BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81172_g1_i1 len=645 path=[623:0-644]

Length=645
                                                                      Score     E

gb|AEW24432.1|  late embryogenesis abundant protein 3L-1              78.6    3e-15   
ref|XP_004247410.1|  PREDICTED: indole-3-acetic acid-induced prot...  77.0    1e-14   
ref|XP_009601603.1|  PREDICTED: late embryogenesis abundant prote...  76.6    1e-14   
ref|XP_009799468.1|  PREDICTED: late embryogenesis abundant prote...  74.7    7e-14   
ref|NP_001275471.1|  uncharacterized protein LOC102577657             74.3    1e-13   
emb|CDP17116.1|  unnamed protein product                              73.2    3e-13   
emb|CAA66948.1|  protein induced upon tuberization                    73.2    3e-13   Solanum demissum
ref|XP_009772870.1|  PREDICTED: indole-3-acetic acid-induced prot...  71.6    8e-13   
gb|ABB87099.1|  unknown                                               71.6    9e-13   Solanum tuberosum [potatoes]
gb|AAW31666.1|  putative late-embryogenesis protein-like protein      71.6    1e-12   Ammopiptanthus mongolicus
ref|XP_009799351.1|  PREDICTED: late embryogenesis abundant prote...  70.9    2e-12   
gb|ADW66129.1|  late embryogenesis abundant protein Lea5              69.7    4e-12   
ref|XP_009596682.1|  PREDICTED: late embryogenesis abundant prote...  69.7    4e-12   
ref|XP_009594113.1|  PREDICTED: indole-3-acetic acid-induced prot...  69.7    4e-12   
ref|XP_007050958.1|  Indole-3-acetic acid-induced protein ARG2, p...  68.9    7e-12   
ref|XP_007145200.1|  hypothetical protein PHAVU_007G218700g           66.6    6e-11   
ref|XP_006355810.1|  PREDICTED: late embryogenesis abundant prote...  66.2    6e-11   
ref|XP_002270639.1|  PREDICTED: indole-3-acetic acid-induced prot...  65.9    1e-10   Vitis vinifera
gb|AFK35936.1|  unknown                                               65.5    2e-10   
gb|AAC06242.1|  late embryogenis abundant protein 5                   65.1    2e-10   Nicotiana tabacum [American tobacco]
ref|XP_010684355.1|  PREDICTED: late embryogenesis abundant prote...  64.3    3e-10   
ref|XP_009793725.1|  PREDICTED: late embryogenesis abundant prote...  64.3    3e-10   
gb|ACJ84182.1|  unknown                                               64.3    4e-10   Medicago truncatula
ref|XP_004240547.1|  PREDICTED: late embryogenesis abundant prote...  63.9    5e-10   
gb|AHI85716.1|  stress-induced protein 11                             63.5    6e-10   
gb|EYU46739.1|  hypothetical protein MIMGU_mgv1a017080mg              62.8    1e-09   
ref|XP_006444379.1|  hypothetical protein CICLE_v10023029mg           62.8    1e-09   
ref|XP_007163120.1|  hypothetical protein PHAVU_001G207900g           62.4    2e-09   
ref|XP_011082454.1|  PREDICTED: late embryogenesis abundant prote...  61.2    3e-09   
gb|KEH24388.1|  late embryogenesis abundant protein                   61.6    4e-09   
ref|XP_004494380.1|  PREDICTED: indole-3-acetic acid-induced prot...  61.2    4e-09   
ref|XP_010088289.1|  Indole-3-acetic acid-induced protein ARG2        61.2    5e-09   
gb|AHI85715.1|  stress-induced protein 10                             61.2    5e-09   
gb|EPS70797.1|  hypothetical protein M569_03965                       60.8    5e-09   
ref|XP_004246056.1|  PREDICTED: late embryogenesis abundant prote...  60.8    6e-09   
gb|KHG16920.1|  Indole-3-acetic acid-induced ARG2                     60.8    7e-09   
ref|XP_006479985.1|  PREDICTED: indole-3-acetic acid-induced prot...  60.8    7e-09   
ref|NP_001237596.1|  uncharacterized protein LOC100527032             60.8    7e-09   
ref|XP_010069902.1|  PREDICTED: indole-3-acetic acid-induced prot...  60.5    8e-09   
ref|XP_003546362.1|  PREDICTED: late embryogenesis abundant prote...  60.5    9e-09   
ref|XP_006288964.1|  hypothetical protein CARUB_v10002338mg           60.1    9e-09   
ref|XP_010429564.1|  PREDICTED: late embryogenesis abundant prote...  59.7    2e-08   
ref|XP_004495942.1|  PREDICTED: indole-3-acetic acid-induced prot...  59.7    2e-08   
gb|KHN20395.1|  Indole-3-acetic acid-induced protein ARG2             59.7    2e-08   
gb|AFK36920.1|  unknown                                               59.3    2e-08   
ref|XP_010422602.1|  PREDICTED: late embryogenesis abundant prote...  59.3    2e-08   
gb|ADQ91844.1|  late embryogenesis abundant protein group 6 protein   59.3    2e-08   
gb|ACJ46652.1|  intrinsically disordered protein 1                    59.3    2e-08   Lotus japonicus
ref|XP_004136021.1|  PREDICTED: indole-3-acetic acid-induced prot...  59.3    2e-08   
gb|ADP23916.1|  late embryogenesis abundant protein                   58.9    3e-08   
ref|XP_004165917.1|  PREDICTED: late embryogenesis abundant prote...  59.3    3e-08   
ref|NP_001237743.1|  uncharacterized protein LOC100306369             58.9    3e-08   
gb|KFK30826.1|  hypothetical protein AALP_AA6G030900                  58.9    3e-08   
gb|AFK48640.1|  unknown                                               58.2    5e-08   
ref|XP_011079638.1|  PREDICTED: late embryogenesis abundant prote...  58.2    5e-08   
ref|XP_002872843.1|  hypothetical protein ARALYDRAFT_327563           59.7    5e-08   
ref|NP_001238729.1|  uncharacterized protein LOC100306430             58.2    6e-08   
ref|XP_010069903.1|  PREDICTED: indole-3-acetic acid-induced prot...  57.8    8e-08   
ref|XP_007201902.1|  hypothetical protein PRUPE_ppa013814mg           57.8    9e-08   
ref|XP_008235109.1|  PREDICTED: indole-3-acetic acid-induced prot...  57.4    1e-07   
ref|NP_567231.1|  senescence-associated protein SAG21                 57.4    1e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KHN43505.1|  Indole-3-acetic acid-induced protein ARG2             57.4    1e-07   
ref|XP_009134437.1|  PREDICTED: indole-3-acetic acid-induced prot...  57.4    1e-07   
gb|KDO71708.1|  hypothetical protein CISIN_1g034332mg                 57.4    1e-07   
sp|P32292.1|ARG2_VIGRR  RecName: Full=Indole-3-acetic acid-induce...  57.0    1e-07   Vigna radiata var. radiata [golden gram]
gb|AFK37878.1|  unknown                                               57.0    1e-07   
gb|KDO71707.1|  hypothetical protein CISIN_1g034332mg                 57.0    1e-07   
ref|XP_006576268.1|  PREDICTED: indole-3-acetic acid induced prot...  56.6    2e-07   
gb|ABG66530.1|  putative late embryogenesis abundant protein          56.6    2e-07   Prosopis juliflora [algorrobo]
gb|KDP28178.1|  hypothetical protein JCGZ_13949                       56.6    2e-07   
ref|NP_001237642.1|  uncharacterized protein LOC100500411             56.2    2e-07   
ref|XP_006418300.1|  hypothetical protein EUTSA_v10009185mg           56.2    3e-07   
ref|XP_002523101.1|  Indole-3-acetic acid-induced protein ARG2, p...  56.2    3e-07   Ricinus communis
ref|XP_010259514.1|  PREDICTED: late embryogenesis abundant prote...  56.2    3e-07   
ref|XP_010325649.1|  PREDICTED: late embryogenesis abundant prote...  55.5    5e-07   
ref|NP_001238473.1|  indole-3-acetic acid induced protein ARG-2 h...  55.1    5e-07   
ref|XP_002892126.1|  late embryogenesis abundant 3 family protein     55.5    6e-07   
ref|XP_009119608.1|  PREDICTED: late embryogenesis abundant prote...  55.5    6e-07   
ref|XP_009144576.1|  PREDICTED: indole-3-acetic acid-induced prot...  55.1    7e-07   
ref|NP_001276069.1|  late embryogenesis abundant protein Lea5         55.1    8e-07   
gb|KDO71712.1|  hypothetical protein CISIN_1g034332mg                 55.1    8e-07   
ref|XP_010522797.1|  PREDICTED: indole-3-acetic acid-induced prot...  54.7    9e-07   
ref|XP_009146587.1|  PREDICTED: late embryogenesis abundant prote...  54.7    1e-06   
ref|XP_006303463.1|  hypothetical protein CARUB_v10010737mg           54.7    1e-06   
ref|NP_001235600.1|  desiccation protective protein LEA5              54.7    1e-06   
ref|XP_006396445.1|  hypothetical protein EUTSA_v10029091mg           54.3    1e-06   
gb|AAC19273.1|  T14P8.2                                               56.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138926.1|  hypothetical protein PHAVU_009G249500g           54.3    1e-06   
ref|XP_007147243.1|  hypothetical protein PHAVU_006G107900g           54.3    2e-06   
ref|XP_009348806.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.9    2e-06   
ref|XP_009335697.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.9    2e-06   
ref|XP_008369025.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.9    2e-06   
ref|XP_009111293.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.9    2e-06   
ref|XP_008359415.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.5    3e-06   
emb|CDY15266.1|  BnaC05g01450D                                        53.5    3e-06   
ref|XP_009335719.1|  PREDICTED: indole-3-acetic acid-induced prot...  53.5    3e-06   
emb|CDY55365.1|  BnaA02g36510D                                        53.5    3e-06   
emb|CDY50390.1|  BnaCnng19220D                                        53.5    3e-06   
emb|CDY01913.1|  BnaC02g28140D                                        53.1    3e-06   
ref|XP_010548983.1|  PREDICTED: late embryogenesis abundant prote...  53.5    3e-06   
gb|KFK42636.1|  hypothetical protein AALP_AA1G021000                  53.1    3e-06   
gb|ABG54481.1|  late embryogenesis abundant protein                   53.1    4e-06   Tamarix androssowii
gb|ABD93882.1|  group 5 late embryogenesis abundant protein           53.1    4e-06   Citrus unshiu [satsuma mandarin]
ref|XP_010474858.1|  PREDICTED: late embryogenesis abundant prote...  53.1    4e-06   
emb|CDY22046.1|  BnaA09g00750D                                        52.8    5e-06   
emb|CDY57180.1|  BnaC03g73200D                                        52.8    5e-06   
gb|KHN26544.1|  Late embryogenesis abundant protein Lea5              52.8    5e-06   
ref|XP_010456043.1|  PREDICTED: late embryogenesis abundant prote...  52.8    5e-06   
sp|P46522.1|LEA5D_GOSHI  RecName: Full=Late embryogenesis abundan...  52.8    5e-06   Gossypium hirsutum [American cotton]
gb|KHG30665.1|  Late embryogenesis abundant Lea5-A                    52.8    5e-06   
ref|NP_193326.4|  protein DROUGHT-INDUCED 21                          52.8    6e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ABF29697.1|  late embryogenesis abundant protein 5                 52.4    6e-06   Populus suaveolens [Mongolian poplar]
ref|XP_011009435.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.4    7e-06   
ref|XP_008451558.1|  PREDICTED: indole-3-acetic acid-induced prot...  52.0    1e-05   
gb|AEZ67462.1|  late embryogenesis abundant proteins                  51.2    1e-05   
ref|XP_010457272.1|  PREDICTED: late embryogenesis abundant prote...  51.6    1e-05   
emb|CDY44170.1|  BnaC01g22200D                                        51.6    2e-05   
ref|XP_008454329.1|  PREDICTED: late embryogenesis abundant prote...  51.2    2e-05   
gb|KGN52818.1|  hypothetical protein Csa_4G001850                     50.4    3e-05   
sp|P46521.1|LEA5A_GOSHI  RecName: Full=Late embryogenesis abundan...  50.4    4e-05   Gossypium hirsutum [American cotton]
ref|XP_004290804.1|  PREDICTED: indole-3-acetic acid-induced prot...  49.7    6e-05   
gb|KDP28177.1|  hypothetical protein JCGZ_13948                       49.7    7e-05   
gb|KDO71713.1|  hypothetical protein CISIN_1g034332mg                 48.9    9e-05   
gb|ACF74336.1|  putative late-embryogenesis protein                   49.3    9e-05   Arachis hypogaea [goober]
ref|XP_006414427.1|  hypothetical protein EUTSA_v10026659mg           49.3    1e-04   
ref|XP_004165915.1|  PREDICTED: late embryogenesis abundant prote...  49.7    1e-04   
ref|XP_007163119.1|  hypothetical protein PHAVU_001G207800g           49.3    1e-04   
ref|XP_007035627.1|  Late embryogenesis abundant protein Lea5-D       48.9    1e-04   
ref|XP_009146595.1|  PREDICTED: late embryogenesis abundant prote...  48.9    2e-04   
ref|XP_010449879.1|  PREDICTED: late embryogenesis abundant prote...  48.9    2e-04   
gb|AGW45454.1|  late embryogenesis abundant protein                   48.9    2e-04   
gb|KCW58419.1|  hypothetical protein EUGRSUZ_H01105                   48.5    2e-04   
ref|XP_006586916.1|  PREDICTED: late embryogenesis abundant prote...  48.5    2e-04   
ref|XP_010544998.1|  PREDICTED: late embryogenesis abundant prote...  47.8    3e-04   
gb|ACV50424.1|  late embryogenesis protein-5                          47.8    3e-04   Jatropha curcas
ref|XP_010269579.1|  PREDICTED: late embryogenesis abundant prote...  47.8    4e-04   
ref|XP_006284808.1|  hypothetical protein CARUB_v10006078mg           47.4    7e-04   
ref|XP_006419542.1|  hypothetical protein CICLE_v10006308mg           46.6    7e-04   



>gb|AEW24432.1| late embryogenesis abundant protein 3L-1 [Camellia sinensis]
Length=96

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 60/95 (63%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK LS+FV+ RIS+A T RRGYAA      +      A+      K G E  +
Sbjct  1    MARSFSNAKLLSAFVVDRISLAVT-RRGYAAASQGVASGPVT--ARGGVMGKKDGEE--E  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++SW PDPVTGYYRPE++ N E+D  ELR+M L
Sbjct  56   ATKTSWVPDPVTGYYRPENKAN-EIDVAELREMLL  89



>ref|XP_004247410.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Solanum 
lycopersicum]
 gb|AAA34193.1| ORF [Solanum lycopersicum]
 gb|AAA86424.1| heat shock protein [Solanum lycopersicum]
Length=97

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS +K LS+FV   +S A   RRGYAA      +  +    +SN    KSG E   
Sbjct  1    MARSFSNSKTLSAFVSDSVS-AFLSRRGYAAASQGAVSGVAKGVPRSNVMMQKSGEE---  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++SW PDPVTGYYRPE + N E+DA ELR+M L
Sbjct  57   SVKTSWVPDPVTGYYRPEGQAN-EIDAAELRKMLL  90



>ref|XP_009601603.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
tomentosiformis]
Length=96

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS +K +S+F++  +S AA  RRGYAA              +SN T  K G E  +
Sbjct  1    MARSFSNSKIVSAFIVDSLS-AAINRRGYAAASQGAVRGGV---VRSNVTM-KKGVEESN  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K   SW PDPVTGYYRPE   NKE+DA ELR+M L
Sbjct  56   KT-ISWVPDPVTGYYRPESHANKEIDAAELRKMLL  89



>ref|XP_009799468.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=96

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 55/95 (58%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR FS +K +S+F++  +S AA  RRGYAA                N    K G E  +
Sbjct  1    MARFFSNSKIVSAFIVDSVS-AAINRRGYAAASQGVVKGGVVR----NNVLMKKGVEESN  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K  +SW PDPVTGYYRPE   NKE+DA ELR+M L
Sbjct  56   KT-TSWVPDPVTGYYRPETHVNKEIDAAELRKMLL  89



>ref|NP_001275471.1| uncharacterized protein LOC102577657 [Solanum tuberosum]
 gb|ABA46753.1| unknown [Solanum tuberosum]
 gb|ABB16999.1| unknown [Solanum tuberosum]
Length=98

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+FS +K LS+FV   +S A   RRGYAA      +  +     +SN    KSG E  
Sbjct  1    MARSFSNSKILSAFVSDSVS-ALLSRRGYAAASQGAVSGVAKGGVPRSNVIMQKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE + N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGQAN-EIDAAELRKMLL  91



>emb|CDP17116.1| unnamed protein product [Coffea canephora]
Length=99

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 54/96 (56%), Gaps = 2/96 (2%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCR-RGYaaveaaegavssgsPAKSNATPPKSGNEGQ  352
            MAR+F  AK +S+FV+ RISVAA+   RGYAA  +      S     +     K G E  
Sbjct  1    MARSFPNAKLISAFVVQRISVAASRHARGYAAGASQGAVPGSMRGGSNANMMRKKGGEES  60

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                +SW PDPVTGYYRPE     E+DA ELR M L
Sbjct  61   SSKTTSWVPDPVTGYYRPETHA-AEIDAAELRNMLL  95



>emb|CAA66948.1| protein induced upon tuberization [Solanum demissum]
Length=98

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 58/96 (60%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+FS +K LS+FV   +S A   RRGYAA      +  +     +SN    KSG E  
Sbjct  1    MARSFSNSKILSAFVSDSVS-AFLSRRGYAAASQGAVSGVAKGGVPRSNVMMQKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE + N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGQAN-EIDAAELRKMLL  91



>ref|XP_009772870.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Nicotiana 
sylvestris]
Length=98

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+FS +K LS+ V   +S A  CRRGYAA      +  +     +SN    KSG E  
Sbjct  1    MARSFSNSKVLSAVVSDSVS-AFLCRRGYAAGSQGALSGGAKGGVPRSNMIMNKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE   N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGVAN-EIDAAELRKMLL  91



>gb|ABB87099.1| unknown [Solanum tuberosum]
 gb|AEJ08687.1| Lea [Solanum tuberosum]
Length=98

 Score = 71.6 bits (174),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 57/96 (59%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR FS +K LS+FV   +S A   RRGYAA      +  +     +SN    KSG E  
Sbjct  1    MARFFSNSKILSAFVSDSVS-AFLSRRGYAAASQGAVSGVAKGGVPRSNVMMQKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE + N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGQAN-EIDAAELRKMLL  91



>gb|AAW31666.1| putative late-embryogenesis protein-like protein [Ammopiptanthus 
mongolicus]
Length=98

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 58/96 (60%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F+ AK LS  VL+R S + T RRGYAA  A + A   G  + S    PKSG E + 
Sbjct  1    MARSFTNAKVLSVLVLNRFSSSLT-RRGYAAASATQSAKRGGVVSISGKMAPKSGEEKRA  59

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +  SW PDPVTGYY+PE+   KE+D  ELR   L
Sbjct  60   TTDKVSWVPDPVTGYYKPENI--KEIDVAELRATLL  93



>ref|XP_009799351.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=98

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 57/107 (53%), Gaps = 28/107 (26%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPP--------  331
            MAR+FS +K +S+FV+  +S +   RRGYA              A S+A+ P        
Sbjct  1    MARSFSNSKLISAFVVDTVS-SFVSRRGYA--------------AASSASVPGGVRGSGV  45

Query  332  ----KSGNEGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                K G E   K  +SW PDPVTGYYRPE    KE+DA ELRQM L
Sbjct  46   NIMMKKGGEESSKKTTSWVPDPVTGYYRPESHA-KEIDAAELRQMLL  91



>gb|ADW66129.1| late embryogenesis abundant protein Lea5 [Solanum nigrum]
Length=94

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+FS +K LS+ V   +S A   RRGYAA         +     +SN    KSG E  
Sbjct  1    MARSFSNSKILSAVVSDSVS-AFLSRRGYAAASQGAVFGVAKGGVPRSNVMMKKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE + N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGQAN-EIDAAELRKMLL  91



>ref|XP_009596682.1| PREDICTED: late embryogenesis abundant protein Lea5 [Nicotiana 
tomentosiformis]
Length=93

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 54/95 (57%), Gaps = 9/95 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS +K +S+FV+  +S +   RRGYA+     G+       K        G E   
Sbjct  1    MARSFSNSKLISAFVVDTVS-SFVSRRGYASSAGVRGSGVINIMMKK-------GGEESS  52

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K  +SW PDPVTGYYRPE    KE+DA ELRQM L
Sbjct  53   KRTTSWVPDPVTGYYRPESH-AKEIDAAELRQMLL  86



>ref|XP_009594113.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Nicotiana 
tomentosiformis]
Length=98

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+FS  K LS+FV   +S A   RRGYAA      +  +     +SN    KSG E  
Sbjct  1    MARSFSNTKVLSAFVSDSVS-AFLSRRGYAAGSQGVVSGGAKGGVPRSNMMMNKSGEE--  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDPVTGYYRPE   N E+DA ELR+M L
Sbjct  58   -SVKTSWVPDPVTGYYRPEGVAN-EIDAAELRKMLL  91



>ref|XP_007050958.1| Indole-3-acetic acid-induced protein ARG2, putative [Theobroma 
cacao]
 gb|EOX95115.1| Indole-3-acetic acid-induced protein ARG2, putative [Theobroma 
cacao]
Length=94

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+FS AK  S+FV   IS  A  RRGYAA      +      A++ A   K+G E   
Sbjct  1    MARSFSNAKLFSTFVADGIS-NAISRRGYAAASQGVVSGG---AARNAAVVKKTGEEMAG  56

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             K + SW PDPVTG+YRPE+   KE+D  ELR M L
Sbjct  57   AKEKVSWVPDPVTGFYRPENTA-KEIDVAELRAMLL  91



>ref|XP_007145200.1| hypothetical protein PHAVU_007G218700g [Phaseolus vulgaris]
 gb|ESW17194.1| hypothetical protein PHAVU_007G218700g [Phaseolus vulgaris]
Length=99

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 57/96 (59%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+F+T K LS+ V    S   T RRG+AA  A + A   G  + S    PKSG E G+
Sbjct  1    MARSFTTVKVLSALVADGFSNTLT-RRGFAAAAATQSATRGGGASISGNITPKSGEEKGR  59

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+ +  E+D  +LR M L
Sbjct  60   GAEKVSWVPDPVTGYYKPENTN--EIDVADLRAMVL  93



>ref|XP_006355810.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Solanum 
tuberosum]
Length=89

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 51/98 (52%), Gaps = 19/98 (19%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR FS  K +S+FV+  +SVA   RRGYA              A S      SG    +
Sbjct  1    MARYFSNCKNISAFVVDSVSVAIQ-RRGYA--------------AASQGGVSGSGAVRSN  45

Query  356  KAES---SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ES   SW PDPVTGYYRPE    KE+DA ELR M L
Sbjct  46   VMESNKTSWVPDPVTGYYRPESHA-KEIDAAELRNMLL  82



>ref|XP_002270639.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Vitis vinifera]
 emb|CBI36877.3| unnamed protein product [Vitis vinifera]
Length=97

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK +S+ V+   S+A   RRGYAA   A  +V+ G   KS     K G E + 
Sbjct  1    MARSLSNAKVISAIVVDGFSLA-IHRRGYAAASGAVSSVARGQ--KSGVVVKKLGEEMKG  57

Query  356  KAE--SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +A   S W PDPVTGYYRPE+E  K++D  ELRQ  L
Sbjct  58   RASETSPWVPDPVTGYYRPENEA-KQIDVAELRQTLL  93



>gb|AFK35936.1| unknown [Medicago truncatula]
 gb|KEH24387.1| late embryogenesis abundant protein [Medicago truncatula]
Length=99

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNAT-PPKSGNEGQ  352
            MAR+F+ AK LS+ VL   S   T RRGYAA   +   V  G  +  N   P KSG +G 
Sbjct  1    MARSFANAKVLSAVVLEGFSNTLT-RRGYAAATESATRVVGGVVSVGNKMGPTKSGEDGS  59

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   K+ DA +LR   L
Sbjct  60   STYKVSWVPDPVTGYYKPENI--KDTDAADLRAKLL  93



>gb|AAC06242.1| late embryogenis abundant protein 5 [Nicotiana tabacum]
Length=97

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 57/106 (54%), Gaps = 27/106 (25%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPK----SGN  343
            MAR+FS +K +S+FV+  +S +   RRGYA              A S+A+ P     SG 
Sbjct  1    MARSFSNSKLISAFVVDTVS-SFVSRRGYA--------------AASSASVPGGVRGSGV  45

Query  344  -------EGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                   E   K  +SW PDPVTGYYRPE    KE+DA ELRQM L
Sbjct  46   NIMMKKWEESSKKTTSWVPDPVTGYYRPESHA-KEIDAAELRQMLL  90



>ref|XP_010684355.1| PREDICTED: late embryogenesis abundant protein Lea5 [Beta vulgaris 
subsp. vulgaris]
Length=93

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 53/99 (54%), Gaps = 17/99 (17%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK   S V+  IS+A+  RRGYAA                 A    SG  GQ+
Sbjct  1    MARSLSNAKVFFSLVVDNISMASQ-RRGYAAASQGVA-----------AVGRGSGKSGQE  48

Query  356  K----AESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +    AE+SW PDPVTGYYRP +    E+D  ELR+M L
Sbjct  49   ERGRSAENSWVPDPVTGYYRPANRA-AEIDVAELREMLL  86



>ref|XP_009793725.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Nicotiana 
sylvestris]
Length=94

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 58/97 (60%), Gaps = 12/97 (12%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATP--PKSGNEG  349
            MAR+ S +K  S+FV  R+S+  T R+GYA  E A G       A+SN      K G E 
Sbjct  1    MARSLSNSKLYSTFVTDRLSLGVT-RKGYAVAEVAGGRGGV---AQSNMMIMMKKGGEE-  55

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                 + W PDPVTGYYRPE++ N ++DAVELR+M L
Sbjct  56   ----SAPWVPDPVTGYYRPENQAN-QIDAVELRRMLL  87



>gb|ACJ84182.1| unknown [Medicago truncatula]
Length=99

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNAT-PPKSGNEGQ  352
            MAR+F+ A+ LS+ VL   S   T RRGYAA   +   V  G  +  N   P KSG +G 
Sbjct  1    MARSFANARVLSAVVLEGFSNTLT-RRGYAAATESATRVVGGVVSVGNKMGPTKSGEDGS  59

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   K+ DA +LR   L
Sbjct  60   STYKVSWVPDPVTGYYKPENI--KDTDAADLRAKLL  93



>ref|XP_004240547.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Solanum 
lycopersicum]
Length=94

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 53/95 (56%), Gaps = 8/95 (8%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR  S  K +S+FV+  +SVA   RRGYAA  A  G   S   + S  +     N+   
Sbjct  1    MARYLSNCKNISAFVVDSVSVAIQ-RRGYAATAAQGGVSGSVRGSGSVRSNVMESNK---  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               +SW PDPVTGYYRPE    KE+DA ELR M L
Sbjct  57   ---TSWVPDPVTGYYRPETHA-KEIDAAELRNMLL  87



>gb|AHI85716.1| stress-induced protein 11 [Capsicum annuum]
Length=96

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 53/95 (56%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR F  +K + +FV+  IS AA  RRGYA       + +  S   SN    K   E  +
Sbjct  1    MARYFPNSKIVCAFVVDSIS-AAIQRRGYAMASQVAASSNGRS---SNVMMKKVVKES-N  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K  +SW PDPVTGYYRPE    KE+DA ELR M L
Sbjct  56   KTTTSWGPDPVTGYYRPESHV-KEIDAAELRNMLL  89



>gb|EYU46739.1| hypothetical protein MIMGU_mgv1a017080mg [Erythranthe guttata]
Length=94

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%), Gaps = 10/95 (11%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK +SSF+ + I      RRG+AA      + +  S A +     K G+E + 
Sbjct  1    MARSFSGAKSVSSFLANEI------RRGFAASTQGVVSGTVRSGAPNVML--KKGSE-EP  51

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             ++++W PDPVTGYYRPE++ N EMD  ELR++ +
Sbjct  52   SSKTAWVPDPVTGYYRPENQGN-EMDPAELREILI  85



>ref|XP_006444379.1| hypothetical protein CICLE_v10023029mg [Citrus clementina]
 gb|ESR57619.1| hypothetical protein CICLE_v10023029mg [Citrus clementina]
Length=98

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK  S+FV   IS  A  +RGY+A      + ++G    + A   K   E   
Sbjct  1    MARSFSNAKLFSAFVADGIS-NAIYKRGYSAASQGAVSRATGGARSAAAMLKKPAEEMTG  59

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E  SW PDPVTG YRPE+  N E+D  +LR MFL
Sbjct  60   SSEKVSWVPDPVTGVYRPENLAN-ELDGADLRAMFL  94



>ref|XP_007163120.1| hypothetical protein PHAVU_001G207900g [Phaseolus vulgaris]
 gb|ESW35114.1| hypothetical protein PHAVU_001G207900g [Phaseolus vulgaris]
Length=103

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 55/102 (54%), Gaps = 18/102 (18%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAK------SNATPPKS  337
            MA +F++AK  SSF LH  S + T RRGYA             PAK      SN   P S
Sbjct  1    MAPSFTSAKTFSSFFLHGFSNSLT-RRGYAVASQN--------PAKGGVVSLSNKIAPTS  51

Query  338  G-NEGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G ++G    + SW PDPV+GYY+PE+ +  E+D  ELR   L
Sbjct  52   GEDKGVSPYKVSWVPDPVSGYYKPENIN--EVDVAELRATLL  91



>ref|XP_011082454.1| PREDICTED: late embryogenesis abundant protein Lea5 [Sesamum 
indicum]
Length=90

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 11/95 (12%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MA +FS+AK +S+FV          RRGYAA      + +  + A +     K G+E  +
Sbjct  1    MAGSFSSAKTVSAFV------TLVTRRGYAAASQGGVSSALRTGAPN--VMLKKGSE--E  50

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +++SW PDPVTGYYRPE +  KE+DA ELR+M +
Sbjct  51   SSKTSWVPDPVTGYYRPETQA-KEIDAAELREMLV  84



>gb|KEH24388.1| late embryogenesis abundant protein [Medicago truncatula]
Length=97

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 54/92 (59%), Gaps = 6/92 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+F+ AK LS+ +L   S   T RRGYAA   +       S   K+ AT  KS  EG 
Sbjct  1    MARSFANAKVLSAIILDGFSNTFT-RRGYAAATESTTRGGVVSAGNKTGAT--KSREEGV  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELR  448
               + SW PDPVTGYYRPE+   K++DA ELR
Sbjct  58   SAYKVSWVPDPVTGYYRPENI--KDIDAAELR  87



>ref|XP_004494380.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cicer 
arietinum]
Length=96

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F+ AK LS+ +L+  S   T RRGYAA   +   V S S      T PKSG E   
Sbjct  1    MARSFANAKVLSTILLNGFSNTLT-RRGYAAATESASKVGSIS---GKITAPKSGEEKSG  56

Query  356  KA-ESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   K++DA +LR   +
Sbjct  57   STYKVSWVPDPVTGYYKPENI--KDIDAADLRAKLI  90



>ref|XP_010088289.1| Indole-3-acetic acid-induced protein ARG2 [Morus notabilis]
 gb|EXB33514.1| Indole-3-acetic acid-induced protein ARG2 [Morus notabilis]
Length=100

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 54/99 (55%), Gaps = 6/99 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaave---aaegavssgsPAKSNATPPKSGNE  346
            MAR+FS AK L++ V+   S   T RRG++A            +G+ A S +   KSG +
Sbjct  1    MARSFSGAKALTALVIDGFSTVIT-RRGFSAAAPQGVVSSVARAGATAGSRSVKKKSGEK  59

Query  347  GQDKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                 E  SW PDPVTGYYRPE+   +E+D  ELR   L
Sbjct  60   IVGNTEKVSWVPDPVTGYYRPEN-GAQEIDVAELRATLL  97



>gb|AHI85715.1| stress-induced protein 10 [Capsicum annuum]
Length=96

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 54/95 (57%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR FS +K + +FV+  +  AA  RRGYAA      + +  S   SN    K   E  +
Sbjct  1    MARYFSNSKIVCAFVVDSV-YAAIQRRGYAAASQGAASGNGRS---SNVMMKKVVKES-N  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K  +SW PDPVTGYYRPE    KE+DA ELR M L
Sbjct  56   KTTTSWGPDPVTGYYRPESHV-KEIDAAELRNMLL  89



>gb|EPS70797.1| hypothetical protein M569_03965, partial [Genlisea aurea]
Length=92

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS  K +S+FV   IS  +  RRG+AA   +  +      A+ N    KS ++  D
Sbjct  1    MARSFSGVKAISAFVEGEISTLS--RRGFAAASRSIASSVVNRGAQ-NMMLKKSASD--D  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +++W PDPVTG+YRPE+ D K+MD  ELR + +
Sbjct  56   NEKTAWVPDPVTGFYRPEN-DGKDMDPAELRAILI  89



>ref|XP_004246056.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X1 [Solanum lycopersicum]
Length=101

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 1/95 (1%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MA +FS  K  S+     ++  + CR+GYA   +  G       +       K G+E Q 
Sbjct  1    MALSFSNVKLFSNRFTLLVTRFSYCRKGYAVAASGGGTRGGSELSNMMMMKLKGGDEDQS  60

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +S W P PVTGYYRPE++ +  +D VELRQM L
Sbjct  61   PPKSPWVPHPVTGYYRPENQADM-IDPVELRQMLL  94



>gb|KHG16920.1| Indole-3-acetic acid-induced ARG2 [Gossypium arboreum]
Length=100

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 53/99 (54%), Gaps = 6/99 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MA +FS AK  S+FV+  IS   + RRGYAA      +      A +S AT  K   E  
Sbjct  1    MALSFSNAKLFSTFVVDGISNVIS-RRGYAAASQGIVSSGIRGGAGRSAATVAKKTGEEM  59

Query  353  D---KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                K + SW PDPVTG YRPE+  N E+D  ELR M L
Sbjct  60   SRGAKEKVSWVPDPVTGCYRPENCPN-EIDVAELRSMLL  97



>ref|XP_006479985.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Citrus 
sinensis]
 ref|XP_006479988.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Citrus 
sinensis]
 gb|KDO87182.1| hypothetical protein CISIN_1g034308mg [Citrus sinensis]
Length=98

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 53/96 (55%), Gaps = 3/96 (3%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK  S+ V   IS  A  +RGY+A      + ++G    + A   K   E   
Sbjct  1    MARSFSNAKLFSALVADGIS-NAIYKRGYSAASQGAVSRATGGARSAAAMLKKPAEEMTG  59

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E  SW PDPVTG YRPE+  N E+D  +LR MFL
Sbjct  60   SSEKVSWVPDPVTGVYRPENLAN-ELDGADLRAMFL  94



>ref|NP_001237596.1| uncharacterized protein LOC100527032 [Glycine max]
 gb|ACU16069.1| unknown [Glycine max]
 gb|KHN08677.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 60.8 bits (146),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE--G  349
            MAR+FS  K LS+ V    S   T RRGYAA   +     +   + S+   PKSG +  G
Sbjct  1    MARSFSNVKVLSALVADGFSNTLT-RRGYAAATQSATRGGAA--SISSKIAPKSGEDKVG  57

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + SW PDPVTGYY+PE+   KE+D  ELR   L
Sbjct  58   GGAEKVSWVPDPVTGYYKPENI--KEIDVAELRATVL  92



>ref|XP_010069902.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Eucalyptus 
grandis]
 gb|KCW58418.1| hypothetical protein EUGRSUZ_H01104 [Eucalyptus grandis]
Length=99

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+ S AK  S+ ++  IS A+  RRGYAA      +  + + A +S     K+G E  
Sbjct  1    MARSLSNAKLFSAALVDGIS-ASIARRGYAAASQGVASSFAKTGATRSTVMSKKTGEEKA  59

Query  353  DKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               E  SW PDP TGYYRPE+   +E+D  ELR M L
Sbjct  60   RSTERVSWVPDPKTGYYRPENRA-EEIDVAELRAMLL  95



>ref|XP_003546362.1| PREDICTED: late embryogenesis abundant protein Lea5 [Glycine 
max]
 gb|KHN14610.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=100

 Score = 60.5 bits (145),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 13/99 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG----N  343
            MA++FS AK+  +F LHR        RGYA    A  +V  G  +  + +  + G    N
Sbjct  1    MAQSFSPAKRALAFSLHR--------RGYAVASDASPSVRGGLDSIGSRSAIEKGVTKNN  52

Query  344  EGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             G   A S+W PDPVTGYYRP +  N E+D VELR+M L
Sbjct  53   SGPSGASSAWAPDPVTGYYRPINHTN-EIDPVELRRMLL  90



>ref|XP_006288964.1| hypothetical protein CARUB_v10002338mg [Capsella rubella]
 gb|EOA21862.1| hypothetical protein CARUB_v10002338mg [Capsella rubella]
Length=94

 Score = 60.1 bits (144),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+F+ H +S  A  RRGYAA         SG  A ++A   K G E + 
Sbjct  1    MARSLSNVKIVSAFLSHELS-NAIFRRGYAATAVQGSGGRSG--AVTSAAMKKKGVE-ES  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              + SW PDP TGYYRPE   N E+DA ELR   L
Sbjct  57   TQKISWVPDPKTGYYRPETGSN-EIDAAELRAALL  90



>ref|XP_010429564.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV H +S  A  RRGYAA         SG  A ++A   K G E   
Sbjct  1    MARSLSNVKIVSAFVSHELS-NAIFRRGYAAAAVQGSGGRSG--AVASAVMKKKGVEEST  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  58   K-KISWVPDPKTGYYRPETGSN-EIDPAELRAALL  90



>ref|XP_004495942.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cicer 
arietinum]
Length=98

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 49/96 (51%), Gaps = 2/96 (2%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F   K +S  V    S + T RRGYAA         + +       PPKSG +   
Sbjct  1    MARSFINVKAISVLVADGFSNSLT-RRGYAAGATENARRGAATSMSGKMVPPKSGEDKVA  59

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E  +W PDPVTGYY+PE+ + KE+D    R   L
Sbjct  60   NSEKVAWVPDPVTGYYKPENTNPKEIDVGNPRATVL  95



>gb|KHN20395.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 51/97 (53%), Gaps = 7/97 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG--NEG  349
            MA +F+  K  SS V    S A T RRGYA    +         + S    PKSG  N+G
Sbjct  1    MAPSFTYVKIFSSLVADGFSNALT-RRGYAVASQSATKGGVA--SMSGKMAPKSGEDNKG  57

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + SW PDPVTGYY+PE+ +  E+D  ELR M L
Sbjct  58   VSTYKVSWVPDPVTGYYKPENIN--EIDPAELRAMLL  92



>gb|AFK36920.1| unknown [Lotus japonicus]
Length=94

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 55/96 (57%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+F+  K +S+ V    S  +  RRGYAA+  + G V +    K  +T  KSG E   
Sbjct  1    MARSFTNIKAISALVAEEFS-NSLARRGYAAIAQSAGRVGASMSGKMGST--KSGEEKAA  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             + + SW PDPVTGYY+P  E+ KE+D  ELR   L
Sbjct  58   AREKVSWVPDPVTGYYKP--ENIKEIDVAELRSAVL  91



>ref|XP_010422602.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV H +S  A  RRGYAA         SG  A ++A   K G E   
Sbjct  1    MARSLSNVKIVSAFVSHELS-NAIFRRGYAATAVQGSGGRSG--AVASAAMKKKGVEEST  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  58   K-KISWVPDPKTGYYRPETGSN-EIDPAELRAALL  90



>gb|ADQ91844.1| late embryogenesis abundant protein group 6 protein [Arachis 
hypogaea]
Length=97

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNA-TPPKSGNEGQ  352
            MAR+F+ +K LSS + ++IS A T  RGYAA      A   G  A S   +   S +  +
Sbjct  1    MARSFANSKALSSLLQNQISKALTASRGYAATATGSVAARRGGGASSAIRSKKSSSSGEE  60

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   KE+D  ELR   L
Sbjct  61   KGEKVSWVPDPVTGYYKPENI--KEIDVAELRASLL  94



>gb|ACJ46652.1| intrinsically disordered protein 1 [Lotus japonicus]
Length=94

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+F+  K +S+ V    S  +  RRGYAA   + G V +    K  +T  KSG E   
Sbjct  1    MARSFTNIKAISALVAEEFS-NSLARRGYAATAQSAGRVGASMSGKMGST--KSGEEKAA  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             + + SW PDPVTGYY+P  E+ KE+D  ELR   L
Sbjct  58   AREKVSWVPDPVTGYYKP--ENIKEIDVAELRSAVL  91



>ref|XP_004136021.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis 
sativus]
 gb|KGN44947.1| Protein induced upon tuberization [Cucumis sativus]
Length=104

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 57/102 (56%), Gaps = 9/102 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssg------sPAKSNATPPKS  337
            MAR+FS AK LS+ V    S +    RGYAA   ++G  SS       + A+S+    KS
Sbjct  1    MARSFSNAKILSAVVSDGFS-SLLSSRGYAAAAGSQGVASSAVKGGSVAAARSSNLLKKS  59

Query  338  GNEGQDKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G E     E  SW PDPVTGYYRPE+  + E+D  ELR + L
Sbjct  60   GEEKVGTTEKVSWVPDPVTGYYRPENRSD-EIDVAELRSILL  100



>gb|ADP23916.1| late embryogenesis abundant protein [Sesuvium portulacastrum]
Length=97

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 50/96 (52%), Gaps = 7/96 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK   S V   +S+    RRGYAA              +      K+G E   
Sbjct  1    MARSLSNAKVFVSLVSDNLSIVLN-RRGYAAASQGVAGTV----GRGTGRIGKAGKEEVG  55

Query  356  KA-ESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +  E+SW PDPVTGYYRP +  + E+D  ELR++FL
Sbjct  56   RGGENSWVPDPVTGYYRPANRPD-EIDVAELREIFL  90



>ref|XP_004165917.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
3 [Cucumis sativus]
Length=114

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 55/102 (54%), Gaps = 9/102 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaave------aaegavssgsPAKSNATPPKS  337
            MAR+FS AK LS+ V    S +    RGYAA        +     +S + A+S+    KS
Sbjct  1    MARSFSNAKILSAVVSDGFS-SLLSSRGYAAAAGSQGVASTAVKGASVAAARSSNLLKKS  59

Query  338  GNEGQDKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G E     E  SW PDPVTGYYRPE+  + E+D  ELR + L
Sbjct  60   GEEKVGTTEKVSWVPDPVTGYYRPENRSD-EIDVAELRSILL  100



>ref|NP_001237743.1| uncharacterized protein LOC100306369 [Glycine max]
 gb|ACU14506.1| unknown [Glycine max]
 gb|KHN03714.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=95

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 49/101 (49%), Gaps = 18/101 (18%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS  K LS+ V    S   T RRGYA    +         A        SG  G+D
Sbjct  1    MARSFSNLKVLSALVADGFSNTLT-RRGYAVATQS---------ATRGGAASISGKSGED  50

Query  356  KA------ESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K       + SW PDPVTGYY+PE+   KE+D  ELR   L
Sbjct  51   KVLGGGAEKVSWVPDPVTGYYKPENI--KEIDVAELRATVL  89



>gb|KFK30826.1| hypothetical protein AALP_AA6G030900 [Arabis alpina]
Length=98

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 52/97 (54%), Gaps = 5/97 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsP--AKSNATPPKSGNEG  349
            MAR+ S  K +S+FV H +S  A  RRGYAA        S G    A  +A   K G E 
Sbjct  1    MARSLSNVKIVSAFVSHELS-NAIFRRGYAATAVQGSVSSGGKSGGAVVSAVMKKKGVE-  58

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            + K + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  59   ESKPKISWIPDPKTGYYRPETGSN-EIDPAELRAALL  94



>gb|AFK48640.1| unknown [Lotus japonicus]
Length=94

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 54/96 (56%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+F+  K +S+ V    S  +  RRGYAA   + G V +    K  +T  KSG E   
Sbjct  1    MARSFTNIKAISALVAEEFS-NSLARRGYAATAQSAGRVGASMSGKMGST--KSGEEKAA  57

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             + + SW PDPVTGYY+P  E+ KE+D  ELR   L
Sbjct  58   AREKVSWVPDPVTGYYKP--ENIKEIDVAELRPAVL  91



>ref|XP_011079638.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Sesamum 
indicum]
Length=89

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 14/95 (15%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS  K LS+F+          RRGYAA   + G+ S  S A +     K+ +E  D
Sbjct  1    MARSFSNLKTLSAFI---------ARRGYAAASPSVGSSSVRSGAPNVML--KTASE--D  47

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             ++++W PDPVTGYYRPE++  KE+D VE+R+M +
Sbjct  48   PSKTAWVPDPVTGYYRPENQV-KELDPVEMREMLI  81



>ref|XP_002872843.1| hypothetical protein ARALYDRAFT_327563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49102.1| hypothetical protein ARALYDRAFT_327563 [Arabidopsis lyrata subsp. 
lyrata]
Length=180

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 5/96 (5%)
 Frame = +2

Query  173  QMARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQ  352
            +MAR+FS  K +S+FV   +S  A  RRGYAA  A      SG  A ++A   K G E +
Sbjct  86   KMARSFSNVKIVSAFVSRELS-NAIFRRGYAATAAQGSGGRSG--AAASAVMKKKGVE-E  141

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDP TGYYRPE   N E+DA ELR   L
Sbjct  142  STQKISWVPDPKTGYYRPETGSN-EIDAAELRAALL  176



>ref|NP_001238729.1| uncharacterized protein LOC100306430 [Glycine max]
 gb|ACU14601.1| unknown [Glycine max]
Length=98

 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 51/97 (53%), Gaps = 7/97 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG--NEG  349
            M  +F++ K  SS VL     A T RRGYA    +      G    S    PKSG  N+G
Sbjct  1    MTPSFTSVKIFSSLVLDGFFNALT-RRGYAVASQSATKEGVGF--MSGKMAPKSGEDNKG  57

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + SW PDPVTGYY+PE+ +  E+D  ELR M L
Sbjct  58   VSTHKVSWVPDPVTGYYKPENIN--EIDPAELRAMLL  92



>ref|XP_010069903.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Eucalyptus 
grandis]
 gb|KCW58417.1| hypothetical protein EUGRSUZ_H01103 [Eucalyptus grandis]
Length=99

 Score = 57.8 bits (138),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 53/97 (55%), Gaps = 4/97 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA-KSNATPPKSGNEGQ  352
            MAR+ S AK  S+ ++  IS A+  RRGYAA      +  + + A +S     K+G E  
Sbjct  1    MARSLSNAKLFSAVLVDGIS-ASFARRGYAAASQGVASSVAKTGATRSAVMSKKTGEETA  59

Query  353  DKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               E  SW PDP TGYYRPE+   +E+D  ELR   L
Sbjct  60   RSTERVSWVPDPKTGYYRPENRA-EEIDVAELRAALL  95



>ref|XP_007201902.1| hypothetical protein PRUPE_ppa013814mg [Prunus persica]
 gb|EMJ03101.1| hypothetical protein PRUPE_ppa013814mg [Prunus persica]
Length=101

 Score = 57.8 bits (138),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 51/100 (51%), Gaps = 7/100 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-GNEGQ  352
            MAR+FS AK LS+ V    S   T RRGYAA      +        +N T      N G+
Sbjct  1    MARSFSNAKLLSALVADGFSSTIT-RRGYAAGSQGVASSVVRGGGATNPTSVNVVKNSGE  59

Query  353  DKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            DK  S    SW P+P TG+Y PE+   +E+DA ELR   L
Sbjct  60   DKVSSASKVSWVPNPKTGFYGPEN-GAEEIDAAELRAALL  98



>ref|XP_008235109.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Prunus 
mume]
Length=101

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 53/103 (51%), Gaps = 13/103 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS----GN  343
            MAR+FS AK LS+ V    S   T RRGYAA      +          AT P+S     N
Sbjct  1    MARSFSNAKLLSALVADGFSSTIT-RRGYAAGSQRVASSVVRG---GGATSPRSVNVVKN  56

Query  344  EGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             G+DK  S    SW P+P TG+Y PE+   +E+DA ELR   L
Sbjct  57   SGEDKVRSASKVSWVPNPKTGFYGPEN-GAEEIDAAELRAALL  98



>ref|NP_567231.1| senescence-associated protein SAG21 [Arabidopsis thaliana]
 gb|AAK95287.1|AF410301_1 AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAK62644.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAK96576.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAL06808.1| AT4g02380/T14P8_2 [Arabidopsis thaliana]
 gb|AAM64340.1| late embryogenis abundant protein [Arabidopsis thaliana]
 gb|AAW72736.1| late embryogenesis abundant-like protein [Arabidopsis thaliana]
 gb|AEE82161.1| senescence-associated protein [Arabidopsis thaliana]
Length=97

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 53/96 (55%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsP-AKSNATPPKSGNEGQ  352
            MAR+ S  K +S+FV   +S  A  RRGYAA  A     S G   A ++A   K G E +
Sbjct  1    MARSISNVKIVSAFVSRELS-NAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVE-E  58

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDP TGYYRPE   N E+DA ELR   L
Sbjct  59   STQKISWVPDPKTGYYRPETGSN-EIDAAELRAALL  93



>gb|KHN43505.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=98

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 50/97 (52%), Gaps = 7/97 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG--NEG  349
            M  +F+  K  SS VL     A T RRGYA    +      G    S    PKSG  N+G
Sbjct  1    MTPSFTNVKIFSSLVLDGFFNALT-RRGYAVASQSATKEGVGF--MSGKMAPKSGEDNKG  57

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + SW PDPVTGYY+PE+ +  E+D  ELR M L
Sbjct  58   VSTYKVSWVPDPVTGYYKPENIN--EIDPAELRAMLL  92



>ref|XP_009134437.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
 emb|CDX90942.1| BnaA03g26220D [Brassica napus]
Length=94

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            M+R+ S  K +SSFV H +S  A  RRGYAA  A       G  A  +A   K G E + 
Sbjct  1    MSRSLSNVKIVSSFVSHELS-NAIFRRGYAATAAQASVGKGG--AVVSAVMKKKGVE-ES  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              + +W PDP TGYYRPE   +KE+D  ELR   L
Sbjct  57   TQKIAWIPDPKTGYYRPET-GSKEIDPAELRAALL  90



>gb|KDO71708.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71709.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71710.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
 gb|KDO71711.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=97

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+   AK L + V   IS++   RRGYAA         +G   K++ TP    + G  
Sbjct  1    MARSLFKAKLLLAPVADGISLS-IGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSG--  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             A S+W PDP+TGYYRPE+    E+D  ELR+M L
Sbjct  58   -ASSAWAPDPITGYYRPENR-AVEIDPAELREMLL  90



>sp|P32292.1|ARG2_VIGRR RecName: Full=Indole-3-acetic acid-induced protein ARG2 [Vigna 
radiata var. radiata]
 dbj|BAA03307.1| hypothetical protein [Vigna radiata var. radiata]
Length=99

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F+  K LS+ V    S   T R G+AA  AA  + + G  +      PKSG E   
Sbjct  1    MARSFTNVKVLSALVADGFS-NTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVR  59

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              E  SW PDPVTGYYRPE+ +  E+D  ++R   L
Sbjct  60   GGEKVSWVPDPVTGYYRPENTN--EIDVADMRATVL  93



>gb|AFK37878.1| unknown [Lotus japonicus]
Length=94

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 53/95 (56%), Gaps = 7/95 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F+  K LS+ +L  IS + T RRGY+A  A + A        S  T     ++G  
Sbjct  1    MARSFANTKALSALLLDGISTSLT-RRGYSAAAATQSATRG-----SGMTKMGGEDKGAS  54

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              + SW PDPVTGYY+PE+   + +D  E+R M L
Sbjct  55   TYKVSWVPDPVTGYYKPENT-KEVVDVAEMRAMLL  88



>gb|KDO71707.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=97

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+   AK L + V   IS++   RRGYAA         +G   K++ TP    + G  
Sbjct  1    MARSLFKAKLLLAPVADGISLS-IGRRGYAAAAPLGTISRTGIMEKNDLTPAVREDSG--  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             A S+W PDP+TGYYRPE+    E+D  ELR+M L
Sbjct  58   -ASSAWAPDPITGYYRPENR-AVEIDPAELREMLL  90



>ref|XP_006576268.1| PREDICTED: indole-3-acetic acid induced protein ARG-2 homolog 
isoform X1 [Glycine max]
 gb|ACU17303.1| unknown [Glycine max]
Length=90

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 50/96 (52%), Gaps = 13/96 (14%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG-NEGQ  352
            MAR+ + AK  S+ VL   S   T RRGY+      G           +  PKSG ++G 
Sbjct  1    MARSIANAKTFSALVLDGFSNTLT-RRGYSQSATRGGVA---------SIAPKSGEDKGV  50

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   KE+D  +LR   L
Sbjct  51   SSYKVSWVPDPVTGYYKPENI--KEVDVADLRATLL  84



>gb|ABG66530.1| putative late embryogenesis abundant protein [Prosopis juliflora]
Length=93

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 49/97 (51%), Gaps = 9/97 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKS--NATPPKSGNEG  349
            MAR+FS    LS  +++ IS     RRG+A+        ++   A S       KS  E 
Sbjct  1    MARSFSNLNGLSVLLVNAIS-----RRGFASSSQGFATTAARVGAASMSGKVAKKSVEER  55

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + +W PDPVTGYYRP  E+ KE+D  ELR   L
Sbjct  56   VTAEKEAWVPDPVTGYYRP--ENTKEIDVAELRATLL  90



>gb|KDP28178.1| hypothetical protein JCGZ_13949 [Jatropha curcas]
Length=92

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 53/96 (55%), Gaps = 8/96 (8%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK +S+ V   I+     RRG++   A   A    + A+S A   KSG +   
Sbjct  1    MARSFSNAKVVSALVTKAIN-----RRGFSGAAAPTAAPQGAA-ARSGAMVKKSGEQTVG  54

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +  SW PDP TG YRPE+  N+E+DA ELR   L
Sbjct  55   STDKISWVPDPRTGCYRPENV-NEEIDAAELRATLL  89



>ref|NP_001237642.1| uncharacterized protein LOC100500411 [Glycine max]
 gb|ACU15486.1| unknown [Glycine max]
Length=98

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 50/97 (52%), Gaps = 7/97 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG--NEG  349
            MA +F+  K  SS V    S A T RRGYA    +         + S    PKSG  N+G
Sbjct  1    MAPSFTYVKIFSSLVADGFSNALT-RRGYAVASQSATKGGVA--SMSGKMAPKSGEDNKG  57

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                + SW PDPVTGYY+PE+ +  E+D  E R M L
Sbjct  58   VSTYKVSWVPDPVTGYYKPENIN--EIDPAESRAMLL  92



>ref|XP_006418300.1| hypothetical protein EUTSA_v10009185mg [Eutrema salsugineum]
 gb|ESQ36653.1| hypothetical protein EUTSA_v10009185mg [Eutrema salsugineum]
Length=97

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S A  LS FV    S  A  RRG+A         S  S   ++A   K+ N GQ+
Sbjct  1    MARSLSNANILSVFVAEEFS-NAIFRRGFAVAANTTLQGSVSSGGAASAAVMKN-NVGQE  58

Query  356  KAESS-WYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E + W PDP TGYYRPE    +E+D  ELR + L
Sbjct  59   SSEKAPWVPDPKTGYYRPETVS-EEIDPAELRAVLL  93



>ref|XP_002523101.1| Indole-3-acetic acid-induced protein ARG2, putative [Ricinus 
communis]
 gb|EEF39286.1| Indole-3-acetic acid-induced protein ARG2, putative [Ricinus 
communis]
Length=95

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 58/98 (59%), Gaps = 9/98 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavss-gsPAKSNAT-PPKSGNEG  349
            MA++FS AK LSS +   I+     RRG++A  +A  + ++  + A+S A    K+G E 
Sbjct  1    MAQSFSNAKALSSLITKAIT-----RRGFSAAASASASAAAPKATARSGAAMVKKTGEEV  55

Query  350  QDKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                E  SW PDP TG+YRPE+   KE+DA ELR M L
Sbjct  56   VGSTEKVSWVPDPRTGFYRPENVA-KEIDAAELRAMLL  92



>ref|XP_010259514.1| PREDICTED: late embryogenesis abundant protein Lea5 [Nelumbo 
nucifera]
Length=101

 Score = 56.2 bits (134),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 60/102 (59%), Gaps = 16/102 (16%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK   + V   +SVA + RRGY+A  AA  +V  G  A+S       GN+G +
Sbjct  1    MARSLSNAKLFFALV-DGVSVAIS-RRGYSAAAAASSSVVRGG-ARSGI-----GNQGME  52

Query  356  K-------AESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K       A SSW PDP+TGYYRPE+   +E+D  ELR++ L
Sbjct  53   KVMMKEESAASSWIPDPITGYYRPENH-GEEIDVAELRRVLL  93



>ref|XP_010325649.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X2 [Solanum lycopersicum]
Length=96

 Score = 55.5 bits (132),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 50/95 (53%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MA +FS  K  S    +R ++  T R+GYA   +  G       +       K G+E Q 
Sbjct  1    MALSFSNVKLFS----NRFTLLVT-RKGYAVAASGGGTRGGSELSNMMMMKLKGGDEDQS  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +S W P PVTGYYRPE++ +  +D VELRQM L
Sbjct  56   PPKSPWVPHPVTGYYRPENQADM-IDPVELRQMLL  89



>ref|NP_001238473.1| indole-3-acetic acid induced protein ARG-2 homolog [Glycine max]
 gb|AAF05766.1|AF192758_1 indole-3-acetic acid induced protein ARG-2 homolog [Glycine max]
 gb|KHN35339.1| Indole-3-acetic acid-induced protein ARG2 [Glycine soja]
Length=86

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 49/96 (51%), Gaps = 17/96 (18%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSG-NEGQ  352
            MAR+ + AK  S+ VL   S     RRGY+      G           +  PKSG ++G 
Sbjct  1    MARSIANAKTFSALVLDGFS-----RRGYSQSATRGGVA---------SIAPKSGEDKGV  46

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+PE+   KE+D  +LR   L
Sbjct  47   SSYKVSWVPDPVTGYYKPENI--KEVDVADLRATLL  80



>ref|XP_002892126.1| late embryogenesis abundant 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68385.1| late embryogenesis abundant 3 family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=97

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 54/96 (56%), Gaps = 4/96 (4%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ + AK LS FV  ++S  A  RRG+AA        S  S   ++A   K  N G+ 
Sbjct  1    MARSLANAKILSVFVSEKLS-NAVFRRGFAAAAKTALDGSVSSGGTASAAEMKK-NVGEA  58

Query  356  KAESS-WYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E + W PDP TGYYRPE   ++E+D  ELR + L
Sbjct  59   SSEKAPWVPDPKTGYYRPETV-SEEIDPAELRAVLL  93



>ref|XP_009119608.1| PREDICTED: late embryogenesis abundant protein Lea5 [Brassica 
rapa]
 emb|CDX89941.1| BnaA10g01410D [Brassica napus]
Length=98

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ STAK LS  V    S  A  RRG+A         S  S   + +T     N G++
Sbjct  1    MARSLSTAKTLSVIVAEGFS-NAIYRRGFAVAADTALHGSVASGGTTASTAAMKKNVGEE  59

Query  356  KAESS-WYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E + W PDP TGYYRP    ++E+D  ELR + L
Sbjct  60   SSEKAPWIPDPKTGYYRPATV-SEEIDPAELRAVLL  94



>ref|XP_009144576.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
Length=93

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 51/98 (52%), Gaps = 12/98 (12%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPP---KSGNE  346
            MAR+ S  K +S+FV   +S  A  RRGYAA  A   +       K  A  P   K G E
Sbjct  1    MARSLSNVKFVSAFVSQELS-NAIFRRGYAATAAQPSS------GKGRAVVPAVMKKGVE  53

Query  347  GQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              +K + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  54   ESNK-KISWIPDPKTGYYRPETGSN-EIDPAELRAALL  89



>ref|NP_001276069.1| late embryogenesis abundant protein Lea5 [Citrus sinensis]
 ref|XP_006419541.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
 sp|Q39644.1|LEA5_CITSI RecName: Full=Late embryogenesis abundant protein Lea5 [Citrus 
sinensis]
 emb|CAA86851.1| Lea5 protein [Citrus sinensis]
 gb|ESR32781.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
Length=97

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+   AK L + V   IS++   RRGYAA         +G   K++  P    + G  
Sbjct  1    MARSLFKAKLLLAPVADGISLS-ISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSG--  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             A S+W PDP+TGYYRPE+    E+D  ELR+M L
Sbjct  58   -ASSAWAPDPITGYYRPENR-AVEIDPAELREMLL  90



>gb|KDO71712.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=96

 Score = 55.1 bits (131),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 52/95 (55%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+   AK L + V   IS+  +  RGYAA         +G   K++ TP    + G  
Sbjct  1    MARSLFKAKLLLAPVADGISL--SIGRGYAAAAPLGTISRTGIMEKNDLTPAVREDSG--  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             A S+W PDP+TGYYRPE+    E+D  ELR+M L
Sbjct  57   -ASSAWAPDPITGYYRPENR-AVEIDPAELREMLL  89



>ref|XP_010522797.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Tarenaya 
hassleriana]
Length=92

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 54/96 (56%), Gaps = 9/96 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKS-NATPPKSGNEGQ  352
            MAR+ S A+ LS+ V +     A CRRG+AA   A G+VS G    +  A   K G E  
Sbjct  1    MARSLSNARVLSNLVSN-----AVCRRGFAAAATAHGSVSGGGRGGAATALKKKVGEENS  55

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             KA  +W PDP TGYYRPE   ++E+D  ELR   L
Sbjct  56   QKA--TWGPDPKTGYYRPET-GSQEIDPAELRATLL  88



>ref|XP_009146587.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X1 [Brassica rapa]
 emb|CDY22889.1| BnaA01g18270D [Brassica napus]
Length=99

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 47/95 (49%), Gaps = 7/95 (7%)
 Frame = +2

Query  179  ARTFSTA-KQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            AR+ S A K L S   H IS +   RR Y A     G         +  T  K       
Sbjct  4    ARSLSGAVKSLCSAASHNISGSIVLRRSYVATVPGFGKG-----GSTRVTVGKMEQRANQ  58

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +AES+W PDPVTGYYRP +  + E+D  ELR+M L
Sbjct  59   EAESAWAPDPVTGYYRPSNRAD-EIDPAELREMLL  92



>ref|XP_006303463.1| hypothetical protein CARUB_v10010737mg [Capsella rubella]
 gb|EOA36361.1| hypothetical protein CARUB_v10010737mg [Capsella rubella]
Length=97

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE---  346
            MAR+ S AK +S FV  ++S  A  RRG+A         S    +  NA+P    N+   
Sbjct  1    MARSLSNAKIISVFVSEKLS-NAVFRRGFAVAAKTASDGSVS--SGGNASPAVMKNKIVE  57

Query  347  -GQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               DKA   W PDP TGYYRPE   ++E+D  ELR + L
Sbjct  58   ASSDKAP--WVPDPKTGYYRPETA-SEEIDPAELRAVLL  93



>ref|NP_001235600.1| desiccation protective protein LEA5 [Glycine max]
 gb|AAB38782.1| desiccation protective protein LEA5 [Glycine max]
 gb|ACU14115.1| unknown [Glycine max]
 gb|KHN03353.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=113

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 47/102 (46%), Gaps = 10/102 (10%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE---  346
            MAR+ S AK++   V   IS+    RRGYA        V  G+  + N      G E   
Sbjct  1    MARSLSQAKRIGVLVAQSISLIPVHRRGYAVASDVSVRVGLGNIGRRNGI--VGGVEEKP  58

Query  347  ----GQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                G     + W PDPVTGYYRP +    E+D VELR   L
Sbjct  59   DTRDGSKAYSTDWAPDPVTGYYRPINH-TPEIDPVELRHRLL  99



>ref|XP_006396445.1| hypothetical protein EUTSA_v10029091mg [Eutrema salsugineum]
 gb|ESQ37898.1| hypothetical protein EUTSA_v10029091mg [Eutrema salsugineum]
Length=94

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV   +S  A  RRG+AA  A      SG  A ++A   K G E + 
Sbjct  1    MARSLSDVKLVSAFVSRELS-NAIFRRGFAATAAQSSGGRSG--AVASAVMKKKGAE-ES  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  57   NQKISWVPDPKTGYYRPETGSN-EIDPAELRAALL  90



>gb|AAC19273.1| T14P8.2 [Arabidopsis thaliana]
 emb|CAB80731.1| AT4g02380 [Arabidopsis thaliana]
Length=206

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 4/97 (4%)
 Frame = +2

Query  173  QMARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsP-AKSNATPPKSGNEG  349
            +MAR+ S  K +S+FV   +S  A  RRGYAA  A     S G   A ++A   K G E 
Sbjct  109  KMARSISNVKIVSAFVSRELS-NAIFRRGYAATAAQGSVSSGGRSGAVASAVMKKKGVE-  166

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +   + SW PDP TGYYRPE   N E+DA ELR   L
Sbjct  167  ESTQKISWVPDPKTGYYRPETGSN-EIDAAELRAALL  202



>ref|XP_007138926.1| hypothetical protein PHAVU_009G249500g [Phaseolus vulgaris]
 gb|ESW10920.1| hypothetical protein PHAVU_009G249500g [Phaseolus vulgaris]
Length=94

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 49/96 (51%), Gaps = 10/96 (10%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGN-EGQ  352
            MA++ S AK+  +F L+R        RGYA         S+     S      + N  G 
Sbjct  1    MAQSISQAKRALAFALNR--------RGYAVASDVSSFTSAARGGMSGIEKGVAKNGSGP  52

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              A S+W PDPVTGYYRP +   +E+D VELR+M L
Sbjct  53   SGASSAWVPDPVTGYYRPINH-REEIDPVELRKMLL  87



>ref|XP_007147243.1| hypothetical protein PHAVU_006G107900g [Phaseolus vulgaris]
 gb|ESW19237.1| hypothetical protein PHAVU_006G107900g [Phaseolus vulgaris]
Length=94

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 48/99 (48%), Gaps = 16/99 (16%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+F+     S+ +L   + A T RRGY+              A        +G  G++
Sbjct  1    MARSFANVNNFSALLLQGFNNALT-RRGYSVAIQ---------SATRGGVSSIAGKSGEE  50

Query  356  KA----ESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K     E SW PDPVTGYY+PE+ +  E+D  +LR   L
Sbjct  51   KRVSTYEVSWVPDPVTGYYKPENIN--EVDVADLRATLL  87



>ref|XP_009348806.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-----G  340
            MAR+FS AK LS+ V+   S + T RRGYAA      +          A  P+S      
Sbjct  1    MARSFSNAKFLSALVVEGFSSSIT-RRGYAAGSQGVASSVVRG---GGAATPRSVNVAKK  56

Query  341  NEGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            N G++K  S    SW PDP TG Y PE+   K +DA ELR   L
Sbjct  57   NSGEEKVGSTFKVSWVPDPKTGVYGPENGAEK-IDAAELRAALL  99



>ref|XP_009335697.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-----G  340
            MAR+FS AK LS+ V+   S +   RRGYAA      +          AT P+S      
Sbjct  1    MARSFSNAKFLSALVVDGFS-STISRRGYAAGSQGVASSVVRG---GGATNPRSVNMTKK  56

Query  341  NEGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            N G++K  S    SW PDP TG Y PE+   K +DA ELR   L
Sbjct  57   NSGEEKVGSTFKVSWVPDPKTGVYGPENGAEK-IDAAELRAALL  99



>ref|XP_008369025.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Malus domestica]
Length=102

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-----G  340
            MAR+FS AK LS  V+   S ++  RRGYAA      +          AT P+S      
Sbjct  1    MARSFSNAKFLSXLVVDGFS-SSISRRGYAAGSQGVASSVVRG---GGATNPRSVNXXKK  56

Query  341  NEGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            N G++K  S    SW PDP TG Y PE+   K +DA ELR   L
Sbjct  57   NSGEEKVGSTFKVSWVPDPKTGVYGPENGTAK-IDAAELRAALL  99



>ref|XP_009111293.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Brassica 
rapa]
Length=94

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K +S+FV  ++S  A  RRG+AA  A    V  G+   +     K G E  +
Sbjct  1    MARSLSSVKFVSAFVSQQLS-NAIFRRGFAATTAQPSGVKGGAVVSAVM---KKGMEESN  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +  ++W PDP TGYYRPE   N E+D  ELR   L
Sbjct  57   QKIAAWIPDPKTGYYRPETGSN-EIDPAELRAALL  90



>ref|XP_008359415.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Malus 
domestica]
Length=102

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 52/104 (50%), Gaps = 14/104 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-----G  340
            MAR+FS AK LS+ V+   S ++  RRGYAA      +          A  P+S      
Sbjct  1    MARSFSNAKFLSALVVDGFS-SSISRRGYAAGSQGVASSVVRG---GGAATPRSVNVAKK  56

Query  341  NEGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            N G++K  S    SW PDP TG Y PE+   K +DA ELR   L
Sbjct  57   NSGEEKVXSTSKVSWVPDPKTGVYGPENGAEK-IDAAELRAALL  99



>emb|CDY15266.1| BnaC05g01450D [Brassica napus]
Length=98

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 50/96 (52%), Gaps = 3/96 (3%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ STAK LS  V    S  A  RRG+A         S GS   + +      N G++
Sbjct  1    MARSLSTAKTLSVIVAGEFS-NAIFRRGFAVAADTALHGSVGSGGTTASASAMKKNVGEE  59

Query  356  KAESS-WYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E + W PDP TGYYRP    ++E+D  ELR + L
Sbjct  60   SSEKAPWIPDPKTGYYRPATV-SQEIDPAELRAVLL  94



>ref|XP_009335719.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Pyrus 
x bretschneideri]
Length=102

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 51/104 (49%), Gaps = 14/104 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKS-----G  340
            MAR+FS AK LS+ V+   S +   RRGYA       +          AT P+S      
Sbjct  1    MARSFSNAKFLSALVVDGFS-STISRRGYAVGSQGVASSVVRG---GGATNPRSVNMTKK  56

Query  341  NEGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            N G++K  S    SW PDP TG Y PE+   K +DA ELR   L
Sbjct  57   NSGEEKVGSTFKVSWVPDPKTGVYGPENGAEK-IDAAELRVALL  99



>emb|CDY55365.1| BnaA02g36510D [Brassica napus]
Length=93

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV   +S  A  RRGYAA  A   +      A  +A   K   E   
Sbjct  1    MARSLSNVKFVSAFVSQELS-NAIFRRGYAATAAQSSSGKGR--AVVSAVMKKGVEESNK  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K   SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  58   KI--SWIPDPKTGYYRPETGSN-EIDPAELRAALL  89



>emb|CDY50390.1| BnaCnng19220D [Brassica napus]
Length=94

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K +S+FV   +S  A  RRG+AA  A       G+   +     K G E  +
Sbjct  1    MARSLSSVKFVSAFVSQELS-NAIFRRGFAATTAQPSGGKGGAVVSAVV---KKGVEESN  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +  ++W PDP TGYYRPE   N E+D  ELR   L
Sbjct  57   QKIAAWIPDPKTGYYRPETGSN-EIDPAELRAALL  90



>emb|CDY01913.1| BnaC02g28140D [Brassica napus]
Length=93

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 47/95 (49%), Gaps = 6/95 (6%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV   +S  A  RRGYAA  A          A  +A   K   E   
Sbjct  1    MARSLSNVKFVSAFVSQELS-NAIFRRGYAATAAQSSTGKGR--AVVSAVMKKGVEESNK  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K   SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  58   KI--SWIPDPKTGYYRPETGSN-EIDPAELRAALL  89



>ref|XP_010548983.1| PREDICTED: late embryogenesis abundant protein Lea5 [Tarenaya 
hassleriana]
Length=106

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 51/98 (52%), Gaps = 5/98 (5%)
 Frame = +2

Query  179  ARTFSTA-KQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQ-  352
            AR+ S A K + S V   ISV+A  RRGY A      +        + A   K   +   
Sbjct  3    ARSISGAVKPVFSAVSGGISVSAVFRRGYVAAPQGVPSGGLSKGGSTGAMVGKQLEQSAV  62

Query  353  --DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++AE++W PDP+TGYYRP +    E+D  ELR+M L
Sbjct  63   RDEEAENAWAPDPITGYYRPANR-AAEIDPAELREMLL  99



>gb|KFK42636.1| hypothetical protein AALP_AA1G021000 [Arabis alpina]
Length=97

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 46/95 (48%), Gaps = 2/95 (2%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ + AK    FV    S  A  RRG+ A        +  S    +A   K    G+ 
Sbjct  1    MARSLANAKIFFVFVSEEFS-NAIFRRGFCAAAKTASQGNVTSGVTGSAAVLKKNVGGES  59

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++ W PDP TGYYRPE    +E+DA ELR + L
Sbjct  60   TEKAPWVPDPKTGYYRPET-GYEEIDAAELRAVLL  93



>gb|ABG54481.1| late embryogenesis abundant protein [Tamarix androssowii]
Length=103

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = +2

Query  176  MAR-TFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAK-SNATPPKSGNEG  349
            MAR ++S AK +S+ V+  +S+A + RR YA       + +    A  SN     + N+ 
Sbjct  1    MARCSYSNAKLVSTLVVDNLSLALS-RRSYAQGMVMSNSSNVMRRAGGSNNATSTTPND-  58

Query  350  QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                E+SW PDPVTGYYRP +  + ++D  ELR+M L
Sbjct  59   ----ENSWVPDPVTGYYRPANHAD-DVDVAELREMLL  90



>gb|ABD93882.1| group 5 late embryogenesis abundant protein [Citrus unshiu]
 gb|ABD93883.1| group 5 late embryogenesis abundant protein [Citrus unshiu]
Length=97

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR    AK L + V   IS++ + RRGYAA         +G   K++  P    + G  
Sbjct  1    MARCLFKAKLLLAPVADGISLSIS-RRGYAAAAPLGTISRTGIMEKNDLRPAVREDSG--  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             A S+W PDP+TGYYRPE+    E+D  ELR++ L
Sbjct  58   -ASSAWAPDPITGYYRPENR-AVEIDPAELREILL  90



>ref|XP_010474858.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=97

 Score = 53.1 bits (126),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK LS FV  ++S  A  RRG+A         S  S   +++   K+      
Sbjct  1    MARSLSNAKILSVFVSEKLS-NAVFRRGFAVAAKTVSEGSVSSGETASSAVMKNKVVEAS  59

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++ W PDP TGYYRPE   ++E+D  ELR + L
Sbjct  60   SEKAPWVPDPKTGYYRPET-VSEEIDPAELRAVLL  93



>emb|CDY22046.1| BnaA09g00750D [Brassica napus]
Length=94

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K +S+FV   +S  A  RRG+AA  A       G+   +     K G E  +
Sbjct  1    MARSLSSVKFVSAFVSQELS-NAIFRRGFAATTAQPSGGKGGAVVSAVM---KKGVEESN  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +  ++W PDP TGYYRPE   N E+D  ELR   L
Sbjct  57   QKIAAWIPDPKTGYYRPETGSN-EIDPAELRAALL  90



>emb|CDY57180.1| BnaC03g73200D [Brassica napus]
Length=94

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 50/95 (53%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV   +S  A  RRGYAA  A       G  A  +    K G E + 
Sbjct  1    MARSLSNVKIVSAFVSRELS-NAIFRRGYAATAAQASVGKGG--AVVSGVMKKKGVE-ES  56

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              + +W PDP TGYYRPE   +KE+D  ELR   L
Sbjct  57   TQKIAWIPDPKTGYYRPET-GSKEIDPAELRAALL  90



>gb|KHN26544.1| Late embryogenesis abundant protein Lea5 [Glycine soja]
Length=97

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 16/99 (16%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKS----NATPPKSGN  343
            MA +FS AK+  +F L R        RGYA    A  ++  G  + S      T   SG 
Sbjct  1    MAHSFSPAKRALAFALQR--------RGYAVASDASPSMRGGLDSISVMEKGVTKKSSGP  52

Query  344  EGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             G     S+W PDP+TGYYRP +  N E+D VELR+M L
Sbjct  53   SGT---SSAWAPDPITGYYRPINHTN-EIDPVELRKMLL  87



>ref|XP_010456043.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=94

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S  K +S+FV H +S  A  RRGYAA     G   SG  A ++A   K G E   
Sbjct  1    MARSLSNVKIVSAFVTHELS-NAIFRRGYAAAAVQGGGGRSG--AVASAVMKKKGVEEST  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K + SW PDP TGYYRPE   N E+D  ELR   L
Sbjct  58   K-KISWVPDPKTGYYRPETGSN-EIDPAELRAALL  90



>sp|P46522.1|LEA5D_GOSHI RecName: Full=Late embryogenesis abundant protein Lea5-D [Gossypium 
hirsutum]
 gb|AAA18544.1| late embryogenesis-abundant protein [Gossypium hirsutum]
 gb|AAA18526.1| late embryogenesis-abundant protein [Gossypium hirsutum]
Length=105

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K L + +   + V+ + RRGY+    A    S G P        +   +   
Sbjct  1    MARSVSSFKLLGASIFDGLYVSIS-RRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESS  59

Query  356  KAE-----SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E     S+W PDPVTGYYRPE+    E+DA ELR+M L
Sbjct  60   SSETRAYSSAWAPDPVTGYYRPEN-CGAEIDAAELREMLL  98



>gb|KHG30665.1| Late embryogenesis abundant Lea5-A [Gossypium arboreum]
Length=105

 Score = 52.8 bits (125),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K L + V   + V+ + RRGY+    A    S G P        +   +   
Sbjct  1    MARSVSSFKFLGASVFDALYVSIS-RRGYSGAPPAAVTASFGRPGAMGKVERRHAMKESS  59

Query  356  KAE-----SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E     S+W PDPVTGYYRPE+    E+DA ELR+M L
Sbjct  60   SSETRAYSSAWAPDPVTGYYRPEN-CGAEIDAAELREMLL  98



>ref|NP_193326.4| protein DROUGHT-INDUCED 21 [Arabidopsis thaliana]
 emb|CAA55322.1| Di21 [Arabidopsis thaliana]
 gb|AAO24597.1| At4g15910 [Arabidopsis thaliana]
 gb|AEE83665.1| drought-induced 21 protein [Arabidopsis thaliana]
Length=104

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 46/96 (48%), Gaps = 3/96 (3%)
 Frame = +2

Query  179  ARTFSTA-KQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            AR+ S A K L S     +S +   RR Y A      A        +     K    G D
Sbjct  3    ARSLSGAVKSLCSAASGSLSCSIVLRRSYVATSQNVTAAGLSKGGSTRVMVGKMEQRGLD  62

Query  356  K-AESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            + AES+W PDPVTGYYRP +    E+D  ELR++ L
Sbjct  63   QEAESAWGPDPVTGYYRPSNRA-AEIDPAELRELLL  97



>gb|ABF29697.1| late embryogenesis abundant protein 5 [Populus suaveolens]
Length=91

 Score = 52.4 bits (124),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK +S  +   I+      RG++AV +   AVS        A   K+G E   
Sbjct  1    MARSFSNAKVISGLISEAIN-----GRGFSAVASQGAAVSKARSGA--AVMKKTGEEVTK  53

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              E  SW PDP TG+YRPE+   +E+DA ELR  FL
Sbjct  54   TTEKISWVPDPRTGFYRPENVA-QEIDAAELRAAFL  88



>ref|XP_011009435.1| PREDICTED: indole-3-acetic acid-induced protein ARG2 [Populus 
euphratica]
Length=91

 Score = 52.4 bits (124),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 52/96 (54%), Gaps = 9/96 (9%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+FS AK +S  +   I+      RG++AV +   AVS        A   K+G E   
Sbjct  1    MARSFSNAKVISGLINEAIN-----GRGFSAVASQGAAVSKARSGA--AVMKKTGEEVTK  53

Query  356  KAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              E  SW PDP TG+YRPE+   +E+DA ELR  FL
Sbjct  54   TTEKISWVPDPRTGFYRPENVA-QEIDAAELRAAFL  88



>ref|XP_008451558.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Cucumis 
melo]
Length=105

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 54/103 (52%), Gaps = 10/103 (10%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPA------KSNATPPKS  337
            MAR+FS  K LS+ V    S   T R GYAA   ++G  SS          +S+    KS
Sbjct  1    MARSFSNVKILSAVVSDGFSSLLTSR-GYAAAAGSQGVASSAVKGAGVAAARSSNLLKKS  59

Query  338  GNEG--QDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G E       + SW PDPVTGYYRPE+  + E+D  ELR + L
Sbjct  60   GEEKVVGSTEKVSWVPDPVTGYYRPENRCD-EIDVAELRSILL  101



>gb|AEZ67462.1| late embryogenesis abundant proteins, partial [Haloxylon ammodendron]
Length=78

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 42/80 (53%), Gaps = 4/80 (5%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK + S V   IS+A+  RRGYAA         + + +    T  +   E   
Sbjct  1    MARSISNAKVILSLVADNISIASQ-RRGYAAASQRVAVEVARAASGKKTTTKE---EIGR  56

Query  356  KAESSWYPDPVTGYYRPEDE  415
             AE SW PDPVTGYYRP + 
Sbjct  57   SAEQSWVPDPVTGYYRPANH  76



>ref|XP_010457272.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=97

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 50/95 (53%), Gaps = 2/95 (2%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S AK LS FV  ++S  A  RRG+A         S  S   +++   K+      
Sbjct  1    MARSLSNAKILSVFVSEKLS-NAVFRRGFAVAAKTASEGSVSSSENASSAVMKNKVVEAS  59

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
              ++ W PDP TGYYRPE   ++E+D  ELR + L
Sbjct  60   SEKAPWVPDPKTGYYRPET-VSEEIDPAELRAVLL  93



>emb|CDY44170.1| BnaC01g22200D [Brassica napus]
Length=99

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 46/95 (48%), Gaps = 7/95 (7%)
 Frame = +2

Query  179  ARTFSTA-KQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            AR+ S   K L S V H  S +   RR Y A     G         +  T  K       
Sbjct  4    ARSLSAGVKSLYSAVSHNFSGSIVLRRSYVATVPGFGKG-----GSTRVTVGKLEQRANQ  58

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +AES+W PDPVTGYYRP +  + E+D  ELR+M L
Sbjct  59   EAESAWAPDPVTGYYRPFNRAD-EIDPAELREMLL  92



>ref|XP_008454329.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like [Cucumis 
melo]
Length=85

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +2

Query  347  GQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G++K   SW PDPVTGYYRPE+    EMDA +LR M L
Sbjct  44   GREKMAVSWVPDPVTGYYRPEN-CGAEMDAADLRAMLL  80



>gb|KGN52818.1| hypothetical protein Csa_4G001850 [Cucumis sativus]
Length=85

 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 1/38 (3%)
 Frame = +2

Query  347  GQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            G++K   SW PDPVTGYYRPE+    EMDA +LR M L
Sbjct  44   GREKKAVSWVPDPVTGYYRPEN-CGAEMDAADLRAMLL  80



>sp|P46521.1|LEA5A_GOSHI RecName: Full=Late embryogenesis abundant protein Lea5-A [Gossypium 
hirsutum]
 gb|AAA18545.1| late embryogenesis-abundant protein [Gossypium hirsutum]
 gb|AAA18538.1| Lea5-A late embryogenesis-abundant protein [Gossypium hirsutum]
Length=105

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 7/100 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MAR+ S+ K L + V   + V+ + RRGY+    A    S G P        +   +   
Sbjct  1    MARSVSSFKFLGASVFDALYVSIS-RRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESS  59

Query  356  KAE-----SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             +E     S+W PDPVTGYYRPE+    E+DA +LR+M L
Sbjct  60   SSETRAYSSAWAPDPVTGYYRPEN-CGAEIDAADLREMML  98



>ref|XP_004290804.1| PREDICTED: indole-3-acetic acid-induced protein ARG2-like [Fragaria 
vesca subsp. vesca]
Length=97

 Score = 49.7 bits (117),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 52/103 (50%), Gaps = 17/103 (17%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGN----  343
            MAR+FS AK LS+ V + I      RRGYAA      AV     A   A+  +S N    
Sbjct  1    MARSFSNAKLLSALVSNTI-----ARRGYAAGSPGLAAVRGEVAA---ASVTRSVNLEKK  52

Query  344  EGQDKAES----SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
             G+DK  S    SW P+P TG Y PE+  + E+D  ELR   L
Sbjct  53   SGEDKVGSVFKVSWVPNPKTGVYGPENRAD-EIDVAELRNALL  94



>gb|KDP28177.1| hypothetical protein JCGZ_13948 [Jatropha curcas]
Length=88

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 12/96 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR+FS AK LS+ +   I+      RG++A     GA      A+S     K+  E  +
Sbjct  1    MARSFSNAKVLSALITKAIN-----SRGFSAAAPQAGAA-----ARSGVVVKKTREEMAR  50

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDP TG YRPE+   +E+DA ELR M L
Sbjct  51   STEKTSWVPDPRTGCYRPENVA-EEIDAAELRAMLL  85



>gb|KDO71713.1| hypothetical protein CISIN_1g034332mg [Citrus sinensis]
Length=75

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +2

Query  251  RRGYaaveaaegavssgsPAKSNATPPKSGNEGQDKAESSWYPDPVTGYYRPEDEDNKEM  430
            RRGYAA         +G   K++ TP    + G   A S+W PDP+TGYYRPE+    E+
Sbjct  3    RRGYAAAAPLGTISRTGIMEKNDLTPAVREDSG---ASSAWAPDPITGYYRPENR-AVEI  58

Query  431  DAVELRQMFL  460
            D  ELR+M L
Sbjct  59   DPAELREMLL  68



>gb|ACF74336.1| putative late-embryogenesis protein [Arachis hypogaea]
 gb|ADQ91845.1| late embryogenesis abundant protein group 6 protein [Arachis 
hypogaea]
Length=91

 Score = 49.3 bits (116),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (49%), Gaps = 12/96 (13%)
 Frame = +2

Query  176  MARTFSTAK-QLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQ  352
            MAR+FST K  +SS +          R+GYA    +     + + +     P  +  +  
Sbjct  1    MARSFSTVKASISSLI---------TRQGYATTAQSAVRGGAATISGGKMGPKTTEEKAA  51

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               + SW PDPVTGYY+P  E+ K++D  +LR   L
Sbjct  52   AAEKVSWVPDPVTGYYKP--ENIKDIDVADLRATLL  85



>ref|XP_006414427.1| hypothetical protein EUTSA_v10026659mg [Eutrema salsugineum]
 dbj|BAJ34567.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55880.1| hypothetical protein EUTSA_v10026659mg [Eutrema salsugineum]
Length=97

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +AES+W PDPVTGYYRP +  + E+D  ELR+M L
Sbjct  57   EAESAWAPDPVTGYYRPSNRTD-EIDPAELREMLL  90



>ref|XP_004165915.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
1 [Cucumis sativus]
 ref|XP_004165916.1| PREDICTED: late embryogenesis abundant protein Lea5-A-like isoform 
2 [Cucumis sativus]
Length=126

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 32/52 (62%), Gaps = 2/52 (4%)
 Frame = +2

Query  308  AKSNATPPKSGNEGQDKAES-SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            A+S+    KSG E     E  SW PDPVTGYYRPE+  + E+D  ELR + L
Sbjct  62   ARSSNLLKKSGEEKVGTTEKVSWVPDPVTGYYRPENRSD-EIDVAELRSILL  112



>ref|XP_007163119.1| hypothetical protein PHAVU_001G207800g [Phaseolus vulgaris]
 gb|ESW35113.1| hypothetical protein PHAVU_001G207800g [Phaseolus vulgaris]
Length=97

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 44/95 (46%), Gaps = 7/95 (7%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MA +F+T K  SSF +   S   T RRGY A       +      KS     +      +
Sbjct  1    MASSFTTIKPFSSFAMLHFSHCLTIRRGYGAASKGVDLIKREMGGKS-----EEKKVCDE  55

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            K  + W PD VTGYY+P + +  E+D  ELR   L
Sbjct  56   KVCNWWMPDSVTGYYKPSNIN--EIDPAELRAKLL  88



>ref|XP_007035627.1| Late embryogenesis abundant protein Lea5-D [Theobroma cacao]
 gb|EOY06553.1| Late embryogenesis abundant protein Lea5-D [Theobroma cacao]
Length=104

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 12/102 (12%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQ-  352
            MAR  S+ K L + V   +S++ + RRGY+         +     +  A P   G   Q 
Sbjct  1    MARPLSSLKLLVASVSDGLSLSIS-RRGYSVTPHGAVTAAF---GRGEARPGMVGKVEQR  56

Query  353  ------DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
                    A ++W PDPVTGYYRPE+    E+DA  LR+M L
Sbjct  57   GVMKEESGASTAWAPDPVTGYYRPEN-CLAEIDAAGLREMLL  97



>ref|XP_009146595.1| PREDICTED: late embryogenesis abundant protein Lea5-like isoform 
X2 [Brassica rapa]
Length=98

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 46/95 (48%), Gaps = 8/95 (8%)
 Frame = +2

Query  179  ARTFSTA-KQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            AR+ S A K L S   H IS  +   R Y A     G         +  T  K       
Sbjct  4    ARSLSGAVKSLCSAASHNIS-GSIVLRSYVATVPGFGKG-----GSTRVTVGKMEQRANQ  57

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +AES+W PDPVTGYYRP +  + E+D  ELR+M L
Sbjct  58   EAESAWAPDPVTGYYRPSNRAD-EIDPAELREMLL  91



>ref|XP_010449879.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Camelina 
sativa]
Length=104

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 41/92 (45%), Gaps = 2/92 (2%)
 Frame = +2

Query  188  FSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQDK-AE  364
            F   K + S     ++ +   RR Y A      A        +     K      D+ AE
Sbjct  7    FGALKHICSATSGNLTGSIVLRRSYVATSQNVTATGLSKGGSTRVMVGKIEQRALDQEAE  66

Query  365  SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            S+W PDPVTGYYRP D    E+D  ELR++ L
Sbjct  67   SAWGPDPVTGYYRPSDR-AAEIDPAELRELLL  97



>gb|AGW45454.1| late embryogenesis abundant protein [Reaumuria trigyna]
Length=104

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 51/96 (53%), Gaps = 6/96 (6%)
 Frame = +2

Query  176  MAR-TFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQ  352
            MAR +FS AK  S+ V+   S+A + RR YAA        +S +  +       S +   
Sbjct  1    MARCSFSNAKLFSTLVIDNFSLAFS-RRTYAAASQGMAMSNSSNLLRRGG---GSSSTST  56

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               E SW PDPVTGYYRP +  + ++D  ELR+M L
Sbjct  57   SSTEDSWVPDPVTGYYRPANHAD-DVDVAELREMLL  91



>gb|KCW58419.1| hypothetical protein EUGRSUZ_H01105, partial [Eucalyptus grandis]
Length=104

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 45/91 (49%), Gaps = 10/91 (11%)
 Frame = +2

Query  191  STAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQDKAES-  367
            S AK  S  ++  IS A+  RRGYAA      +         N    K+G E     E  
Sbjct  19   SNAKLFSVALVDGIS-ASIARRGYAAASQGVASSF-------NVMSKKTGEEMARSTERV  70

Query  368  SWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            SW PDP TGYYRPE+  + E+D  ELR + L
Sbjct  71   SWVPDPKTGYYRPENRAD-EIDVAELRALLL  100



>ref|XP_006586916.1| PREDICTED: late embryogenesis abundant protein Lea5 [Glycine 
max]
Length=106

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 1/40 (3%)
 Frame = +2

Query  341  NEGQDKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            + G     S+W PDP+TGYYRP +  N E+D VELR+M L
Sbjct  58   SSGPSGTSSAWAPDPITGYYRPINHTN-EIDPVELRKMLL  96



>ref|XP_010544998.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Tarenaya 
hassleriana]
Length=88

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 44/95 (46%), Gaps = 12/95 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNEGQD  355
            MA++ S  K +S  + +     A  RRGY A      A +     +        G  G  
Sbjct  1    MAKSLSNVKSMSLCIYN-----AMVRRGYRAAANEAEAKAVRDGERK-------GTRGSR  48

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +  SSW PDP TGYYRP+   N+ +DA ELR   L
Sbjct  49   EKPSSWAPDPKTGYYRPDPSANELVDAAELRASLL  83



>gb|ACV50424.1| late embryogenesis protein-5 [Jatropha curcas]
Length=88

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 51/96 (53%), Gaps = 12/96 (13%)
 Frame = +2

Query  176  MARTFSTAKQLSSFVLHRISVAATCRRGYaaveaaegavssgsPAKSNATPPKSGNE-GQ  352
            MAR FS AK LS+ +   I+      RG++A     GA      A+S     K+  E  +
Sbjct  1    MARPFSNAKVLSALITKAIN-----SRGFSAAAPQAGAA-----ARSGVVVKKTREEMAR  50

Query  353  DKAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
               ++SW PDP TG YRPE+   +E+DA ELR M L
Sbjct  51   STEKTSWVPDPRTGCYRPENVA-EEIDAAELRAMLL  85



>ref|XP_010269579.1| PREDICTED: late embryogenesis abundant protein Lea5-D-like [Nelumbo 
nucifera]
Length=106

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 1/32 (3%)
 Frame = +2

Query  365  SSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            SSW PDPVTGYYRPE+    E+D  ELR+M L
Sbjct  67   SSWVPDPVTGYYRPENR-GAEIDVAELREMVL  97



>ref|XP_006284808.1| hypothetical protein CARUB_v10006078mg [Capsella rubella]
 gb|EOA17706.1| hypothetical protein CARUB_v10006078mg [Capsella rubella]
Length=107

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  356  KAESSWYPDPVTGYYRPEDEDNKEMDAVELRQMFL  460
            +AES+W PDPVTGYYRP +  + E+D  ELR++ L
Sbjct  66   EAESAWGPDPVTGYYRPSNRAD-EIDPAELRELLL  99



>ref|XP_006419542.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
 gb|ESR32782.1| hypothetical protein CICLE_v10006308mg [Citrus clementina]
Length=75

 Score = 46.6 bits (109),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +2

Query  251  RRGYaaveaaegavssgsPAKSNATPPKSGNEGQDKAESSWYPDPVTGYYRPEDEDNKEM  430
            RRGYAA         +G   K++  P    + G   A S+W PDP+TGYYRPE+    E+
Sbjct  3    RRGYAAAAPLGTISRTGIMEKNDLRPAVREDSG---ASSAWAPDPITGYYRPENR-AVEI  58

Query  431  DAVELRQMFL  460
            D  ELR+M L
Sbjct  59   DPAELREMLL  68



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897646128048