BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81166_g1_i1 len=583 path=[1:0-582]

Length=583
                                                                      Score     E

ref|XP_009776701.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    155   1e-41   
ref|XP_009622770.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    155   2e-41   
ref|XP_009590435.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    154   3e-41   
gb|AII99841.1|  chloroplast sedoheptulose-1,7-bisphosphatase            154   5e-41   
ref|XP_007009096.1|  Sedoheptulose-bisphosphatase                       153   9e-41   
ref|XP_011084948.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    150   1e-39   
ref|XP_009780073.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    150   1e-39   
ref|NP_001234585.1|  chloroplast sedoheptulose-1,7-bisphosphatase       147   9e-39   
gb|EYU41251.1|  hypothetical protein MIMGU_mgv1a007806mg                147   1e-38   
ref|XP_002530415.1|  sedoheptulose-1,7-bisphosphatase, chloroplas...    146   3e-38   Ricinus communis
gb|KHG28838.1|  hypothetical protein F383_10336                         145   4e-38   
emb|CDP14065.1|  unnamed protein product                                145   5e-38   
ref|XP_002263049.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    145   7e-38   Vitis vinifera
gb|KDP44831.1|  hypothetical protein JCGZ_01331                         145   8e-38   
ref|XP_004307611.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    144   2e-37   
ref|XP_006355654.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    144   2e-37   
ref|XP_008463213.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    140   3e-36   
ref|XP_002316235.1|  Sedoheptulose-1 family protein                     139   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_006435666.1|  hypothetical protein CICLE_v10031765mg             139   2e-35   
ref|XP_011036010.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    137   4e-35   
gb|AFK49549.1|  unknown                                                 132   5e-35   
ref|NP_001267658.1|  sedoheptulose-1,7-bisphosphatase, chloroplas...    137   7e-35   
emb|CDY02960.1|  BnaC04g25260D                                          137   1e-34   
ref|XP_004294065.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    136   1e-34   
ref|XP_010504450.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    135   4e-34   
ref|XP_009361829.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    134   1e-33   
emb|CDX72200.1|  BnaC08g26740D                                          133   2e-33   
ref|NP_191139.1|  Sedoheptulose-1,7-bisphosphatase                      133   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010031259.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    133   3e-33   
gb|AAK96860.1|  sedoheptulose-bisphosphatase precursor                  133   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876336.1|  sedoheptulose-bisphosphatase                       132   4e-33   
ref|XP_006291276.1|  hypothetical protein CARUB_v10017407mg             132   4e-33   
emb|CDX76072.1|  BnaA04g03360D                                          132   4e-33   
ref|XP_009139137.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    132   6e-33   
ref|XP_010093027.1|  Sedoheptulose-1,7-bisphosphatase                   132   6e-33   
ref|XP_009139136.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    132   7e-33   
ref|XP_010516168.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    132   1e-32   
gb|ACU23254.1|  unknown                                                 130   2e-32   Glycine max [soybeans]
ref|XP_003552524.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    130   2e-32   
ref|XP_003538446.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    129   5e-32   
ref|XP_010690111.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    129   5e-32   
ref|XP_004503228.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    129   6e-32   
ref|XP_011076739.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    129   7e-32   
ref|XP_007163512.1|  hypothetical protein PHAVU_001G240200g             126   5e-31   
sp|O20252.1|S17P_SPIOL  RecName: Full=Sedoheptulose-1,7-bisphosph...    126   6e-31   Spinacia oleracea
gb|KFK34828.1|  hypothetical protein AALP_AA5G198500                    126   8e-31   
ref|XP_006403416.1|  hypothetical protein EUTSA_v10010434mg             125   1e-30   
ref|XP_009139135.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    125   2e-30   
ref|XP_009103972.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    125   2e-30   
ref|XP_003600853.1|  Sedoheptulose-1 7-bisphosphatase                   124   3e-30   
ref|XP_009103971.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    124   3e-30   
ref|XP_007213879.1|  hypothetical protein PRUPE_ppa006836mg             124   3e-30   
emb|CDY27264.1|  BnaA09g35380D                                          123   9e-30   
ref|XP_009116278.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    122   2e-29   
gb|AHY18974.1|  sedoheptulose-1,7-bisphosphatase                        122   2e-29   
emb|CDX67626.1|  BnaA07g16660D                                          120   7e-29   
ref|XP_008226111.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    120   7e-29   
ref|XP_010256671.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    120   1e-28   
gb|ABK76304.1|  chloroplast sedoheptulose-1,7-bisphosphatase            119   2e-28   Morus alba var. multicaulis
gb|ACN73053.1|  COSII_At3g55800                                         112   2e-28   Solanum pimpinellifolium [currant tomato]
ref|XP_009341715.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    119   3e-28   
ref|XP_010554642.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    119   3e-28   
gb|ACN73065.1|  COSII_At3g55800                                         111   5e-28   Solanum juglandifolium
ref|XP_008383089.1|  PREDICTED: LOW QUALITY PROTEIN: sedoheptulos...    118   7e-28   
gb|ACN73050.1|  COSII_At3g55800                                         110   8e-28   Solanum cheesmaniae
ref|XP_009351006.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    117   1e-27   
gb|ACN73057.1|  COSII_At3g55800                                         110   1e-27   Solanum huaylasense
ref|XP_009344459.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    117   1e-27   
ref|XP_010427373.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    117   1e-27   
gb|ACN73059.1|  COSII_At3g55800                                         110   1e-27   Solanum peruvianum [Peruvian tomato]
ref|XP_008381958.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    116   3e-27   
ref|XP_010554641.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    115   4e-27   
ref|XP_007218076.1|  hypothetical protein PRUPE_ppa006859mg             115   4e-27   
gb|ACV49901.1|  fructose-1,6-bisphosphatase                             111   8e-27   Fragaria x ananassa
ref|XP_008372025.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    114   2e-26   
ref|XP_008785431.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    111   2e-25   
ref|XP_006827008.1|  hypothetical protein AMTR_s00010p00216200          105   1e-23   
ref|XP_010923135.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    105   2e-23   
ref|XP_010923134.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    105   2e-23   
gb|EPS64973.1|  chloroplast sedoheptulose-1,7-bisphosphatase            103   2e-23   
ref|XP_008234053.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    104   4e-23   
ref|XP_010928921.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    104   4e-23   
ref|XP_008775070.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    104   4e-23   
ref|XP_010928919.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    103   8e-23   
ref|NP_001052293.1|  Os04g0234600                                       103   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AAO22558.1|  sedoheptulose-1,7-bisphosphatase precursor              102   1e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAJ89104.1|  predicted protein                                    99.0    1e-22   
ref|XP_002456647.1|  hypothetical protein SORBIDRAFT_03g040100          102   2e-22   Sorghum bicolor [broomcorn]
ref|XP_004970606.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...    101   5e-22   
gb|ABK24111.1|  unknown                                                 101   5e-22   Picea sitchensis
ref|XP_009398831.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...  99.8    2e-21   
ref|XP_006664812.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...  99.0    3e-21   
gb|EMS67709.1|  Sedoheptulose-1,7-bisphosphatase, chloroplastic       98.2    6e-21   
dbj|BAJ85704.1|  predicted protein                                    98.2    7e-21   
emb|CBH32512.1|  sedoheptulose-1,7-bisphosphatase, chloroplast pr...  98.2    7e-21   
sp|P46285.1|S17P_WHEAT  RecName: Full=Sedoheptulose-1,7-bisphosph...  98.2    7e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003564625.1|  PREDICTED: sedoheptulose-1,7-bisphosphatase,...  98.2    8e-21   
ref|NP_001148402.1|  sedoheptulose bisphosphatase1                    97.4    1e-20   Zea mays [maize]
gb|ACJ84871.1|  unknown                                               95.9    3e-20   Medicago truncatula
emb|CDY63439.1|  BnaC06g42620D                                        92.4    4e-19   
ref|XP_001760166.1|  predicted protein                                91.7    1e-18   
ref|XP_001784896.1|  predicted protein                                86.3    2e-16   
ref|XP_002973325.1|  hypothetical protein SELMODRAFT_99338            80.9    5e-15   
gb|EMT17623.1|  Sedoheptulose-1,7-bisphosphatase, chloroplastic       80.9    2e-14   
gb|ACA48679.1|  chloroplast sedoheptulose-1,7-bisphosphatase          69.3    3e-12   Oenothera elata subsp. elata
gb|ACA48689.1|  chloroplast sedoheptulose-1,7-bisphosphatase          69.3    4e-12   Oenothera grandiflora
ref|XP_005850770.1|  hypothetical protein CHLNCDRAFT_19601            72.8    5e-12   
gb|ABK00060.1|  chloroplast sedoheptulose-1,7-bisphosphatase          73.2    5e-12   Marchantia polymorpha
gb|ABF68592.1|  chloroplast sedoheptulose-1,7-bisphosphatase          73.2    5e-12   Marchantia polymorpha
ref|XP_001691997.1|  sedoheptulose-1,7-bisphosphatase                 72.4    1e-11   Chlamydomonas reinhardtii
ref|XP_005642742.1|  sedoheptulose-1,7-bisphosphatase                 71.6    1e-11   
ref|XP_002946928.1|  sedoheptulose-1,7-biphosphatase                  72.0    1e-11   
emb|CAA74960.1|  sedoheptulose-1,7-biphosphatase                      71.6    2e-11   Chlamydomonas reinhardtii
sp|P46284.1|S17P_CHLRE  RecName: Full=Sedoheptulose-1,7-bisphosph...  71.2    2e-11   Chlamydomonas reinhardtii
gb|ACA48696.1|  chloroplast sedoheptulose-1,7-bisphosphatase          65.9    6e-11   Oenothera argillicola
gb|ACA48670.1|  chloroplast sedoheptulose-1,7-bisphosphatase          65.1    1e-10   Oenothera biennis
gb|KFM29064.1|  Sedoheptulose-1,7-bisphosphatase, chloroplastic       67.8    3e-10   
gb|ABK00061.1|  chloroplast sedoheptulose-1,7-bisphosphatase          67.0    5e-10   Mesostigma viride
dbj|BAA94305.1|  sedoheptulose-1,7-bisphosphatase                     66.2    1e-09   Chlamydomonas sp. W80
gb|KDO69103.1|  hypothetical protein CISIN_1g022390mg                 54.7    5e-06   
gb|KDO69100.1|  hypothetical protein CISIN_1g022390mg                 55.1    6e-06   
gb|ABF68591.1|  chloroplast sedoheptulose-1,7-bisphosphatase          52.8    5e-05   Euglena gracilis



>ref|XP_009776701.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Nicotiana sylvestris]
Length=393

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFAR-AALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET +TC AR AALLPNV+SQHS+SLA P        S     SSLFGESLR+ PKSS+ 
Sbjct  1    METSVTCCARTAALLPNVSSQHSTSLAAPRSISPSFSSRSLKSSSLFGESLRIAPKSSIK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
            V +T+  +SS VTKCEIGDSLEEFLTKSTSDKGLI LM+CMGEAIRTIAFKVRTASCGGT
Sbjct  61   VSRTK--NSSLVTKCEIGDSLEEFLTKSTSDKGLIRLMMCMGEAIRTIAFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>ref|XP_009622770.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=395

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = +2

Query  212  IMETGITCFARA-ALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            IMET +TC AR  ALLPN++SQHS+SLA P        S     SSLFGESLR+ PKSSL
Sbjct  2    IMETSVTCCARTTALLPNISSQHSTSLAAPRSISPSFSSRSLKSSSLFGESLRLAPKSSL  61

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V +T+  +SS VTKCEIGDSLEEFLTKSTSDKGLI LM+CMGEAIRTIAFKVRTASCGG
Sbjct  62   KVSRTK--NSSLVTKCEIGDSLEEFLTKSTSDKGLIRLMMCMGEAIRTIAFKVRTASCGG  119

Query  569  TACVN  583
            TACVN
Sbjct  120  TACVN  124



>ref|XP_009590435.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Nicotiana 
tomentosiformis]
Length=394

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSS--SLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            M+T +TC ARAALLPNV+SQ  S  +LA P              SSLFGESL V PKSSL
Sbjct  1    MDTSVTCCARAALLPNVSSQQYSTTALAAPRSISPSFSIRSLKSSSLFGESLHVAPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
            NV KT+ +S   +TKCEIGDSLEEFLTKSTSDKGLISLM+CMGEA+RTIAFKVRTASCGG
Sbjct  61   NVSKTKSYSL--MTKCEIGDSLEEFLTKSTSDKGLISLMLCMGEALRTIAFKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>gb|AII99841.1| chloroplast sedoheptulose-1,7-bisphosphatase [Nicotiana tabacum]
Length=393

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFAR-AALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET +TC AR AALLPNV+SQHS+SLA P        S     SSLFGESLRV PKSS+ 
Sbjct  1    METSVTCCARTAALLPNVSSQHSTSLAAPRSISPSFSSRSLKSSSLFGESLRVAPKSSIK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
            V +T+  +SS VTKCEIGDSLEEFLTKSTSDKGLI LM+CMGEAIRTIAFKVRTA CGGT
Sbjct  61   VSRTK--NSSLVTKCEIGDSLEEFLTKSTSDKGLIRLMMCMGEAIRTIAFKVRTAPCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>ref|XP_007009096.1| Sedoheptulose-bisphosphatase [Theobroma cacao]
 gb|EOY17906.1| Sedoheptulose-bisphosphatase [Theobroma cacao]
Length=392

 Score =   153 bits (386),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METG+TC+AR  +LP+V+S+HS++L +P     P        SSL GESLRV+P+SSL V
Sbjct  1    METGVTCYARGIVLPSVSSKHSTALVSPPSISPPFSYRSLKTSSLLGESLRVVPRSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  SSS VT+CEIGDSLEEFLTK+T DKGLI LM+CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   SKTK--SSSFVTRCEIGDSLEEFLTKATPDKGLIRLMMCMGEALRTIAFKVRTASCGGTA  118

Query  575  CVN  583
            CVN
Sbjct  119  CVN  121



>ref|XP_011084948.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Sesamum 
indicum]
 ref|XP_011084949.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Sesamum 
indicum]
Length=392

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET +TC AR A+LP  +SQ  S+LA+P        S     SS++G+SLR++P+SSL V
Sbjct  1    METSLTCCARGAILPTASSQQYSTLASPRSVSPSFSSKSLRGSSIYGDSLRIVPRSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  SS+ VTKCEIGDSLEEFLTKSTSDKGLI LM+CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   SKAK--SSALVTKCEIGDSLEEFLTKSTSDKGLIRLMMCMGEALRTIAFKVRTASCGGTA  118

Query  575  CVN  583
            CVN
Sbjct  119  CVN  121



>ref|XP_009780073.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Nicotiana sylvestris]
Length=397

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 95/125 (76%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSS--SLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            MET +TC ARA LLPNV+SQ  S  +LA P              SSLFGESL V PKSSL
Sbjct  1    METSVTCCARADLLPNVSSQQYSTTALAAPRSISPSFSIRSLKSSSLFGESLHVAPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
            NV KT+ +S   V+KCEIGDSLE FLTKSTSDKGLISLM+CMGEA+RTIAFKVRTASCGG
Sbjct  61   NVSKTKSYSL--VSKCEIGDSLEGFLTKSTSDKGLISLMLCMGEALRTIAFKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>ref|NP_001234585.1| chloroplast sedoheptulose-1,7-bisphosphatase [Solanum lycopersicum]
 gb|ACR46521.1| chloroplast sedoheptulose-1,7-bisphosphatase [Solanum lycopersicum]
Length=394

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 100/125 (80%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARA-ALLPNVTSQ-HSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            METG+TC AR  +LLPNV+SQ +S+S+AT         S     SSLFGESLRV PKSSL
Sbjct  1    METGVTCCARVTSLLPNVSSQQYSTSIATSRSISPSFNSRSLKSSSLFGESLRVAPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V +T+  +SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RTIAFKVRTASCGG
Sbjct  61   KVSRTK--NSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRTIAFKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>gb|EYU41251.1| hypothetical protein MIMGU_mgv1a007806mg [Erythranthe guttata]
Length=394

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQ-HSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET I C  R+ +LPNV+SQ +S++LA+P        S     SSLFGESLRV PKSSL 
Sbjct  1    METSIACCTRSTILPNVSSQQYSAALASPRSVYPSFSSKSLKASSLFGESLRVAPKSSLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
             VK  K+SSS VTKCEIGDSLEEFL+KST DKGLI LM CMGEA+RTIAFKVRTASCGGT
Sbjct  61   FVKA-KNSSSLVTKCEIGDSLEEFLSKSTKDKGLIRLMTCMGEALRTIAFKVRTASCGGT  119

Query  572  ACVN  583
            ACVN
Sbjct  120  ACVN  123



>ref|XP_002530415.1| sedoheptulose-1,7-bisphosphatase, chloroplast, putative [Ricinus 
communis]
 gb|EEF31985.1| sedoheptulose-1,7-bisphosphatase, chloroplast, putative [Ricinus 
communis]
Length=389

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 94/123 (76%), Gaps = 6/123 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR ALLP ++SQHS +LA+P        S     SSLFGESLR++PKSS  V
Sbjct  1    METGIACCARGALLPGISSQHSKALASP----PSFNSKNLKSSSLFGESLRLVPKSSFKV  56

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  +SS VT+CEIGDSLEEFL K+T DKGL  LM+CMGEA+RTIAFKVRTASCGGTA
Sbjct  57   SKAK--NSSLVTRCEIGDSLEEFLAKATPDKGLARLMMCMGEALRTIAFKVRTASCGGTA  114

Query  575  CVN  583
            CVN
Sbjct  115  CVN  117



>gb|KHG28838.1| hypothetical protein F383_10336 [Gossypium arboreum]
Length=393

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 98/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET +TC+AR  +LP V+S+HSS+L +P        S     SSLFGESLRV+P+SSL V
Sbjct  1    METSVTCYARGIVLPGVSSKHSSALVSPPSISPSFSSKSLKTSSLFGESLRVVPRSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K  K+++S VTKCEIG+SLEEFLTK+T+DK LI LM+CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   SKA-KNTTSLVTKCEIGESLEEFLTKATTDKALIRLMMCMGEALRTIAFKVRTASCGGTA  119

Query  575  CVN  583
            CVN
Sbjct  120  CVN  122



>emb|CDP14065.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLP-KSSLN  391
            METGI C AR ALLPNV+SQHS+ L +P        S     SSLFGESLR++P +SSL 
Sbjct  1    METGIACCARGALLPNVSSQHSTGLVSPRSVSPSFSSRSLKSSSLFGESLRIMPPRSSLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K++  +SS VTKCEIGDSLEEFLTK+T DKGLI LM+CMGEA+RTI+FKVRTASCGGT
Sbjct  61   ASKSK--NSSLVTKCEIGDSLEEFLTKATPDKGLIRLMMCMGEALRTISFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>ref|XP_002263049.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Vitis 
vinifera]
 emb|CBI31540.3| unnamed protein product [Vitis vinifera]
Length=393

 Score =   145 bits (366),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAALL-PNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            METG+TC+AR A L  +V+SQHS++L +P        S     SSLFGESLRV+P+SSL 
Sbjct  1    METGVTCYARGAFLHTSVSSQHSTALVSPPSISPSFSSKSLRSSSLFGESLRVVPRSSLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
            V +T+  +SS VT+CE+GDSLEEFLTK+T DKGLI LM+CMGEA+RTIAFKVRTASCGGT
Sbjct  61   VSRTK--NSSLVTRCEVGDSLEEFLTKATPDKGLIRLMMCMGEALRTIAFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>gb|KDP44831.1| hypothetical protein JCGZ_01331 [Jatropha curcas]
Length=388

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR ALLP ++SQH+ +LA+P      S       SSLFGESLR++P+SSL V
Sbjct  1    METGIACCARGALLPGISSQHTKALASP-----SSTFRSLKSSSLFGESLRLVPRSSLKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  ++S VT+CEIGDSLEEFLTK+T DKGLI L++CMGEA+RTI+FKVRTASCGGTA
Sbjct  56   SKPK--NASLVTRCEIGDSLEEFLTKATPDKGLIRLLMCMGEALRTISFKVRTASCGGTA  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_004307611.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=392

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 93/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            ME  I C +  A LP V++QHS++LA P        S     +SLFGESLR +P+SSL V
Sbjct  1    MEASIACCSARAFLPGVSTQHSTALAAPSTISPSFSSKSLKATSLFGESLRQVPRSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT++  SS VTKCEIGDSLEEFLTK+T DKGLI LM+CMGEAIRTI+FKVRTASCGGTA
Sbjct  61   SKTKQ--SSLVTKCEIGDSLEEFLTKATPDKGLIRLMMCMGEAIRTISFKVRTASCGGTA  118

Query  575  CVN  583
            CVN
Sbjct  119  CVN  121



>ref|XP_006355654.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Solanum tuberosum]
Length=395

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 101/126 (80%), Gaps = 5/126 (4%)
 Frame = +2

Query  215  METGITCFARA-ALLPNVTSQ-HSSSLATP-GWsispsfstkslksslfGESLRVLPKSS  385
            MET +TC ARA +LLPNV+SQ +S+SLAT    S     S     SSLFGESLRV PKSS
Sbjct  1    METSVTCCARATSLLPNVSSQQYSTSLATSRSISQPSFNSRSLKSSSLFGESLRVAPKSS  60

Query  386  LNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCG  565
            L V +T+  +SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RTIAFKVRTASCG
Sbjct  61   LKVSRTK--NSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRTIAFKVRTASCG  118

Query  566  GTACVN  583
            GTACVN
Sbjct  119  GTACVN  124



>ref|XP_008463213.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Cucumis 
melo]
Length=388

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR A LPN++SQHS++L +P ++     ++        GESLR  PKSS+ V
Sbjct  1    METGIACCARGAFLPNLSSQHSTALMSPSFATRSLKASSLF-----GESLRQFPKSSVKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
              +R  S    T+CEIGDSLEEFLTK+T DKGLI L+ CMGEA+RTI+FKVRTASCGGTA
Sbjct  56   A-SRPKSVPLKTRCEIGDSLEEFLTKATPDKGLIRLLTCMGEALRTISFKVRTASCGGTA  114

Query  575  CVN  583
            CVN
Sbjct  115  CVN  117



>ref|XP_002316235.1| Sedoheptulose-1 family protein [Populus trichocarpa]
 gb|ABK95047.1| unknown [Populus trichocarpa]
 gb|EEF02406.1| Sedoheptulose-1 family protein [Populus trichocarpa]
Length=392

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR A LP V SQHS +  +P        S     SSLFGE+LR +P+SSL V
Sbjct  1    METGIACCARGAYLPGV-SQHSKAPVSPQSISPSCSSRGLKSSSLFGETLRFVPRSSLKV  59

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  +SS VT+CEIGDSLEEFLTK+TSDKGLI +++CMGEA+RTIAFKVRTASCGGTA
Sbjct  60   SKAK--NSSLVTRCEIGDSLEEFLTKATSDKGLIRVLMCMGEALRTIAFKVRTASCGGTA  117

Query  575  CVN  583
            CVN
Sbjct  118  CVN  120



>ref|XP_006435666.1| hypothetical protein CICLE_v10031765mg [Citrus clementina]
 ref|XP_006486375.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Citrus sinensis]
 gb|ESR48906.1| hypothetical protein CICLE_v10031765mg [Citrus clementina]
Length=392

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGITC++R  + P V+SQ  ++L +P    S   S     SSLFGE LRV+P+S++ V
Sbjct  1    METGITCYSRGVVTPTVSSQRYTALVSPTSVSSSFGSRSLKASSLFGEPLRVVPRSAVKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  +SS VTKCE+GDSLEEFLTK+T DK LI LM+CMGEA+RTIAFKVRTASC GTA
Sbjct  61   SKTK--NSSLVTKCELGDSLEEFLTKATPDKALIRLMMCMGEALRTIAFKVRTASCVGTA  118

Query  575  CVN  583
            CVN
Sbjct  119  CVN  121



>ref|XP_011036010.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Populus 
euphratica]
Length=392

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR A LP V SQHS +  +P        S     SSLFGE+LR +P+SSL V
Sbjct  1    METGIACCARGAYLPGV-SQHSKAPVSPQSISPSCSSRSLKSSSLFGETLRFVPRSSLKV  59

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  + S VT+CEIGDSLEEFLTK+TSDKGL+ +++CMGEA+RTIAFKVRTASCGGTA
Sbjct  60   SKAK--NPSLVTRCEIGDSLEEFLTKATSDKGLVRVLMCMGEALRTIAFKVRTASCGGTA  117

Query  575  CVN  583
            CVN
Sbjct  118  CVN  120



>gb|AFK49549.1| unknown [Lotus japonicus]
Length=172

 Score =   132 bits (332),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (72%), Gaps = 6/123 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C+ R A LP+V+S+HS    +P +      S+        GESLRV  KS+L V
Sbjct  1    METGIACYTRGAFLPSVSSKHSPPSISPSFGFRSLKSSSLF-----GESLRVSSKSTLKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             +T K S+S VTKCEIGDSLEEFLTK+T DKGLI L+  MGEA+RTI+FKV+TASCGGT 
Sbjct  56   SRT-KGSTSLVTKCEIGDSLEEFLTKATPDKGLIRLLFSMGEALRTISFKVKTASCGGTQ  114

Query  575  CVN  583
            CVN
Sbjct  115  CVN  117



>ref|NP_001267658.1| sedoheptulose-1,7-bisphosphatase, chloroplastic-like [Cucumis 
sativus]
 gb|ACQ82818.1| sedoheptulose-1,7-bisphosphatase [Cucumis sativus]
 gb|KGN50632.1| hypothetical protein Csa_5G198220 [Cucumis sativus]
Length=388

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 6/123 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C AR A LPN++SQHS++L +P ++     ++        GESLR + KSS+ V
Sbjct  1    METGIACCARGAFLPNLSSQHSTALMSPSFATRSLKASSLF-----GESLRQVSKSSVKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
              +R  S    T+CEIGDSLEEFLTK+T DKGLI L+ CMGEA+RTI+FKVRTASCGGTA
Sbjct  56   A-SRPKSVPLKTRCEIGDSLEEFLTKATPDKGLIRLLTCMGEALRTISFKVRTASCGGTA  114

Query  575  CVN  583
            CVN
Sbjct  115  CVN  117



>emb|CDY02960.1| BnaC04g25260D [Brassica napus]
Length=394

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPG-WsispsfstkslksslfGESLRVLPKSSLN  391
            MET +TC++R  +LP+V+SQ SS+L +P  +  + S   +   SS+FG+SLRV P+S L 
Sbjct  1    METSVTCYSRGIILPSVSSQRSSTLVSPPPFFSASSSFKRLKSSSIFGDSLRVAPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + +  S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   ATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_004294065.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=393

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTS-QHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET + C+AR A   NV+S QHS+SL +P        +     SSLFGESLR++PKSSL 
Sbjct  1    METSVACYARGAFPRNVSSSQHSTSLMSPASISPSFNAKVLRTSSLFGESLRLVPKSSLR  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
             +KT+  S +P  KC IGDSLEEFLTK+T DK LISL++ MGEAIRTI +KVRTASCGGT
Sbjct  61   ALKTKNSSVAP--KCAIGDSLEEFLTKATPDKSLISLLLAMGEAIRTIGYKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>ref|XP_010504450.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Camelina 
sativa]
Length=393

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +P    S S   +   SS+FG+SLR+ PKS +  
Sbjct  1    METSIACYSRGILPPSVSSQRSSTLVSPASFSSSSSFKRLKSSSIFGDSLRLAPKSQVKS  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASSVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>ref|XP_009361829.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=403

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAAL--LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            MET + C+AR A     NV+SQHS+SL +P        S     SSLFGESLR++PKS L
Sbjct  1    METSVACYARGAFPVRNNVSSQHSNSLFSPASISPSFNSKVLRTSSLFGESLRLVPKSFL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V+KT+ +S  P  KC IGDSLEEFLTK+T DK LI+L+I MGEA RTI FKVRTASCGG
Sbjct  61   KVLKTKNNSIVP--KCAIGDSLEEFLTKATPDKKLITLLISMGEAFRTIGFKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>emb|CDX72200.1| BnaC08g26740D [Brassica napus]
Length=394

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstk-slksslfGESLRVLPKSSLN  391
            MET +TC++R  LLP V+SQ S SL TP  S S S S K    SS+FG+SLRV P+S L 
Sbjct  1    METSVTCYSRGVLLPRVSSQRSPSLVTPPSSFSTSSSFKGLKSSSIFGDSLRVAPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +S VTKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   ATKPKSNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|NP_191139.1| Sedoheptulose-1,7-bisphosphatase [Arabidopsis thaliana]
 sp|P46283.1|S17P_ARATH RecName: Full=Sedoheptulose-1,7-bisphosphatase, chloroplastic; 
AltName: Full=SED(1,7)P2ase; AltName: Full=Sedoheptulose bisphosphatase; 
Short=SBPase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAB33001.1| sedoheptulose-1,7-bisphosphatase (chloroplast) [Arabidopsis thaliana]
 emb|CAB81605.1| sedoheptulose-bisphosphatase precursor [Arabidopsis thaliana]
 gb|AEE79443.1| Sedoheptulose-1,7-bisphosphatase [Arabidopsis thaliana]
Length=393

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +P    + S   +   SS+FG+SLR+ PKS L  
Sbjct  1    METSIACYSRGILPPSVSSQRSSTLVSPPSYSTSSSFKRLKSSSIFGDSLRLAPKSQLKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>ref|XP_010031259.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW50519.1| hypothetical protein EUGRSUZ_J00242 [Eucalyptus grandis]
Length=390

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 91/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRV-LPKSSLN  391
            METG+ C+AR A LP   ++HS+SL +P        S     SSLFGESLRV  P+SSL 
Sbjct  1    METGVACYARGAFLP---AKHSTSLVSPHSLSPSFTSKSLKSSSLFGESLRVGPPRSSLK  57

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K +  +SS  T+CEIGDSLEEFL K+T DKGLI L++CMGEAIRTI+FKVRTASCGGT
Sbjct  58   ASKAK--NSSLTTRCEIGDSLEEFLNKATPDKGLIRLLVCMGEAIRTISFKVRTASCGGT  115

Query  572  ACVN  583
            ACVN
Sbjct  116  ACVN  119



>gb|AAK96860.1| sedoheptulose-bisphosphatase precursor [Arabidopsis thaliana]
 gb|AAM91137.1| sedoheptulose-bisphosphatase precursor [Arabidopsis thaliana]
Length=393

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +P    + S   +   SS+FG+SLR+ PKS L  
Sbjct  1    METSIACYSRGILPPSVSSQRSSTLVSPPSYSTSSSFKRLKSSSIFGDSLRLAPKSQLKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>ref|XP_002876336.1| sedoheptulose-bisphosphatase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52595.1| sedoheptulose-bisphosphatase [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +P    + S   +   SS+FG+SLR+ PKS    
Sbjct  1    METSIACYSRGILPPSVSSQRSSTLVSPPSFSTSSSFKRLKSSSIFGDSLRLAPKSQFKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+ +  S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKTKSNGVSTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>ref|XP_006291276.1| hypothetical protein CARUB_v10017407mg [Capsella rubella]
 gb|EOA24174.1| hypothetical protein CARUB_v10017407mg [Capsella rubella]
Length=393

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +P    + S   +   SS+FG+SLR+ PKS L  
Sbjct  1    METSIACYSRGILPPSVSSQRSSTLVSPPSFSTSSSFKRLKSSSIFGDSLRLAPKSQLKS  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASSVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>emb|CDX76072.1| BnaA04g03360D [Brassica napus]
Length=394

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf-GESLRVLPKSSLN  391
            MET +TC++R  +LP+V+SQ SS+L +P  S S S S K LKSS   GESLRV P+S L 
Sbjct  1    METSVTCYSRGIILPSVSSQRSSTLVSPPSSFSASSSFKRLKSSSIFGESLRVAPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + +  S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   ATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_009139137.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X3 [Brassica rapa]
Length=394

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf-GESLRVLPKSSLN  391
            MET +TC++R  +LP+V+SQ SS+L +P  S S S S K LKSS   GESLRV P+S L 
Sbjct  1    METSVTCYSRGIILPSVSSQRSSTLVSPPSSFSASSSFKRLKSSSIFGESLRVEPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + +  S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   ATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_010093027.1| Sedoheptulose-1,7-bisphosphatase [Morus notabilis]
 gb|EXB53355.1| Sedoheptulose-1,7-bisphosphatase [Morus notabilis]
Length=393

 Score =   132 bits (331),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET ITC+ R A LPN++S HS S  +P        S     SSLFGESLR +P+SSL V
Sbjct  1    METSITCYTRGAFLPNISSSHSMSFVSPSSISPSFNSKILKSSSLFGESLRTVPRSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K+ K++S PVTKCEIG+SLEEFL K+T DKGL +L+  MGEA+RTIAFKVRTASCGGTA
Sbjct  61   SKS-KNASLPVTKCEIGESLEEFLIKATPDKGLRALLNSMGEALRTIAFKVRTASCGGTA  119

Query  575  CVN  583
            CVN
Sbjct  120  CVN  122



>ref|XP_009139136.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=395

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf--GESLRVLPKSSL  388
            MET +TC++R  +LP+V+SQ SS+L +P  S S S S K    S    GESLRV P+S L
Sbjct  1    METSVTCYSRGIILPSVSSQRSSTLVSPPSSFSASSSFKQRLKSSSIFGESLRVEPRSQL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
               K + +  S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGG
Sbjct  61   KATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGEALRTIAFKVRTASCGG  120

Query  569  TACVN  583
            TACVN
Sbjct  121  TACVN  125



>ref|XP_010516168.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Camelina sativa]
Length=472

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++R  L P+V+SQ SS+L +     S S   +   SS+FG+SLR+ PKS L  
Sbjct  80   METSIACYSRGILPPSVSSQRSSTLVSNSSFSSSSSFKRLKSSSIFGDSLRLAPKSQLKS  139

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  140  TKAKSNGASSVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  199

Query  575  CVN  583
            CVN
Sbjct  200  CVN  202



>gb|ACU23254.1| unknown [Glycine max]
 gb|KHN07640.1| Sedoheptulose-1,7-bisphosphatase, chloroplastic [Glycine soja]
Length=387

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C+ R   LP+V+S+HS    +P + +    S+        GESLRV  KS+L V
Sbjct  1    METGIACYTRGPFLPSVSSKHSPPSISPSFGLRSLKSSSLF-----GESLRVASKSTLKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  ++S VT+CEIGDSLEEFLTK+T DKGLI L++ MGEA+RTI+FKV+TASCGGT 
Sbjct  56   SKTK--NTSLVTRCEIGDSLEEFLTKATPDKGLIRLLVSMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_003552524.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform 1 [Glycine max]
Length=387

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C+ R   LP+V+S+HS    +P + +    S+        GESLRV  KS+L V
Sbjct  1    METGIACYTRGPFLPSVSSKHSPPSISPSFGLRSLKSSSLF-----GESLRVASKSTLKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  ++S VT+CEIGDSLEEFLTK+T DKGLI L++ MGEA+RTI+FKV+TASCGGT 
Sbjct  56   SKTK--NTSLVTRCEIGDSLEEFLTKATPDKGLIRLLVSMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_003538446.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform 1 [Glycine max]
 gb|KHN17854.1| Sedoheptulose-1,7-bisphosphatase, chloroplastic [Glycine soja]
Length=387

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C+ R   LP+V+S+HS    +P + +    S+        GESLRV  KS++ V
Sbjct  1    METGIACYTRGPFLPSVSSKHSPPSISPSFGLRSLKSSSLF-----GESLRVASKSTIKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  ++S VT+CEIGDSLEEFLTK+T DKGLI L++ MGEA+RTI+FKV+TASCGGT 
Sbjct  56   SKTK--NTSLVTRCEIGDSLEEFLTKATPDKGLIRLLVSMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_010690111.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=387

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C +R+ LLP V+SQHSS+L    +++    S+        G+SLR+  KSS  V
Sbjct  1    METSIACCSRSMLLPKVSSQHSSALLPSSFNLKSLKSSSLF-----GDSLRMNTKSSFKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
            +K +  +SS VTKCE+GDSLEEFL K+T DKGLI L++CMGEA+RTI FKVRTASCGGT 
Sbjct  56   IKAK--NSSLVTKCELGDSLEEFLAKATPDKGLIRLLMCMGEALRTIGFKVRTASCGGTQ  113

Query  575  CVN  583
            C+N
Sbjct  114  CIN  116



>ref|XP_004503228.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Cicer arietinum]
Length=387

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C++R A LP V+S+HS            S       SSLFGESLRV  KS+L +
Sbjct  1    METGIACYSRGAFLPTVSSKHSLPSIP-----PSSSFKSLKSSSLFGESLRVSSKSTLKI  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             +T+   +S +TKCEIGDSLEEFL K+T DKGLI LM+CMGEA+RTI+FKV+TASCGGT 
Sbjct  56   SRTK--GASFITKCEIGDSLEEFLAKATPDKGLIRLMVCMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_011076739.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Sesamum indicum]
Length=397

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 93/124 (75%), Gaps = 4/124 (3%)
 Frame = +2

Query  221  TGITCFARAALLPNVTSQ--HSSSLATP-GWsispsfstkslksslfGESLRVLPKSSLN  391
            TGI C AR A+LPN+TSQ  H ++LA+P   S S         SSLFGESLR+ P+SS  
Sbjct  4    TGIACCARGAILPNLTSQQYHPTALASPRAGSTSFISPKSLKASSLFGESLRIAPRSS-Y  62

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
                   SSS VTKCEIGDSLEEFLTKST+DKGLISLMI MGEA+RTIAFKVRTASCGGT
Sbjct  63   KSSKAPKSSSLVTKCEIGDSLEEFLTKSTTDKGLISLMISMGEALRTIAFKVRTASCGGT  122

Query  572  ACVN  583
            ACVN
Sbjct  123  ACVN  126



>ref|XP_007163512.1| hypothetical protein PHAVU_001G240200g [Phaseolus vulgaris]
 gb|ESW35506.1| hypothetical protein PHAVU_001G240200g [Phaseolus vulgaris]
Length=387

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METGI C+ R   LP V+S+HS    +P +      S+        GESLRV  KS+L V
Sbjct  1    METGIACYTRGPFLPTVSSKHSPPSISPSFGFRNLKSSSLF-----GESLRVASKSTLKV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +   +S VT+CEIGD LEEFLTK+T DKGLI L++ MGEA+RTI+FKV+TASCGGT 
Sbjct  56   SKAK--GTSLVTRCEIGDGLEEFLTKATPDKGLIRLLVSMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>sp|O20252.1|S17P_SPIOL RecName: Full=Sedoheptulose-1,7-bisphosphatase, chloroplastic; 
AltName: Full=SED(1,7)P2ase; AltName: Full=Sedoheptulose bisphosphatase; 
Short=SBPase; Flags: Precursor [Spinacia oleracea]
 gb|AAB81104.1| sedoheptulose-1,7-bisphosphatase [Spinacia oleracea]
Length=387

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 89/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET + C +R+ +LP V+ QHSS+L       S         SSLFGESLR+  KSS+ V
Sbjct  1    METSMACCSRSIVLPRVSPQHSSALVP-----SSINLKSLKSSSLFGESLRMTTKSSVRV  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K +  +SS VTKCE+GDSLEEFL K+T+DKGLI LM+CMGEA+RTI FKVRTASCGGT 
Sbjct  56   NKAK--NSSLVTKCELGDSLEEFLAKATTDKGLIRLMMCMGEALRTIGFKVRTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>gb|KFK34828.1| hypothetical protein AALP_AA5G198500 [Arabis alpina]
Length=395

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstk-slksslfGESLRVLPKSSLN  391
            MET +TC++R  +LPN +SQ SS+L +P  S S S S K    SS+FG+SLR+ P+S L 
Sbjct  1    METSVTCYSRGIILPNASSQRSSTLVSPPSSFSVSSSFKGLKSSSIFGDSLRLAPRSQLK  60

Query  392  VVKTRKHSSS-PVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
              K + ++ +  VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGG
Sbjct  61   ATKAKNNNGALTVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGG  120

Query  569  TACVN  583
            TACVN
Sbjct  121  TACVN  125



>ref|XP_006403416.1| hypothetical protein EUTSA_v10010434mg [Eutrema salsugineum]
 gb|ESQ44869.1| hypothetical protein EUTSA_v10010434mg [Eutrema salsugineum]
Length=394

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf-GESLRVLPKSSLN  391
            MET I  ++   LLP+V+SQ SS+L +P  S S S S K LKSS   G+SLR+ P+S L 
Sbjct  1    METSIARYSHGILLPSVSSQRSSTLVSPPSSFSASSSFKRLKSSSIFGDSLRLAPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +S VTKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   STKAKNNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_009139135.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=411

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 94/141 (67%), Gaps = 18/141 (13%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsf------------------stkslk  340
            MET +TC++R  +LP+V+SQ SS+L +P  S S S                     +   
Sbjct  1    METSVTCYSRGIILPSVSSQRSSTLVSPPSSFSASSSFKVSSILYTHTCKAHTCDQRLKS  60

Query  341  sslfGESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGE  520
            SS+FGESLRV P+S L   K + +  S VTKCEIG SLEEFL ++T DKGL +L++CMGE
Sbjct  61   SSIFGESLRVEPRSQLKATKAKNNGGSTVTKCEIGQSLEEFLREATPDKGLRTLLMCMGE  120

Query  521  AIRTIAFKVRTASCGGTACVN  583
            A+RTIAFKVRTASCGGTACVN
Sbjct  121  ALRTIAFKVRTASCGGTACVN  141



>ref|XP_009103972.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=394

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslkssl-fGESLRVLPKSSLN  391
            MET +  ++R  LLP+V+SQ SS+L +P  S S S S K LKSS  FG+SLR+ P+S L 
Sbjct  1    METSVISYSRGILLPSVSSQRSSTLVSPPSSFSASSSFKRLKSSSIFGDSLRLTPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +  +TKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   ATKAKNNGAFTMTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_003600853.1| Sedoheptulose-1 7-bisphosphatase [Medicago truncatula]
 gb|AES71104.1| sedoheptulose-1,7-bisphosphatase [Medicago truncatula]
Length=387

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 7/123 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++  A L +V+++HS    TP      S       SSLFGESLRV  KS+L  
Sbjct  1    METSIACYSSGAFLRSVSAKHSLPSITP-----SSAFRSLKSSSLFGESLRVSSKSTLKF  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
              +R  S+S +TKCEIGDSLEEFL+K+T DKGLI LM+CMGEA+RTI+FKV+TASCGGT 
Sbjct  56   --SRAKSTSVITKCEIGDSLEEFLSKATPDKGLIRLMVCMGEALRTISFKVKTASCGGTQ  113

Query  575  CVN  583
            CVN
Sbjct  114  CVN  116



>ref|XP_009103971.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=395

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 91/125 (73%), Gaps = 2/125 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf--GESLRVLPKSSL  388
            MET +  ++R  LLP+V+SQ SS+L +P  S S S S K    S    G+SLR+ P+S L
Sbjct  1    METSVISYSRGILLPSVSSQRSSTLVSPPSSFSASSSFKQRLKSSSIFGDSLRLTPRSQL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
               K + + +  +TKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGG
Sbjct  61   KATKAKNNGAFTMTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGG  120

Query  569  TACVN  583
            TACVN
Sbjct  121  TACVN  125



>ref|XP_007213879.1| hypothetical protein PRUPE_ppa006836mg [Prunus persica]
 gb|EMJ15078.1| hypothetical protein PRUPE_ppa006836mg [Prunus persica]
Length=393

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAAL-LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET + C+AR A  + NV+SQHSSSL +P    S   S     SSLFGESLR++PKSSL 
Sbjct  1    METSVACYARGAFPVRNVSSQHSSSLVSPASISSSFNSKVLRTSSLFGESLRMVPKSSLR  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
            V+K++  SS P  KC IGDSLEEFLTK+T DK LI+L+I MGEA+RTI FKVRTASCGGT
Sbjct  61   VLKSKNSSSVP--KCAIGDSLEEFLTKATPDKKLITLLISMGEALRTIGFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>emb|CDY27264.1| BnaA09g35380D [Brassica napus]
Length=393

 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET +TC++   LLP V+SQ SSSL +P    + S       SS+FG+SLRV P+S L  
Sbjct  1    METSVTCYSHGILLPRVSSQRSSSLVSPPSFSTSSSFKGLKSSSIFGDSLRVAPRSQLKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>ref|XP_009116278.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Brassica 
rapa]
Length=393

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET +TC++R  LLP V+SQ SSSL +P    + S       SS+FG+SLRV P+S L  
Sbjct  1    METSVTCYSRGVLLPRVSSQRSSSLVSPPSFSTSSSFKGLKSSSIFGDSLRVAPRSQLKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFLT++T DK L +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASSVTKCEIGQSLEEFLTQATPDKVLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>gb|AHY18974.1| sedoheptulose-1,7-bisphosphatase [Brassica rapa subsp. chinensis]
Length=393

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++   LLP V+SQ SSSL +P    + S       SS+FG+SLRV P+S L  
Sbjct  1    METSIACYSHGILLPRVSSQRSSSLVSPPSFSTSSSFKGLKSSSIFGDSLRVAPRSQLKA  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             K + + +S VTKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   TKAKSNGASSVTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTA  120

Query  575  CVN  583
            CVN
Sbjct  121  CVN  123



>emb|CDX67626.1| BnaA07g16660D [Brassica napus]
Length=394

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf-GESLRVLPKSSLN  391
            MET +  ++R  LL +V+SQ SS+L +P  S S S S K LKSS   G+SLR+ P+S L 
Sbjct  1    METSVISYSRGILLRSVSSQRSSTLVSPPPSFSASSSFKRLKSSSIFGDSLRLTPRSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +S +TKCEIG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASC GT
Sbjct  61   ATKAKNNGASTMTKCEIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCSGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>ref|XP_008226111.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Prunus mume]
Length=393

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAAL-LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET + C+AR A    NV+SQHSSSL +P    S   S     SSLFGESLR++PKSSL 
Sbjct  1    METSVACYARGAFPARNVSSQHSSSLVSPASISSSFNSKVLRTSSLFGESLRMVPKSSLR  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
             +K++  SS P  KC +GDSLEEFLTK+T DK LI+L+I MGEA+RTI FKVRTASCGGT
Sbjct  61   ALKSKNSSSVP--KCALGDSLEEFLTKATPDKKLITLLISMGEALRTIGFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>ref|XP_010256671.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Nelumbo 
nucifera]
Length=393

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/123 (63%), Positives = 89/123 (72%), Gaps = 1/123 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET ITC+ R   L NV+SQ S+ L +               SSLFGESLR + KSSL V
Sbjct  1    METSITCYTRGTFLSNVSSQRSTVLPSLPSISRSFNLRSLKSSSLFGESLRTVSKSSLKV  60

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
             KT+  SS  +T+CEIGDSLEEFLTK+T DKGLI LM+CMGEA+RTIAFKVRTASCGGTA
Sbjct  61   SKTKSSSSL-ITRCEIGDSLEEFLTKATPDKGLIRLMVCMGEALRTIAFKVRTASCGGTA  119

Query  575  CVN  583
            CVN
Sbjct  120  CVN  122



>gb|ABK76304.1| chloroplast sedoheptulose-1,7-bisphosphatase [Morus alba var. 
multicaulis]
Length=392

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET ITC+ R A LPN++S HS S  +P        S     SSLFGESLR +PKSS  +
Sbjct  1    METSITCYTRGAFLPNISSSHSMSFVSPSSISPSFNSKILKSSSLFGESLRTVPKSS--L  58

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
              ++  ++ PVTKCEIG+SLEEFL K+T DKGL +L+I MGEA+RTIAFKVRTASCGGTA
Sbjct  59   KVSKSKNALPVTKCEIGESLEEFLIKATPDKGLRALLISMGEALRTIAFKVRTASCGGTA  118

Query  575  CVN  583
            CVN
Sbjct  119  CVN  121



>gb|ACN73053.1| COSII_At3g55800, partial [Solanum pimpinellifolium]
 gb|ACN73054.1| COSII_At3g55800, partial [Solanum chmielewskii]
 gb|ACN73055.1| COSII_At3g55800, partial [Solanum neorickii]
 gb|ACN73056.1| COSII_At3g55800, partial [Solanum arcanum]
Length=71

 Score =   112 bits (279),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/70 (83%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLRV PKSSL V +T+  SSS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RT
Sbjct  4    GESLRVAPKSSLKVSRTK--SSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRT  61

Query  533  IAFKVRTASC  562
            IAFKVRTASC
Sbjct  62   IAFKVRTASC  71



>ref|XP_009341715.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=393

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 90/125 (72%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAAL--LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            MET + C+AR A     NV+SQHSSSL +P        S     SSLFGESLR+ PKSSL
Sbjct  1    METSVACYARGAFPVRNNVSSQHSSSLFSPASISPSFNSKVLRTSSLFGESLRMAPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V+KT+  S  P  KC IGDSLEEFLTK+T DK LI+L+I MGEA+RTI +KVRTASCGG
Sbjct  61   KVLKTKNTSIVP--KCAIGDSLEEFLTKATPDKKLITLLISMGEALRTIGYKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>ref|XP_010554642.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=394

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQH-SSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            MET ITC++R  L P+ +SQ  S+ L+ P    + S S +   SS FGESLR  P+SSL 
Sbjct  1    METSITCYSRGILPPSFSSQRFSALLSPPSSLSTSSTSRRLKSSSFFGESLRSAPRSSLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +S VTKCE+G SLEEFL K+T DKGL +L++CMGEA+RTI+FKVRTASCGGT
Sbjct  61   --KAKSNGTSIVTKCELGQSLEEFLAKATPDKGLRTLLMCMGEALRTISFKVRTASCGGT  118

Query  572  ACVN  583
            ACVN
Sbjct  119  ACVN  122



>gb|ACN73065.1| COSII_At3g55800, partial [Solanum juglandifolium]
Length=71

 Score =   111 bits (277),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 64/70 (91%), Gaps = 2/70 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLR++PKSSL V +T+  +SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RT
Sbjct  4    GESLRIVPKSSLKVSRTK--NSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRT  61

Query  533  IAFKVRTASC  562
            IAFKVRTASC
Sbjct  62   IAFKVRTASC  71



>ref|XP_008383089.1| PREDICTED: LOW QUALITY PROTEIN: sedoheptulose-1,7-bisphosphatase, 
chloroplastic-like [Malus domestica]
Length=393

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 91/125 (73%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAAL--LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            MET + C+AR A     NV+SQHSSSL +P        S     SSLFGESL+++PKSSL
Sbjct  1    METSVACYARGAFPVRNNVSSQHSSSLFSPASISPSFNSKVLRTSSLFGESLQMVPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V+KT+  S  P  KC IGDSLEEFLTK+T DK LI+L+I MGEA+RTI +KVRTASCGG
Sbjct  61   KVLKTKNTSIVP--KCAIGDSLEEFLTKATPDKKLITLLISMGEALRTIGYKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>gb|ACN73050.1| COSII_At3g55800, partial [Solanum cheesmaniae]
 gb|ACN73051.1| COSII_At3g55800, partial [Solanum galapagense]
 gb|ACN73052.1| COSII_At3g55800, partial [Solanum lycopersicum]
 gb|ACN73058.1| COSII_At3g55800, partial [Solanum huaylasense]
 gb|ACN73061.1| COSII_At3g55800, partial [Solanum chilense]
 gb|ACN73063.1| COSII_At3g55800, partial [Solanum habrochaites]
 gb|ACN73064.1| COSII_At3g55800, partial [Solanum pennellii]
 gb|ACN73067.1| COSII_At3g55800, partial [Solanum lycopersicoides]
 gb|ACN73068.1| COSII_At3g55800, partial [Solanum sitiens]
 gb|ACN73069.1| COSII_At3g55800, partial [Solanum dulcamara]
 gb|ACN73070.1| COSII_At3g55800, partial [Datura inoxia]
Length=71

 Score =   110 bits (276),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLRV PKSSL V +T+  +SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RT
Sbjct  4    GESLRVAPKSSLKVSRTK--NSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRT  61

Query  533  IAFKVRTASC  562
            IAFKVRTASC
Sbjct  62   IAFKVRTASC  71



>ref|XP_009351006.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Pyrus x bretschneideri]
 ref|XP_009351012.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=390

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 88/127 (69%), Gaps = 11/127 (9%)
 Frame = +2

Query  215  METGITCFARA-ALLPN---VTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKS  382
            ME  + C + A A LP    V+ QHS+SL  P        S     SSLFGESLR +P+S
Sbjct  1    MEATMACCSSARAFLPAAGVVSHQHSTSLVAP-----SFSSKSLKSSSLFGESLRQVPRS  55

Query  383  SLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASC  562
            SL V KT+ ++   VTKC IGDSLEEFL K+T DKGLI L+I MGEA+RTI+FKVRTA+C
Sbjct  56   SLKVSKTKHYTH--VTKCAIGDSLEEFLAKATPDKGLIRLLISMGEALRTISFKVRTAAC  113

Query  563  GGTACVN  583
            GGTAC+N
Sbjct  114  GGTACIN  120



>gb|ACN73057.1| COSII_At3g55800, partial [Solanum huaylasense]
Length=71

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 62/70 (89%), Gaps = 2/70 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLRV PKSSL V +T+   SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RT
Sbjct  4    GESLRVAPKSSLKVSRTK--XSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRT  61

Query  533  IAFKVRTASC  562
            IAFKVRTASC
Sbjct  62   IAFKVRTASC  71



>ref|XP_009344459.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Pyrus x bretschneideri]
Length=390

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 88/127 (69%), Gaps = 11/127 (9%)
 Frame = +2

Query  215  METGITCFARA-ALLPNV---TSQHSSSLATPGWsispsfstkslksslfGESLRVLPKS  382
            ME  I C + A ALLP     T QHS+S+  P        S     SSLFGESLR +P+S
Sbjct  1    MEATIACCSSARALLPATGVSTHQHSTSVVAP-----SFSSKGLKSSSLFGESLRQVPRS  55

Query  383  SLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASC  562
            SL   +T++ S   VTKCEIGDSLEEFL K+T DKGLI L++ MGEA+RTI+FKVRTASC
Sbjct  56   SLKFSRTKQPSH--VTKCEIGDSLEEFLAKATPDKGLIRLLLSMGEALRTISFKVRTASC  113

Query  563  GGTACVN  583
            GGTAC+N
Sbjct  114  GGTACIN  120



>ref|XP_010427373.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Camelina sativa]
Length=394

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 92/124 (74%), Gaps = 1/124 (1%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslf-GESLRVLPKSSLN  391
            MET I C++R  L P+V+SQ SSS      S S S S K LKSS   G+SLRVLPKS L 
Sbjct  1    METSIACYSRGILPPSVSSQRSSSTLVSPSSFSSSSSFKRLKSSSIFGDSLRVLPKSQLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
              K + + +S VTKCEIG SLEEFL ++T DKGL +L++CMGEA+RTIAFKVRTASCGGT
Sbjct  61   STKAKSNGASSVTKCEIGQSLEEFLAQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGT  120

Query  572  ACVN  583
            ACVN
Sbjct  121  ACVN  124



>gb|ACN73059.1| COSII_At3g55800, partial [Solanum peruvianum]
 gb|ACN73060.1| COSII_At3g55800, partial [Solanum corneliomuelleri]
 gb|ACN73062.1| COSII_At3g55800, partial [Solanum chilense]
 gb|ACN73066.1| COSII_At3g55800, partial [Solanum ochranthum]
Length=71

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLR+ PKSSL V +T+  +SS VTKCEIGDSLEEFL+KSTSDKGLI LM+CMGEA+RT
Sbjct  4    GESLRIAPKSSLKVSRTK--NSSLVTKCEIGDSLEEFLSKSTSDKGLIRLMMCMGEALRT  61

Query  533  IAFKVRTASC  562
            IAFKVRTASC
Sbjct  62   IAFKVRTASC  71



>ref|XP_008381958.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Malus domestica]
Length=390

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 87/127 (69%), Gaps = 11/127 (9%)
 Frame = +2

Query  215  METGITCFARA-ALLPNV---TSQHSSSLATPGWsispsfstkslksslfGESLRVLPKS  382
            ME  I C + A ALLP     T QHS+S+  P        S     SSLFGESLR +P+S
Sbjct  1    MEATIACCSSARALLPAAGISTHQHSTSVVAP-----SFSSKGLKSSSLFGESLRQVPRS  55

Query  383  SLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASC  562
            SL    T++  SS V KCEIGDSLEEFL K+T DKGLI L++ MGEA+RTI+FKVRTASC
Sbjct  56   SLKFSTTKQ--SSHVIKCEIGDSLEEFLAKATPDKGLIRLLLSMGEALRTISFKVRTASC  113

Query  563  GGTACVN  583
            GGTACVN
Sbjct  114  GGTACVN  120



>ref|XP_010554641.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=402

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 11/132 (8%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsi---------spsfstkslksslfGESLR  367
            MET ITC++R  L P+ +SQ  S+L +P  S+            +  +   SS FGESLR
Sbjct  1    METSITCYSRGILPPSFSSQRFSALLSPPSSLSTSSTSRGFQIRYYQRLKSSSFFGESLR  60

Query  368  VLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKV  547
              P+SSL   K + + +S VTKCE+G SLEEFL K+T DKGL +L++CMGEA+RTI+FKV
Sbjct  61   SAPRSSLK--KAKSNGTSIVTKCELGQSLEEFLAKATPDKGLRTLLMCMGEALRTISFKV  118

Query  548  RTASCGGTACVN  583
            RTASCGGTACVN
Sbjct  119  RTASCGGTACVN  130



>ref|XP_007218076.1| hypothetical protein PRUPE_ppa006859mg [Prunus persica]
 gb|EMJ19275.1| hypothetical protein PRUPE_ppa006859mg [Prunus persica]
Length=393

 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +2

Query  215  METGITCFARAALLPNV-TSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLN  391
            ME  I C +  A LP V T QHS++L  P        S     SSLFGE LR +P+SSL 
Sbjct  1    MEASIGCCSPRAFLPGVSTHQHSTALVAPPSISPSFSSKSLKSSSLFGEPLRQVPRSSLK  60

Query  392  VVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGT  571
            V KT++  SS VT+C IG+SLE FL K+T DKGLI L+I MGEA+RTI+FKVRTASCGGT
Sbjct  61   VSKTKQ--SSLVTRCAIGESLEVFLAKATPDKGLIRLLISMGEALRTISFKVRTASCGGT  118

Query  572  ACVN  583
            AC+N
Sbjct  119  ACIN  122



>gb|ACV49901.1| fructose-1,6-bisphosphatase [Fragaria x ananassa]
Length=190

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 2/70 (3%)
 Frame = +2

Query  374  PKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRT  553
            P+SSL V KT++  SS VTKCEIGDSLEEFLTK+T DKGLI LM+CMGEAI+TI+FKVRT
Sbjct  1    PRSSLKVSKTKQ--SSLVTKCEIGDSLEEFLTKATPDKGLIRLMMCMGEAIKTISFKVRT  58

Query  554  ASCGGTACVN  583
            ASCGGTACVN
Sbjct  59   ASCGGTACVN  68



>ref|XP_008372025.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Malus domestica]
Length=394

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +2

Query  215  METGITCFARAAL--LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSL  388
            MET +  +A  A     NV+SQHSSSL +P        S     SSLFGESLR++PKSSL
Sbjct  1    METSVAYYAXGAFPVRNNVSSQHSSSLFSPASISPSFNSKVLRTSSLFGESLRLVPKSSL  60

Query  389  NVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGG  568
             V+ T+ +S  P  KC IGDSLEEFLTK+T DK LI+L+I MGEA+RTI FKVRTASCGG
Sbjct  61   KVLXTKNNSIVP--KCAIGDSLEEFLTKATPDKKLITLLISMGEALRTIGFKVRTASCGG  118

Query  569  TACVN  583
            TACVN
Sbjct  119  TACVN  123



>ref|XP_008785431.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Phoenix 
dactylifera]
Length=394

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 84/129 (65%), Gaps = 12/129 (9%)
 Frame = +2

Query  215  METGITCFARAAL------LPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLP  376
            ME G+  +AR  +      +P V +  S+    P +S S         S   GESLRV+ 
Sbjct  1    MEAGVASYARGTIPHDVLRIPRVAAPSSA----PSFSRSHRNHGLRSSSLF-GESLRVMS  55

Query  377  KSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTA  556
            KSS  + K R  SSS +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTA
Sbjct  56   KSSPRISK-RAGSSSLITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRTISFKVRTA  114

Query  557  SCGGTACVN  583
            SCGGTACVN
Sbjct  115  SCGGTACVN  123



>ref|XP_006827008.1| hypothetical protein AMTR_s00010p00216200 [Amborella trichopoda]
 gb|ERM94245.1| hypothetical protein AMTR_s00010p00216200 [Amborella trichopoda]
Length=391

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            METG+  +    L+P+ TS+ SS   TP  S   +  +    +   GESLR+ PKS    
Sbjct  1    METGVLTYTCGTLVPH-TSRPSS---TPSLSRFINSQSSKCSAIY-GESLRLSPKSQSR-  54

Query  395  VKTRK----HSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASC  562
             +T K     SSS +T+CEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTASC
Sbjct  55   -RTAKVGAGKSSSTITRCEIGDSLEEFLTKATPDKNLIRLLVSMGEALRTISFKVRTASC  113

Query  563  GGTACVN  583
            GGTACVN
Sbjct  114  GGTACVN  120



>ref|XP_010923135.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=396

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 10/128 (8%)
 Frame = +2

Query  215  METGITCFARAALLPNVT-----SQHSSSLATPGWsispsfstkslksslfGESLRVLPK  379
            METG+  +AR  +  NV      +  SS+ + P        +     SSLFGESLRV+  
Sbjct  3    METGVASYARGTIPHNVLRIPRLAAPSSAPSFP----RSHRNHGLRASSLFGESLRVMSN  58

Query  380  SSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTAS  559
            SS    K   +SS  +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTAS
Sbjct  59   SSPRNSKGAGNSSL-ITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRTISFKVRTAS  117

Query  560  CGGTACVN  583
            CGGTACVN
Sbjct  118  CGGTACVN  125



>ref|XP_010923134.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=398

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVT-----SQHSSSLATPGWsispsfstkslksslfGESLRVLPK  379
            METG+  +AR  +  NV      +  SS+ + P      +       SSLFGESLRV+  
Sbjct  3    METGVASYARGTIPHNVLRIPRLAAPSSAPSFP--RSHRNHVRGLRASSLFGESLRVMSN  60

Query  380  SSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTAS  559
            SS    K   +SS  +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTAS
Sbjct  61   SSPRNSKGAGNSSL-ITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRTISFKVRTAS  119

Query  560  CGGTACVN  583
            CGGTACVN
Sbjct  120  CGGTACVN  127



>gb|EPS64973.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Genlisea 
aurea]
Length=206

 Score =   103 bits (256),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%), Gaps = 0/52 (0%)
 Frame = +2

Query  428  TKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            TKCEIGDSLEEFLTKSTSDKGLI L++CMGEA+RTIAFKVRTASCGGTACVN
Sbjct  1    TKCEIGDSLEEFLTKSTSDKGLIRLLVCMGEALRTIAFKVRTASCGGTACVN  52



>ref|XP_008234053.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Prunus 
mume]
Length=385

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 64/77 (83%), Gaps = 2/77 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GE LR +P+SSL V KT++  SS VT+C IG+SLE FL K+T DKGLI L+I MGEA+RT
Sbjct  40   GEPLRQVPRSSLKVSKTKQ--SSLVTRCAIGESLEVFLAKATPDKGLIRLLISMGEALRT  97

Query  533  IAFKVRTASCGGTACVN  583
            I+FKVRTA+CGGTAC+N
Sbjct  98   ISFKVRTAACGGTACIN  114



>ref|XP_010928921.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=394

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 82/126 (65%), Gaps = 6/126 (5%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslkssl---fGESLRVLPKSS  385
            ME+G   + R  L  NV +   + LA P  + S S S  +        FGESLRV+ KS 
Sbjct  1    MESGAAGYVRGTLPHNVLNH--ARLAAPSSAPSFSRSLMNHGLKSCSLFGESLRVMSKSL  58

Query  386  LNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCG  565
              + K   + S  +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTASCG
Sbjct  59   PRISKVAGNKSL-ITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRTISFKVRTASCG  117

Query  566  GTACVN  583
            GTACVN
Sbjct  118  GTACVN  123



>ref|XP_008775070.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Phoenix dactylifera]
Length=394

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            GESLRV+ KS   + K    S+S +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RT
Sbjct  48   GESLRVMSKSLPRISKV-AGSNSLITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRT  106

Query  533  IAFKVRTASCGGTACVN  583
            I+FKVRTASCGGTACVN
Sbjct  107  ISFKVRTASCGGTACVN  123



>ref|XP_010928919.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=396

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslks-----slfGESLRVLPK  379
            ME+G   + R  L  NV +   + LA P  + S S S  +        SLFGESLRV+ K
Sbjct  1    MESGAAGYVRGTLPHNVLNH--ARLAAPSSAPSFSRSLMNHVRGLKSCSLFGESLRVMSK  58

Query  380  SSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTAS  559
            S   + K   + S  +TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTAS
Sbjct  59   SLPRISKVAGNKSL-ITKCEIGDSLEEFLTKATPDKNLIRLLMSMGEALRTISFKVRTAS  117

Query  560  CGGTACVN  583
            CGGTACVN
Sbjct  118  CGGTACVN  125



>ref|NP_001052293.1| Os04g0234600 [Oryza sativa Japonica Group]
 emb|CAE02306.2| OSJNBa0042F21.13 [Oryza sativa Japonica Group]
 dbj|BAF14207.1| Os04g0234600 [Oryza sativa Japonica Group]
Length=392

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEAI  526
            GESLRV    SL   +  K +S     T+CEIGDSLEEFLTK+T DK LI L+ICMGEA+
Sbjct  43   GESLRVNTARSLPSGRQSKAASRAALSTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAM  102

Query  527  RTIAFKVRTASCGGTACVN  583
            RTI+FKVRTASCGGTACVN
Sbjct  103  RTISFKVRTASCGGTACVN  121



>gb|AAO22558.1| sedoheptulose-1,7-bisphosphatase precursor [Oryza sativa Indica 
Group]
 gb|AAO22559.1| sedoheptulose-1,7-bisphosphatase precursor [Oryza sativa Indica 
Group]
 emb|CAH66132.1| H0622G10.1 [Oryza sativa Indica Group]
 gb|EEC76601.1| hypothetical protein OsI_14458 [Oryza sativa Indica Group]
 gb|EEE60350.1| hypothetical protein OsJ_13468 [Oryza sativa Japonica Group]
Length=392

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 61/79 (77%), Gaps = 2/79 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEAI  526
            GESLRV    SL   +  K +S     T+CEIGDSLEEFLTK+T DK LI L+ICMGEA+
Sbjct  43   GESLRVNTARSLPSGRQSKAASRAALSTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAM  102

Query  527  RTIAFKVRTASCGGTACVN  583
            RTI+FKVRTASCGGTACVN
Sbjct  103  RTISFKVRTASCGGTACVN  121



>dbj|BAJ89104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=140

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  353  GESLRV-LPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEA  523
            GESLR    ++S    +  K +S     T+C IGDSLEEFLTK+T DK LI L+ICMGEA
Sbjct  43   GESLRANTARTSFPAGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEA  102

Query  524  IRTIAFKVRTASCGGTACVN  583
            +RTIAFKVRTASCGGTACVN
Sbjct  103  MRTIAFKVRTASCGGTACVN  122



>ref|XP_002456647.1| hypothetical protein SORBIDRAFT_03g040100 [Sorghum bicolor]
 gb|EES01767.1| hypothetical protein SORBIDRAFT_03g040100 [Sorghum bicolor]
Length=383

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVT-KCEIGDSLEEFLTKSTSDKGLISLMICMGEAIR  529
            GES+RV     L+  +++  S + +T +CEIGDSLEEFLTK+T DK LI L+ICMGEA+R
Sbjct  35   GESVRVNTARPLSARQSKAVSRAALTTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAMR  94

Query  530  TIAFKVRTASCGGTACVN  583
            TIAFKVRTASCGGTACVN
Sbjct  95   TIAFKVRTASCGGTACVN  112



>ref|XP_004970606.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Setaria italica]
Length=393

 Score =   101 bits (251),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/78 (65%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPV-TKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIR  529
            GES+RV     L+  +++  S + + T+CEIGDSLEEFLTK+T DK LI L+ CMGEA+R
Sbjct  45   GESVRVSTARPLSARQSKAASRAALNTRCEIGDSLEEFLTKATPDKNLIRLLTCMGEAMR  104

Query  530  TIAFKVRTASCGGTACVN  583
            TIAFKVRTASCGGTACVN
Sbjct  105  TIAFKVRTASCGGTACVN  122



>gb|ABK24111.1| unknown [Picea sitchensis]
 gb|ABK26067.1| unknown [Picea sitchensis]
Length=413

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 4/104 (4%)
 Frame = +2

Query  284  SLATPGWsispsfstkslksslfGESLRVLPKS-SLNVVKTRK---HSSSPVTKCEIGDS  451
            SLA+P    S +F   + +SS++GE LR  PKS +  +   RK   +SS+ VTKCE+GDS
Sbjct  39   SLASPARIPSITFRQTAKESSIYGEPLRTWPKSCARRMASARKASSNSSTLVTKCELGDS  98

Query  452  LEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            LEEFL K+T +K L  LM+CMGEA+RTIAFKVRTASCG TAC+N
Sbjct  99   LEEFLGKATPNKNLARLMVCMGEALRTIAFKVRTASCGATACIN  142



>ref|XP_009398831.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=394

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 80/126 (63%), Gaps = 7/126 (6%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsis---psfstkslksslfGESLRVLPKSS  385
            METG    AR  +  +V  Q  S LA P  + S       +    SS+FG+SLR+ P  S
Sbjct  1    METGAATCARGVIAHSVLYQ--SRLAVPSSAPSLPRSHRHSGLKSSSIFGDSLRLTPPKS  58

Query  386  LNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCG  565
                     SSS  TKCEIGDSLEEFLTK+T DK LI L++ MGEA+RTI+FKVRTASCG
Sbjct  59   RACRAV--GSSSLATKCEIGDSLEEFLTKATPDKNLIRLLMAMGEALRTISFKVRTASCG  116

Query  566  GTACVN  583
            GTACVN
Sbjct  117  GTACVN  122



>ref|XP_006664812.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic-like 
[Oryza brachyantha]
Length=392

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 2/79 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEAI  526
            GESLRV         +  K +S     T+CEIGDSLEEFLTK+T DK LI L+ICMGEA+
Sbjct  43   GESLRVNTARPFLPGRQSKAASRAALNTRCEIGDSLEEFLTKATPDKNLIRLLICMGEAM  102

Query  527  RTIAFKVRTASCGGTACVN  583
            RTI+FKVRTASCGGTACVN
Sbjct  103  RTISFKVRTASCGGTACVN  121



>gb|EMS67709.1| Sedoheptulose-1,7-bisphosphatase, chloroplastic [Triticum urartu]
Length=369

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  353  GESLRV-LPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEA  523
            GESLR    ++S    +  K +S     T+C IGDSLEEFLTK+T DK LI L+ICMGEA
Sbjct  20   GESLRANTARTSFPAGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEA  79

Query  524  IRTIAFKVRTASCGGTACVN  583
            +RTIAFKVRTASCGGTACVN
Sbjct  80   MRTIAFKVRTASCGGTACVN  99



>dbj|BAJ85704.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90667.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ94694.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96071.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89227.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  353  GESLRV-LPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEA  523
            GESLR    ++S    +  K +S     T+C IGDSLEEFLTK+T DK LI L+ICMGEA
Sbjct  43   GESLRANTARTSFPAGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEA  102

Query  524  IRTIAFKVRTASCGGTACVN  583
            +RTIAFKVRTASCGGTACVN
Sbjct  103  MRTIAFKVRTASCGGTACVN  122



>emb|CBH32512.1| sedoheptulose-1,7-bisphosphatase, chloroplast precursor, expressed 
[Triticum aestivum]
 emb|CDM85031.1| unnamed protein product [Triticum aestivum]
Length=393

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  353  GESLRV-LPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEA  523
            GESLR    ++S    +  K +S     T+C IGDSLEEFLTK+T DK LI L+ICMGEA
Sbjct  43   GESLRANTARTSFPAGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEA  102

Query  524  IRTIAFKVRTASCGGTACVN  583
            +RTIAFKVRTASCGGTACVN
Sbjct  103  MRTIAFKVRTASCGGTACVN  122



>sp|P46285.1|S17P_WHEAT RecName: Full=Sedoheptulose-1,7-bisphosphatase, chloroplastic; 
AltName: Full=SED(1,7)P2ase; AltName: Full=Sedoheptulose bisphosphatase; 
Short=SBPase; Flags: Precursor [Triticum aestivum]
 emb|CAA46507.1| sedoheptulose-1,7-bisphosphatase [Triticum aestivum]
Length=393

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 60/80 (75%), Gaps = 3/80 (4%)
 Frame = +2

Query  353  GESLRV-LPKSSLNVVKTRKHSSSPV--TKCEIGDSLEEFLTKSTSDKGLISLMICMGEA  523
            GESLR    ++S    +  K +S     T+C IGDSLEEFLTK+T DK LI L+ICMGEA
Sbjct  43   GESLRANTARTSFPAGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEA  102

Query  524  IRTIAFKVRTASCGGTACVN  583
            +RTIAFKVRTASCGGTACVN
Sbjct  103  MRTIAFKVRTASCGGTACVN  122



>ref|XP_003564625.1| PREDICTED: sedoheptulose-1,7-bisphosphatase, chloroplastic [Brachypodium 
distachyon]
Length=391

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVT-KCEIGDSLEEFLTKSTSDKGLISLMICMGEAIR  529
            GES+R     +L   +++  S + +T +C IGDSLEEFLTK+T DK LI L+ICMGEA+R
Sbjct  43   GESVRANTARTLPGRQSKAASRAALTTRCAIGDSLEEFLTKATPDKNLIRLLICMGEAMR  102

Query  530  TIAFKVRTASCGGTACVN  583
            TIAFKVRTASCGGTACVN
Sbjct  103  TIAFKVRTASCGGTACVN  120



>ref|NP_001148402.1| sedoheptulose bisphosphatase1 [Zea mays]
 gb|ACG31345.1| sedoheptulose-1,7-bisphosphatase [Zea mays]
Length=385

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 59/79 (75%), Gaps = 2/79 (3%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTK--CEIGDSLEEFLTKSTSDKGLISLMICMGEAI  526
            GES+RV     L+  +  K +S       CEIGDSLEEFLTK+T DK LI L+ICMGEA+
Sbjct  34   GESVRVNTARPLSARRQSKAASRAALSARCEIGDSLEEFLTKATPDKNLIRLLICMGEAM  93

Query  527  RTIAFKVRTASCGGTACVN  583
            RTIAFKVRTASCGGTACVN
Sbjct  94   RTIAFKVRTASCGGTACVN  112



>gb|ACJ84871.1| unknown [Medicago truncatula]
 gb|AFK43093.1| unknown [Medicago truncatula]
Length=336

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 73/107 (68%), Gaps = 7/107 (7%)
 Frame = +2

Query  215  METGITCFARAALLPNVTSQHSSSLATPGWsispsfstkslksslfGESLRVLPKSSLNV  394
            MET I C++  A L +V+++HS    TP      S       SSLFGESLRV  KS+L  
Sbjct  1    METSIACYSSGAFLRSVSAKHSLPSITP-----SSAFRSLKSSSLFGESLRVSSKSTLKF  55

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTI  535
              +R  S+S +TKCEIGDSLEEFL+K+T DKGLI LM+CMGEA+RTI
Sbjct  56   --SRAKSTSVITKCEIGDSLEEFLSKTTPDKGLIRLMVCMGEALRTI  100



>emb|CDY63439.1| BnaC06g42620D [Brassica napus]
Length=282

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  425  VTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            +TKC+IG SLEEFLT++T DKGL +L++CMGEA+RTIAFKVRTASCGGTACVN
Sbjct  1    MTKCKIGQSLEEFLTQATPDKGLRTLLMCMGEALRTIAFKVRTASCGGTACVN  53



>ref|XP_001760166.1| predicted protein [Physcomitrella patens]
 gb|EDQ74922.1| predicted protein [Physcomitrella patens]
Length=339

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  395  VKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTA  574
            VK    S + +T+ E+GDSLEEFL K+T+DK L  L++CMGEA+RTIAFKVRTASCG TA
Sbjct  10   VKASSTSRNTLTRAELGDSLEEFLAKATTDKNLARLLVCMGEALRTIAFKVRTASCGATA  69

Query  575  CVN  583
            CVN
Sbjct  70   CVN  72



>ref|XP_001784896.1| predicted protein [Physcomitrella patens]
 gb|EDQ50285.1| predicted protein [Physcomitrella patens]
Length=396

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%), Gaps = 2/67 (3%)
 Frame = +2

Query  389  NVVKTRKHSSS--PVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASC  562
            N V  +  S++   + + E+GDSLEEFL K+T DK L  L++CMGEA+RTIAFKVRTASC
Sbjct  63   NAVAQKASSTNREALIRAELGDSLEEFLAKATPDKKLARLLVCMGEALRTIAFKVRTASC  122

Query  563  GGTACVN  583
            G TACVN
Sbjct  123  GATACVN  129



>ref|XP_002973325.1| hypothetical protein SELMODRAFT_99338 [Selaginella moellendorffii]
 ref|XP_002976581.1| hypothetical protein SELMODRAFT_105333 [Selaginella moellendorffii]
 gb|EFJ22250.1| hypothetical protein SELMODRAFT_105333 [Selaginella moellendorffii]
 gb|EFJ25699.1| hypothetical protein SELMODRAFT_99338 [Selaginella moellendorffii]
Length=325

 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  431  KCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            + E+GDSLEEFL  ST DK L  L+ CMGEAIRTI+FKV+TASCG TACVN
Sbjct  5    RAELGDSLEEFLATSTKDKSLARLLTCMGEAIRTISFKVKTASCGATACVN  55



>gb|EMT17623.1| Sedoheptulose-1,7-bisphosphatase, chloroplastic [Aegilops tauschii]
Length=578

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  455  EEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            EEFLTK+T DK LI L+ICMGEA+RTIAFKVRTASCGGTACVN
Sbjct  265  EEFLTKATPDKNLIRLLICMGEAMRTIAFKVRTASCGGTACVN  307



>gb|ACA48679.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. elata]
 gb|ACA48680.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. elata]
 gb|ACA48681.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. elata]
 gb|ACA48682.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. elata]
 gb|ACA48683.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
villosa subsp. villosa]
 gb|ACA48684.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. hookeri]
 gb|ACA48685.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
glazioviana]
 gb|ACA48686.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
glazioviana]
 gb|ACA48687.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
glazioviana]
 gb|ACA48688.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
glazioviana]
Length=76

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGL  493
            GESLRV P+SSL + +  K S+SPVT+CEIGDSLEEFLTKSTSDKGL
Sbjct  31   GESLRVAPRSSLKISRP-KGSNSPVTRCEIGDSLEEFLTKSTSDKGL  76



>gb|ACA48689.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
grandiflora]
 gb|ACA48690.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
grandiflora]
 gb|ACA48691.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
grandiflora]
 gb|ACA48692.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
biennis]
 gb|ACA48693.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
grandiflora]
 gb|ACA48694.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
biennis]
 gb|ACA48695.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
grandiflora]
Length=76

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 1/47 (2%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGL  493
            GESLRV P+SSL + +  K S+SPVT+CEIGDSLEEFLTKSTSDKGL
Sbjct  31   GESLRVAPRSSLKISRP-KVSNSPVTRCEIGDSLEEFLTKSTSDKGL  76



>ref|XP_005850770.1| hypothetical protein CHLNCDRAFT_19601 [Chlorella variabilis]
 gb|EFN58668.1| hypothetical protein CHLNCDRAFT_19601 [Chlorella variabilis]
Length=339

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = +2

Query  437  EIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            +IGD+LEEFL ++T D  L  LM+ M EAIRTIA+KVRTASCGGTACVN
Sbjct  39   KIGDTLEEFLLEATPDPKLRQLMMSMSEAIRTIAYKVRTASCGGTACVN  87



>gb|ABK00060.1| chloroplast sedoheptulose-1,7-bisphosphatase [Marchantia polymorpha]
Length=396

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            G+SL  L   S+        S    T+ E+GDSLEEFL K+T +  L  LM+ MG AI+ 
Sbjct  51   GQSLAGLSVKSVAHKAVASRSRVASTRAELGDSLEEFLFKNTKNINLRQLMLSMGLAIKK  110

Query  533  IAFKVRTASCGGTACVN  583
            I+FKVRTASCG TACVN
Sbjct  111  ISFKVRTASCGATACVN  127



>gb|ABF68592.1| chloroplast sedoheptulose-1,7-bisphosphatase [Marchantia polymorpha]
Length=396

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            G+SL  L   S+        S    T+ E+GDSLEEFL K+T +  L  LM+ MG AI+ 
Sbjct  51   GQSLAGLSVKSVAHKAVASRSRVASTRAELGDSLEEFLFKNTKNINLRQLMLSMGLAIKK  110

Query  533  IAFKVRTASCGGTACVN  583
            I+FKVRTASCG TACVN
Sbjct  111  ISFKVRTASCGATACVN  127



>ref|XP_001691997.1| sedoheptulose-1,7-bisphosphatase [Chlamydomonas reinhardtii]
 gb|EDP04487.1| sedoheptulose-1,7-bisphosphatase [Chlamydomonas reinhardtii]
Length=389

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            G ++    K S    + +   ++ +T+ +IGDSL EFL ++T D  L  LM+ M EA RT
Sbjct  46   GAAVTARVKRSTRAARVQSRRTAVLTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEATRT  105

Query  533  IAFKVRTASCGGTACVN  583
            IA KVRTASC GTACVN
Sbjct  106  IAHKVRTASCAGTACVN  122



>ref|XP_005642742.1| sedoheptulose-1,7-bisphosphatase [Coccomyxa subellipsoidea C-169]
 gb|EIE18198.1| sedoheptulose-1,7-bisphosphatase [Coccomyxa subellipsoidea C-169]
Length=337

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 3/70 (4%)
 Frame = +2

Query  374  PKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRT  553
            P+++L     R   S+ +T+ +IGD+LEEFL  +TSD  L  +++ + EA+RTIAFKVRT
Sbjct  3    PRAALRSANRR---SALLTQAKIGDTLEEFLVDATSDPKLRQVLMSLAEAVRTIAFKVRT  59

Query  554  ASCGGTACVN  583
            ASCG   CVN
Sbjct  60   ASCGAANCVN  69



>ref|XP_002946928.1| sedoheptulose-1,7-biphosphatase [Volvox carteri f. nagariensis]
 gb|EFJ52154.1| sedoheptulose-1,7-biphosphatase [Volvox carteri f. nagariensis]
Length=388

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            G ++    K S    + +   ++ +T+ +IGDSL EFL ++T D  L  LM+ M EA+RT
Sbjct  46   GATVAARVKRSTRAARMQSRRTAVMTQAKIGDSLAEFLVEATPDPKLRQLMMSMAEAVRT  105

Query  533  IAFKVRTASCGGTACVN  583
            I  KVRTASC GTACVN
Sbjct  106  IGHKVRTASCAGTACVN  122



>emb|CAA74960.1| sedoheptulose-1,7-biphosphatase [Chlamydomonas reinhardtii]
Length=389

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  377  KSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTA  556
            K+S    + +   ++ +T+ +IGDSL EFL ++T D  L  +M+ M EA RTIA KVRTA
Sbjct  54   KASTRAARVQSRRTAVLTQAKIGDSLAEFLVEATPDPKLRHVMMSMAEATRTIAHKVRTA  113

Query  557  SCGGTACVN  583
            SC GTACVN
Sbjct  114  SCAGTACVN  122



>sp|P46284.1|S17P_CHLRE RecName: Full=Sedoheptulose-1,7-bisphosphatase, chloroplastic; 
AltName: Full=SED(1,7)P2ase; AltName: Full=Sedoheptulose bisphosphatase; 
Short=SBPase; Flags: Precursor [Chlamydomonas 
reinhardtii]
 emb|CAA52439.1| sedoheptulose-bisphosphatase [Chlamydomonas reinhardtii]
Length=389

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRT  532
            G ++    K+S    + +   ++ +T+ +IGDSL EFL ++T D  L  +M+ M EA RT
Sbjct  46   GAAVTARVKASTRAARVQSRRTAVLTQAKIGDSLAEFLVEATPDPKLRHVMMSMAEATRT  105

Query  533  IAFKVRTASCGGTACVN  583
            IA KVRTASC GTACVN
Sbjct  106  IAHKVRTASCAGTACVN  122



>gb|ACA48696.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
argillicola]
 gb|ACA48697.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
argillicola]
 gb|ACA48698.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
argillicola]
Length=76

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 1/47 (2%)
 Frame = +2

Query  353  GESLRVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGL  493
            GESLRV P+SSL + +  K S+S VT+CEIGDSLEEFLTKSTSDKGL
Sbjct  31   GESLRVAPRSSLKISRP-KVSNSSVTRCEIGDSLEEFLTKSTSDKGL  76



>gb|ACA48670.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
biennis]
 gb|ACA48671.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
biennis]
 gb|ACA48672.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
glazioviana]
 gb|ACA48673.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. hookeri]
 gb|ACA48674.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. hookeri]
 gb|ACA48675.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
elata subsp. hookeri]
 gb|ACA48676.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
villosa subsp. villosa]
 gb|ACA48677.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
biennis]
 gb|ACA48678.1| chloroplast sedoheptulose-1,7-bisphosphatase, partial [Oenothera 
oakesiana]
Length=77

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 2/48 (4%)
 Frame = +2

Query  353  GESL-RVLPKSSLNVVKTRKHSSSPVTKCEIGDSLEEFLTKSTSDKGL  493
            GESL RV P+SSL + +  K S+SPVT+CEIGDSLEEFLTKSTSDKGL
Sbjct  31   GESLMRVAPRSSLKISRP-KGSNSPVTRCEIGDSLEEFLTKSTSDKGL  77



>gb|KFM29064.1| Sedoheptulose-1,7-bisphosphatase, chloroplastic [Auxenochlorella 
protothecoides]
Length=354

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  440  IGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            +GDSLEE+L  +TSD  L  LM  M EAIRTIA+KVRTASC  TAC+N
Sbjct  38   LGDSLEEYLQTATSDPNLRRLMTAMSEAIRTIAYKVRTASCSSTACIN  85



>gb|ABK00061.1| chloroplast sedoheptulose-1,7-bisphosphatase [Mesostigma viride]
Length=370

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 43/59 (73%), Gaps = 1/59 (2%)
 Frame = +2

Query  407  KHSSSPVTKCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            K + SPV + EIGD+LEEFL K+T +  L  +M  +GEA+RTIAFKVRTASC   +C N
Sbjct  48   KAAPSPV-RAEIGDTLEEFLVKATPNPKLRQMMQSLGEAMRTIAFKVRTASCSQISCTN  105



>dbj|BAA94305.1| sedoheptulose-1,7-bisphosphatase [Chlamydomonas sp. W80]
Length=366

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  440  IGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            IGDSL EFL  +T D  L  LM  M EA RTIA KVRTASCGGTACVN
Sbjct  42   IGDSLAEFLAVATPDTKLRQLMTSMSEATRTIAHKVRTASCGGTACVN  89



>gb|KDO69103.1| hypothetical protein CISIN_1g022390mg [Citrus sinensis]
Length=219

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  503  MICMGEAIRTIAFKVRTASCGGTACVN  583
            M+CMGEA+RTIAFKVRTASC GTACVN
Sbjct  1    MMCMGEALRTIAFKVRTASCVGTACVN  27



>gb|KDO69100.1| hypothetical protein CISIN_1g022390mg [Citrus sinensis]
 gb|KDO69101.1| hypothetical protein CISIN_1g022390mg [Citrus sinensis]
Length=298

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +2

Query  503  MICMGEAIRTIAFKVRTASCGGTACVN  583
            M+CMGEA+RTIAFKVRTASC GTACVN
Sbjct  1    MMCMGEALRTIAFKVRTASCVGTACVN  27



>gb|ABF68591.1| chloroplast sedoheptulose-1,7-bisphosphatase [Euglena gracilis]
Length=815

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  431  KCEIGDSLEEFLTKSTSDKGLISLMICMGEAIRTIAFKVRTASCGGTACVN  583
            K E+G +LE+F+     D  L  +M  M E+ RTI  KV TASCGGTAC N
Sbjct  142  KVELGSTLEDFMKAYVPDPKLRIIMATMAESGRTIDHKVTTASCGGTACTN  192



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 666899500002