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
 gb|KDO75443.1| hypothetical protein CISIN_1g014846mg [Citrus sinensis]
Length=417

 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 98/214 (46%), Gaps = 36/214 (17%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     CV L ++S  ++    + +
Sbjct  169  QVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGAASVMNNVLAKALD  228

Query  580  LLAEN-------------------GGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALW  696
            + A +                   G  D N   PE+F  TN  L+ RV       + A  
Sbjct  229  IGATDLPCVSSNNNNSNNNNTNVNGATDDNGSIPESF-YTNGGLKLRVVWTISSLIAASA  287

Query  697  RRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE-----  861
            R ++L+ ++A+H KTL+    TD  G G + + +EQ   L++LR K P+   +A      
Sbjct  288  RHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNREQ---LEELRVK-PLSASSASKRTLV  342

Query  862  -AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
             A  M++W+   ++ P  G V++G T V I  SE
Sbjct  343  PALNMRLWYAPYLELPD-GVVLKGATLVAIRPSE  375


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD VLLL+  ++ D K+L RC +VS+RF SL+P + NV+
Sbjct  20   HFDRLPDSVLLLVFNKIGDVKALGRCCVVSRRFHSLVPQVDNVV  63



>ref|XP_010086997.1| hypothetical protein L484_005892 [Morus notabilis]
 gb|EXB25437.1| hypothetical protein L484_005892 [Morus notabilis]
Length=410

 Score = 55.5 bits (132),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 96/208 (46%), Gaps = 30/208 (14%)
 Frame = +1

Query  406  RFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssssssdnddfsdE  579
            + LK F EI+ L I+ P       D  LLKW A  G     C+ L +SS           
Sbjct  168  QVLKNFNEIRFLRIELPSGELGIDDGVLLKWRADFGSTLDNCLILGASSVVYPGPPAKLS  227

Query  580  LLAEN-------------GGGDLNN--PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLR  714
             + ++             GGG+ N   P++F  TN  L+ RV       + A  R ++L+
Sbjct  228  SIEQSNGAEAFCYANGNVGGGEDNGSIPDSF-YTNGGLKLRVVWTISSLIAASARHYLLQ  286

Query  715  HVVADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRAAE------AGYMK  876
             ++++H KTL+    TD  G G + + ++Q   L++LR K P+   +A       A  M+
Sbjct  287  PIISEH-KTLDNLVLTDADGQGVLCMNRDQ---LEELRVK-PLSASSASKRTLVPALNMR  341

Query  877  VWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
            +W+   ++ P  G V++G T V I  SE
Sbjct  342  LWYAPHLELPD-GVVLKGATLVAIRPSE  368


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = +1

Query  19   DLEHRNSSDSDGA---HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            DL  R   + D     H   LPD +LLL+  ++ D K+L RC +VS+RF +L+P + NV+
Sbjct  7    DLTSRVYPEPDAMEIDHFDRLPDSLLLLVFNKIGDVKALGRCCVVSRRFHALVPQVENVV  66



>ref|XP_006646370.1| PREDICTED: F-box protein At5g46170-like, partial [Oryza brachyantha]
Length=275

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 92/206 (45%), Gaps = 28/206 (14%)
 Frame = +1

Query  409  FLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKd-------sifcvslfssssssdn  561
             L+ F+E++ L I+ P      +D  LLKW+A  G             VS       +  
Sbjct  30   VLRSFKELRSLRIELPSGELGIEDGVLLKWKADFGSTLGSCVILGASSVSSKPPPPPAAP  89

Query  562  ddfsdELLAENGGG-----DLNN-PEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVV  723
               + ++ A +        +L N PE+   TN  L+ RV       + A  R ++L+ ++
Sbjct  90   PPTAADISAASPDSSREPDELGNIPESL-YTNGGLKLRVVWTISSLIAASARHYLLQPII  148

Query  724  ADHHKTLEEARFTDQKGNGKVYLRKEQVANLQDLRAKEPVDLRA------AEAGYMKVWH  885
            ADH  TLE    TD  G G + + K Q   LQ+LR + PV            A  M++W+
Sbjct  149  ADH-STLESLDLTDADGQGVLTMNKRQ---LQELRVR-PVSASGNSHRTLMPALSMRLWY  203

Query  886  VSEVQTPKTGRVMRGVTAVLIGVSED  963
               ++ P  G++++G T V I  SED
Sbjct  204  APHIELPG-GQLLKGATLVAIRPSED  228



>emb|CDP21114.1| unnamed protein product [Coffea canephora]
Length=420

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 68/238 (29%), Positives = 100/238 (42%), Gaps = 51/238 (21%)
 Frame = +1

Query  379  NSVAFVNGIRFLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfsssss  552
            +SV   +  + LK F EI  L I+ P       D  LLKW A  G     CV L +SS  
Sbjct  143  SSVTHHSPTQVLKNFNEISFLRIELPSGELGIDDGVLLKWRADFGSTLDNCVILGASSII  202

Query  553  sdnddfsdE-------------LLAENGGGDLNN-----------------------PEA  624
             +    + +                EN G D +N                       PE+
Sbjct  203  KNYKSSTCDDQISNCNNIVEPVRAHENNGNDNSNHPANTDHSNSNNSNSNESDNGSIPES  262

Query  625  FALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVYLRKEQ  804
            F  TN  L+ RV       + A  R ++L+ ++A+H KTL+    TD  G G + + KEQ
Sbjct  263  F-YTNGGLKLRVVWTISSLIAASARHYLLQPIIAEH-KTLDSLVLTDADGQGVLCMNKEQ  320

Query  805  VANLQDLRAKEPVDLRAAE------AGYMKVWHVSEVQTPKTGRVMRGVTAVLIGVSE  960
               L++LR K P+   +A       A  M++W+   ++ P  G V++G T V I  SE
Sbjct  321  ---LEELRVK-PLSASSASKRTLVPALNMRLWYAPHLELPD-GTVLKGATLVAIRPSE  373


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC LVS+RF +L+P + NV+
Sbjct  19   HFDRLPDSLLLLVFNKIGDVKALGRCCLVSRRFHTLVPQVENVV  62



>ref|XP_006283811.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
 gb|EOA16709.1| hypothetical protein CARUB_v10004910mg, partial [Capsella rubella]
Length=418

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLLI   + D KSL RC +VSKRF SLIP + NV+
Sbjct  48   HFDHLPDSILLLIFNNIGDVKSLGRCCVVSKRFHSLIPQVENVV  91



>ref|XP_006854457.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
 gb|ERN15924.1| hypothetical protein AMTR_s00039p00227540 [Amborella trichopoda]
Length=354

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 103/263 (39%), Gaps = 49/263 (19%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVIFsipdpdsspinsysn  237
            H   LPD VLLLI  +++D KSL  C  VSKRF SLIP + +++  +             
Sbjct  18   HFERLPDSVLLLIFNKVQDIKSLGLCLSVSKRFFSLIPMVEDILIKVDCVI---------  68

Query  238  psisdnnGETQKNFPKNVLNLLSKPFHYLRQItggpslpspsstpAFNSVAFVNGIR---  408
                     T    P N     S+   +L  +          S  AF+ +     IR   
Sbjct  69   ---------TDDEDPIN-----SRTRGFLSHLLKMVMGSFVKSLEAFHKLVTPQKIRVSE  114

Query  409  --------FLKKFREIQRLEIQTPC--FHAQDPSLLKWEAGLGKdsifcvslfssss---  549
                     LK F  I+ L+IQ P       D  LLKW A  G     CV L +SS    
Sbjct  115  VTHHSPVEVLKSFSSIRTLKIQLPNGELGFGDGVLLKWRAEFGTSLESCVILGASSVIEP  174

Query  550  ------ssdnddfsdELLAENGGGDLNNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVL  711
                  +  +DD       E+  G +  PE+F + N  L+ RV       + A  R  VL
Sbjct  175  GFVREKTRVSDDLDMAFYGEDESGTI--PESFYI-NGGLKLRVVWTISSLIAASARHFVL  231

Query  712  RHVVADHHKTLEEARFTDQKGNG  780
            + ++++ H  LE    TD    G
Sbjct  232  QQIISE-HPGLERLTVTDCDNQG  253



>ref|XP_002870048.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46307.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=386

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLLI   + D K+L RC +VSKRF SLIP + NV+
Sbjct  24   HFDHLPDSILLLIFNNIGDVKALGRCSVVSKRFHSLIPQVENVV  67



>ref|XP_006414111.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
 gb|ESQ55564.1| hypothetical protein EUTSA_v10025383mg [Eutrema salsugineum]
Length=397

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D K+L RC +VSKRF SL+P + NV+
Sbjct  24   HFDHLPDSILLLVFNKIGDVKALGRCCVVSKRFHSLVPQVENVV  67



>gb|EEE55450.1| hypothetical protein OsJ_03607 [Oryza sativa Japonica Group]
Length=851

 Score = 52.8 bits (125),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 13/124 (10%)
 Frame = +1

Query  610  NNPEAFALTNEMLRDRVEIAYQCFMEALWRRHVLRHVVADHHKTLEEARFTDQKGNGKVY  789
            N PE+   TN  L+ RV       + A  R ++L+ ++ADH  TLE    TD  G G + 
Sbjct  688  NIPESL-YTNGGLKLRVVWTISSLIAASARHYLLQPIIADH-STLESLDLTDADGQGVLT  745

Query  790  LRKEQVANLQDLRAKEPVDLRA------AEAGYMKVWHVSEVQTPKTGRVMRGVTAVLIG  951
            + K Q   LQ+LR + PV            A  M++W+   ++ P  G++++G T V I 
Sbjct  746  MDKRQ---LQELRVR-PVSASGNSHRTLMPALSMRLWYAPHIELPG-GQLLKGATLVAIR  800

Query  952  VSED  963
             SED
Sbjct  801  PSED  804



>ref|XP_006398302.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
 gb|ESQ39755.1| hypothetical protein EUTSA_v10000919mg [Eutrema salsugineum]
Length=387

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +1

Query  58   HIHDLPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            H   LPD +LLL+  ++ D KSL RC +VS+RF SL+P + N++
Sbjct  24   HFDRLPDSILLLVFNKIGDVKSLGRCCVVSRRFHSLVPQVENIV  67



>emb|CDX78847.1| BnaA01g09140D [Brassica napus]
Length=238

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            LPD +LLL+  R+ D K+L RC +VSKRF SL+P + NV+
Sbjct  27   LPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENVV  66



>emb|CDX99469.1| BnaC01g10830D [Brassica napus]
Length=227

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +1

Query  70   LPDEVLLLILRRLEDAKSLCRCYLVSKRFASLIPHIHNVI  189
            LPD +LLL+  R+ D K+L RC +VSKRF SL+P + NV+
Sbjct  27   LPDSILLLVFNRIGDVKALGRCGVVSKRFHSLVPQVENVV  66



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2108914979916