BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c8115_g1_i2 len=1274 path=[1252:0-678 1931:679-1273]

Length=1274
                                                                      Score     E

ref|XP_009592777.1|  PREDICTED: hydroxyphenylpyruvate reductase         451   4e-154   
ref|XP_009800853.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    450   6e-154   
emb|CDO98027.1|  unnamed protein product                                448   5e-153   
ref|XP_006343076.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    441   3e-150   
ref|XP_004235670.1|  PREDICTED: hydroxyphenylpyruvate reductase-l...    441   4e-150   
gb|AGE44245.1|  hydroxyphenylpyruvate reductase                         431   3e-146   
ref|XP_007024184.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    429   1e-145   
ref|XP_011072370.1|  PREDICTED: hydroxyphenylpyruvate reductase         431   2e-145   
ref|XP_010062486.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    426   2e-144   
ref|XP_006426955.1|  hypothetical protein CICLE_v10026120mg             422   5e-143   
ref|XP_006465618.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    422   9e-143   
gb|AHB63232.1|  hydroxyphenylpyruvate reductase                         421   2e-142   
ref|XP_004166835.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate/h...    422   3e-142   
gb|EYU21462.1|  hypothetical protein MIMGU_mgv1a008651mg                422   4e-142   
ref|XP_004141766.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    421   5e-142   
gb|AAZ67354.1|  putative hydroxyphenylpyruvate reductase                419   9e-142   Salvia miltiorrhiza [Chinese salvia]
gb|AJA31668.1|  4-hydroxyphenylpyruvate reductase                       419   1e-141   
gb|ADM48810.1|  hydroxyphenylpyruvate reductase                         418   3e-141   
gb|ABR67588.1|  putative hydroxyphenylpyruvate reductase                417   6e-141   Salvia miltiorrhiza [Chinese salvia]
ref|XP_004252344.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    417   9e-141   
ref|XP_006359456.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    417   1e-140   
pdb|3BA1|A  Chain A, Structure Of Hydroxyphenylpyruvate Reductase...    417   2e-140   
ref|XP_004302898.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    415   5e-140   
ref|XP_010691338.1|  PREDICTED: hydroxyphenylpyruvate reductase i...    415   6e-140   
ref|XP_011010519.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    414   7e-140   
sp|Q65CJ7.2|HPPR_PLESU  RecName: Full=Hydroxyphenylpyruvate reduc...    414   1e-139   Solenostemon scutellarioides
gb|ABC02200.1|  putative hydroxyphenylpyruvate reductase                413   2e-139   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007215716.1|  hypothetical protein PRUPE_ppa008942mg             412   5e-139   
gb|ABK96235.1|  unknown                                                 412   5e-139   Populus trichocarpa x Populus deltoides
ref|XP_007215717.1|  hypothetical protein PRUPE_ppa008942mg             412   9e-139   
ref|XP_002516028.1|  glycerate dehydrogenase, putative                  411   1e-138   Ricinus communis
ref|XP_010318542.1|  PREDICTED: hydroxyphenylpyruvate reductase-l...    411   2e-138   
ref|XP_003632860.1|  PREDICTED: hydroxyphenylpyruvate reductase         410   3e-138   
ref|XP_009353612.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    410   3e-138   
ref|XP_002304205.2|  oxidoreductase family protein                      410   4e-138   Populus trichocarpa [western balsam poplar]
ref|XP_009626855.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    409   1e-137   
ref|XP_009784627.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    408   3e-137   
ref|XP_008228554.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    409   1e-136   
ref|XP_009338036.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    406   2e-136   
emb|CDO98028.1|  unnamed protein product                                405   4e-136   
ref|XP_010691339.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    405   5e-136   
gb|KHG02729.1|  Glyoxylate reductase                                    404   8e-136   
ref|XP_009626862.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    404   9e-136   
ref|XP_004302899.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    404   1e-135   
ref|XP_010473017.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    404   1e-135   
ref|XP_007215715.1|  hypothetical protein PRUPE_ppa008934mg             404   2e-135   
ref|XP_006359457.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    403   3e-135   
ref|XP_003604496.1|  Glyoxylate reductase                               403   3e-135   
ref|XP_008342684.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    402   4e-135   
ref|XP_009338072.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    402   5e-135   
ref|XP_004302900.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    401   1e-134   
ref|XP_008380917.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    404   1e-134   
gb|ACK99041.1|  hydroxyphenylpyruvate reductase                         400   1e-134   Salvia officinalis
ref|XP_004506841.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    400   3e-134   
ref|XP_008228555.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    400   3e-134   
gb|KDP37245.1|  hypothetical protein JCGZ_06301                         400   3e-134   
gb|EYU24702.1|  hypothetical protein MIMGU_mgv1a010401mg                400   4e-134   
gb|AFK48218.1|  unknown                                                 399   6e-134   
ref|XP_010521519.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    399   1e-133   
ref|XP_004252345.2|  PREDICTED: hydroxyphenylpyruvate reductase-like    398   2e-133   
gb|KDO56910.1|  hypothetical protein CISIN_1g021361mg                   397   4e-133   
ref|XP_006426958.1|  hypothetical protein CICLE_v10026118mg             397   6e-133   
ref|XP_008795067.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    395   2e-132   
ref|XP_007024183.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    395   2e-132   
ref|XP_003604495.1|  Glyoxylate/hydroxypyruvate reductase B             395   3e-132   
ref|XP_008348509.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    394   5e-132   
ref|XP_007135676.1|  hypothetical protein PHAVU_010G149000g             394   6e-132   
ref|XP_002516030.1|  glycerate dehydrogenase, putative                  394   6e-132   Ricinus communis
ref|XP_002516029.1|  glycerate dehydrogenase, putative                  394   7e-132   Ricinus communis
ref|XP_003604486.1|  Glyoxylate reductase                               394   8e-132   
ref|XP_009104430.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    394   8e-132   
emb|CDY58781.1|  BnaCnng33820D                                          392   3e-131   
emb|CDX67931.1|  BnaA07g19710D                                          392   3e-131   
ref|XP_010033867.1|  PREDICTED: hydroxyphenylpyruvate reductase-l...    392   6e-131   
ref|XP_009784628.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    391   1e-130   
ref|XP_010915830.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    390   3e-130   
ref|XP_011080783.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    389   9e-130   
ref|XP_008793047.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    389   1e-129   
gb|KDP37244.1|  hypothetical protein JCGZ_06300                         389   1e-129   
emb|CDX79406.1|  BnaC06g18970D                                          388   2e-129   
ref|XP_004486744.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    388   3e-129   
gb|ACU18122.1|  unknown                                                 387   4e-129   Glycine max [soybeans]
ref|XP_008799958.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    387   4e-129   
ref|XP_009353642.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    387   7e-129   
ref|XP_003530169.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    386   7e-129   
ref|XP_010417783.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    386   1e-128   
ref|NP_178105.1|  glyoxylate/hydroxypyruvate reductase A HPR2           385   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010254094.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    385   2e-128   
ref|XP_010924596.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    385   4e-128   
ref|XP_002889322.1|  oxidoreductase family protein                      384   6e-128   
ref|XP_010430045.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    384   7e-128   
gb|KFK42391.1|  hypothetical protein AALP_AA2G250000                    384   1e-127   
ref|XP_006389715.1|  hypothetical protein EUTSA_v10018906mg             383   2e-127   
dbj|BAJ96237.1|  predicted protein                                      383   2e-127   
dbj|BAJ94452.1|  predicted protein                                      382   3e-127   
dbj|BAJ84809.1|  predicted protein                                      382   4e-127   
ref|XP_011014261.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    382   1e-126   
ref|XP_002299712.2|  hypothetical protein POPTR_0001s18420g             381   3e-126   Populus trichocarpa [western balsam poplar]
gb|EPS61208.1|  hypothetical protein M569_13592                         380   4e-126   
ref|XP_006300949.1|  hypothetical protein CARUB_v10021337mg             379   4e-126   
ref|XP_009390691.1|  PREDICTED: hydroxyphenylpyruvate reductase         379   4e-126   
ref|XP_011009822.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    379   1e-125   
gb|KDO56911.1|  hypothetical protein CISIN_1g042102mg                   378   2e-125   
ref|XP_006465733.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    378   2e-125   
ref|XP_006426957.1|  hypothetical protein CICLE_v10026933mg             378   2e-125   
emb|CDX87280.1|  BnaA07g35930D                                          376   7e-125   
ref|XP_009106776.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    376   8e-125   
ref|XP_010098078.1|  Glyoxylate reductase                               377   1e-124   
ref|XP_009800851.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    375   1e-124   
ref|NP_001150094.1|  glyoxylate reductase                               375   3e-124   Zea mays [maize]
ref|XP_004967419.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    374   6e-124   
dbj|BAD82415.1|  putative D-isomer specific 2-hydroxyacid dehydro...    374   8e-124   Oryza sativa Japonica Group [Japonica rice]
gb|AGW27202.1|  putative hydroxyphenylpyruvate reductase 2              374   9e-124   
ref|XP_003565909.1|  PREDICTED: hydroxyphenylpyruvate reductase i...    373   1e-123   
gb|KEH28789.1|  D-glycerate dehydrogenase/hydroxypyruvate reductase     372   3e-123   
ref|XP_010254093.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    371   6e-123   
ref|XP_006343075.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    371   1e-122   
ref|XP_002454895.1|  hypothetical protein SORBIDRAFT_03g000950          374   1e-121   Sorghum bicolor [broomcorn]
ref|XP_002284520.1|  PREDICTED: hydroxyphenylpyruvate reductase         367   2e-121   Vitis vinifera
ref|XP_008655043.1|  PREDICTED: glyoxylate reductase isoform X1         367   3e-121   
ref|XP_004235671.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    367   5e-121   
ref|XP_009394191.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    363   9e-120   
ref|NP_001185444.1|  glyoxylate/hydroxypyruvate reductase A HPR2        362   1e-119   
ref|XP_010230652.1|  PREDICTED: hydroxyphenylpyruvate reductase i...    362   3e-119   
ref|XP_008462163.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    362   4e-119   
ref|XP_003597747.1|  Glyoxylate reductase                               362   4e-119   
ref|XP_008462161.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    359   6e-118   
ref|NP_001042479.1|  Os01g0228600                                       357   3e-117   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004141767.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    357   3e-117   
ref|XP_006833317.1|  hypothetical protein AMTR_s00109p00059250          357   4e-117   
gb|AFK44882.1|  unknown                                                 356   5e-117   
ref|XP_011072371.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    350   1e-114   
emb|CDM82380.1|  unnamed protein product                                355   1e-114   
gb|EPS70836.1|  hypothetical protein M569_03919                         350   1e-114   
gb|EMS68593.1|  Glyoxylate reductase                                    358   2e-114   
ref|XP_003546452.1|  PREDICTED: hydroxyphenylpyruvate reductase-l...    348   4e-114   
ref|XP_010521520.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    346   5e-113   
gb|EEC70231.1|  hypothetical protein OsI_01001                          350   1e-112   Oryza sativa Indica Group [Indian rice]
gb|AGW27203.1|  putative hydroxyphenylpyruvate reductase 3              345   2e-112   
ref|XP_007150632.1|  hypothetical protein PHAVU_005G168600g             344   3e-112   
ref|XP_004141768.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    343   1e-111   
emb|CBI36125.3|  unnamed protein product                                338   5e-111   
ref|XP_002984586.1|  hypothetical protein SELMODRAFT_156743             334   3e-108   
gb|EMS65296.1|  Glyoxylate reductase                                    334   3e-108   
ref|XP_002978650.1|  hypothetical protein SELMODRAFT_109271             331   4e-107   
tpg|DAA46911.1|  TPA: glyoxylate reductase                              322   2e-103   
ref|NP_001147460.1|  glyoxylate reductase                               321   5e-103   Zea mays [maize]
ref|XP_001771114.1|  predicted protein                                  311   2e-99    
ref|XP_006643938.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    308   4e-99    
gb|ACJ84562.1|  unknown                                                 291   1e-92    Medicago truncatula
gb|AIY25103.1|  hydroxyphenylpyruvate reductase                         288   8e-92    
ref|XP_004159022.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    291   4e-91    
ref|XP_001751565.1|  predicted protein                                  290   7e-91    
ref|XP_008789393.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxypheny...    290   5e-90    
ref|WP_012649277.1|  MULTISPECIES: dihydrofolate reductase              284   6e-89    
dbj|GAJ92169.1|  putative hydroxyacid oxidoreductase                    284   6e-89    
ref|WP_007689257.1|  dihydrofolate reductase                            279   5e-87    
ref|XP_008232825.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    278   2e-86    
ref|WP_012978154.1|  dihydrofolate reductase                            276   1e-85    
ref|WP_014250214.1|  dihydrofolate reductase                            275   3e-85    
ref|XP_007220744.1|  hypothetical protein PRUPE_ppa025117mg             275   3e-85    
ref|XP_009148581.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    275   5e-85    
ref|WP_026871361.1|  hypothetical protein                               274   5e-85    
gb|EYU21461.1|  hypothetical protein MIMGU_mgv1a013906mg                269   1e-84    
ref|WP_034832238.1|  hypothetical protein                               273   2e-84    
ref|XP_006417223.1|  hypothetical protein EUTSA_v10008209mg             272   3e-84    
ref|XP_004155807.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    272   5e-84    
ref|XP_010533732.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    270   3e-83    
ref|XP_010056262.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    270   7e-83    
ref|XP_010476225.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    269   8e-83    
ref|XP_007218334.1|  hypothetical protein PRUPE_ppa008547mg             268   1e-82    
ref|XP_004133897.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    268   2e-82    
ref|XP_004308425.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    266   6e-82    
emb|CDY57070.1|  BnaCnng31510D                                          266   6e-82    
ref|XP_010494315.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    266   8e-82    
gb|KGN56572.1|  hypothetical protein Csa_3G124910                       266   1e-81    
ref|XP_008438123.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    266   1e-81    
ref|XP_002889940.1|  oxidoreductase family protein                      266   1e-81    
gb|KCW72900.1|  hypothetical protein EUGRSUZ_E01342                     263   2e-81    
ref|XP_010661599.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    264   5e-81    
ref|WP_024898012.1|  dihydrofolate reductase                            263   7e-81    
emb|CDX98054.1|  BnaA06g08050D                                          263   2e-80    
ref|NP_172716.1|  glyoxylate/hydroxypyruvate reductase HPR3             263   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056260.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    263   3e-80    
ref|XP_004306883.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    263   3e-80    
ref|WP_007880036.1|  2-hydroxyacid dehydrogenase                        261   4e-80    
ref|WP_003497843.1|  dihydrofolate reductase                            261   4e-80    
ref|XP_010056265.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    262   4e-80    
ref|WP_020810587.1|  dihydrofolate reductase                            261   6e-80    
ref|XP_010058441.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    261   7e-80    
ref|XP_009400965.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    261   1e-79    
ref|XP_006417222.1|  hypothetical protein EUTSA_v10008292mg             260   1e-79    
ref|XP_010934080.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    259   3e-79    
ref|XP_006664931.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    259   4e-79    
ref|WP_003521698.1|  2-hydroxyacid dehydrogenase                        259   5e-79    
gb|KFK43523.1|  hypothetical protein AALP_AA1G136500                    259   6e-79    
ref|XP_009626262.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    258   1e-78    
ref|WP_035243208.1|  dihydrofolate reductase                            257   1e-78    
ref|XP_007051988.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    258   1e-78    
ref|WP_035224930.1|  dihydrofolate reductase                            257   2e-78    
ref|XP_006305294.1|  hypothetical protein CARUB_v10009669mg             258   2e-78    
ref|XP_008232839.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    258   2e-78    
ref|WP_003519674.1|  D-isomer specific 2-hydroxyacid dehydrogenase      256   3e-78    
ref|WP_003505982.1|  dihydrofolate reductase                            256   3e-78    
ref|XP_004974992.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    257   4e-78    
ref|WP_022686984.1|  dihydrofolate reductase                            256   5e-78    
ref|WP_020009163.1|  MULTISPECIES: dihydrofolate reductase              256   6e-78    
ref|XP_011093187.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    256   6e-78    
ref|WP_003505668.1|  dihydrofolate reductase                            256   7e-78    
ref|WP_020009854.1|  MULTISPECIES: dihydrofolate reductase              255   1e-77    
ref|XP_006445206.1|  hypothetical protein CICLE_v10020981mg             256   1e-77    
ref|WP_010974076.1|  MULTISPECIES: dihydrofolate reductase              254   1e-77    
ref|XP_010056258.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    255   2e-77    
ref|WP_004431336.1|  dihydrofolate reductase                            254   2e-77    
ref|XP_010056263.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    254   3e-77    
ref|WP_035200409.1|  dihydrofolate reductase                            254   4e-77    
ref|XP_010053876.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate/h...    254   4e-77    
ref|XP_004134340.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    254   5e-77    
ref|XP_009400796.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    254   6e-77    
ref|XP_008439355.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    253   6e-77    
ref|XP_005973367.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    253   8e-77    
ref|WP_019566714.1|  dihydrofolate reductase                            253   9e-77    
ref|WP_020810952.1|  dihydrofolate reductase                            253   1e-76    
ref|WP_035225056.1|  dihydrofolate reductase                            252   1e-76    
ref|WP_013761076.1|  MULTISPECIES: dihydrofolate reductase              252   1e-76    
ref|XP_008462451.1|  PREDICTED: hydroxyphenylpyruvate reductase-like    248   1e-76    
ref|WP_035264890.1|  dihydrofolate reductase                            252   2e-76    
ref|XP_006491460.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    252   2e-76    
ref|WP_014197341.1|  dihydrofolate reductase                            252   2e-76    
ref|XP_002511757.1|  glycerate dehydrogenase, putative                  252   2e-76    Ricinus communis
ref|XP_010058443.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    252   2e-76    
ref|WP_027316374.1|  dehydrogenase                                      251   4e-76    
gb|EGP56235.1|  2-hydroxyacid dehydrogenase                             251   4e-76    
emb|CAH67836.1|  B0616E02-H0507E05.12                                   251   5e-76    Oryza sativa [red rice]
gb|EZQ05679.1|  dihydrofolate reductase                                 251   6e-76    
ref|NP_001052017.1|  Os04g0107500                                       250   8e-76    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783586.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    253   9e-76    
ref|XP_004155806.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    251   9e-76    
gb|KDO85915.1|  hypothetical protein CISIN_1g020160mg                   251   1e-75    
gb|KCW72898.1|  hypothetical protein EUGRSUZ_E01340                     249   1e-75    
ref|WP_035676338.1|  dihydrofolate reductase                            250   1e-75    
ref|XP_003633919.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    250   2e-75    
emb|CDP13464.1|  unnamed protein product                                249   2e-75    
ref|XP_010056261.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    250   2e-75    
ref|XP_009626264.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    249   3e-75    
ref|XP_004306882.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    249   3e-75    
ref|WP_037169103.1|  2-hydroxyacid dehydrogenase                        249   3e-75    
gb|KCW72902.1|  hypothetical protein EUGRSUZ_E01346                     247   3e-75    
ref|WP_034497901.1|  dihydrofolate reductase                            249   3e-75    
ref|XP_009780940.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    249   4e-75    
ref|XP_010272620.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    249   5e-75    
ref|WP_035053438.1|  hydroxyacid dehydrogenase                          248   5e-75    
ref|WP_037518301.1|  2-hydroxyacid dehydrogenase                        248   7e-75    
dbj|BAJ53140.1|  JHL05D22.11                                            248   7e-75    
emb|CAE02764.1|  OSJNBb0085F13.11                                       248   7e-75    Oryza sativa Japonica Group [Japonica rice]
ref|WP_037212386.1|  2-hydroxyacid dehydrogenase                        248   9e-75    
ref|XP_007219660.1|  hypothetical protein PRUPE_ppa023890mg             248   9e-75    
ref|WP_035078127.1|  hypothetical protein                               247   9e-75    
gb|KEZ19793.1|  Lactate dehydrogenase-like oxidoreductase               248   1e-74    
ref|WP_035209570.1|  dihydrofolate reductase                            247   1e-74    
gb|EEC76636.1|  hypothetical protein OsI_14575                          248   1e-74    Oryza sativa Indica Group [Indian rice]
ref|WP_036347179.1|  dehydrogenase                                      248   1e-74    
ref|NP_001052015.1|  Os04g0107200                                       248   1e-74    Oryza sativa Japonica Group [Japonica rice]
gb|KCW72905.1|  hypothetical protein EUGRSUZ_E01349                     248   1e-74    
emb|CAH67834.1|  B0616E02-H0507E05.10                                   248   1e-74    Oryza sativa [red rice]
gb|KCW72895.1|  hypothetical protein EUGRSUZ_E01337                     248   2e-74    
dbj|BAJ53141.1|  JHL05D22.12                                            248   2e-74    
ref|XP_008438122.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    247   2e-74    
ref|WP_027474172.1|  hydroxyacid dehydrogenase                          247   2e-74    
ref|WP_028033802.1|  hypothetical protein                               246   2e-74    
ref|WP_037092540.1|  dihydrofolate reductase                            246   2e-74    
ref|XP_007051987.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    247   3e-74    
ref|WP_007711837.1|  D-2-hydroxyacid dehydrogenase                      246   4e-74    
ref|XP_008375871.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    246   7e-74    
ref|XP_011002083.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    246   8e-74    
ref|WP_025099077.1|  2-hydroxyacid dehydrogenase                        245   8e-74    
ref|XP_002301314.2|  hypothetical protein POPTR_0002s15250g             246   9e-74    Populus trichocarpa [western balsam poplar]
ref|NP_001147169.1|  glyoxylate reductase                               245   9e-74    Zea mays [maize]
ref|WP_017499599.1|  D-2-hydroxyacid dehydrogenase                      245   1e-73    
ref|XP_009626261.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    245   1e-73    
ref|WP_022563857.1|  Glyoxylate/hydroxypyruvate reductase A HPR2        244   1e-73    
ref|WP_006700308.1|  dihydrofolate reductase                            244   1e-73    
ref|WP_013848252.1|  D-2-hydroxyacid dehydrogenase                      245   1e-73    
ref|WP_003591815.1|  D-2-hydroxyacid dehydrogenase                      244   1e-73    
ref|WP_021006814.1|  putative glyoxylate reductase                      244   1e-73    
ref|XP_002301313.2|  hypothetical protein POPTR_0002s15240g             245   2e-73    
ref|WP_035814212.1|  hydroxyacid dehydrogenase                          244   2e-73    
ref|WP_014898107.1|  D-2-hydroxyacid dehydrogenase                      244   2e-73    
ref|XP_002447410.1|  hypothetical protein SORBIDRAFT_06g000620          245   2e-73    
gb|EKU76243.1|  hypothetical protein HMPREF9718_01595                   244   2e-73    
dbj|BAJ53139.1|  JHL05D22.10                                            244   3e-73    
ref|XP_007051989.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    244   3e-73    
ref|WP_019657881.1|  D-2-hydroxyacid dehydrogenase                      244   3e-73    
ref|XP_009397043.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    245   3e-73    
ref|WP_032900520.1|  2-hydroxyacid dehydrogenase                        243   3e-73    
ref|WP_032808060.1|  2-hydroxyacid dehydrogenase                        243   3e-73    
ref|XP_005980955.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    244   3e-73    
ref|XP_010494324.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    244   3e-73    
ref|XP_002281980.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    244   3e-73    
ref|XP_003580691.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    244   3e-73    
ref|WP_037490556.1|  2-hydroxyacid dehydrogenase                        244   3e-73    
ref|WP_027100549.1|  hydroxyacid dehydrogenase                          244   3e-73    
ref|WP_019997526.1|  hypothetical protein                               243   4e-73    
ref|WP_010337326.1|  D-2-hydroxyacid dehydrogenase                      243   4e-73    
ref|XP_006477345.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    243   6e-73    
gb|KFK43521.1|  hypothetical protein AALP_AA1G136200                    251   6e-73    
ref|XP_004308424.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    243   6e-73    
ref|WP_039324046.1|  2-hydroxyacid dehydrogenase                        243   7e-73    
ref|WP_003572268.1|  D-2-hydroxyacid dehydrogenase                      243   8e-73    
ref|WP_026638028.1|  hydroxyacid dehydrogenase                          242   1e-72    
ref|XP_008783589.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    243   1e-72    
ref|WP_033467434.1|  hydroxyacid dehydrogenase                          243   1e-72    
ref|WP_021316422.1|  D-2-hydroxyacid dehydrogenase                      242   1e-72    
ref|XP_010676603.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    242   2e-72    
ref|WP_008878464.1|  Glyoxylate reductase                               241   2e-72    
ref|XP_007040064.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    242   2e-72    
ref|XP_008654890.1|  PREDICTED: glyoxylate reductase isoform X2         244   2e-72    
ref|XP_008375889.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    242   2e-72    
emb|CDY16010.1|  BnaC08g41130D                                          248   2e-72    
ref|XP_008654889.1|  PREDICTED: glyoxylate reductase isoform X1         244   2e-72    
ref|WP_018329204.1|  D-2-hydroxyacid dehydrogenase                      241   3e-72    
ref|WP_022535179.1|  2-hydroxyacid dehydrogenase                        241   3e-72    
ref|WP_012317767.1|  dihydrofolate reductase                            241   4e-72    
ref|XP_011002085.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    241   4e-72    
ref|WP_035487836.1|  hypothetical protein                               240   4e-72    
gb|ESY91966.1|  D-2-hydroxyacid dehydrogenase                           240   5e-72    
gb|EXS71078.1|  2-hydroxyacid dehydrogenase                             241   5e-72    
ref|WP_037510869.1|  2-hydroxyacid dehydrogenase                        241   5e-72    
ref|XP_010667718.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    241   5e-72    
ref|WP_037526470.1|  dehydrogenase                                      241   5e-72    
ref|WP_018063370.1|  hypothetical protein                               240   6e-72    
ref|WP_008943781.1|  dihydrofolate reductase                            240   6e-72    
ref|WP_018449103.1|  D-2-hydroxyacid dehydrogenase                      240   6e-72    
ref|WP_007877958.1|  D-2-hydroxyacid dehydrogenase                      240   7e-72    
ref|WP_029555262.1|  dehydrogenase                                      240   7e-72    
emb|CAN64820.1|  hypothetical protein VITISV_009548                     236   7e-72    
ref|WP_037146593.1|  2-hydroxyacid dehydrogenase                        240   8e-72    
ref|XP_010476226.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    240   8e-72    
ref|WP_021159277.1|  D-3-phosphoglycerate dehydrogenase                 240   8e-72    
ref|XP_006339508.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    240   1e-71    
ref|WP_004670758.1|  D-2-hydroxyacid dehydrogenase                      239   1e-71    
ref|XP_009780938.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    240   1e-71    
ref|WP_035866878.1|  hydroxyacid dehydrogenase                          239   1e-71    
gb|ESZ21193.1|  D-2-hydroxyacid dehydrogenase                           239   1e-71    
ref|WP_006220308.1|  hydroxyacid dehydrogenase                          239   1e-71    
ref|WP_012555579.1|  D-2-hydroxyacid dehydrogenase                      239   1e-71    
ref|WP_024830972.1|  dehydrogenase                                      239   1e-71    
ref|WP_012249595.1|  hydroxyacid dehydrogenase                          239   2e-71    
gb|KHG16301.1|  Glyoxylate reductase                                    239   2e-71    
ref|WP_012114461.1|  dihydrofolate reductase                            239   2e-71    
ref|WP_028008295.1|  hydroxyacid dehydrogenase                          239   2e-71    
ref|WP_003577785.1|  D-2-hydroxyacid dehydrogenase                      239   2e-71    
ref|WP_012748437.1|  D-2-hydroxyacid dehydrogenase                      239   2e-71    
ref|XP_002446023.1|  hypothetical protein SORBIDRAFT_06g000590          239   2e-71    
ref|XP_010559121.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    240   2e-71    
ref|XP_002447412.1|  hypothetical protein SORBIDRAFT_06g000640          239   2e-71    
ref|WP_027788395.1|  2-hydroxyacid dehydrogenase                        239   2e-71    
ref|WP_007634477.1|  D-2-hydroxyacid dehydrogenase                      239   2e-71    
ref|WP_029360614.1|  dehydrogenase                                      239   2e-71    
ref|WP_017968673.1|  D-2-hydroxyacid dehydrogenase                      239   2e-71    
gb|AHG48373.1|  D-2-hydroxyacid dehydrogenase                           239   3e-71    
ref|WP_036368227.1|  2-hydroxyacid dehydrogenase                        238   3e-71    
ref|XP_004229871.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    239   3e-71    
gb|KEC69806.1|  D-isomer specific 2-hydroxyacid dehydrogenase fam...    238   3e-71    
ref|WP_012171143.1|  dihydrofolate reductase                            238   3e-71    
ref|XP_006440485.1|  hypothetical protein CICLE_v10024328mg             238   4e-71    
ref|WP_018905573.1|  D-2-hydroxyacid dehydrogenase                      238   5e-71    
gb|KHG11322.1|  Glyoxylate reductase                                    239   5e-71    
ref|XP_006375318.1|  hypothetical protein POPTR_0014s06930g             240   5e-71    
ref|WP_015928106.1|  dihydrofolate reductase                            238   5e-71    
ref|WP_012330795.1|  dihydrofolate reductase                            238   5e-71    
ref|WP_031252397.1|  2-hydroxyacid dehydrogenase                        238   5e-71    
ref|XP_004510901.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    238   6e-71    
ref|WP_010685885.1|  NAD-binding D-isomer specific 2-hydroxyacid ...    238   6e-71    
ref|WP_007836039.1|  D-2-hydroxyacid dehydrogenase                      238   7e-71    
ref|NP_001266568.1|  glyoxylate reductase                               238   7e-71    
ref|XP_011081063.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    238   8e-71    
ref|XP_007051990.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    239   8e-71    
ref|WP_028732403.1|  2-hydroxyacid dehydrogenase                        237   8e-71    
ref|NP_001052016.1|  Os04g0107300                                       238   8e-71    
ref|WP_031254529.1|  2-hydroxyacid dehydrogenase                        237   8e-71    
ref|XP_002511759.1|  glycerate dehydrogenase, putative                  238   9e-71    
ref|WP_003538473.1|  D-2-hydroxyacid dehydrogenase                      237   9e-71    
ref|XP_011034831.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    239   1e-70    
emb|CAH67835.1|  B0616E02-H0507E05.11                                   238   1e-70    
ref|WP_018246838.1|  D-2-hydroxyacid dehydrogenase                      237   1e-70    
ref|WP_024320278.1|  2-hydroxyacid dehydrogenase                        237   1e-70    
ref|WP_010842371.1|  D-Lactate dehydrogenase-related dehydrogenase      238   1e-70    
ref|WP_033190318.1|  hydroxyacid dehydrogenase                          237   1e-70    
ref|WP_036164751.1|  hydroxyacid dehydrogenase                          236   1e-70    
gb|AJC83777.1|  glyoxylate reductase 2                                  236   1e-70    
gb|ESX50788.1|  D-2-hydroxyacid dehydrogenase                           237   1e-70    
ref|XP_010934081.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    237   1e-70    
ref|WP_013394794.1|  hydroxyacid dehydrogenase                          237   1e-70    
gb|ESX85564.1|  D-2-hydroxyacid dehydrogenase                           236   1e-70    
ref|XP_002509672.1|  glycerate dehydrogenase, putative                  237   2e-70    
ref|WP_033472611.1|  hydroxyacid dehydrogenase                          237   2e-70    
ref|WP_024280327.1|  dehydrogenase                                      237   2e-70    
ref|WP_003932612.1|  hydroxyacid dehydrogenase                          236   2e-70    
ref|WP_008529991.1|  D-2-hydroxyacid dehydrogenase                      236   2e-70    
gb|ESY62880.1|  D-2-hydroxyacid dehydrogenase                           237   2e-70    
gb|ESY09134.1|  D-2-hydroxyacid dehydrogenase                           236   2e-70    
gb|AIQ88699.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...    236   2e-70    
ref|WP_015459111.1|  glyoxylate reductase                               235   2e-70    
ref|WP_037184072.1|  hydroxyacid dehydrogenase                          236   2e-70    
ref|WP_037020139.1|  dehydrogenase                                      236   2e-70    
ref|WP_027683046.1|  2-hydroxyacid dehydrogenase                        236   3e-70    
ref|WP_026352945.1|  hydroxyacid dehydrogenase                          236   3e-70    
ref|WP_017992551.1|  D-2-hydroxyacid dehydrogenase                      236   3e-70    
ref|WP_033452099.1|  hydroxyacid dehydrogenase                          236   3e-70    
ref|WP_037137614.1|  2-hydroxyacid dehydrogenase                        236   3e-70    
ref|WP_033184156.1|  2-hydroxyacid dehydrogenase                        236   3e-70    
ref|WP_029603524.1|  dihydrofolate reductase                            236   3e-70    
ref|WP_020112373.1|  MULTISPECIES: hypothetical protein                 236   3e-70    
ref|WP_026380387.1|  hypothetical protein                               236   4e-70    
ref|XP_004134341.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    236   4e-70    
ref|XP_007040063.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    236   4e-70    
ref|WP_019666858.1|  hypothetical protein                               235   4e-70    
ref|WP_011350918.1|  D-2-hydroxyacid dehydrogenase                      236   4e-70    
gb|EYU35053.1|  hypothetical protein MIMGU_mgv1a009863mg                236   4e-70    
ref|XP_002320082.1|  hypothetical protein POPTR_0014s06940g             236   5e-70    
ref|WP_037139909.1|  hydroxyacid dehydrogenase                          235   5e-70    
ref|WP_016706248.1|  hydroxyacid dehydrogenase                          236   5e-70    
ref|WP_037263408.1|  hypothetical protein                               235   5e-70    
ref|WP_031398880.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase          235   5e-70    
ref|WP_035099571.1|  hypothetical protein                               235   6e-70    
ref|WP_037112110.1|  hydroxyacid dehydrogenase                          235   6e-70    
ref|WP_018486096.1|  D-2-hydroxyacid dehydrogenase                      235   6e-70    
ref|WP_033458523.1|  hydroxyacid dehydrogenase                          235   6e-70    
gb|AIC31818.1|  glyoxylate reductase 2                                  234   7e-70    
ref|WP_029873600.1|  2-hydroxyacid dehydrogenase                        235   7e-70    
ref|WP_036351518.1|  2-hydroxyacid dehydrogenase                        235   7e-70    
ref|WP_011778298.1|  MULTISPECIES: hydroxyacid dehydrogenase            235   7e-70    
ref|WP_018070700.1|  D-2-hydroxyacid dehydrogenase                      235   7e-70    
gb|EEE60381.1|  hypothetical protein OsJ_13524                          235   7e-70    
gb|AHF88504.1|  D-2-hydroxyacid dehydrogenase                           235   8e-70    
gb|EEC76638.1|  hypothetical protein OsI_14578                          235   8e-70    
gb|AFW57716.1|  hypothetical protein ZEAMMB73_333171                    236   8e-70    
ref|WP_003820372.1|  putative D-isomer specific 2-hydroxyacid deh...    235   8e-70    
ref|WP_035270054.1|  hydroxyacid dehydrogenase                          235   8e-70    
ref|WP_022533770.1|  2-hydroxyacid dehydrogenase                        234   9e-70    
ref|WP_038364373.1|  dehydrogenase                                      235   9e-70    
ref|XP_008662993.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    236   9e-70    
ref|WP_028743110.1|  2-hydroxyacid dehydrogenase                        234   9e-70    
ref|XP_004977695.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    235   9e-70    
ref|WP_032631038.1|  hydroxyacid dehydrogenase                          234   9e-70    
ref|WP_018496301.1|  D-2-hydroxyacid dehydrogenase                      234   1e-69    
ref|WP_018262605.1|  dihydrofolate reductase                            234   1e-69    
ref|WP_022954508.1|  D-2-hydroxyacid dehydrogenase                      234   1e-69    
ref|WP_027667386.1|  2-hydroxyacid dehydrogenase                        234   1e-69    
ref|WP_003812928.1|  hydroxyacid dehydrogenase                          234   1e-69    
gb|ESY89735.1|  D-2-hydroxyacid dehydrogenase                           234   1e-69    
ref|WP_031261432.1|  2-hydroxyacid dehydrogenase                        234   1e-69    
gb|ESY79853.1|  D-2-hydroxyacid dehydrogenase                           234   1e-69    
emb|CBI38817.3|  unnamed protein product                                248   1e-69    
ref|WP_010928598.1|  hydroxyacid dehydrogenase                          234   1e-69    
ref|WP_013540718.1|  D-2-hydroxyacid dehydrogenase                      234   1e-69    
ref|WP_006201214.1|  D-2-hydroxyacid dehydrogenase                      234   1e-69    
ref|WP_031198705.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase          234   2e-69    
ref|WP_031239605.1|  2-hydroxyacid dehydrogenase                        234   2e-69    
gb|EGO36732.1|  lactate dehydrogenase-like oxidoreductase               234   2e-69    
ref|WP_007566883.1|  dihydrofolate reductase                            234   2e-69    
ref|XP_010544675.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate/h...    234   2e-69    
ref|WP_014927216.1|  hydroxyacid dehydrogenase                          235   2e-69    
ref|WP_015064103.1|  D-isomer specific 2-hydroxyacid dehydrogenase      234   2e-69    
ref|XP_006445207.1|  hypothetical protein CICLE_v10023615mg             248   2e-69    
ref|WP_031351002.1|  hydroxyacid dehydrogenase                          234   2e-69    
ref|WP_003876893.1|  hypothetical protein                               234   2e-69    
ref|WP_014905951.1|  hydroxyacid dehydrogenase                          233   2e-69    
ref|XP_011029131.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    234   2e-69    
ref|WP_019306447.1|  hydroxyacid dehydrogenase                          234   3e-69    
ref|WP_032919057.1|  2-hydroxyacid dehydrogenase                        233   3e-69    
ref|WP_017958196.1|  D-2-hydroxyacid dehydrogenase                      233   3e-69    
ref|WP_009455447.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    233   3e-69    
ref|WP_031232958.1|  hydroxyacid dehydrogenase                          233   3e-69    
ref|WP_006225442.1|  hydroxyacid dehydrogenase                          233   3e-69    
gb|KEQ52942.1|  Glyoxylate reductase                                    233   3e-69    
ref|XP_010667719.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    234   3e-69    
gb|KGD99734.1|  hydroxyacid dehydrogenase                               233   3e-69    
ref|WP_009823188.1|  D-2-hydroxyacid dehydrogenase                      233   3e-69    
ref|WP_020047855.1|  D-2-hydroxyacid dehydrogenase                      233   4e-69    
ref|WP_010948746.1|  hydroxyacid dehydrogenase                          234   4e-69    
ref|WP_019142457.1|  hypothetical protein                               233   4e-69    
ref|WP_037452880.1|  2-hydroxyacid dehydrogenase                        233   4e-69    
ref|WP_036040475.1|  2-hydroxyacid dehydrogenase                        233   4e-69    
ref|WP_036361997.1|  dehydrogenase                                      233   4e-69    
gb|ETA97469.1|  hydroxyacid dehydrogenase                               234   4e-69    
ref|WP_028272353.1|  hydroxyacid dehydrogenase                          233   5e-69    
ref|WP_020928163.1|  D-3-phosphoglycerate dehydrogenase                 233   5e-69    
ref|WP_027231286.1|  2-hydroxyacid dehydrogenase                        233   5e-69    
gb|KER66165.1|  2-hydroxyacid dehydrogenase                             233   5e-69    
ref|WP_031298798.1|  2-hydroxyacid dehydrogenase                        233   5e-69    
ref|WP_026382913.1|  hydroxyacid dehydrogenase                          233   6e-69    
gb|EQB12203.1|  D-2-hydroxyacid dehydrogenase                           233   6e-69    
ref|XP_011034863.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    233   6e-69    
ref|WP_024069243.1|  D-3-phosphoglycerate dehydrogenase                 233   6e-69    
ref|XP_006358844.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    233   6e-69    
ref|WP_035182778.1|  hydroxyacid dehydrogenase                          233   6e-69    
ref|WP_019462729.1|  MULTISPECIES: hypothetical protein                 232   7e-69    
ref|WP_003897527.1|  4-phosphoerythronate dehydrogenase                 233   7e-69    



>ref|XP_009592777.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana tomentosiformis]
Length=313

 Score =   451 bits (1159),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 233/318 (73%), Positives = 270/318 (85%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++IGVLMACPM++YLE +L  R  L RFWNFP  + F  Q NA S+RA+V NAF GAD 
Sbjct  1     MQSIGVLMACPMSSYLEQELDKRLKLFRFWNFPQKNEFLNQ-NADSIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    --ELIDSLPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+KGLWK     F+ TS+FSGKSVGIIGLGRIGL IA+RAEAF C ISYH+R
Sbjct  118   RICECDRYVRKGLWKSG--DFKLTSKFSGKSVGIIGLGRIGLTIARRAEAFGCPISYHAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYYP+V+ELASNCQILVVACALTPET HI+NR+VI++LG  GV+INI RG H
Sbjct  176   SEKPNTNYKYYPSVVELASNCQILVVACALTPETRHIVNREVIEALGSKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE+EPEV E+LFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEKELVSALVEGRLGGAGLDVFENEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>ref|XP_009800853.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana sylvestris]
Length=313

 Score =   450 bits (1158),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 235/318 (74%), Positives = 270/318 (85%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLMACPM++YLE +L  RF L RFWNF   + F  Q NA S+RA+V NAF GAD 
Sbjct  1     MESIGVLMACPMSSYLEQELDKRFKLFRFWNFSQKNEFLNQ-NADSIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+A+GL+LAVLR
Sbjct  60    --ELIDSLPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAVGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+KGLWK     F+ TS+FSGKSVGIIGLGRIGLAIA RAEAF C ISYH+R
Sbjct  118   RICECDRYVRKGLWKSG--DFKLTSKFSGKSVGIIGLGRIGLAIANRAEAFGCPISYHAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             SQK NTNYKYYP+V+ELASNCQILVVACALTPET HI+NR+VI++LG  GV+INI RG H
Sbjct  176   SQKPNTNYKYYPSVVELASNCQILVVACALTPETRHIVNREVIEALGSKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE+EPEV E+LFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEKELVSALVEGRLGGAGLDVFENEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>emb|CDO98027.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   448 bits (1152),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 270/318 (85%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE +L  RF L R+WN P +  F  + N+ S+RA+V N+  GAD 
Sbjct  1     MESIGVLMMCPMNSYLEQELDKRFKLFRYWNIPQTQQFLKE-NSNSIRAVVGNSMAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    Q--LIESLPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+KGLWK     F+ T++F+GKSVGIIGLGRIG AIAKRAEAF+C ISY+SR
Sbjct  118   RLCECDRYVRKGLWKTG--DFKLTTKFTGKSVGIIGLGRIGTAIAKRAEAFDCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K +TNYKYYP+VI+LASNCQILVVAC+LTPET HIINR+VID+LGP GV+INI RG H
Sbjct  176   SEKADTNYKYYPSVIDLASNCQILVVACSLTPETRHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDVFE+EPE  EELFG+DNVVLLPH G  T+ETR AMADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVFENEPEAPEELFGLDNVVLLPHVGSGTIETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>ref|XP_006343076.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum tuberosum]
Length=313

 Score =   441 bits (1134),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 270/318 (85%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLMACPM++YLE +L  RF L RFWN P  + F  Q +A S+RA+V NAF GAD 
Sbjct  1     MESIGVLMACPMSSYLEQELDKRFKLFRFWNVPQKNEFLIQ-HADSIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    --ELINSLPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+KGLWK     F+ TS+FSGKSVGIIGLGRIGLAIAKRAEAF C ISY++R
Sbjct  118   RICECDRYVRKGLWKSG--DFKLTSKFSGKSVGIIGLGRIGLAIAKRAEAFGCPISYYTR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYYP+V+ELASNCQILVVACALTPET HI+NR+V+++LG  G++INI RG H
Sbjct  176   SEKPNTNYKYYPSVVELASNCQILVVACALTPETRHIVNREVMEALGSKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDVFE+EPEV E+LFG++NVV+LPH G  T ETR AMADLV
Sbjct  236   VDEKELVSALLEGRLGGAGLDVFENEPEVPEQLFGLENVVILPHVGSGTEETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>ref|XP_004235670.1| PREDICTED: hydroxyphenylpyruvate reductase-like isoform X2 [Solanum 
lycopersicum]
Length=313

 Score =   441 bits (1133),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 229/318 (72%), Positives = 270/318 (85%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLMACPM++YLE +L  RF L RFWN P  + F +Q +A S+RA+V NAF GAD 
Sbjct  1     MESIGVLMACPMSSYLEQELDKRFKLFRFWNVPQKNEFLSQ-HADSIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    --ELINSLPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR V+KGLWK     F+ TS+FSGKSVGIIGLGRIGLAIAKRAEAF C ISY++R
Sbjct  118   RICECDRHVRKGLWKSG--DFKLTSKFSGKSVGIIGLGRIGLAIAKRAEAFGCPISYYTR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYYP+V+ELASNCQILVVACALTPET HI+NR+V+++LG  G++INI RG H
Sbjct  176   SEKPNTNYKYYPSVVELASNCQILVVACALTPETRHIVNREVMEALGSKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDVFE+EPEV E+LFG++NVVLLPH G  T ETR AMADLV
Sbjct  236   VDEKELVSALLEGRLGGAGLDVFENEPEVPEQLFGLENVVLLPHVGSGTEETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>gb|AGE44245.1| hydroxyphenylpyruvate reductase [Salvia officinalis]
Length=313

 Score =   431 bits (1107),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 225/318 (71%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN+YLE +L  RF LLR+W  P    F AQ  A S+RA+V NA  GAD 
Sbjct  1     MEAIGVLMMCPMNSYLEQELDKRFKLLRYWTQPKQSEFLAQ-QADSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S +SVGLDKVDL KCKEKG+RVTNTPDVLTDDVAD+AIGLILAVLR
Sbjct  60    --ALIDALPKLEIVSNFSVGLDKVDLVKCKEKGVRVTNTPDVLTDDVADLAIGLILAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V++G WK+    F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRRGAWKLG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +++ELASN  ILVVACALTPET HI+NR+VID+LGP GV+INI RG H
Sbjct  176   SKKANTNYTYYGSIVELASNSDILVVACALTPETTHIVNREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>ref|XP_007024184.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
[Theobroma cacao]
 gb|EOY26806.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
[Theobroma cacao]
Length=313

 Score =   429 bits (1104),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLEH+L  RFNL RFW  P+  AF A  N  S+RA+V N+  GAD 
Sbjct  1     MESIGVLMVCPMNSYLEHELEKRFNLFRFWTVPEKSAFLAT-NKNSIRAVVGNSSAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVGLDK+DLAKCKEKGIRVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --ELIEVLPKLEIVASFSVGLDKIDLAKCKEKGIRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+ E DR+V+ G WK     ++ T++F+GK VGIIGLGRIG+A+AKRAEAF+C ISY+SR
Sbjct  118   KLCESDRYVRSGKWKKG--DYRLTTKFTGKKVGIIGLGRIGMAVAKRAEAFSCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYP V+ELA+NC ILVVAC+LT ET HIINR+VID+LGP GV+IN+ RG H
Sbjct  176   TEKPEIKYKYYPGVVELAANCDILVVACSLTEETLHIINREVIDALGPKGVLINVGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVE RLGGAGLDVFE EPEV EELFG+DNVVLLPH G  TVETR AMADLV
Sbjct  236   VDEPELVSALVERRLGGAGLDVFEHEPEVPEELFGLDNVVLLPHVGSGTVETRQAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+N+PLLT VV
Sbjct  296   IGNLEAHFLNRPLLTPVV  313



>ref|XP_011072370.1| PREDICTED: hydroxyphenylpyruvate reductase [Sesamum indicum]
Length=361

 Score =   431 bits (1107),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 264/319 (83%), Gaps = 6/319 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
              ME IGVLM CPMN YLE +L+ RFNL R+W  P    F  Q +A S+RA+V NA  GAD
Sbjct  49    RMEAIGVLMMCPMNNYLEEELNKRFNLFRYWKQPRPSEFLTQ-HAQSIRAVVGNATAGAD  107

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  108   A--KLIEALPKLEIVSSFSVGLDKIDLTKCKEKGIRVTNTPDVLTDDVADLAIGLMLAVL  165

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E D++V++G WK     F+ TS+FSGK VGIIGLGRIGLA+AKRAEAF+C ISY+S
Sbjct  166   RRICECDKYVRRGEWKFG--DFKLTSKFSGKRVGIIGLGRIGLAVAKRAEAFDCPISYYS  223

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RSQK NTNYKYY +V+ELASNC ILVVACALTPET HI+NR+V+D+LGP+GV+INI RG 
Sbjct  224   RSQK-NTNYKYYGSVVELASNCDILVVACALTPETTHIVNREVMDALGPSGVLINIGRGP  282

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  MADL
Sbjct  283   HVDEPELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKDMADL  342

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+RNLEAHF NKPLLT VV
Sbjct  343   VLRNLEAHFANKPLLTPVV  361



>ref|XP_010062486.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Eucalyptus grandis]
 gb|KCW69622.1| hypothetical protein EUGRSUZ_F03036 [Eucalyptus grandis]
Length=313

 Score =   426 bits (1096),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 260/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++IGVLMACPMNAYLE +L  RF L RFW  P    F    +AAS+RA+V ++  GAD 
Sbjct  1     MDSIGVLMACPMNAYLEQELEKRFRLFRFWQVPQKPQFLKD-HAASIRAVVGSSVAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KC+EKGIRVTNTPDVLT+DVAD+AIGL LAVLR
Sbjct  60    --ELIEALPRLEIVSSFSVGLDKIDLGKCREKGIRVTNTPDVLTEDVADLAIGLCLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   D++V+ G WK     F+ T++F+GK+VGIIGLGRIG AIAKRAEAFNC ISY+SR
Sbjct  118   RICASDKYVRSGKWKKG--DFRLTTKFTGKTVGIIGLGRIGTAIAKRAEAFNCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYP+V+ELASNC IL+VAC LTPET HIINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPDCKYKYYPSVVELASNCHILIVACPLTPETRHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDV+E EPEV EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVYEHEPEVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   LGNLEAHFTNKPLLTPVV  313



>ref|XP_006426955.1| hypothetical protein CICLE_v10026120mg [Citrus clementina]
 gb|ESR40195.1| hypothetical protein CICLE_v10026120mg [Citrus clementina]
Length=313

 Score =   422 bits (1086),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 220/319 (69%), Positives = 262/319 (82%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFF-AQINAASVRALVVNAFVGAD  941
             ME+IGVLMACPMN YLE +L  RFNL +FW   D   F  AQ N  ++RA+V NA  GAD
Sbjct  1     MESIGVLMACPMNTYLEQELERRFNLFKFWTVSDKTQFLKAQQN--NIRAVVGNATAGAD  58

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+S++SVGLDKVD+AKCKEKG+RVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  59    A--ELIDALPKLEIVSSFSVGLDKVDVAKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVL  116

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E DR+V+ G WK     ++ T++F+GK+VGIIGLGRIG+A+AKRAEAF+C I+Y+S
Sbjct  117   RRLCESDRYVRSGKWKKG--DYKLTTKFTGKTVGIIGLGRIGMAVAKRAEAFSCPINYYS  174

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K N  YKYYP+V+ELASNC ILVVAC LT ET HIINR+VID+LGP GV+INI RG 
Sbjct  175   RTEKPNLKYKYYPSVVELASNCHILVVACPLTEETRHIINREVIDALGPKGVLINIGRGP  234

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFE+EP V EELFG++NVVL+PH G  TVETR  MADL
Sbjct  235   HVDERELLSALVEGRLGGAGLDVFENEPHVPEELFGLENVVLMPHVGSGTVETRKTMADL  294

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAHF+NKPLLT VV
Sbjct  295   VLGNLEAHFLNKPLLTPVV  313



>ref|XP_006465618.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Citrus sinensis]
 gb|KDO56913.1| hypothetical protein CISIN_1g021388mg [Citrus sinensis]
Length=313

 Score =   422 bits (1085),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 261/319 (82%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFF-AQINAASVRALVVNAFVGAD  941
             ME+IGVLMACPMN YLE +L  RFNL +FW   D   F  AQ N  ++RA+V NA  GAD
Sbjct  1     MESIGVLMACPMNTYLEQELERRFNLFKFWTVSDKTQFLKAQQN--NIRAVVGNATAGAD  58

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+S++SVGLDKVD+ KCKEKG+RVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  59    A--ELIDALPKLEIVSSFSVGLDKVDMVKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVL  116

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E DR+V+ G WK     ++ T++F+GK+VGIIGLGRIG+A+AKRAEAF+C I+Y+S
Sbjct  117   RRLCESDRYVRSGKWKKG--DYKLTTKFTGKTVGIIGLGRIGMAVAKRAEAFSCPINYYS  174

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K N  YKYYP+V+ELASNC ILVVAC LT ET HIINR+VID+LGP GV+INI RG 
Sbjct  175   RTEKPNLKYKYYPSVVELASNCHILVVACPLTEETRHIINREVIDALGPKGVLINIGRGP  234

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFE+EP V EELFG++NVVL+PH G  TVETR  MADL
Sbjct  235   HVDERELVSALVEGRLGGAGLDVFENEPHVPEELFGLENVVLMPHVGSGTVETRKTMADL  294

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAHF+NKPLLT VV
Sbjct  295   VLGNLEAHFLNKPLLTPVV  313



>gb|AHB63232.1| hydroxyphenylpyruvate reductase [Scutellaria baicalensis]
Length=313

 Score =   421 bits (1083),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/318 (70%), Positives = 259/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M+ IGVLM CPMN YLE +L  RF L R+W  P    F +Q  A S+RA+V NAF GAD 
Sbjct  1     MDAIGVLMMCPMNNYLEQELDKRFKLFRYWTQPRQRDFLSQ-QAESIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDKVDL KCKEKGIRVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --ELIDVLPKLEIVSSFSVGLDKVDLIKCKEKGIRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D+FV++G W      F+ T++FSGK VGIIGLGRIGLA+A+RA AF+C ISY SR
Sbjct  118   RICECDKFVRRGQWSSG--DFKLTTRFSGKRVGIIGLGRIGLAVAQRAVAFDCPISYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTN+KYY TV+ELASNC ILVVACALTPET HI+NR+VI++LGPNGV+INI RG H
Sbjct  176   SEKPNTNFKYYGTVVELASNCDILVVACALTPETRHIVNREVINALGPNGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL EGRLGGAG+DVFE EPEV E+LFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEPELVSALAEGRLGGAGIDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFASKPLLTPVV  313



>ref|XP_004166835.1| PREDICTED: LOW QUALITY PROTEIN: glyoxylate/hydroxypyruvate reductase 
A HPR2-like [Cucumis sativus]
Length=346

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMNAYLE +L  RFNL +FW FP    F  + +  S+RA+V NA  GAD 
Sbjct  34    MESIGVLMTCPMNAYLEGELQKRFNLYKFWQFPQKTQFLTE-HCNSIRAVVGNASAGADA  92

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLI+AVLR
Sbjct  93    --TLIDALPKLEIVSSFSVGLDKIDLKKCKEKGIRVTNTPDVLTEDVADLAIGLIIAVLR  150

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK+ +++   T++FSGKSVGIIGLGRIGLAIAKRAEAFNC ISY+SR
Sbjct  151   RLCECDRYVRSGKWKIGNYKL--TTKFSGKSVGIIGLGRIGLAIAKRAEAFNCPISYYSR  208

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +T YKYY  ++ELASN  IL+VACALT ETHHI+NR+VID+LGP GV+INI RG H
Sbjct  209   TKKEDTKYKYYSNLLELASNSDILIVACALTKETHHIVNREVIDALGPKGVLINIGRGPH  268

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++ALVEGRLGGAGLDVFE+EPEV +ELF ++NVVL+PH G  TVETR  MADLV
Sbjct  269   VDEPELVAALVEGRLGGAGLDVFENEPEVPQELFALENVVLVPHIGSGTVETRKEMADLV  328

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLE+HF NKPLLT VV
Sbjct  329   LXNLESHFSNKPLLTPVV  346



>gb|EYU21462.1| hypothetical protein MIMGU_mgv1a008651mg [Erythranthe guttata]
 gb|EYU21463.1| hypothetical protein MIMGU_mgv1a008651mg [Erythranthe guttata]
Length=367

 Score =   422 bits (1086),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 226/320 (71%), Positives = 260/320 (81%), Gaps = 6/320 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
              M+ +GVLM CPMN YLE +L  RF L R+WN P    F  Q  A S+RA+V NA  GAD
Sbjct  53    KMDAVGVLMMCPMNNYLEQELDKRFKLFRYWNQPQQREFLTQ-QADSIRAVVGNATAGAD  111

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  112   A--GLIDALPKLEIVSSFSVGLDKIDLIKCKEKGIRVTNTPDVLTDDVADLAIGLMLAVL  169

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E D++V+KG WK     F+ TS+FSGK VGIIGLGRIGLAIAKRAE F+C ISY+S
Sbjct  170   RRICECDKYVRKGAWKFG--DFKLTSKFSGKRVGIIGLGRIGLAIAKRAEGFDCPISYYS  227

Query  580   RSQKLNT-NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             RS+K N  NYKY+ +V+ELASNC ILVVACALTPET HI+NR+VID+LGP+GV+INI RG
Sbjct  228   RSEKPNAENYKYHKSVVELASNCDILVVACALTPETTHIVNREVIDALGPSGVLINIGRG  287

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
              HVDE EL+SALVEGRLGGAGLDVFE EPEV E+LFG+DNVVLLPH G  TVETR AMAD
Sbjct  288   PHVDEPELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLDNVVLLPHVGSGTVETRIAMAD  347

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEA+F NKPLLT VV
Sbjct  348   LVLGNLEAYFANKPLLTPVV  367



>ref|XP_004141766.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cucumis 
sativus]
 gb|KGN45382.1| hypothetical protein Csa_7G446970 [Cucumis sativus]
Length=346

 Score =   421 bits (1083),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMNAYLE +L  RFNL +FW FP    F  + +  S+RA+V NA  GAD 
Sbjct  34    MESIGVLMTCPMNAYLEGELQKRFNLYKFWQFPQKTQFLTE-HCNSIRAVVGNASAGADA  92

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLI+AVLR
Sbjct  93    --TLIDALPKLEIVSSFSVGLDKIDLKKCKEKGIRVTNTPDVLTEDVADLAIGLIIAVLR  150

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK+ +++   T++FSGKSVGIIGLGRIGLAIAKRAEAFNC ISY+SR
Sbjct  151   RLCECDRYVRSGKWKIGNYKL--TTKFSGKSVGIIGLGRIGLAIAKRAEAFNCPISYYSR  208

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +T YKYY  ++ELASN  IL+VACALT ETHHI+NR+VID+LGP GV+INI RG H
Sbjct  209   TKKEDTKYKYYSNLLELASNSDILIVACALTKETHHIVNREVIDALGPKGVLINIGRGPH  268

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++ALVEGRLGGAGLDVFE+EPEV +ELF ++NVVL+PH G  TVETR  MADLV
Sbjct  269   VDEPELVAALVEGRLGGAGLDVFENEPEVPQELFALENVVLVPHIGSGTVETRKEMADLV  328

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLE+HF NKPLLT VV
Sbjct  329   LGNLESHFSNKPLLTPVV  346



>gb|AAZ67354.1| putative hydroxyphenylpyruvate reductase [Salvia miltiorrhiza]
Length=313

 Score =   419 bits (1078),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN+YLE +L  RF L R+W  P    F AQ  A S+RA+V N+  GAD 
Sbjct  1     MEAIGVLMLCPMNSYLEQELDKRFKLFRYWTQPKQREFLAQ-QAESIRAIVGNSNSGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
              D+ ID LP LEI+S++SVGLD++DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    -DI-IDSLPKLEIVSSFSVGLDRIDLLKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V+ G WK+    F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRSGAWKLG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+V+D+LGP GV+INI RG H
Sbjct  176   SKKANTNYTYYGSVVELASNSDILVVACALTPETTHIVNREVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  MADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>gb|AJA31668.1| 4-hydroxyphenylpyruvate reductase [Salvia miltiorrhiza]
Length=313

 Score =   419 bits (1078),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN+YLE +L  RF L R+W  P    F AQ  A S+RA+V N+  GAD 
Sbjct  1     MEAIGVLMMCPMNSYLEQELDKRFKLFRYWTQPKQREFLAQ-QAESIRAIVGNSNSGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
              D+ ID LP LEI+S++SVGLD++DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    -DI-IDSLPKLEIVSSFSVGLDRIDLLKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V+ G WK+    F+ T++FSGK VGIIGLGRIGLAIA+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRSGAWKLG--DFKLTTKFSGKRVGIIGLGRIGLAIAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+V+D+LGP GV+IN+ RG H
Sbjct  176   SKKANTNYTYYGSVVELASNSDILVVACALTPETTHIVNREVMDALGPKGVLINVGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  MADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>gb|ADM48810.1| hydroxyphenylpyruvate reductase [Perilla frutescens]
Length=313

 Score =   418 bits (1075),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 258/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN YLE +L  RF L R+W  P    F  Q  A S+RA+V N+ VGAD 
Sbjct  1     MEAIGVLMMCPMNNYLEQELDKRFKLFRYWTQPRQREFLTQ-QAESIRAVVGNSTVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S +SVGLDKVDL KCKEKGIRV+NTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --ELIDALPKLEIVSCFSVGLDKVDLIKCKEKGIRVSNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V++G WK     F+ T++FSGK +GIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRRGAWKFG--DFKLTTKFSGKRIGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+VID+LGP GV+INI RG H
Sbjct  176   SKKPNTNYTYYSSVVELASNSDILVVACALTPETTHIVNREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVFEREPEVPEQLFGLENVVLLPHVGSGTVETRKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>gb|ABR67588.1| putative hydroxyphenylpyruvate reductase [Salvia miltiorrhiza]
Length=313

 Score =   417 bits (1072),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN+YLE +L  RF L R+W  P    F AQ  A S+RA+V N+  GAD 
Sbjct  1     MEAIGVLMMCPMNSYLEQELDKRFKLFRYWTQPKQREFLAQ-QAESIRAIVGNSTSGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
              D+ ID LP LEI+S++SVGLD++DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    -DI-IDSLPKLEIVSSFSVGLDRIDLLKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V+ G WK+    F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRSGAWKLG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+V+D+LGP GV+INI RG H
Sbjct  176   SKKANTNYTYYGSVVELASNSDILVVACALTPETTHIVNREVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALV+GRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  +ADLV
Sbjct  236   VDEAELVSALVKGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKVIADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>ref|XP_004252344.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum lycopersicum]
Length=313

 Score =   417 bits (1071),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 266/318 (84%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLMACPM++YLE QL NRFNL+R+WNF D   F     A S+RA+V NA  GAD 
Sbjct  1     MESIGVLMACPMSSYLEQQLDNRFNLIRYWNFSDKKQFINDY-AHSIRAVVGNAAAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILAVLR
Sbjct  60    --ELIEALPQLEIVASFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLILAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+VKKGLWK     F  TS+FSGK VGIIGLGRIGLAIAKRAEAF+C ISY++R
Sbjct  118   RICESDRYVKKGLWKAG--DFALTSKFSGKRVGIIGLGRIGLAIAKRAEAFDCPISYYAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYYPTV+ELA+NC+ILVVACALTPET +++NR+VID+LG  G++INI RG H
Sbjct  176   SEKTNTNYKYYPTVVELATNCEILVVACALTPETRYVVNREVIDALGAKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE E++S+L++GRLGGAGLDVFE+EPEV + LFG++NVVLLPH    T ETR +MAD+V
Sbjct  236   VDEKEMVSSLLDGRLGGAGLDVFENEPEVPDNLFGLENVVLLPHVASGTEETRESMADIV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   IGNLEAHFQNKPLLTPVV  313



>ref|XP_006359456.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum tuberosum]
Length=313

 Score =   417 bits (1071),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/318 (70%), Positives = 267/318 (84%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLMACPM++YLE QL NRFNL+R+WNF D   F     A S+RA+V NA  GAD 
Sbjct  1     MESIGVLMACPMSSYLEQQLDNRFNLIRYWNFSDKKQFINNY-AHSIRAVVGNAAAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    --ELIEALPQLEIVTSFSVGLDKIDLNKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+VKKGLWK     F+ TS+FSGK VGIIGLGRIGLAIAKRAEAF+C ISY++R
Sbjct  118   RICESDRYVKKGLWKAG--DFELTSKFSGKRVGIIGLGRIGLAIAKRAEAFDCPISYYAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YYPTV+ELA+NC+ILVVACALTPET +I+NR+VI +LGP G++INI RG H
Sbjct  176   SEKANTNYNYYPTVVELATNCEILVVACALTPETRYIVNREVIYALGPKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE E++SAL++GRLGGAGLDVFE+EPEV ++LFG++NVVLLPH    T ETR +MAD+V
Sbjct  236   VDEKEMVSALLDGRLGGAGLDVFENEPEVPDKLFGLENVVLLPHVASGTEETRESMADIV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   IGNLEAHFQNKPLLTPVV  313



>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus 
Blu
 pdb|3BAZ|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus 
Blumei In Complex With Nadp+
Length=333

 Score =   417 bits (1072),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 222/319 (70%), Positives = 256/319 (80%), Gaps = 5/319 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             HME IGVLM CPM+ YLE +L  RF L R+W  P    F A + A S+RA+V N+  GAD
Sbjct  20    HMEAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLA-LQAESIRAVVGNSNAGAD  78

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+S++SVGLDKVDL KC+EKG+RVTNTPDVLTDDVAD+AIGLILAVL
Sbjct  79    A--ELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVL  136

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E D++V++G WK     F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C ISY S
Sbjct  137   RRICECDKYVRRGAWKFG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFS  194

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K NTNY YY +V+ELASN  ILVVAC LTPET HIINR+VID+LGP GV+INI RG 
Sbjct  195   RSKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGP  254

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  MADL
Sbjct  255   HVDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADL  314

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF  KPLLT VV
Sbjct  315   VVGNLEAHFSGKPLLTPVV  333



>ref|XP_004302898.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   415 bits (1067),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 212/318 (67%), Positives = 259/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVL+  PM+ YLE +L  RFNLL+ W  P    F    +AAS+RA+V NA  GAD 
Sbjct  1     MESIGVLLPIPMSPYLEQELEKRFNLLKLWTAPHKTQFIKD-HAASIRAIVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YSVG+DKVDL  CKEKG+RVTNTPDVLTDDVADIAIGL LAV+R
Sbjct  60    --ELIDSLPKLEIVASYSVGIDKVDLKYCKEKGVRVTNTPDVLTDDVADIAIGLTLAVMR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ GLWK     ++ T++F+GK+VGIIGLGRIG AIAKRAEAF+C I+Y +R
Sbjct  118   RLCESDRYVRSGLWKKG--DYKLTTKFTGKTVGIIGLGRIGKAIAKRAEAFSCPIAYFTR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELAS+C +LVVAC LT ETHH+INR+VID+LGP GV+INI RG H
Sbjct  176   TEKPDLKYKYYPTVVELASHCDVLVVACPLTEETHHVINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDV+++EP V E+LFG++NVVLLPH G AT ETRNAMADLV
Sbjct  236   VDEPELVSALLEGRLGGAGLDVYQNEPNVPEQLFGLENVVLLPHVGSATTETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   IGNLEAHFLNKPLLTPVV  313



>ref|XP_010691338.1| PREDICTED: hydroxyphenylpyruvate reductase isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=313

 Score =   415 bits (1066),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 258/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVL+ACPMN+YLE +L+ R+NL RFWN PD   F +  +A S+RA+V NA  GAD 
Sbjct  1     MESIGVLLACPMNSYLEEELNKRYNLFRFWNIPDRTQFLSH-HANSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --SLIDALPKLEIVASFSVGLDKIDLGKCKERGIRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI + DR+V+ GLWK     FQ T++FSGK VGIIGLGRIG A+AKRAEAF+C ISY SR
Sbjct  118   KIPQCDRYVRNGLWKKG--DFQLTTRFSGKKVGIIGLGRIGAAVAKRAEAFDCPISYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +++Y YYP+V+ELASNC ILVVACALT ET HI+NR+V+D+LGP GV+INI RG H
Sbjct  176   TKKSDSSYTYYPSVVELASNCDILVVACALTAETRHIVNREVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGR+ GAGLDVFE+EP V EE+F +DNVVLLPH    TVETR  MA+LV
Sbjct  236   VDEPELVKALAEGRIAGAGLDVFENEPHVPEEMFKLDNVVLLPHVASGTVETRTDMANLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF  KPLLT VV
Sbjct  296   LGNLEAHFSAKPLLTPVV  313



>ref|XP_011010519.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Populus 
euphratica]
Length=314

 Score =   414 bits (1065),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 262/319 (82%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPM-NAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CP  + YL  QL  RF L +F + PD  A F   N AS+RA+V NA  GAD
Sbjct  1     MESIGVLMTCPPPDPYLVEQLEKRFTLFKFHSIPDK-AQFLNSNKASIRAVVGNASAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I +LPNLEI+S++SVGLDK+DLAKC+EKGIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  60    AQ--LIHQLPNLEIVSSFSVGLDKIDLAKCREKGIRVTNTPDVLTDDVADLAIGLMLAVL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ + DR+V+ G WK     ++ T++F+GKSVGIIGLGRIGLAIAKRAEAF+C ISYH+
Sbjct  118   RRLCQSDRYVRSGQWKRG--DYKLTTKFTGKSVGIIGLGRIGLAIAKRAEAFSCPISYHT  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K +  YKYYP+V+ELA+NCQILVVACALT ET HIINR+VI++LGP GV+IN+ RG 
Sbjct  176   RTEKSDVKYKYYPSVVELATNCQILVVACALTEETRHIINREVINALGPKGVLINVGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVF+DEP V EELFG++NVVLLPH G  TVETR  MADL
Sbjct  236   HVDEPELVSALVEGRLGGAGLDVFQDEPNVPEELFGLENVVLLPHVGSGTVETRKEMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+NKPLLT V+
Sbjct  296   VVGNLEAHFLNKPLLTPVL  314



>sp|Q65CJ7.2|HPPR_PLESU RecName: Full=Hydroxyphenylpyruvate reductase; Short=HPPR [Solenostemon 
scutellarioides]
 emb|CAD47810.2| hydroxyphenylpyruvate reductase (HPPR) [Solenostemon scutellarioides]
Length=313

 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPM+ YLE +L  RF L R+W  P    F A + A S+RA+V N+  GAD 
Sbjct  1     MEAIGVLMMCPMSTYLEQELDKRFKLFRYWTQPAQRDFLA-LQAESIRAVVGNSNAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDKVDL KC+EKG+RVTNTPDVLTDDVAD+AIGLILAVLR
Sbjct  60    --ELIDALPKLEIVSSFSVGLDKVDLIKCEEKGVRVTNTPDVLTDDVADLAIGLILAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V++G WK     F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C ISY SR
Sbjct  118   RICECDKYVRRGAWKFG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPISYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVAC LTPET HIINR+VID+LGP GV+INI RG H
Sbjct  176   SKKPNTNYTYYGSVVELASNSDILVVACPLTPETTHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  MADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVFEREPEVPEKLFGLENVVLLPHVGSGTVETRKVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  KPLLT VV
Sbjct  296   VGNLEAHFSGKPLLTPVV  313



>gb|ABC02200.1| putative hydroxyphenylpyruvate reductase [Salvia miltiorrhiza]
Length=313

 Score =   413 bits (1062),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 217/318 (68%), Positives = 261/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN+YLE +L  RF L R+W  P    F AQ  A S+RA+V N+  GAD 
Sbjct  1     MEAIGVLMMCPMNSYLEQELDKRFKLFRYWTQPKQREFLAQ-QAESIRAIVGNSTSGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
              D+ ID LP LEI+S++SVGLD++DL KCKEKGIRVTNTPDVLT+DVAD+AIGL+LAVLR
Sbjct  60    -DI-IDSLPKLEIVSSFSVGLDRIDLLKCKEKGIRVTNTPDVLTEDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V+ G WK+    F+ T++FS K VGIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRSGAWKLG--DFKLTTKFSVKRVGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+V+D+LGP GV+INI RG H
Sbjct  176   SKKANTNYTYYGSVVELASNSDILVVACALTPETTHIVNREVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALV+GRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR  +ADLV
Sbjct  236   VDEAELVSALVKGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKVIADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF +KPLLT VV
Sbjct  296   LGNLEAHFSSKPLLTPVV  313



>ref|XP_007215716.1| hypothetical protein PRUPE_ppa008942mg [Prunus persica]
 gb|EMJ16915.1| hypothetical protein PRUPE_ppa008942mg [Prunus persica]
Length=313

 Score =   412 bits (1060),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 212/318 (67%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++IGVLM  PM+ YLE +L  RFNLL+ W  P    F    ++ S+RA+V NA  GAD 
Sbjct  1     MDSIGVLMPVPMSPYLEQELEKRFNLLKLWTVPQKTQFLKD-HSGSIRAVVGNAGNGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIETLPKLEIVSSFSVGIDKVDLNKCREKGIRVTNTPDVLTDDVADLAIGLALAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     ++ T++F+GK+VGI+GLGRIG A+AKRAEAF+C ISYHSR
Sbjct  118   RLCESDRYVRSGQWKKG--DYKLTTKFTGKTVGILGLGRIGKAVAKRAEAFSCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYP V+ELASNC ILVV CALT ET HIINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPELKYKYYPCVVELASNCDILVVVCALTEETRHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDV+E EPEV E+LFG++NVVLLPH G  TVETRN MADLV
Sbjct  236   VDEPELVSALLEGRLGGAGLDVYEKEPEVPEQLFGLENVVLLPHVGSGTVETRNVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF+ KPLLT VV
Sbjct  296   VENLEAHFLKKPLLTPVV  313



>gb|ABK96235.1| unknown [Populus trichocarpa x Populus deltoides]
Length=314

 Score =   412 bits (1060),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 261/319 (82%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACP-MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CP  + YL  QL  RF L +F + PD  A F   N AS+RA+V NA  GAD
Sbjct  1     MESIGVLMTCPPFDPYLVEQLEKRFTLFKFHSIPDK-AHFLNSNKASIRAVVGNASAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I +LPNLEI+S++SVGLDK+DLAKC+E+GIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  60    AQ--LIHQLPNLEIVSSFSVGLDKIDLAKCRERGIRVTNTPDVLTDDVADLAIGLMLAVL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++   DR+V+ G WK     ++ T++F+GKSVGIIGLGRIGLAIAKRAEAF+C ISYH+
Sbjct  118   RRLCPSDRYVRSGQWKRG--DYKLTTKFTGKSVGIIGLGRIGLAIAKRAEAFSCPISYHT  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K +  YKYYP+V+ELA+NCQILVVACALT ET HIINR+VI++LGP GV+INI RG 
Sbjct  176   RAEKSDVKYKYYPSVVELAANCQILVVACALTEETRHIINREVINALGPKGVLINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVF+DEP V EELFG++NVVLLPH G  T+ETR  MADL
Sbjct  236   HVDEPELVSALVEGRLGGAGLDVFQDEPNVPEELFGLENVVLLPHVGSGTMETRKEMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+NKPLLT V+
Sbjct  296   VVGNLEAHFLNKPLLTPVL  314



>ref|XP_007215717.1| hypothetical protein PRUPE_ppa008942mg [Prunus persica]
 gb|EMJ16916.1| hypothetical protein PRUPE_ppa008942mg [Prunus persica]
Length=313

 Score =   412 bits (1058),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 257/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PM++YLE +L  RFNLL+ W  P    F    +++S+RA+V NA  GAD 
Sbjct  1     MESIGVLMPAPMSSYLEQELEKRFNLLKLWTVPQKPQFLKD-HSSSIRAVVGNAGNGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I++LP LEI++++SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIEKLPKLEIVASFSVGVDKVDLNKCREKGIRVTNTPDVLTDDVADLAIGLTLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     ++ T++F+GK+VGIIGLGRIG A+AKRAE F+C I+Y+SR
Sbjct  118   RLCECDRYVRSGQWKKG--DYKLTTKFTGKTVGIIGLGRIGKAVAKRAEGFSCPIAYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K    YKYYP+V+ELASNC +LVVAC LT ET HI+NR+VID+LGP GV+INI RG H
Sbjct  176   TAKPELKYKYYPSVVELASNCDVLVVACPLTEETRHIVNREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDV+E EPEV E+LFG++NVVLLPH G  TVETRN MADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVYEKEPEVPEQLFGLENVVLLPHVGSGTVETRNVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF+ KPLLT VV
Sbjct  296   VENLEAHFLKKPLLTPVV  313



>ref|XP_002516028.1| glycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF46448.1| glycerate dehydrogenase, putative [Ricinus communis]
Length=314

 Score =   411 bits (1057),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 259/319 (81%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACP-MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVLM CP +  YL  QL  RF L +F N PD   F    +  S+RA+V NA  GAD
Sbjct  1     MESVGVLMTCPPIYPYLIEQLEKRFTLYQFQNVPDKTQFLNS-HKNSIRAVVGNAGFGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID+LP LEI+S+YSVGLDKVDLAKCK KGIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  60    A--ELIDQLPKLEIVSSYSVGLDKVDLAKCKGKGIRVTNTPDVLTDDVADLAIGLMLAVL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E DR+V+ G W+     ++ T++F+GKSVGIIGLGRIG+AIAKRAEAF+C ISY +
Sbjct  118   RRLCESDRYVRSGQWRKG--DYKLTTKFTGKSVGIIGLGRIGMAIAKRAEAFSCPISYFA  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K +  YKYYP+V+ELA+NCQILVVACALT ETHHI+NR+VI++LGP GV+INI RG 
Sbjct  176   RSEKPDMKYKYYPSVVELAANCQILVVACALTEETHHIVNREVINALGPKGVLINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGAGLDVFEDEP V E+LF ++NVVLLPH G  TVETR AMADL
Sbjct  236   HVDEPELVSALLEGRLGGAGLDVFEDEPNVPEQLFSLENVVLLPHVGSGTVETRTAMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+NKPLLT VV
Sbjct  296   VVGNLEAHFLNKPLLTPVV  314



>ref|XP_010318542.1| PREDICTED: hydroxyphenylpyruvate reductase-like isoform X1 [Solanum 
lycopersicum]
Length=315

 Score =   411 bits (1056),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 259/319 (81%), Gaps = 5/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSD-AFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CPM+ YLE +L  RFN LR W FP++  + F ++++ S+R +V NA +GA+
Sbjct  1     MESIGVLMTCPMSPYLEQELDKRFNFLRLWKFPENQKSHFLKLHSDSIRGVVGNATIGAN  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I  LP LEI+S+YSVGLDK+DL  CKEKGI+V   PD++TDD AD  + LILAVL
Sbjct  61    --AELIGALPKLEIVSSYSVGLDKIDLGLCKEKGIKVAYCPDLITDDAADTGVALILAVL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I + D +VK GLWK  +  F  TS+FSGKSVGIIGLGRIGLAIAKRAEAF C ISY++
Sbjct  119   RRICQCDSYVKNGLWK--NGDFMLTSKFSGKSVGIIGLGRIGLAIAKRAEAFGCPISYYT  176

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K NTNYKYYP+V+ELASNCQILVVACALTPET HI+NR+V+++LG  G++INI RG 
Sbjct  177   RSEKPNTNYKYYPSVVELASNCQILVVACALTPETRHIVNREVMEALGSKGILINIGRGP  236

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGAGLDVFE+EPEV E+LFG++NVVLLPH G  T ETR AMADL
Sbjct  237   HVDEKELVSALLEGRLGGAGLDVFENEPEVPEQLFGLENVVLLPHVGSGTEETRKAMADL  296

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAHF+NKPLLT VV
Sbjct  297   VLGNLEAHFLNKPLLTPVV  315



>ref|XP_003632860.1| PREDICTED: hydroxyphenylpyruvate reductase [Vitis vinifera]
 emb|CAN84153.1| hypothetical protein VITISV_025327 [Vitis vinifera]
Length=313

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 263/318 (83%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVL+ CPMN YLE +L  RF L RFW+FP ++  F + ++ S+RA+V N+F+GAD 
Sbjct  1     MESIGVLLTCPMNPYLEQELDKRFKLFRFWDFPSANDLFRE-HSNSIRAVVGNSFIGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP +EI+S++SVGLDK+DL +CKEKGIRVTNTPDVLT+DVAD+A+ LILA LR
Sbjct  60    Q--MIEALPKMEIVSSFSVGLDKIDLVRCKEKGIRVTNTPDVLTEDVADLALALILATLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+ G WK     F+ T++F+GKSVGIIGLGRIG AIAKRAE F+C ISYHSR
Sbjct  118   RICESDRYVRSGSWKKG--DFKLTTKFTGKSVGIIGLGRIGSAIAKRAEGFSCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K  TNYKYYP+V+ELASNCQILVVACALTPET HIINR+VI++LGP GVVINI RG H
Sbjct  176   TEKPGTNYKYYPSVVELASNCQILVVACALTPETRHIINREVINALGPKGVVINIGRGLH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE+EP V EEL  +DNVVLLPH G  TVETR  MADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVFENEPNVPEELLAMDNVVLLPHVGSGTVETRKDMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   LGNLEAHFLNKPLLTPVV  313



>ref|XP_009353612.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Pyrus 
x bretschneideri]
Length=313

 Score =   410 bits (1054),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/317 (67%), Positives = 256/317 (81%), Gaps = 5/317 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PM+ YLE +L  RFNLL+ W  P    F    ++AS+RA+V NA  GAD 
Sbjct  1     MESIGVLMPIPMSPYLEQELEKRFNLLKLWTVPHKTQFIKD-HSASIRAIVGNASAGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVG+DKVDL  CKEKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  59    -GELIAALPKLEIISSFSVGIDKVDLKTCKEKGIRVTNTPDVLTDDVADLAIGLTLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E +R+V+ G WK     ++ T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y SR
Sbjct  118   RLCESERYVRSGQWKKG--DYKLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K ++ +KYYPTV+ELA+NC +LVVAC LT ET HIINRQVI++LGP GV+INI RG H
Sbjct  176   TEKPDSKFKYYPTVVELAANCDVLVVACPLTEETRHIINRQVINALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDV+E+EPEV E+LF ++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEAELVSALVEGRLGGAGLDVYENEPEVPEQLFALENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRV  167
             V NLEAHF+ KPLLT V
Sbjct  296   VGNLEAHFLKKPLLTPV  312



>ref|XP_002304205.2| oxidoreductase family protein [Populus trichocarpa]
 gb|EEE79184.2| oxidoreductase family protein [Populus trichocarpa]
Length=314

 Score =   410 bits (1054),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 261/319 (82%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACP-MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CP  + YL  QL  RF L +F + PD  A F   N AS+RA+V NA  GAD
Sbjct  1     MESIGVLMTCPPFDPYLVEQLEKRFTLFKFHSIPDK-AHFLNSNKASIRAVVGNASAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I +LPNLEI+S++SVG+DK+DLAKC+E+GIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  60    AQ--LIHQLPNLEIVSSFSVGIDKIDLAKCRERGIRVTNTPDVLTDDVADLAIGLMLAVL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++   DR+V+ G WK     ++ T++F+GKSVGIIGLGRIGLAIAKRAEAF+C ISYH+
Sbjct  118   RRLCPSDRYVRSGQWKRG--DYKLTTKFTGKSVGIIGLGRIGLAIAKRAEAFSCPISYHT  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K +  YKYYP+V+ELA+NCQILVVACALT ET HIINR+VI++LGP GV+INI RG 
Sbjct  176   RAEKSDVKYKYYPSVVELAANCQILVVACALTEETRHIINREVINALGPKGVLINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVF+DEP V EELFG++NVVLLPH G  T+E+R  MADL
Sbjct  236   HVDEPELVSALVEGRLGGAGLDVFQDEPNVPEELFGLENVVLLPHVGSGTMESRKEMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+NKPLLT V+
Sbjct  296   VVGNLEAHFLNKPLLTPVL  314



>ref|XP_009626855.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana tomentosiformis]
Length=313

 Score =   409 bits (1051),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 221/318 (69%), Positives = 262/318 (82%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLMAC M++YLE +L  R+NLL +WNF D   F  +  A  +RA+V NA  GAD 
Sbjct  1     METIGVLMACSMSSYLEQELDKRYNLLHYWNFSDKKEFLNEY-AHLIRAVVGNAAAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --ELIEALPKLEIVSSFSVGLDKIDLNKCKEKGIRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+VKKGLWK     F+ TS+FSGK+VGIIGLGRIGLAIAKRAEAF C ISY++R
Sbjct  118   RICECDRYVKKGLWKAG--DFKLTSKFSGKTVGIIGLGRIGLAIAKRAEAFGCLISYYAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K +T YKYYPTV+ELA+NC+ILVVACALTPETH+I+NR+VID+LG  G++INI RG H
Sbjct  176   SEKPDTTYKYYPTVVELATNCEILVVACALTPETHYIVNRKVIDALGAKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL +GRLGGAGLDVFE+EPEV E+LFG++NVVLLPH    T ETR  MAD+V
Sbjct  236   VDEKELVSALFDGRLGGAGLDVFENEPEVPEQLFGLENVVLLPHVASGTEETRKEMADIV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   IGNLEAHFQNKPLLTPVV  313



>ref|XP_009784627.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana sylvestris]
Length=313

 Score =   408 bits (1048),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME +GVLM CPM +YLE QL+ RFNL RFW  P+   F  Q N  SVRA+V NAF GAD 
Sbjct  1     MEKMGVLMTCPMFSYLEEQLNKRFNLFRFWLTPNKAEFLTQ-NGDSVRAVVGNAFFGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LPNLEI+STYSVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD AIGL L  LR
Sbjct  59    -SELIGALPNLEIVSTYSVGLDKIDLGKCKERGIRVTNTPDVLTDDVADTAIGLALTTLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D FV++GLWK  +  F+ T++FSGK VGIIGLGRIG AIAKRAEAF C ISYHSR
Sbjct  118   KICVADGFVRRGLWK--NGDFELTTKFSGKLVGIIGLGRIGSAIAKRAEAFGCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K N NYKYY TV++LA+N +IL+VACALT ET HI+ R+V+D+LGP G++INI RG H
Sbjct  176   SKKPNINYKYYSTVVDLAANSEILIVACALTEETRHIVTRKVLDALGPKGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL++AL+EGR+GGAGLDV++ EPEV E+LFG++NVVLL H    TVET  AMADLV
Sbjct  236   VDESELVAALIEGRIGGAGLDVYQTEPEVPEQLFGLENVVLLSHAASDTVETCTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
               NLEAHF++KPLLT V+
Sbjct  296   AANLEAHFLHKPLLTPVL  313



>ref|XP_008228554.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Prunus 
mume]
Length=388

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PM++YLE +L  RFNLL+ W  P    F    ++ S+RA V NA  GAD 
Sbjct  76    MESIGVLMPAPMSSYLEQELEKRFNLLKLWTVPQKTQFLKD-HSGSIRAFVGNAGNGADA  134

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I++LP LEI++ +SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  135   --ELIEKLPKLEIVACFSVGVDKVDLNKCREKGIRVTNTPDVLTDDVADLAIGLTLAVLR  192

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     ++ T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y+SR
Sbjct  193   RLCECDRYVRSGQWKKG--DYKLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYYSR  250

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K    YKYYP+V+ELASNC +LVVAC LT ET HI+NR+VID+LGP GV+INI RG H
Sbjct  251   TAKPEPKYKYYPSVVELASNCDVLVVACPLTEETRHIVNREVIDALGPKGVLINIGRGPH  310

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDV+E EPEV E+LFG++NVVLLPH G  TVETRN MADLV
Sbjct  311   VDEAELVSALVEGRLGGAGLDVYEKEPEVPEQLFGLENVVLLPHVGSGTVETRNVMADLV  370

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF+ KPLLT VV
Sbjct  371   VENLEAHFLKKPLLTPVV  388



>ref|XP_009338036.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Pyrus 
x bretschneideri]
Length=313

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VLM  PM++YLE +L  RFNLL+ W  P+   F    ++AS+RA+V NA  GAD 
Sbjct  1     MESIAVLMPIPMSSYLEQELKKRFNLLKLWTVPNKTQFIKD-HSASIRAIVGNATAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVG+DKVDL  CKEKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIAALPKLEIVSSFSVGMDKVDLKTCKEKGIRVTNTPDVLTDDVADLAIGLTLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK    +++ T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y SR
Sbjct  118   RLCESDRYVRSGQWKEG--EYKLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  +KYYP+V+ELA+NC +LVVAC LT ET HIINRQVI++LGP GV+INI RG H
Sbjct  176   TEKPDLKFKYYPSVVELAANCDVLVVACPLTEETRHIINRQVINALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDV+E EPEV EELF ++NVVLLPH G  TVETR+ MADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVYEKEPEVPEELFALENVVLLPHVGSGTVETRSVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT VV
Sbjct  296   IGNLEAHFLKKPLLTPVV  313



>emb|CDO98028.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   405 bits (1040),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 216/318 (68%), Positives = 252/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             MEN GVLM CPM++YLE QL  RF LL+ W+      F  Q N+  + A+V N  +GAD 
Sbjct  1     MENKGVLMTCPMSSYLEEQLQKRFRLLKLWDSQMKADFLKQ-NSHLISAVVGNTVLGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+S+YSVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD+AIGL LA LR
Sbjct  59    -SELIDSLPNLEIVSSYSVGLDKIDLVKCKERGIRVTNTPDVLTDDVADLAIGLALATLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KIS  D F++ GLWK  +  F  T++FSGKSVGIIGLGRIG AIAKRA+AF C I YHSR
Sbjct  118   KISVADGFLRNGLWK--NSDFGLTTKFSGKSVGIIGLGRIGSAIAKRAKAFGCPIGYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K N NYKYY +VI+LA+NCQILVVACALT ET HI+NR+VID+LGP G++INI RG H
Sbjct  176   SRKPNANYKYYSSVIDLAANCQILVVACALTDETRHIVNREVIDALGPKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDV+E+EPE+ E+LF + NVVLL H G  TVET  AMADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVYENEPEIPEKLFQLQNVVLLSHVGSDTVETCKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT VV
Sbjct  296   LANLEAHFLGKPLLTPVV  313



>ref|XP_010691339.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 257/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVL+ACPMN+YLE +L+ R+NL RFWN PD   F +  +A S+RA+V NA  GAD 
Sbjct  1     MESIGVLLACPMNSYLEEELNKRYNLFRFWNIPDRTQFLSH-HANSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --SLIDALPKLEIVASFSVGLDKIDLGKCKERGIRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI + DR+V+ GLWK     FQ T++F+GKSVGI+GLGRIG AIAKR EAF C +SY SR
Sbjct  118   KIPQCDRYVRNGLWKKG--DFQLTTRFTGKSVGILGLGRIGYAIAKRVEAFGCDVSYCSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K +  Y+YY  V +LA+NC+ILVV+C+LT ET HIINR VID+LGP  ++INI RG H
Sbjct  176   SKKTDVQYRYYENVTDLAANCEILVVSCSLTEETRHIINRGVIDALGPKSILINIGRGSH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             + E E++SAL+EGRLGGAGLDVFE+EP V E+LF +DNVV+L H G  TVET  AMADLV
Sbjct  236   LVETEVVSALLEGRLGGAGLDVFENEPHVPEDLFELDNVVMLSHVGSDTVETCKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             +RNLEAHF+NKPLLT V+
Sbjct  296   IRNLEAHFLNKPLLTPVI  313



>gb|KHG02729.1| Glyoxylate reductase [Gossypium arboreum]
Length=314

 Score =   404 bits (1039),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 254/318 (80%), Gaps = 4/318 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M NIGVLM CPM+ YLE+QL NRF+L + WN       F + +++S++A+V N  +GAD 
Sbjct  1     MNNIGVLMTCPMSEYLENQLENRFSLFKLWNHSSPKPDFLKTHSSSIKAVVGNTKIGADA  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPN+EI+++YSVGLDK+DL KCKEKGI+VTNTPDVLTDDVAD+ IGL LAVLR
Sbjct  61    --NMIDSLPNMEIVASYSVGLDKIDLGKCKEKGIKVTNTPDVLTDDVADLGIGLALAVLR  118

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+   DRFV+ G W   +  F   S+FSGKSVGI+GLGRIG AIAKRAEAFNC+ISYHSR
Sbjct  119   KMCACDRFVRSGNW--INGDFGLASKFSGKSVGIVGLGRIGSAIAKRAEAFNCSISYHSR  176

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYY  +++LA++CQIL VACALT ETHHI+NR+VID+LGP G++INI RG H
Sbjct  177   SKKPNTNYKYYSNIVDLAADCQILFVACALTEETHHIVNRKVIDALGPKGILINIGRGAH  236

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL++GRLGGAGLDV+E+EP V E+LF ++N+VL+PH G  T ET  AMADLV
Sbjct  237   VDEPELVSALLKGRLGGAGLDVYENEPNVPEQLFSLENIVLVPHVGSDTEETSKAMADLV  296

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF   PLLT V+
Sbjct  297   ISNLEAHFKGMPLLTPVL  314



>ref|XP_009626862.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana tomentosiformis]
Length=313

 Score =   404 bits (1038),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 252/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME +GVLM CPM +YLE QL+ RFNL RFW  P+   F  Q N  SVRA+V NAF GAD 
Sbjct  1     MEKMGVLMTCPMFSYLEEQLNKRFNLFRFWLTPNKAEFLTQ-NGDSVRAVVGNAFFGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+STYSVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD AIGL L  LR
Sbjct  59    -SELIDALPNLEIVSTYSVGLDKIDLGKCKERGIRVTNTPDVLTDDVADTAIGLTLTTLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D FV++GLWK  +  F  T++FSGK VGIIGLGRIG AIAKRAEAF C ISYHSR
Sbjct  118   KICVADGFVRRGLWK--NGDFGLTTKFSGKLVGIIGLGRIGSAIAKRAEAFGCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K N NYKYY  V++LA+N +IL+VACALT ET HI+NR+V+++LGP G++INI RG H
Sbjct  176   SKKPNVNYKYYSNVVDLAANSEILIVACALTEETRHIVNRKVLNALGPKGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL++AL+EGR+GGAGLDV++ EP+V E LFG++NVVLL H    TVET  AMADLV
Sbjct  236   VDESELVAALIEGRIGGAGLDVYQTEPDVPERLFGLENVVLLSHAASDTVETCTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEA F++KPLLT V+
Sbjct  296   VANLEAQFLHKPLLTPVL  313



>ref|XP_004302899.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   404 bits (1038),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VL+  PM+ YLE +L  RFNLL+ W  P    F    +AAS+RA+V NA  GAD 
Sbjct  1     MESICVLLPIPMSPYLEQELEKRFNLLKLWTAPHKTQFIKD-HAASIRAIVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YSVG+DKVDL  CKEKG+RVTNTPDVLTDDVADIAIGL LAV+R
Sbjct  60    --ELIDSLPKLEIVASYSVGIDKVDLKYCKEKGVRVTNTPDVLTDDVADIAIGLTLAVMR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ GLWK     F+ T++F+G++VGI+GLGRIG A+A+RAEAF+C I+Y SR
Sbjct  118   RLCESDRYVRSGLWKKG--DFKLTTKFTGQTVGILGLGRIGKAVARRAEAFSCPIAYSSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYPTV+ELAS C +LVVACALT ET +IINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPELKYKYYPTVVELASKCDVLVVACALTEETRYIINREVIDALGPKGVLINIGRGHH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL+EGRLGGAGLDV+++EPEV E+LFG++NVVLLPH G  T ET NAMADLV
Sbjct  236   IDEPELLSALLEGRLGGAGLDVYQNEPEVPEQLFGLENVVLLPHAGSDTTETCNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   IGNLEAHFLNKPLLTPVV  313



>ref|XP_010473017.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Camelina 
sativa]
Length=313

 Score =   404 bits (1037),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 212/318 (67%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNLLRFW  P+   F  + +  S+RA+V NAF GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQKRFNLLRFWTSPEKSVFL-ETHRNSIRAVVGNAFAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL  CK+KGIRVTNTPDVLT+DVAD+AIGLI+A+LR
Sbjct  60    Q--LINDLPKLEIVSSFSVGLDKIDLGICKDKGIRVTNTPDVLTEDVADLAIGLIIALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     F+ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--DFKLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC L+ ET HI+NRQV+D+LGP GV+INI RG H
Sbjct  176   TVKPDVAYKYYPTVVDLAKNSDILVVACPLSDETRHIVNRQVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEKEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  296   VGNLEAHFSGKSLLTPVV  313



>ref|XP_007215715.1| hypothetical protein PRUPE_ppa008934mg [Prunus persica]
 gb|EMJ16914.1| hypothetical protein PRUPE_ppa008934mg [Prunus persica]
Length=313

 Score =   404 bits (1037),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++IGVLM  PM+ YLE +L  RFNLL+ W  P    F    ++ S+RA+V NA  GAD 
Sbjct  1     MDSIGVLMPVPMSPYLEQELEKRFNLLKLWTVPQKTQFLKD-HSGSIRAVVGNAGNGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIETLPKLEIVSSFSVGIDKVDLNKCREKGIRVTNTPDVLTDDVADLAIGLALAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     ++ T++F+GK+VGI+GLGRIG A+AKRAEAF+C ISYHSR
Sbjct  118   RLCESDRYVRSGQWKKG--DYKLTTKFTGKTVGILGLGRIGKAVAKRAEAFSCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYP V+ELASNC ILVV CALT ET HIINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPELKYKYYPCVVELASNCDILVVVCALTEETRHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDV+E+EPEV E+LF ++NVVLLPH G  TV+T  AMADLV
Sbjct  236   VDEPELVSALLEGRLGGAGLDVYENEPEVPEQLFELENVVLLPHVGSDTVQTDTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   IGNLEAHFSNKPLLTPVV  313



>ref|XP_006359457.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum tuberosum]
Length=315

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M  IGVLM CPM +YLE +L+ RF+L RFW       F  Q N+ SVRA+V NAF GA+ 
Sbjct  3     MAKIGVLMTCPMLSYLEEELNKRFDLFRFWEASSKSEFLTQ-NSDSVRAVVGNAFFGAE-  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+S+YSVGLDK+DL KCKE+GIRVTNTPDVLTDDVAD AIGLILA LR
Sbjct  61    -SELIDALPNLEIVSSYSVGLDKIDLVKCKERGIRVTNTPDVLTDDVADAAIGLILATLR  119

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   D FV++GLWK  +  F+ TS+FSGK VGIIGLGRIG AIAKRAEAF C ISYHSR
Sbjct  120   RICVADGFVRRGLWK--NGDFELTSKFSGKLVGIIGLGRIGSAIAKRAEAFGCPISYHSR  177

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S++ N NYKYY TV++LA++ +IL+VACALT ET  I+NR+V+D+LGP G++INI RG H
Sbjct  178   SKRPNLNYKYYSTVVDLAASSEILIVACALTEETRDIVNRKVLDALGPKGILINIGRGAH  237

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL++AL+EGR+GGAGLDV++ EPEV E+LFG++NVVLL H    TVET  AMADLV
Sbjct  238   VDESELVAALIEGRIGGAGLDVYQTEPEVPEQLFGLENVVLLSHAASDTVETCTAMADLV  297

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF++KPLLT V+
Sbjct  298   IANLEAHFLHKPLLTPVL  315



>ref|XP_003604496.1| Glyoxylate reductase [Medicago truncatula]
 gb|AES86693.1| D-glycerate dehydrogenase/hydroxypyruvate reductase [Medicago 
truncatula]
Length=314

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 211/319 (66%), Positives = 257/319 (81%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMAC-PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             M +IGVL+    +  YLE +L+ R+NL R W+FP       Q + AS+RA+V +AF GAD
Sbjct  1     MGSIGVLLVSHQVIPYLEQELNKRYNLFRLWDFPQKSQLLTQ-HGASIRAVVGDAFAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I+ LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLTD+VAD+AIGL+L +L
Sbjct  60    --SDLIEALPKLEIVSSFSVGVDKIDLGKCKEKGIRVTNTPDVLTDEVADLAIGLMLTLL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E DR+V+ G WK  H  ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC ISY+S
Sbjct  118   RRICECDRYVRGGNWK--HGDYKLTTKFSGKTVGIIGLGRIGAAIAKRAEGFNCPISYYS  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R+QK  + YKYYP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG 
Sbjct  176   RTQKQESKYKYYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGFLINIGRGK  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G ATVETR AMADL
Sbjct  236   HVDEPELVSALLEGRLGGAGLDVFENEPHVPEELFGLENVVLLPHVGSATVETRTAMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAHF+ KPLLT +V
Sbjct  296   VLGNLEAHFLGKPLLTPLV  314



>ref|XP_008342684.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Malus 
domestica]
Length=313

 Score =   402 bits (1034),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VLM  PM++YLE +L  RFNLL+ W  P+   F    ++AS+RA+V NA  GAD 
Sbjct  1     MESIAVLMPIPMSSYLEQELEKRFNLLKLWTVPNKTQFIKD-HSASIRAIVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVG+DKVDL  CKEKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIAALPKLEIVSSFSVGIDKVDLKTCKEKGIRVTNTPDVLTDDVADLAIGLTLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     ++ T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y SR
Sbjct  118   RLCESDRYVRSGQWKEG--DYKLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  +KYYP+V+ELA+NC +LVVAC LT ET HIINR+VI++LGP GV+IN+ RG H
Sbjct  176   TEKPDLKFKYYPSVVELAANCDVLVVACPLTEETRHIINREVINALGPKGVLINVGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDV+E EPEV EELF ++NVVLLPH G  TVETR+ MADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVYEKEPEVPEELFALENVVLLPHVGSGTVETRSTMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT VV
Sbjct  296   IGNLEAHFLKKPLLTPVV  313



>ref|XP_009338072.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Pyrus 
x bretschneideri]
Length=313

 Score =   402 bits (1034),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VLM  PM++YLE +L  RFNLL+ W  P+   F    ++AS+RA+V NA  GAD 
Sbjct  1     MESIAVLMPIPMSSYLEQELEKRFNLLKLWTVPNKTQFIKD-HSASIRAIVGNATAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S+ SVG+DKVDL  CKEKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIAALPKLEIVSSSSVGMDKVDLKTCKEKGIRVTNTPDVLTDDVADLAIGLTLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK    +++ T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y SR
Sbjct  118   RLCESDRYVRSGQWKEG--EYKLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  +KYYP+V+ELA+NC +LVVAC L  ET HIINRQVI++LGP GV+INI RG H
Sbjct  176   TEKPDLKFKYYPSVVELAANCDVLVVACPLIEETRHIINRQVINALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDV+E EPEV EELF ++NVVLLPH G  TVETR+ MADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVYEKEPEVPEELFALENVVLLPHVGSGTVETRSVMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT VV
Sbjct  296   IGNLEAHFLKKPLLTPVV  313



>ref|XP_004302900.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Fragaria 
vesca subsp. vesca]
Length=313

 Score =   401 bits (1031),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++I VL   P+ +YLE +L  RFN+L+ W  P+   F    N+ S+RA+V +  VGAD 
Sbjct  1     MDSIDVLYPSPVCSYLEQELDKRFNVLKLWTAPNKTQFIKD-NSTSIRAIVGHGGVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+DKVDL KCKEKG+RVTNTPDVLTDDVADIAIGL LAV+R
Sbjct  60    --ELIESLPKLEIISSFSVGMDKVDLKKCKEKGVRVTNTPDVLTDDVADIAIGLALAVMR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G+WK     ++ T++F+GK+VGIIGLGRIG AIAKRAEAF+C I+Y SR
Sbjct  118   RLCESDRYVRSGMWKKG--DYKLTTKFTGKTVGIIGLGRIGKAIAKRAEAFSCPIAYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYPTV+ELAS C +LVVACALT ET HIINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPELKYKYYPTVVELASKCDVLVVACALTEETRHIINREVIDALGPKGVLINIGRGHH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDV+++EPEV E+LFG++NVVLLPH G  T ETR AMADLV
Sbjct  236   VDEPELVSALLEGRLGGAGLDVYQNEPEVPEQLFGLENVVLLPHAGSGTTETRCAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   IANLEAHFLNKPLLTPVV  313



>ref|XP_008380917.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Malus 
domestica]
Length=375

 Score =   404 bits (1037),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 208/317 (66%), Positives = 253/317 (80%), Gaps = 5/317 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PM++YLE +L  RFNLL+ W  P    F    ++ S+RA+V NA  GAD 
Sbjct  63    MESIGVLMPIPMSSYLEQELEKRFNLLKPWTVPHKTQFIKD-HSTSIRAIVGNASAGADA  121

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVG+DKVDL  CKEKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  122   --ELIAALPKLEIISSFSVGIDKVDLKTCKEKGIRVTNTPDVLTDDVADLAIGLTLAVLR  179

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E +R+V+ G WK     ++ T++F+GK+VGIIGLGRIG A+AKR EAF+C I+Y SR
Sbjct  180   RLCESERYVRSGQWKKG--GYKLTTKFTGKTVGIIGLGRIGKAVAKRXEAFSCPIAYFSR  237

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K ++ +KYYPTV+ELA+NC +LVVAC LT ET HIINRQVI++LGP GV+INI RG H
Sbjct  238   TEKPDSKFKYYPTVVELAANCHVLVVACPLTEETRHIINRQVINALGPRGVLINIGRGPH  297

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRLGGAGLDV+E EP V E+LF ++NVVLLPH G  TVETRNAMADLV
Sbjct  298   VDEAELVSALVEGRLGGAGLDVYEKEPHVPEQLFALENVVLLPHVGSGTVETRNAMADLV  357

Query  217   VRNLEAHFMNKPLLTRV  167
             V NLEAHF+ KPLLT V
Sbjct  358   VGNLEAHFLKKPLLTPV  374



>gb|ACK99041.1| hydroxyphenylpyruvate reductase [Salvia officinalis]
Length=296

 Score =   400 bits (1029),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 210/299 (70%), Positives = 245/299 (82%), Gaps = 5/299 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPMN YL+ +L  RF LLR+W  P    F AQ  A S+RA+V NA  GAD 
Sbjct  1     MEAIGVLMMCPMNNYLDEELDKRFKLLRYWTQPKQSEFLAQ-QADSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S +SVGLDKVDL KCKEKG+RVTNTPDVLTDDVAD+AIGL+LAVLR
Sbjct  60    --ALIDALPKLEIVSNFSVGLDKVDLVKCKEKGVRVTNTPDVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E D++V++G WK+    F+ T++FSGK VGIIGLGRIGLA+A+RAEAF+C I+Y+SR
Sbjct  118   RICECDKYVRRGAWKLG--DFKLTTKFSGKRVGIIGLGRIGLAVAERAEAFDCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNY YY +V+ELASN  ILVVACALTPET HI+NR+VID+LGP GV+INI RG H
Sbjct  176   SKKANTNYTYYGSVVELASNSDILVVACALTPETTHIVNREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             VDEAEL+SALVEGRLGGAGLDVFE EPEV E+LFG++NVVLLPH G  TVETR AMADL
Sbjct  236   VDEAELVSALVEGRLGGAGLDVFEKEPEVPEQLFGLENVVLLPHVGSGTVETRKAMADL  294



>ref|XP_004506841.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cicer 
arietinum]
Length=313

 Score =   400 bits (1028),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M +I +L+   +  YLE +L+ R+NLLR W+FP      +Q + AS+RA+V N+  GAD 
Sbjct  1     MASISLLLVAQVMPYLEQELNKRYNLLRVWDFPQKSHLLSQ-HGASIRAVVGNSNAGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLTDDVAD+AIGLIL +LR
Sbjct  59    -SELIDALPKLEIVSSFSVGVDKIDLNKCKEKGIRVTNTPDVLTDDVADLAIGLILTLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+ G WK     ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC+I Y+SR
Sbjct  118   RICECDRYVRSGNWKYG--DYKLTTKFSGKTVGIIGLGRIGAAIAKRAEGFNCSICYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK  + YK+YP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG H
Sbjct  176   TQKQESKYKFYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGFLINIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVEGRLGGAGLDVFE+EP V EELFG+DNVVLLPH G  TVETR AMADLV
Sbjct  236   VDEPELVSALVEGRLGGAGLDVFENEPHVPEELFGLDNVVLLPHVGSGTVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+  PLLT +V
Sbjct  296   LGNLEAHFLGNPLLTPLV  313



>ref|XP_008228555.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Prunus 
mume]
Length=313

 Score =   400 bits (1028),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 206/318 (65%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M++IGVLM  PM+ YLE +L  RFNLL+ W  P    F    ++ S+RA+V NA  GAD 
Sbjct  1     MDSIGVLMPVPMSTYLEQELEKRFNLLKLWTVPQKTQFLKD-HSGSIRAVVGNAGNGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --ELIETLPKLEIVASFSVGIDKVDLNKCREKGIRVTNTPDVLTDDVADLAIGLALAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+++ G WK     ++ T++F+GK+VGI+GLGRIG A+AKRAEAF+C ISYHSR
Sbjct  118   RLCESDRYLRSGQWKKG--DYKLTTKFTGKTVGILGLGRIGKAVAKRAEAFSCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    YKYYP V+ELASNC ILVV CALT ET HIINR+VID+LGP GV+INI RG H
Sbjct  176   TEKPELKYKYYPCVVELASNCDILVVVCALTDETRHIINREVIDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE E++SAL+EGRLGGAGLDV+E+EPEV E+LF ++NVVLLPH G  TV+T  AMADLV
Sbjct  236   VDEPEMVSALLEGRLGGAGLDVYENEPEVPEQLFELENVVLLPHVGSDTVQTDTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF NKPLLT VV
Sbjct  296   IGNLEAHFSNKPLLTPVV  313



>gb|KDP37245.1| hypothetical protein JCGZ_06301 [Jatropha curcas]
Length=314

 Score =   400 bits (1028),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 255/319 (80%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMN-AYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CP    YL  +L  RF LL+  N PD   F    +  S+RA+V NA  GAD
Sbjct  1     MESIGVLMTCPPTYPYLVEELEKRFTLLKLQNAPDKTQFINS-HKNSIRAIVGNAGFGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID+LP LEI+S+YSVGLDKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL+LAVL
Sbjct  60    A--ELIDQLPKLEIVSSYSVGLDKVDLPKCREKGIRVTNTPDVLTDDVADLAIGLMLAVL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E DR+V+ G W+     ++ T++F+GKSVGIIGLGRIG+AIAKRAEAF+C ISY +
Sbjct  118   RRLCESDRYVRSGKWRKG--DYKLTTKFTGKSVGIIGLGRIGMAIAKRAEAFSCPISYFA  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K +  YKYYP+V+ELA+NCQILVVACALT ET HI+NR+VI++LG  GV+INI RG 
Sbjct  176   RTEKRDVKYKYYPSVVELAANCQILVVACALTEETRHIVNREVINALGKKGVLINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGAGLDVFEDEP V E+LFG++NVVLLPH G  T ETR  MAD+
Sbjct  236   HVDEPELVSALLEGRLGGAGLDVFEDEPNVPEQLFGLENVVLLPHVGSGTEETRKEMADI  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+NKPLLT VV
Sbjct  296   VVGNLEAHFLNKPLLTPVV  314



>gb|EYU24702.1| hypothetical protein MIMGU_mgv1a010401mg [Erythranthe guttata]
Length=313

 Score =   400 bits (1028),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             MEN  VLM CPM+AYLE +L  RF L + W FP    F  + +  SV+A+V N  +GAD 
Sbjct  1     MENAVVLMTCPMSAYLEQELEKRFTLFKLWEFPSKPQFLTR-HGDSVKAVVGNTKIGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID L  LEI+++YSVGLDK+DL+KC+E+GIRVTNTPDVLT DVAD+AIGL LA  R
Sbjct  59    -SELIDSLRRLEIVASYSVGLDKIDLSKCRERGIRVTNTPDVLTADVADLAIGLALAASR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D FV+ GLWK  +F+    ++FSGKS+GI+GLGRIG AIAKRAEAFNC ISYHSR
Sbjct  118   KICPSDEFVRSGLWKSRNFEL--ANKFSGKSIGIVGLGRIGSAIAKRAEAFNCTISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K NTNYK+Y  V++LA++CQILVV+C+LT ET HI+NRQVID+LGP+G++INI RG H
Sbjct  176   TKKENTNYKHYTNVVDLAASCQILVVSCSLTEETRHIVNRQVIDALGPHGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL EGRLGGAGLDVFE+EPEV E  FG++NVVLLPH G  T ET  AMADLV
Sbjct  236   VDEQELVSALQEGRLGGAGLDVFENEPEVRESFFGLENVVLLPHVGSDTFETSKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLE+HF+NKPL+T VV
Sbjct  296   VANLESHFLNKPLITPVV  313



>gb|AFK48218.1| unknown [Medicago truncatula]
Length=314

 Score =   399 bits (1026),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 256/319 (80%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMAC-PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             M +IGVL+    +  YLE +L+ R+NL R W+FP       Q + AS+RA+V +AF GAD
Sbjct  1     MGSIGVLLVSHQVIPYLEQELNKRYNLFRLWDFPQKSQLLTQ-HGASIRAVVGDAFAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I+ LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLTD+VAD+AIGL+L +L
Sbjct  60    --SDLIEALPKLEIVSSFSVGVDKIDLGKCKEKGIRVTNTPDVLTDEVADLAIGLMLTLL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E DR+V+ G WK  H  ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC ISY+S
Sbjct  118   RRICECDRYVRGGNWK--HGDYKLTTKFSGKTVGIIGLGRIGAAIAKRAEGFNCPISYYS  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R+QK  + YKYYP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG 
Sbjct  176   RTQKQESKYKYYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGFLINIGRGK  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+ AL+EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G ATVETR AMADL
Sbjct  236   HVDEPELVFALLEGRLGGAGLDVFENEPHVPEELFGLENVVLLPHVGSATVETRTAMADL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAHF+ KPLLT +V
Sbjct  296   VLGNLEAHFLGKPLLTPLV  314



>ref|XP_010521519.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Tarenaya 
hassleriana]
Length=313

 Score =   399 bits (1024),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 256/317 (81%), Gaps = 5/317 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE+++  RF+LLRFW  P++  F  + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENEIQKRFDLLRFWTAPENSGFL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKE+GIRVTNTPDVLT+DVAD+AIGL+L+VLR
Sbjct  60    R--LIDTLPKLEIVSSFSVGLDKIDLGKCKERGIRVTNTPDVLTEDVADLAIGLMLSVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK  +++   T++F+GKSVGIIGLGRIG AIAKRAEAF+C I Y+SR
Sbjct  118   RLCECDRYVRSGKWKSGNYKL--TTKFTGKSVGIIGLGRIGTAIAKRAEAFSCPIKYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELA    ILVVAC L+ ET  I+NR+V+D+LGP GV+INI RG H
Sbjct  176   TKKSDVTYKYYPTVVELARESDILVVACPLSEETRRIVNREVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEPELVAALKEGRLGGAGLDVFENEPYVPEELFGMENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRV  167
             V NL AHF  +PL+T V
Sbjct  296   VSNLVAHFAGEPLVTPV  312



>ref|XP_004252345.2| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum lycopersicum]
Length=315

 Score =   398 bits (1023),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 252/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M  IGVL+ CPM +YLE +L  RFNL R W  P    F  Q N+ S+RA+V +A  GAD 
Sbjct  3     MAKIGVLVICPMLSYLEEELDKRFNLFRLWEAPSKSEFLTQ-NSDSIRAVVGSASFGAD-  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+S++ VGLDK+DL KCKE+GIRVTNTPDVLTDDVAD AIGLILA LR
Sbjct  61    -SELIDALPNLEIVSSFCVGLDKIDLVKCKERGIRVTNTPDVLTDDVADAAIGLILATLR  119

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   D FV+ GLWK  +  F+ TS+FSGKSVGIIGLGRIG AIAKRAEAF C ISYHSR
Sbjct  120   RICVADGFVRSGLWK--NGDFELTSKFSGKSVGIIGLGRIGSAIAKRAEAFGCPISYHSR  177

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K N NYKYY TV++LA+N +ILVVACALT ET +I+NR V+D+LGP G++INI RG H
Sbjct  178   SKKPNINYKYYSTVVDLAANSEILVVACALTEETRNIVNRIVLDALGPKGIIINIGRGAH  237

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL++AL+EGR+GGAGLDV++ EPEV E+LFG++NVVLL H    TVET  AMADLV
Sbjct  238   VDESELVAALIEGRIGGAGLDVYQREPEVPEQLFGLENVVLLSHVASDTVETCTAMADLV  297

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF++KPLLT V+
Sbjct  298   IANLEAHFLHKPLLTPVL  315



>gb|KDO56910.1| hypothetical protein CISIN_1g021361mg [Citrus sinensis]
Length=313

 Score =   397 bits (1021),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM  PM+ YLE +L  RF L + W     + FF Q N++++RA+V +   GAD 
Sbjct  1     MEKIGVLMTTPMSNYLEQELAARFTLFKLWTQSCKNKFF-QENSSAIRAVVGDTKCGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YSVGLDK+DL KCK+K +RVTNTPDVLTDDVAD+A+GL+LAVLR
Sbjct  60    --ELIDSLPTLEIVASYSVGLDKIDLDKCKDKAVRVTNTPDVLTDDVADLAVGLVLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E D FVK G WK  HF+    S+FSGKSVGI+GLGRIG AIAKR EAF C ISYHSR
Sbjct  118   RVCEFDEFVKSGKWKNGHFELG--SKFSGKSVGIVGLGRIGTAIAKRVEAFGCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K + NYKYY  +I+LASNCQIL+VAC+LT ETHHI+NR+VID+LGP+G++INI RG H
Sbjct  176   SEKSDANYKYYTNIIDLASNCQILIVACSLTEETHHIVNRKVIDALGPSGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL+EGRL GAGLDV+E+EPEV E++ G++NVVLLPH G  T ET  AMADLV
Sbjct  236   IDEPELVSALLEGRLAGAGLDVYENEPEVPEQMLGLNNVVLLPHVGSDTEETSKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL AHF NKPLLT V+
Sbjct  296   IENLVAHFSNKPLLTPVI  313



>ref|XP_006426958.1| hypothetical protein CICLE_v10026118mg [Citrus clementina]
 gb|ESR40198.1| hypothetical protein CICLE_v10026118mg [Citrus clementina]
Length=313

 Score =   397 bits (1019),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM  PM+ YLE +L  RF L + W     + FF Q N++++RA+V +   GAD 
Sbjct  1     MEKIGVLMTTPMSNYLEQELAARFTLFKLWTQSCKNKFF-QENSSAIRAVVGDTKCGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YSVGLDK+DL KCK+K +RVTNTPDVLTDDVAD+A+GL+LAVLR
Sbjct  60    --ELIDSLPTLEIVASYSVGLDKIDLDKCKDKAVRVTNTPDVLTDDVADLAVGLVLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E D FVK G WK  HF+    S+FSGKSVGI+GLGRIG AIAKR EAF C ISYHSR
Sbjct  118   RVCEFDEFVKSGKWKNGHFELG--SKFSGKSVGIVGLGRIGTAIAKRVEAFGCPISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K + NYKYY  +I+LASNCQIL+VAC+LT ETHHI+NR+VID+LGP+G++INI RG H
Sbjct  176   SEKSHANYKYYTNIIDLASNCQILIVACSLTEETHHIVNRKVIDALGPSGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL+EGRL GAGLDV+E+EPEV E++ G++NVVLLPH G  T ET  AMADLV
Sbjct  236   IDEPELVSALLEGRLAGAGLDVYENEPEVPEQMLGLNNVVLLPHVGSDTEETSKAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL AHF NKPLLT V+
Sbjct  296   IENLVAHFSNKPLLTPVI  313



>ref|XP_008795067.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Phoenix dactylifera]
Length=316

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 256/319 (80%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  P N+YLE +L  R  L R W  P +    F + NAAS+RALV N+ VGAD
Sbjct  1     MESLGVLLTFPTNSYLEEELSKRCKLFRLWETPPEKRREFLRANAASIRALVGNSGVGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++++ VGLDKVDLAKC++KGIRVTNTPDVLTDDVAD+AIGL LA +
Sbjct  61    A--EMIDALPALEIVASFGVGLDKVDLAKCRKKGIRVTNTPDVLTDDVADLAIGLALATM  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E DR+V+ G WK A   ++ TS+FSGK+VGIIGLGRIGLAIA+RAEAF+C ISY+S
Sbjct  119   RRICEADRYVRSGAWK-AKGDYKLTSKFSGKTVGIIGLGRIGLAIAERAEAFDCPISYYS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K +TNYKY+ +V++LA+NC +L+VACALT ET HI+NR+V+D+LGP GV++N+ RG 
Sbjct  178   RSEKPHTNYKYHSSVVDLAANCHVLIVACALTEETRHIVNREVMDALGPKGVLVNVGRGA  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGA LDVFE EP V E+LFG+DNVVL+PH G  T ETR AMADL
Sbjct  238   HVDEPELVSALLEGRLGGAALDVFEQEPHVPEQLFGLDNVVLVPHAGSGTWETRKAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH  NKPLLT VV
Sbjct  298   VLGNLEAHATNKPLLTPVV  316



>ref|XP_007024183.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
[Theobroma cacao]
 gb|EOY26805.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
[Theobroma cacao]
Length=314

 Score =   395 bits (1016),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 250/318 (79%), Gaps = 4/318 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M N  VL+ CPM  YLE +L  RFNL + W+   S A F    ++S++A+V N  VGAD 
Sbjct  1     MNNTCVLVTCPMFTYLEQELETRFNLFKLWDHSSSKAEFFNNYSSSIKAVVGNTKVGADA  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+++YSVGLDK+DL KCK++GI+VTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  61    --KLIDSLPNLEIVASYSVGLDKIDLDKCKQRGIKVTNTPDVLTDDVADLAIGLALAVLR  118

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+   D+FV+ G W   +  F   ++FSGKSVGI+GLGRIG AIAKRAEAF C ISYHSR
Sbjct  119   KVCVCDQFVRSGNW--INGDFGLATKFSGKSVGIVGLGRIGSAIAKRAEAFQCPISYHSR  176

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NTNYKYY  +++LA+NC+ILVVACALT ETHHI+NR+VID+LGP G +INIARG H
Sbjct  177   SKKPNTNYKYYLNIVDLAANCEILVVACALTEETHHIVNRKVIDALGPKGFLINIARGAH  236

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDVFE+EPE  E+LF +DNVVL+PH G  T ET  AMADLV
Sbjct  237   VDEPELVSALLEGRLGGAGLDVFENEPEPPEQLFALDNVVLVPHVGSDTGETSKAMADLV  296

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF  KPLLT V+
Sbjct  297   ISNLEAHFKGKPLLTPVI  314



>ref|XP_003604495.1| Glyoxylate/hydroxypyruvate reductase B [Medicago truncatula]
 gb|AES86692.1| D-glycerate dehydrogenase/hydroxypyruvate reductase [Medicago 
truncatula]
Length=313

 Score =   395 bits (1015),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 209/318 (66%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VL+   +  YLE +L  R+NL R  ++P    F  Q + A +RA+V N   GAD 
Sbjct  1     MESIDVLLVAQVLPYLEQELSKRYNLFRICDYPQKSQFLTQ-HGALIRAVVGNGSCGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+S++SVG+DK+DL KCKEKGI VTNTPDVLTDDVAD+AIGL+L +LR
Sbjct  59    -SELIDALPNLEIVSSFSVGVDKIDLNKCKEKGICVTNTPDVLTDDVADLAIGLMLTLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DRFV+ G WK  H  ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC+I Y+SR
Sbjct  118   RICECDRFVRSGDWK--HGDYKLTTKFSGKTVGIIGLGRIGTAIAKRAEGFNCSICYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK    YKYYP V+ELASNC ILVVAC+LT ETHHIINR+VI++LGP G +INI RG H
Sbjct  176   TQKQEPKYKYYPNVVELASNCDILVVACSLTDETHHIINREVINALGPKGFLINIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G  TVETR AMADLV
Sbjct  236   VDEPELVSALLEGRLGGAGLDVFENEPHVPEELFGLENVVLLPHVGSGTVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT +V
Sbjct  296   LGNLEAHFLGKPLLTPLV  313



>ref|XP_008348509.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Malus 
domestica]
Length=313

 Score =   394 bits (1013),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 202/318 (64%), Positives = 258/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVLM  PM+ YLE +L  RFNLL+ W  P+  A F + ++ +VRA++ NA  GAD+
Sbjct  1     MESVGVLMPVPMSPYLEQELERRFNLLKLWTAPEK-AEFLKAHSGAVRAVIGNAGNGADV  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVG+DKVDL KC+EKGIRVTNTPDVLTDDVAD+AIGL L VLR
Sbjct  60    --GLIEALPELEIIASFSVGIDKVDLEKCREKGIRVTNTPDVLTDDVADLAIGLALGVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E D +V+ G WK  +  ++ T++F+GK+VGIIGLGRIG A+AKR EAF+C I+Y+SR
Sbjct  118   RLCEADGYVRSGGWK--NGDYKLTTKFTGKTVGIIGLGRIGKAVAKRVEAFSCPIAYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYP+V+ELASNC ILVV C LT ET HIINR+VID+LGP G++INI RG H
Sbjct  176   TEKPDLKYKYYPSVVELASNCDILVVVCPLTQETRHIINREVIDALGPKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL+SAL+EGRLGGAGLDV+E+EP+V E+LF ++NVVLLPH G  TVET  AMADLV
Sbjct  236   VDESELVSALLEGRLGGAGLDVYENEPDVPEQLFQLENVVLLPHVGSDTVETDTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  296   IGNLEAHFLNKPLLTPVV  313



>ref|XP_007135676.1| hypothetical protein PHAVU_010G149000g [Phaseolus vulgaris]
 gb|ESW07670.1| hypothetical protein PHAVU_010G149000g [Phaseolus vulgaris]
Length=313

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 259/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M +IGVL+   +  YLE +L  R+ L R W++P++    +Q +A SVRA+V N+  GAD 
Sbjct  1     MGSIGVLLVGHVMPYLEQELDKRYKLFRAWDYPNAAQLPSQ-HATSVRAVVGNSSAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+DKVDL KC+EKGIRVT TPDVLTD+VAD+AIGL+L++LR
Sbjct  60    --ALIEALPKLEIVSSFSVGVDKVDLEKCREKGIRVTYTPDVLTDEVADLAIGLMLSLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DRFV+ G WK  H  ++ T++FSGK+VGIIGLGRIG AIAKRAEAFNC ISY+SR
Sbjct  118   RICESDRFVRSGKWK--HGAYKLTTKFSGKTVGIIGLGRIGQAIAKRAEAFNCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K ++ YKYYP+V+ELASNC +LVVAC LT ETHHI+NR+V+++LGP G ++NI RG H
Sbjct  176   TEKRDSKYKYYPSVVELASNCDVLVVACPLTEETHHIVNREVMNALGPKGYLVNIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SAL+EGRLGGAGLDVFE+EP V +ELF ++NVVLLPH G ATVETR AMADLV
Sbjct  236   VDEAELVSALLEGRLGGAGLDVFENEPVVPQELFQLENVVLLPHVGSATVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT +V
Sbjct  296   LGNLEAHFLGKPLLTPLV  313



>ref|XP_002516030.1| glycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF46450.1| glycerate dehydrogenase, putative [Ricinus communis]
Length=313

 Score =   394 bits (1013),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 248/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CP+  YLE QL + FNLL+ W  P S   F + +  +++A+V +  +GAD 
Sbjct  1     MEKIGVLMTCPIYTYLEKQLESHFNLLKLWQQP-SKTEFLKTHENNIKAIVCDTKIGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI++TYSVGLDK+DL KC EKGIRVTNTPDVLTDDVAD+AIGL+L VLR
Sbjct  59    -GELIDALPNLEIVATYSVGLDKIDLKKCAEKGIRVTNTPDVLTDDVADLAIGLMLGVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D +V+ G W+     F+ T++FSGKS+GI+GLGRIG AIAKRAEAFNC+ISY+SR
Sbjct  118   KICASDGYVRNGKWRDG--DFELTTKFSGKSIGIVGLGRIGTAIAKRAEAFNCSISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK  TNYKY+  +++LA  CQILVVACALT ET HIINR+VID+LGP G++INI RG H
Sbjct  176   TQKPYTNYKYFSNILDLAKTCQILVVACALTEETRHIINREVIDALGPKGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRL GAG DV+E+EP V E+LF +DNV L PH G  TVET NAMADLV
Sbjct  236   VDEPELVSALLEGRLAGAGFDVYENEPMVPEQLFSLDNVFLQPHIGSDTVETSNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAH  NKPLLT V+
Sbjct  296   IANLEAHLTNKPLLTPVI  313



>ref|XP_002516029.1| glycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF46449.1| glycerate dehydrogenase, putative [Ricinus communis]
Length=314

 Score =   394 bits (1013),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 209/319 (66%), Positives = 256/319 (80%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACP-MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGVLM CP MN YL  +L  RF L   +N PD   F    ++ S+RA+V N+  G D
Sbjct  1     MESIGVLMTCPPMNPYLVEELEKRFTLYNLYNIPDKTQFLNS-HSNSIRAVVGNSGYGID  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID+LPNLEI+S++SVGLDKVDLAKCKEK IRVTNTPDVLTDDVAD+AIGL+LAV+
Sbjct  60    A--DLIDQLPNLEIVSSHSVGLDKVDLAKCKEKRIRVTNTPDVLTDDVADLAIGLMLAVM  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E D++++ G WK     ++ T++F+GKSVGIIGLGRIG+AIAKRAEAF+C ISY++
Sbjct  118   RRLCESDQYLRSGKWKKG--DYKLTTKFTGKSVGIIGLGRIGMAIAKRAEAFSCPISYYA  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K   NYKYY +V+E+A +CQILVV+CALT ET HI+NR+VID+LGP G++INI RG 
Sbjct  176   RTEKTVVNYKYYQSVVEMAGDCQILVVSCALTEETRHIVNREVIDALGPKGILINIGRGS  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+EGRLGGAGLDVFEDEP V E+LFG++NVVLLPH G  T ETR AMA L
Sbjct  236   HVDEPELVSALLEGRLGGAGLDVFEDEPNVPEQLFGLENVVLLPHVGTRTFETRIAMAYL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF NKPLLT VV
Sbjct  296   VVGNLEAHFSNKPLLTPVV  314



>ref|XP_003604486.1| Glyoxylate reductase [Medicago truncatula]
 gb|AES86683.1| D-glycerate dehydrogenase/hydroxypyruvate reductase [Medicago 
truncatula]
Length=310

 Score =   394 bits (1012),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 205/318 (64%), Positives = 252/318 (79%), Gaps = 8/318 (3%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVL+   +  YLE +L+ R+NL R W+FP    F  Q + AS+RA+V  +  GAD 
Sbjct  1     MESIGVLLVAQVIPYLEQELNKRYNLYRIWDFPQKSQFLIQ-HGASIRAVVGRSTAGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S+ SVG+D++D+ KCKE+GIRVT TPDVLTD+VAD+AIGLIL++LR
Sbjct  59    -SELIDALPKLEIISSSSVGVDQIDVKKCKERGIRVTITPDVLTDEVADLAIGLILSLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +ISE DRFV+ G WK      Q T++FSGK+VGI+GLGRIG AIAKRAE FNC+I Y+SR
Sbjct  118   RISECDRFVRNGNWK-----HQLTTKFSGKTVGIVGLGRIGTAIAKRAEGFNCSICYYSR  172

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK  + YKYYP V+ELASNC ILVVAC+LT ETHHIINR+VI++LGP G +INI RG H
Sbjct  173   TQKQESKYKYYPNVVELASNCDILVVACSLTEETHHIINREVINALGPKGFLINIGRGKH  232

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDVFE+EP V EEL  ++NVVLLPH G  T+ETR AMADLV
Sbjct  233   VDEPELVSALLEGRLGGAGLDVFENEPHVPEELLSLENVVLLPHCGSGTIETRTAMADLV  292

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT +V
Sbjct  293   LGNLEAHFLGKPLLTPLV  310



>ref|XP_009104430.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Brassica 
rapa]
Length=313

 Score =   394 bits (1012),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 258/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE++L  R+NL RFW  P+   F  + + +S+RA+V NA VGAD 
Sbjct  1     MESIGVLMMCPMNSYLENELQKRYNLHRFWTCPEKSVFL-ETHRSSIRAIVGNASVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    K--LIDDLPKLEIISSFSVGVDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK  +  FQ T++FSGKSVGIIGLGRIG AIAKRA+ FNC I+Y+SR
Sbjct  118   RLCECDRYVRSGKWK--YGDFQLTTKFSGKSVGIIGLGRIGAAIAKRAQGFNCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELA N  ILVVACALT ET HI+NR+V+D+LG  GV+INI RG H
Sbjct  176   TEKPDVGYKYYPTVVELAQNSDILVVACALTDETRHIVNREVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE E++ AL EGRLGGAGLDVFE EP V EELFG++NVVLLPH   ATVETR AMADLV
Sbjct  236   IDEKEMVKALTEGRLGGAGLDVFEQEPHVPEELFGLENVVLLPHVASATVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF  KPLLTRVV
Sbjct  296   MGNLDAHFAGKPLLTRVV  313



>emb|CDY58781.1| BnaCnng33820D [Brassica napus]
Length=313

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 249/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNL+RFWNF +   F  + +  S+ A+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQKRFNLIRFWNFQEKSVFL-ETHRNSIGAVVGNASTGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLT+DVAD+AI LIL +LR
Sbjct  60    --ELINDLPKLEIISSFSVGIDKIDLGKCKEKGIRVTNTPDVLTEDVADVAISLILTLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK  +  FQ T++FSGKS+GI+GLGRIG AIAKRAEAF+C +SY+SR
Sbjct  118   RLCECDRYVRSGKWK--YGDFQLTTKFSGKSLGILGLGRIGTAIAKRAEAFSCPVSYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
               K +  YKYYPTV+ELA N  ILVVAC LT ET HI+NR V+D+LG  GV+INI RG H
Sbjct  176   RVKPDLGYKYYPTVVELAQNSDILVVACPLTDETRHIVNRNVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL EGRLGGA LDVFE EP V EELFG+ NVVLLPH G  TVET NAMADLV
Sbjct  236   VDEQELVNALTEGRLGGAALDVFEQEPHVPEELFGLQNVVLLPHVGSGTVETENAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  + LLT VV
Sbjct  296   VANLEAHFAGESLLTPVV  313



>emb|CDX67931.1| BnaA07g19710D [Brassica napus]
Length=313

 Score =   392 bits (1008),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 257/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE++L  R+NL RFW  P+   F  + + +S+RA+V NA VGAD 
Sbjct  1     MESIGVLMMCPMNSYLENELQKRYNLHRFWTCPEKSVFL-ETHRSSIRAIVGNASVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    --KLIDDLPKLEIISSFSVGVDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK  +  FQ T++FSGKSVGIIGLGRIG AIAKRA+ FNC I+Y SR
Sbjct  118   RLCECDRYVRSGKWK--YGDFQLTTKFSGKSVGIIGLGRIGAAIAKRAQGFNCPINYFSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELA N  ILVVACALT ET HI+NR+V+D+LG  GV+INI RG H
Sbjct  176   TEKPDVGYKYYPTVVELAQNSDILVVACALTDETRHIVNREVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE E++ AL EGRLGGAGLDVFE EP V EELFG++NVVLLPH   ATVETR AMADLV
Sbjct  236   IDEKEMVKALTEGRLGGAGLDVFEQEPHVPEELFGLENVVLLPHVASATVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF  KPLLT+VV
Sbjct  296   MGNLEAHFAGKPLLTQVV  313



>ref|XP_010033867.1| PREDICTED: hydroxyphenylpyruvate reductase-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW53701.1| hypothetical protein EUGRSUZ_J02960 [Eucalyptus grandis]
Length=329

 Score =   392 bits (1008),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
              ME IGVLM CPM  YLE +L  RF L R W+FP    F  + +A S+RA+V +  VGAD
Sbjct  16    QMEGIGVLMTCPMFPYLEQELEQRFRLHRLWDFPSRRRFL-EAHAGSIRAVVGDTKVGAD  74

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++T+SVGLDK+DL +C EKGIRVTNTPDVLTDDVADIAI L+L VL
Sbjct  75    A--ELIDALPGLEIVATFSVGLDKIDLGRCGEKGIRVTNTPDVLTDDVADIAIALMLGVL  132

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RK+   D FV+ G WK     F  T++FSGKSVGI+GLGRIG AIAKRAEAF C ISY S
Sbjct  133   RKVCGCDAFVRSGKWKSG--DFGLTAKFSGKSVGIVGLGRIGSAIAKRAEAFGCPISYCS  190

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K + +YKYYPT  ELA +C+ILVVACALT ET  I+ R+V+D+LGP GV+IN+ RG 
Sbjct  191   RSEKPHVSYKYYPTAAELARHCRILVVACALTEETRRIVGREVLDALGPEGVLINVGRGA  250

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL++AL+EGRLGGAGLDV+E+EPE  EELF +DNVVLLPH G  TVET  AMADL
Sbjct  251   HVDEPELVAALLEGRLGGAGLDVYENEPEAAEELFPMDNVVLLPHVGSDTVETSTAMADL  310

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF  KPLLT V+
Sbjct  311   VVANLEAHFAGKPLLTPVI  329



>ref|XP_009784628.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana sylvestris]
Length=313

 Score =   391 bits (1005),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 210/317 (66%), Positives = 249/317 (79%), Gaps = 5/317 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLMAC M++YLE +L  RFNLLR+WNF D   F   IN  S     V     A  
Sbjct  1     METIGVLMACSMSSYLEQELDKRFNLLRYWNFSDKKEF---INNYSHLIRAVVGHAAAAA  57

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK DL KCKEKGIRVTNTP VLTDDVAD+AIGL+LAVLR
Sbjct  58    GAELIEALPKLEIVSSFSVGLDKTDLNKCKEKGIRVTNTPHVLTDDVADLAIGLMLAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+VKK LWK     F+ TS+FSGK+VGIIGLGRIGLAIAKRAEAF C ISY++R
Sbjct  118   RICECDRYVKKRLWKAG--DFKLTSKFSGKTVGIIGLGRIGLAIAKRAEAFGCLISYYAR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +TNYKYYPTV++LA+NC+ILVVACALTPET +I+N +VID+LG  G++INI RG H
Sbjct  176   AEKPDTNYKYYPTVVQLATNCEILVVACALTPETRYIVNHEVIDALGAKGILINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL++GRLGG GLDVFE+EPEV E+LFG++NVVLLPH      E R  MAD+V
Sbjct  236   VDEKELVSALLDGRLGGTGLDVFENEPEVPEQLFGLENVVLLPHVASGIKEMRKEMADIV  295

Query  217   VRNLEAHFMNKPLLTRV  167
             + NLEAHF NKPLLT V
Sbjct  296   IGNLEAHFQNKPLLTPV  312



>ref|XP_010915830.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Elaeis guineensis]
Length=316

 Score =   390 bits (1002),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 255/319 (80%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PM++YLE +L  R  L R W  P +      ++NAAS+RA+V +  VGAD
Sbjct  1     MESLGVLLTYPMDSYLEEELGKRCKLFRLWETPPEKRQELLRVNAASIRAVVGSTAVGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++++SVGLDKVDLAKC+E+ IRVTNTPDVLTDDVAD+AIGL +A +
Sbjct  61    A--ETIDALPALEIVASFSVGLDKVDLAKCRERRIRVTNTPDVLTDDVADLAIGLAIATM  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E DR+V+ G W  A   ++ TS+FSGK++GIIGLGRIGLAIAKRAEAF+C ISY+S
Sbjct  119   RRICEADRYVRSGAWN-AKGDYKLTSKFSGKTIGIIGLGRIGLAIAKRAEAFDCPISYYS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K  TNYKYY +V++LA+NC IL+VACALT ET HI+NR+V+D+LGP GV++NI RG 
Sbjct  178   RSEKPQTNYKYYSSVVDLAANCHILIVACALTEETRHIVNREVMDALGPKGVLVNIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDEAEL+SAL+EGRLGGA LDVFE EP V E+LFG++NVVL+PH G AT ETR  MADL
Sbjct  238   HVDEAELVSALIEGRLGGAALDVFEHEPHVPEQLFGLENVVLVPHVGSATWETRKEMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH  NKPLLT V+
Sbjct  298   VLGNLEAHATNKPLLTPVL  316



>ref|XP_011080783.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Sesamum indicum]
Length=328

 Score =   389 bits (1000),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 245/319 (77%), Gaps = 5/319 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
              MEN+GVLM C M+AYLE +L  RF L R W       F A     S+RA+V +  VGAD
Sbjct  15    EMENVGVLMTCSMSAYLERELEKRFKLFRLWESNSKAQFLAGF-GESIRAVVGDTKVGAD  73

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LE++++YSVGLDK+DL KC+E+GIRVTNTPDVLTDDVAD+AIGL LA L
Sbjct  74    A--ELIDALPRLEVVASYSVGLDKIDLNKCRERGIRVTNTPDVLTDDVADVAIGLALATL  131

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI   D FV+ G W+  +  F+  ++FSGKS+GI+GLGRIG AIAKRAEAF C+ISYHS
Sbjct  132   RKICNADAFVRSGQWR--NGDFELANKFSGKSIGIVGLGRIGTAIAKRAEAFGCSISYHS  189

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K NTNYKYY   ++LA+NC++LVVACALT ET HI+N++VID+LGP G++INI RG 
Sbjct  190   RTKKQNTNYKYYSNAVDLAANCEVLVVACALTNETRHIVNQEVIDALGPKGILINIGRGP  249

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              +DE +LISAL EGRL GAGLDVFE+EP++NE  FG+ NVVLLPH G  TVET  AMADL
Sbjct  250   LIDEPKLISALREGRLAGAGLDVFENEPDINESFFGLQNVVLLPHVGTDTVETSKAMADL  309

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLE HF+ KPLLT VV
Sbjct  310   VVANLELHFLKKPLLTPVV  328



>ref|XP_008793047.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Phoenix dactylifera]
Length=316

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 251/316 (79%), Gaps = 4/316 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAF-FAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMN YLE +LH R +L R W  P +    F + NA S+RA+V NAFVGAD
Sbjct  1     MESLGVLLTLPMNPYLEAELHRRCHLFRLWESPPARRKDFLRANAPSIRAVVGNAFVGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+++YSVGLDKVDLA+C+E+GIRVT TPDVLTDD AD+AIGL +A L
Sbjct  61    AET--IDALPRLEIVASYSVGLDKVDLARCRERGIRVTYTPDVLTDDAADLAIGLSIATL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ + DR+V+ G WK A   ++ TS+FSGK+VG++GLGRIGLA+AKRAEAF C I YHS
Sbjct  119   RRLFDADRYVRAGSWK-AKGDYKLTSRFSGKTVGLLGLGRIGLAVAKRAEAFGCPICYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K N NYKY+P+V+ELA+NC +L+VAC+LT ET  IINR VI++LGP GV++NI RG 
Sbjct  178   RTRKPNVNYKYFPSVLELAANCDVLIVACSLTEETRRIINRGVINTLGPKGVLVNIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE ELISALVEGRLG A LDV+E EP+V EELF ++NVVL PH G AT ETR AMADL
Sbjct  238   HVDEPELISALVEGRLGAAALDVYEHEPDVPEELFRLENVVLTPHVGSATWETRKAMADL  297

Query  220   VVRNLEAHFMNKPLLT  173
             V+ NLEAH +NKPLLT
Sbjct  298   VLGNLEAHVLNKPLLT  313



>gb|KDP37244.1| hypothetical protein JCGZ_06300 [Jatropha curcas]
Length=313

 Score =   389 bits (998),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 248/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM CPM  YLE +L +RF L + W   +S   F + N   ++A+V N  +GAD 
Sbjct  1     METIGVLMTCPMYTYLEQELESRFRLFKLWQ-SNSKGEFLRTNQDKIKAIVGNTKIGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+++YSVGLDK+DL KC+EKGIRVTNTPDVLTDDVAD+AIGLIL VLR
Sbjct  60    --ELIDALPNLEIVASYSVGLDKIDLRKCEEKGIRVTNTPDVLTDDVADLAIGLILGVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   D +V++G W+     F+  ++FSGKSVGI+GLGRIG AIAKRA+AF+C +SY+SR
Sbjct  118   RICACDGYVRRGKWRAG--DFELATKFSGKSVGIVGLGRIGSAIAKRADAFSCPVSYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK +T YKY+  +++LA NCQILVVACALT ET HIINR+V+D+LGP G++INI RG H
Sbjct  176   TQKAHTGYKYFSNILDLAKNCQILVVACALTQETRHIINREVVDALGPEGILINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRL GAGLDV+ +EP V EELF + NVVL PH G  T+ET NAMADLV
Sbjct  236   VDEHELVSALLEGRLRGAGLDVYGNEPNVPEELFSLHNVVLQPHVGSDTIETSNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             +RNLEAHF NKPL T V+
Sbjct  296   IRNLEAHFSNKPLSTPVI  313



>emb|CDX79406.1| BnaC06g18970D [Brassica napus]
Length=313

 Score =   388 bits (996),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 256/318 (81%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE++L  R+NL RFW  P+   F  + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMNSYLENELQKRYNLHRFWTCPEKSVFL-ETHRNSIRAIVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVGLDK+DL KCKEKGIRVTNTP+VLT+DVAD+AIGLILA+LR
Sbjct  60    --KLIDDLPKLEIISSFSVGLDKIDLGKCKEKGIRVTNTPEVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK  +  F+ T++FSGKSVGIIGLGRIG AIAKRA+ FNC I+Y+SR
Sbjct  118   RLCECDRYVRSGKWK--YGDFKLTTKFSGKSVGIIGLGRIGAAIAKRAQGFNCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELA N  ILVVACALT ET HI+NR+V+D+LG  GV+INI RG H
Sbjct  176   TEKPDVGYKYYPTVVELAQNSDILVVACALTDETRHIVNREVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE E++ AL EGRLGGAGLDVFE EP V EELFG++NVVL+PH   ATVETR AMADLV
Sbjct  236   VDEKEMVKALTEGRLGGAGLDVFEQEPHVPEELFGLENVVLVPHVASATVETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF  KPLLT+VV
Sbjct  296   LGNLEAHFAGKPLLTQVV  313



>ref|XP_004486744.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cicer 
arietinum]
Length=313

 Score =   388 bits (996),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 248/319 (78%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM C M+  LE +L +RF L + WN+P   AF ++ +A S+RALVVN  +GAD+
Sbjct  1     MESIGVLMTCEMHGELEEKLASRFKLFKLWNYPSFQAF-SKTHANSIRALVVNTKLGADV  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID  PNLEI+STYSVGLD +DL KCKEKGIRV+NTPDVLTDDVAD AI L LAV R
Sbjct  60    NT--IDSFPNLEIVSTYSVGLDHIDLKKCKEKGIRVSNTPDVLTDDVADQAIALALAVFR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI + DRFVK  +W      +  T++FSGK+VGI+GLGRIG AIAKRA AF C ISYHSR
Sbjct  118   KIPQSDRFVKTAMWTS---DYPLTTKFSGKAVGIVGLGRIGSAIAKRAAAFGCPISYHSR  174

Query  577   SQKLNTN-YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             S+K     YKYYP +++LA+N Q+L+VAC+L  +T+HI+NR VID+LGP GV++NI RG 
Sbjct  175   SEKPEAGPYKYYPNILDLAANSQVLIVACSLNEQTYHIVNRNVIDALGPEGVIVNIGRGK  234

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             H+DE EL+SALVEGRLGGAGLDVFE+EP V EEL G++NVVL PH G  TVET N MADL
Sbjct  235   HIDEPELVSALVEGRLGGAGLDVFENEPNVPEELLGLENVVLTPHVGSDTVETCNDMADL  294

Query  220   VVRNLEAHFMNKPLLTRVV  164
             VV NLEAHF+ KPLLT V+
Sbjct  295   VVANLEAHFLGKPLLTPVL  313



>gb|ACU18122.1| unknown [Glycine max]
Length=313

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M +IGVL+   +  YLE +L  R+ L R ++ P +    +Q +A+S+RA+V N+  GAD 
Sbjct  1     MRSIGVLLVAQVIPYLEQELDKRYKLFRAYDQPQTAQVLSQ-HASSIRAVVGNSNAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+D++DL +CKEKGIRVTNTPDVLTD+VAD+AIGL+LA+LR
Sbjct  60    --ELIEALPKLEIVSSFSVGVDRIDLDRCKEKGIRVTNTPDVLTDEVADLAIGLMLALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+ G WK     ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC I Y+SR
Sbjct  118   RICECDRYVRSGKWKKG--DYKLTTKFSGKTVGIIGLGRIGQAIAKRAEGFNCPICYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK ++NYKYYP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG H
Sbjct  176   TQKRDSNYKYYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGYLINIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+ AL+EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G  T+ETR AMADLV
Sbjct  236   VDEAELVPALLEGRLGGAGLDVFENEPTVPEELFGLENVVLLPHVGSGTIETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF+  PLLT +V
Sbjct  296   LGNLDAHFLGNPLLTPLV  313



>ref|XP_008799958.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Phoenix dactylifera]
Length=316

 Score =   387 bits (994),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 253/316 (80%), Gaps = 4/316 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+   M++YLE +L  R  L R W  P +    F + NAA++RA+V N  VGAD
Sbjct  1     MESLGVLLTYSMDSYLEEELSKRCKLFRLWETPPEKRREFLRANAATIRAVVGNTAVGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++++SVGLDKVDLAKC+E+GIRVTNTPDVLTDDVAD+AIGL +A +
Sbjct  61    AET--IDALPALEIVASFSVGLDKVDLAKCRERGIRVTNTPDVLTDDVADLAIGLAIATM  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++   DR+V+ G WK A   ++ TS+FSGK+VGIIGLGRIGLAIAKRAEAF C ISY+S
Sbjct  119   RRLFAADRYVRGGAWK-AKGDYKLTSKFSGKTVGIIGLGRIGLAIAKRAEAFGCPISYYS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K  T+YKYY +V+ LA+NC +L+VACALT ETHHI+NR+VID+LGP GV++NI RG 
Sbjct  178   RSEKPQTDYKYYSSVVALAANCNVLIVACALTEETHHIVNREVIDALGPRGVLVNIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+ AL+EGRLGGAGLDVFEDEP+V E+LFG++NVVL+PH G +T ET  AMADL
Sbjct  238   HVDEPELVLALLEGRLGGAGLDVFEDEPDVPEQLFGLENVVLVPHVGSSTWETCKAMADL  297

Query  220   VVRNLEAHFMNKPLLT  173
             V+ NLEAH  NKPLLT
Sbjct  298   VLGNLEAHVTNKPLLT  313



>ref|XP_009353642.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Pyrus 
x bretschneideri]
Length=312

 Score =   387 bits (993),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 203/318 (64%), Positives = 257/318 (81%), Gaps = 6/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVLM  PM+ YLE +L  RFNLL+ W  P+  A F + ++ ++RA++ NA  GAD+
Sbjct  1     MESVGVLMPVPMSPYLEQELERRFNLLKLWTAPEK-AEFLKAHSGAIRAVIGNAGNGADV  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI++++SVG+DKVDL K  EKGIRVTNTPDVLTDDVAD+AIGL LAVLR
Sbjct  60    --GLIEALPELEIIASFSVGIDKVDLDKW-EKGIRVTNTPDVLTDDVADLAIGLALAVLR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E D +V+ G WK  +  +  T++F+GK+VGIIGLGRIG A+AKRAEAF+C I+Y+SR
Sbjct  117   RLCEADGYVRSGGWK--NGDYNLTTKFTGKTVGIIGLGRIGKAVAKRAEAFSCPIAYYSR  174

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K +  YKYYPTV+ELASNC ILVV C LT ET HIINR+VID+LGP G++INI RG H
Sbjct  175   TEKPDLKYKYYPTVVELASNCDILVVVCPLTQETRHIINREVIDALGPMGILINIGRGPH  234

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE+EL+SAL+EGRLGGAGLDV+E+EP+V E+LF ++NVVLLPH G  TVET  AMADLV
Sbjct  235   VDESELVSALLEGRLGGAGLDVYENEPDVPEQLFQLENVVLLPHVGSDTVETDTAMADLV  294

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT VV
Sbjct  295   IGNLEAHFLNKPLLTPVV  312



>ref|XP_003530169.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Glycine max]
 gb|KHN04209.1| Glyoxylate reductase [Glycine soja]
Length=313

 Score =   386 bits (992),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 201/318 (63%), Positives = 255/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M +IGVL+   +  YLE +L  R+ L R ++ P +    +Q +A+S+RA+V N+  GAD 
Sbjct  1     MGSIGVLLVAQVIPYLEQELDKRYKLFRAYDQPQTAQVLSQ-HASSIRAVVGNSNAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVG+D++DL +CKEKGIRVTNTPDVLTD+VAD+AIGL+LA+LR
Sbjct  60    --ELIEALPKLEIVSSFSVGVDRIDLDRCKEKGIRVTNTPDVLTDEVADLAIGLMLALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DR+V+ G WK     ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC I Y+SR
Sbjct  118   RICECDRYVRSGKWKKG--DYKLTTKFSGKTVGIIGLGRIGQAIAKRAEGFNCPICYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK ++NYKYYP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG H
Sbjct  176   TQKRDSNYKYYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGYLINIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+ AL+EGRLGGAGLDVFE+EP V EELFG++NVVLLPH G  T+ETR AMADLV
Sbjct  236   VDEAELVPALLEGRLGGAGLDVFENEPTVPEELFGLENVVLLPHVGSGTIETRTAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF+  PLLT +V
Sbjct  296   LGNLDAHFLGNPLLTPLV  313



>ref|XP_010417783.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Camelina 
sativa]
Length=313

 Score =   386 bits (991),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE++L  RFNLLR+W  P+   F  + +  S+RA+V NAFVGAD 
Sbjct  1     MESIGVLMMCPMNSYLENELQKRFNLLRYWTSPEKSVFL-ETHRNSIRAVVGNAFVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL  CK+KGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LINDLPKLEIVSSFSVGLDKIDLGICKDKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     F+ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--DFKLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC L+ ET HI+NRQV+D+LGP  V+INI RG H
Sbjct  176   TVKPDVAYKYYPTVVDLAKNSDILVVACPLSDETRHIVNRQVMDALGPKSVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEKEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  296   VGNLEAHFSGKSLLTPVV  313



>ref|NP_178105.1| glyoxylate/hydroxypyruvate reductase A HPR2 [Arabidopsis thaliana]
 sp|Q9CA90.1|HPR2_ARATH RecName: Full=Glyoxylate/hydroxypyruvate reductase A HPR2; AltName: 
Full=NAD(P)H-dependent hydroxypyruvate reductase 2; Short=AtHPR2; 
Short=HPR 2 [Arabidopsis thaliana]
 gb|AAG52259.1|AC011717_27 putative D-isomer specific 2-hydroxyacid dehydrogenase; 59386-58329 
[Arabidopsis thaliana]
 gb|AAL47452.1| At1g79870/F19K16_17 [Arabidopsis thaliana]
 gb|AAM47330.1| At1g79870/F19K16_17 [Arabidopsis thaliana]
 gb|AAM65710.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [Arabidopsis 
thaliana]
 gb|AEE36315.1| glyoxylate/hydroxypyruvate reductase A HPR2 [Arabidopsis thaliana]
Length=313

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNLLRFW  P+      + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELEKRFNLLRFWTSPEKSVLL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LPNLEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LISDLPNLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK    +FQ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--EFQLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC LT +T HI++RQV+D+LG  GV+INI RG H
Sbjct  176   TIKPDVAYKYYPTVVDLAQNSDILVVACPLTEQTRHIVDRQVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE ELI AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELIKALTEGRLGGAALDVFEQEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  296   VGNLEAHFSGKSLLTPVV  313



>ref|XP_010254094.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nelumbo nucifera]
Length=313

 Score =   385 bits (990),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 214/318 (67%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM  P++AYLE +L  RF L RFW  P+   F  + N+ S+RA+V NA VG D 
Sbjct  1     METIGVLMTSPISAYLEEELDKRFKLFRFWESPEKKEFLNK-NSLSIRAVVGNASVGCDA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S +SVGLDKVDL KCKE+G+RVTNTPDVLTDDVAD+A+ LILAVLR
Sbjct  60    --AMIDLLPKLEIVSNFSVGLDKVDLVKCKERGVRVTNTPDVLTDDVADLALALILAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
              I   DR+V+ G W      F+ T++FSGK+VGI+GLGRIG  IAKRAEAF C ISY+SR
Sbjct  118   GICACDRYVRGGSWIKG--DFKLTTKFSGKTVGILGLGRIGSGIAKRAEAFGCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K N NYKYYP+V+ELA+NC ILVVAC LT ET HI+NR+VID+LGP GV+INI RG H
Sbjct  176   SKKPNINYKYYPSVVELAANCDILVVACPLTEETRHIVNREVIDALGPKGVIINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+SALVEGRL GAGLDVFE EP V E+LF ++NVVLLPH G  TVETR  MADLV
Sbjct  236   VDEAELVSALVEGRLAGAGLDVFEHEPHVPEQLFDLENVVLLPHVGSGTVETRKDMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             +RNLEAHF+NKPL+T VV
Sbjct  296   IRNLEAHFLNKPLITPVV  313



>ref|XP_010924596.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Elaeis guineensis]
Length=316

 Score =   385 bits (988),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 203/316 (64%), Positives = 248/316 (78%), Gaps = 4/316 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAF-FAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMN YLE +LH R +L R W  P +    F Q NA S+RA+V NA VGAD
Sbjct  1     MESLGVLLTLPMNPYLEAELHRRCHLFRLWESPPAHRKDFLQANAPSIRAVVGNATVGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI+++YSVGLDKVDLA+C+E+GIRVT TPDVLTDD AD+AIGL +A L
Sbjct  61    AET--IDALPRLEIVASYSVGLDKVDLARCRERGIRVTYTPDVLTDDAADLAIGLSIATL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ E DR+V+ G WK A   ++ TS+FSGK+VGI+GLGRIGLA+AKRAEAF C I YHS
Sbjct  119   RRLCEADRYVRAGSWK-AKGDYKLTSRFSGKTVGILGLGRIGLAVAKRAEAFGCPICYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++  N NYKY+ +V+ELA NC +L+VAC LT ETHHIIN +VI++LGP GV++NI RG 
Sbjct  178   RTKNPNVNYKYFHSVLELAGNCDVLIVACPLTKETHHIINHEVINTLGPKGVLVNIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE ELISALVEGRLG A LDV+E EP++ EELF ++NVVL PH G AT ETR AMADL
Sbjct  238   HVDEPELISALVEGRLGAAALDVYEHEPDIPEELFRLENVVLTPHVGSATWETRKAMADL  297

Query  220   VVRNLEAHFMNKPLLT  173
             V+ NLEAH +NKPLLT
Sbjct  298   VLGNLEAHVLNKPLLT  313



>ref|XP_002889322.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65581.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=313

 Score =   384 bits (987),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 254/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNLLRFW  P+   F  + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELEKRFNLLRFWTCPEKSVFL-ESHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LINDLPKLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     FQ T++FSGKSVGIIGLGRIG AIAKRA+AF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--DFQLTTKFSGKSVGIIGLGRIGTAIAKRAQAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC LT +T HI++RQV+D+LG  GV+INI RG H
Sbjct  176   TVKPDVAYKYYPTVVDLAQNSDILVVACPLTDQTRHIVDRQVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEHEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             VRNLEAHF  K LLT VV
Sbjct  296   VRNLEAHFSGKSLLTPVV  313



>ref|XP_010430045.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Camelina 
sativa]
Length=313

 Score =   384 bits (986),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPMN+YLE++L  RFNLLRFW  P+      + +  S+RA+V NAFVGAD 
Sbjct  1     MESIGVLMMCPMNSYLENELEKRFNLLRFWTSPEKSVLL-ETHRNSIRAVVGNAFVGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL  CK+KGI VTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LINDLPKLEIVSSFSVGLDKIDLGVCKDKGIHVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     F+ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--DFKLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC L+ ET HI+NRQV+D+LGP GV+INI RG H
Sbjct  176   TVKPDVAYKYYPTVVDLAKNSDILVVACPLSDETRHIVNRQVMDALGPKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEKEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  296   VGNLEAHFSGKSLLTPVV  313



>gb|KFK42391.1| hypothetical protein AALP_AA2G250000 [Arabis alpina]
Length=313

 Score =   384 bits (985),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 213/318 (67%), Positives = 253/318 (80%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L NRFNLLRFW  P+   F  + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQNRFNLLRFWTAPEKSVFL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVGLDK+DLAKCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LITDLPKLEIVSSFSVGLDKIDLAKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DRFV+ G WK     F+ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRFVRSGKWKTG--DFKLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K + +YKYYPTV+ELA N  ILVVAC LT ET HI+N +V+D+LG  GV+INI RG H
Sbjct  176   TVKPDVDYKYYPTVVELAKNSDILVVACPLTDETRHIVNGEVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V +ELF ++NVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEQEPHVPQELFSLENVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K L+T VV
Sbjct  296   VNNLEAHFSGKSLITPVV  313



>ref|XP_006389715.1| hypothetical protein EUTSA_v10018906mg [Eutrema salsugineum]
 gb|ESQ27001.1| hypothetical protein EUTSA_v10018906mg [Eutrema salsugineum]
Length=313

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 212/318 (67%), Positives = 250/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM+ YLE +L  RFNL+RFW  P+      + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSTYLEDELQKRFNLVRFWTCPEKSVLL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LINDLPKLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V++G WK     FQ T++FSGKSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRRGKWKTG--DFQLTTKFSGKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV+ELA N  ILVVAC LT ET HI+NRQV+D+LG  GV+INI RG H
Sbjct  176   TVKPDVGYKYYPTVVELAENSDILVVACPLTDETRHIVNRQVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL +GRLGGA LDVFE EP V EELF +DNVVLLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTQGRLGGAALDVFEQEPHVPEELFALDNVVLLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  + LLT VV
Sbjct  296   VGNLEAHFSGRSLLTPVV  313



>dbj|BAJ96237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 198/319 (62%), Positives = 254/319 (80%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF L R W+ P D  A F + NA+++RA+V NA   AD
Sbjct  1     MESLGVLLLHPMNAYLEQELDRRFRLFRLWDSPPDGRAEFLRANASAIRAVVGNAGYNAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDL KC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--ALIDALPSLEIVASFSVGIDRVDLPKCRERGIRVTNTPDVLTDDVADLAVGLTIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ GLWK A   +  T++FSGK V I+GLGRIGLA+AKRAEAF C+ISYHS
Sbjct  119   RKIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVAILGLGRIGLAVAKRAEAFGCSISYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K   NYK++  V++LASNC +L+VAC+L+ ET+HI+NR+V+D+LGP+GV+INI RG 
Sbjct  178   RSEKPFPNYKFFTNVVDLASNCDVLIVACSLSAETNHIVNRKVMDALGPDGVLINIGRGA  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+E RLG AGLDVFE EP   E+LF +DNVVL+PH G  T ET  AMADL
Sbjct  238   HVDEPELVSALLEKRLGAAGLDVFEHEPFAPEQLFSLDNVVLVPHVGSDTEETCMAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V++NLEAH +NKPLLT V+
Sbjct  298   VLKNLEAHALNKPLLTPVI  316



>dbj|BAJ94452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   382 bits (982),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 249/319 (78%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF L R W+ P D  A F + NA+++RA+V NA   AD
Sbjct  1     MESLGVLLLHPMNAYLEQELDRRFRLFRLWDSPPDGRAEFLRANASAIRAVVGNAGYNAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDL KC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--ALIDALPSLEIVASFSVGIDRVDLPKCRERGIRVTNTPDVLTDDVADLAVGLTIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ GLWK A   +  T++FSGK VGIIGLGRIGLAIA R EAF+C ++Y+ 
Sbjct  119   RKIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVGIIGLGRIGLAIATRVEAFDCPVNYYQ  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K   NY YYP+V+ELA N  ILVVAC L  +T HI+NR+VI++LGP GV+INI RG 
Sbjct  178   RTKKDYPNYTYYPSVVELAVNSDILVVACPLNEQTRHIVNREVIEALGPKGVLINIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFEDEP V E LF +DNVVL+PH G  T ETR AMADL
Sbjct  238   HVDEPELVSALVEGRLGGAGLDVFEDEPNVPEALFALDNVVLVPHVGSGTHETRQAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH + KPLLT VV
Sbjct  298   VLGNLEAHVLKKPLLTPVV  316



>dbj|BAJ84809.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=318

 Score =   382 bits (982),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 249/319 (78%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF L R W+ P D  A F + NA+++RA+V NA   AD
Sbjct  3     MESLGVLLLHPMNAYLEQELDRRFRLFRLWDSPPDGRAEFLRANASAIRAVVGNAGYNAD  62

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDL KC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  63    A--ALIDALPSLEIVASFSVGIDRVDLPKCRERGIRVTNTPDVLTDDVADLAVGLTIAAL  120

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ GLWK A   +  T++FSGK VGIIGLGRIGLAIA R EAF+C ++Y+ 
Sbjct  121   RKIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVGIIGLGRIGLAIATRVEAFDCPVNYYQ  179

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K   NY YYP+V+ELA N  ILVVAC L  +T HI+NR+VI++LGP GV+INI RG 
Sbjct  180   RTKKDYPNYTYYPSVVELAVNSDILVVACPLNEQTRHIVNREVIEALGPKGVLINIGRGP  239

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFEDEP V E LF +DNVVL+PH G  T ETR AMADL
Sbjct  240   HVDEPELVSALVEGRLGGAGLDVFEDEPNVPEALFALDNVVLVPHVGSGTHETRQAMADL  299

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH + KPLLT VV
Sbjct  300   VLGNLEAHVLKKPLLTPVV  318



>ref|XP_011014261.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Populus 
euphratica]
Length=341

 Score =   382 bits (980),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 209/338 (62%), Positives = 252/338 (75%), Gaps = 10/338 (3%)
 Frame = -2

Query  1174  K*KKPPTEIIHTITLPY*HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQ  995
             K K P  E I  I      M++IGVLM CPM+ YLE QL   FNL R W+   S   F +
Sbjct  13    KEKDPNLEKISGI-----EMKSIGVLMTCPMHKYLEQQLETHFNLFRLWHCNSSITEFLK  67

Query  994   INAA-SVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTP  818
              +   ++RA+V N  +GAD     I  LP+LEI+++YSVGLDK+DL KC+EKGIRV NTP
Sbjct  68    THQGNTIRAVVGNTEIGADA--ELIASLPSLEIVASYSVGLDKIDLRKCEEKGIRVANTP  125

Query  817   DVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgri  638
             DVLTDDVAD+AIGLIL VLR I   D +V+ G WK A   F   ++FSGKSVGI+GLGRI
Sbjct  126   DVLTDDVADLAIGLILGVLRGICASDAYVRIGKWKDA--DFGLATKFSGKSVGIVGLGRI  183

Query  637   glaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINR  458
             G AIAKRAEAF C+ISY SRSQK   +YK+Y  +I+LA++CQIL+VACALT ET HIINR
Sbjct  184   GTAIAKRAEAFGCSISYFSRSQKPFASYKFYSNIIDLATSCQILIVACALTEETRHIINR  243

Query  457   QVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVV  278
             +VID+LGP G++INI RG HVDE EL+SAL+EGRLGGAGLDV+E+EPEV EEL G+ NVV
Sbjct  244   EVIDALGPKGILINIGRGAHVDETELVSALLEGRLGGAGLDVYENEPEVPEELLGLGNVV  303

Query  277   LLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             L PH G  TVET +AMADLV+ NL+AHF  K LLT V+
Sbjct  304   LQPHVGSDTVETSDAMADLVISNLKAHFSKKSLLTPVI  341



>ref|XP_002299712.2| hypothetical protein POPTR_0001s18420g [Populus trichocarpa]
 gb|EEE84517.2| hypothetical protein POPTR_0001s18420g [Populus trichocarpa]
Length=341

 Score =   381 bits (978),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 252/338 (75%), Gaps = 10/338 (3%)
 Frame = -2

Query  1174  K*KKPPTEIIHTITLPY*HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQ  995
             K K P  E I  I      M++IGVLM CPM+ YLE QL   FNL + W+   S   F +
Sbjct  13    KEKNPNLEKISGI-----KMKSIGVLMTCPMHKYLEQQLETHFNLFKLWHCNSSITEFLK  67

Query  994   INAA-SVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTP  818
              +   ++RA+V N  +GAD     I  LP+LEI+++YSVGLDK+DL KC+EKGIRV NTP
Sbjct  68    THQGNTIRAVVGNTEIGADA--ELIASLPSLEIVASYSVGLDKIDLRKCEEKGIRVANTP  125

Query  817   DVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgri  638
             DVLTDDVAD+AIGLIL VLR I   D +V+ G WK A   F   ++FSGKSVGI+GLGRI
Sbjct  126   DVLTDDVADLAIGLILGVLRGICASDAYVRIGKWKDA--DFGLATKFSGKSVGIVGLGRI  183

Query  637   glaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINR  458
             G AIAKRAEAF C+ISY SRSQK   NYK+Y  +I+LA++CQIL+VACALT ET HIINR
Sbjct  184   GTAIAKRAEAFGCSISYFSRSQKPFANYKFYSNIIDLATSCQILIVACALTEETRHIINR  243

Query  457   QVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVV  278
             +VID+LGP G++INI RG HVDE EL+SAL+EGRLGGAGLDV+E+EP+V EEL G+ NVV
Sbjct  244   EVIDALGPKGILINIGRGAHVDETELVSALLEGRLGGAGLDVYENEPDVPEELLGLGNVV  303

Query  277   LLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             L PH G  TVET +AMADLV+ NL+AHF  K LLT V+
Sbjct  304   LQPHVGSDTVETSDAMADLVISNLKAHFSKKSLLTPVI  341



>gb|EPS61208.1| hypothetical protein M569_13592, partial [Genlisea aurea]
Length=320

 Score =   380 bits (975),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 252/319 (79%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVLM  P N+YLE +L  RFNL R+W+  + +   AQ ++  +RA VVNA +G D 
Sbjct  8     MEKIGVLMMAPFNSYLEQELDKRFNLFRYWS-RNPNELLAQ-HSEKIRAAVVNAGIGVDA  65

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVGLDK+DL  C+ KGIRVTNTPDVLTDDVAD+AIGL L+V+R
Sbjct  66    --ELIHALPKLEIISSFSVGLDKIDLKTCEGKGIRVTNTPDVLTDDVADLAIGLALSVMR  123

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+   DRFV+ G WK  + QF+  ++FSGK VGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  124   KLCACDRFVRSGAWK--NGQFELATKFSGKRVGIIGLGRIGSAIAKRAEAFDCQINYYSR  181

Query  577   SQK-LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             S+K +  NYKY+ +V +LASN  +LVVACALTPET HI+NR+VI++LGP+GV+INIARGG
Sbjct  182   SEKQIAVNYKYFSSVTDLASNSDVLVVACALTPETTHIVNREVIEALGPDGVLINIARGG  241

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDEAEL+SALVEGRLGGAGLDVFE+EP+  E+L G+DNVVLL H G  TVETR  MADL
Sbjct  242   HVDEAELVSALVEGRLGGAGLDVFENEPDAPEQLLGLDNVVLLSHVGSGTVETRKDMADL  301

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NL+A+F   PLLT VV
Sbjct  302   VLGNLQAYFSGHPLLTPVV  320



>ref|XP_006300949.1| hypothetical protein CARUB_v10021337mg [Capsella rubella]
 gb|EOA33847.1| hypothetical protein CARUB_v10021337mg [Capsella rubella]
Length=313

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 251/318 (79%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNLLR+W  P+  AF  + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQKRFNLLRYWTSPEKSAFL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S++SVGLDK+DL  CKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LISDLPKLEIVSSFSVGLDKIDLGICKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK     FQ T++FS KSVGIIGLGRIG AIAKRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQG--DFQLTTKFSRKSVGIIGLGRIGTAIAKRAEAFSCPINYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC LT ET HI+NRQV+D+LG  GV+INI RG H
Sbjct  176   TVKPDVAYKYYPTVVDLAKNSDILVVACPLTDETTHIVNRQVMDALGAKGVLINIGRGPH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+ AL EGRLGGA LDVFE EP V EELFG++NV+LLPH G  TVETRNAMADLV
Sbjct  236   VDEQELVKALTEGRLGGAALDVFEKEPHVPEELFGLENVILLPHVGSGTVETRNAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF  K LLT VV
Sbjct  296   LGNLEAHFSGKSLLTPVV  313



>ref|XP_009390691.1| PREDICTED: hydroxyphenylpyruvate reductase [Musa acuminata subsp. 
malaccensis]
Length=316

 Score =   379 bits (974),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 205/319 (64%), Positives = 261/319 (82%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFW-NFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  R+ + R W + P+    F + NAA++RA+V N+  GAD
Sbjct  1     MESLGVLLPVPMNAYLESELARRYKVFRLWESPPERRQDFIRANAAAIRAVVGNSKAGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++ +SVGLDKVDLAKC+E+GIRVTNTPDVLT+DVAD+AIGL +AVL
Sbjct  61    A--DTIDALPRLEIVACFSVGLDKVDLAKCRERGIRVTNTPDVLTEDVADLAIGLAIAVL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++ + DR+V+ G W ++   ++ T++FSGK++GIIGLGRIGLAIAKRAEAF C ISY+S
Sbjct  119   RRLCQADRYVRSGTW-LSKGDYKLTTRFSGKTIGIIGLGRIGLAIAKRAEAFGCPISYYS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K NTNYKYY  +++LA+NC +LVVAC+LT ET+HI+NR+V+D+LGP GV++NI RG 
Sbjct  178   RSEKPNTNYKYYSNLVDLAANCHVLVVACSLTEETYHIVNREVLDALGPKGVLVNIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL++AL EGRLGGAGLDVFE EP+V EELFG++NVVL+PH G  T ETRNAMADL
Sbjct  238   HVDEPELVTALREGRLGGAGLDVFEHEPDVPEELFGMENVVLVPHVGSGTNETRNAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH MNKPLLT VV
Sbjct  298   VLGNLEAHVMNKPLLTPVV  316



>ref|XP_011009822.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Populus 
euphratica]
Length=341

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 208/338 (62%), Positives = 252/338 (75%), Gaps = 10/338 (3%)
 Frame = -2

Query  1174  K*KKPPTEIIHTITLPY*HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQ  995
             K K P  E I  I      M++IGVLM CPM+ YLE QL   FNL R W+   S   F +
Sbjct  13    KEKDPNLEKISGI-----EMKSIGVLMTCPMHKYLEQQLETHFNLFRLWHCNSSITEFLK  67

Query  994   INAA-SVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTP  818
              +   ++RA+V N  +GAD     I  LP+LEI+++YSVGLDK+DL KC+EKGIRV+NTP
Sbjct  68    THQGNTIRAVVGNTEIGADA--ELIASLPSLEIVASYSVGLDKIDLRKCEEKGIRVSNTP  125

Query  817   DVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgri  638
             DVLT DVAD+AIGLIL VLR I   D +V+ G WK A   F   ++FSGKSVGI+GLGRI
Sbjct  126   DVLTHDVADLAIGLILGVLRGICASDAYVRIGKWKDA--DFGLATKFSGKSVGIVGLGRI  183

Query  637   glaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINR  458
             G AIAKRAEAF C+ISY SRSQK   +YK+Y  +I+LA++CQIL+VACALT ET HIINR
Sbjct  184   GTAIAKRAEAFGCSISYFSRSQKPFASYKFYSNIIDLATSCQILIVACALTEETRHIINR  243

Query  457   QVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVV  278
             +VID+LGP G++INI RG HVDE EL+SAL+EGRLGGAGLDV+E+EPEV EEL G+ NVV
Sbjct  244   EVIDALGPKGILINIGRGAHVDETELVSALLEGRLGGAGLDVYENEPEVPEELLGLGNVV  303

Query  277   LLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             L PH G  TVET +AMADLV+ NL+AHF  K LLT V+
Sbjct  304   LQPHVGSDTVETSDAMADLVISNLKAHFSKKSLLTPVI  341



>gb|KDO56911.1| hypothetical protein CISIN_1g042102mg [Citrus sinensis]
Length=317

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/316 (65%), Positives = 252/316 (80%), Gaps = 5/316 (2%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLD  932
             NI VLM CP++ YLE ++   F + + W+F D + F    +  S++A+V +A  GAD   
Sbjct  7     NIIVLMVCPVSNYLEQEIEKSFKVFKLWHFEDKEQFI-NTHKDSIQAVVGSAAAGADA--  63

Query  931   VFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKI  752
               I+ LP LEI++T SVGLDK+DLA+CKEKGIRV NTPDVLTDDVAD+AIGLILAVLR+I
Sbjct  64    ELIESLPKLEIVATCSVGLDKIDLARCKEKGIRVANTPDVLTDDVADLAIGLILAVLRRI  123

Query  751   SEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQ  572
              E DR+V+ G WK    +F+ T++F+GKSVGI+G+GRIG AIAKRAEAF+C I Y+SR++
Sbjct  124   CESDRYVRSGEWKKG--EFKMTTKFTGKSVGILGMGRIGTAIAKRAEAFDCIIGYNSRTE  181

Query  571   KLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVD  392
             K N NYKYYP +I+LASNCQILVVAC+LT ET HI+NRQVI++LGP GV+INI RG  VD
Sbjct  182   KPNLNYKYYPNLIDLASNCQILVVACSLTEETQHIVNRQVINALGPKGVLINIGRGLLVD  241

Query  391   EAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVR  212
             E EL+SAL++GRLGGAGLDVFE EP+V EEL G++NVVLLPH   ATVETR AMADLVV 
Sbjct  242   EHELVSALLQGRLGGAGLDVFEHEPDVPEELIGLENVVLLPHVASATVETRKAMADLVVG  301

Query  211   NLEAHFMNKPLLTRVV  164
             NL+AHF  KPLLT VV
Sbjct  302   NLQAHFGKKPLLTPVV  317



>ref|XP_006465733.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Citrus 
sinensis]
Length=317

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/316 (65%), Positives = 251/316 (79%), Gaps = 5/316 (2%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLD  932
             NI VLM CP++ YLE ++   F + + W+F D + F    +  S++A+V +A  GAD   
Sbjct  7     NIIVLMVCPVSNYLEQEIEKSFKVFKLWHFEDKEQFI-NTHKDSIQAVVGSAAAGADA--  63

Query  931   VFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKI  752
               I+ LP LEI++T SVGLDK+DLA+CKEKGIRV NTPDVLTDDVAD+AIGLILAVLR+I
Sbjct  64    ELIESLPKLEIVATCSVGLDKIDLARCKEKGIRVANTPDVLTDDVADLAIGLILAVLRRI  123

Query  751   SEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQ  572
              E DR+V+ G WK    +F+ T++F+GKSVGI+G+GRIG  IAKRAEAF+C I Y+SR++
Sbjct  124   CESDRYVRSGEWKKG--EFKMTTKFTGKSVGILGMGRIGTVIAKRAEAFDCIIGYNSRTE  181

Query  571   KLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVD  392
             K N NYKYYP +I+LASNCQILVVAC+LT ET HI+NRQVI++LGP GV+INI RG  VD
Sbjct  182   KPNLNYKYYPNLIDLASNCQILVVACSLTEETQHIVNRQVINALGPKGVLINIGRGLLVD  241

Query  391   EAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVR  212
             E EL+SAL++GRLGGAGLDVFE EP+V EEL G++NVVLLPH   ATVETR AMADLVV 
Sbjct  242   EHELVSALLQGRLGGAGLDVFEHEPDVPEELIGLENVVLLPHVASATVETRKAMADLVVG  301

Query  211   NLEAHFMNKPLLTRVV  164
             NL+AHF  KPLLT VV
Sbjct  302   NLQAHFGKKPLLTPVV  317



>ref|XP_006426957.1| hypothetical protein CICLE_v10026933mg [Citrus clementina]
 gb|ESR40197.1| hypothetical protein CICLE_v10026933mg [Citrus clementina]
Length=317

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 205/316 (65%), Positives = 252/316 (80%), Gaps = 5/316 (2%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLD  932
             NI VLM CP++ YLE ++   F + + W+F D + F    +  S++A+V +A  GAD   
Sbjct  7     NIIVLMVCPVSNYLEQEIEKSFKVFKLWHFEDKEQFI-NTHKDSIQAVVGSAAAGADA--  63

Query  931   VFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKI  752
               I+ LP LEI++T SVGLDK+DLA+CKEKGIRV NTPDVLTDDVAD+AIGLILAVLR+I
Sbjct  64    ELIESLPKLEIVATCSVGLDKIDLARCKEKGIRVANTPDVLTDDVADLAIGLILAVLRRI  123

Query  751   SEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQ  572
              E DR+V+ G WK    +F+ T++F+GKSVGI+G+GRIG AIAKRAEAF+C I Y+SR++
Sbjct  124   CESDRYVRSGEWKKG--EFKLTTKFTGKSVGILGMGRIGTAIAKRAEAFDCIIGYNSRTE  181

Query  571   KLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVD  392
             K N NYKYYP +I+LASNCQILVVAC+LT ET HI+NRQVI++LGP GV+INI RG  VD
Sbjct  182   KPNLNYKYYPNLIDLASNCQILVVACSLTEETQHIVNRQVINALGPKGVLINIGRGLLVD  241

Query  391   EAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVR  212
             E EL+SAL++GRLGGAGLDVFE EP+V EEL G++NVVLLPH   ATVETR AMADLVV 
Sbjct  242   EHELVSALLQGRLGGAGLDVFEHEPDVPEELIGLENVVLLPHVASATVETRKAMADLVVG  301

Query  211   NLEAHFMNKPLLTRVV  164
             NL+AHF  KPLLT VV
Sbjct  302   NLQAHFGKKPLLTPVV  317



>emb|CDX87280.1| BnaA07g35930D [Brassica napus]
Length=310

 Score =   376 bits (966),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 250/318 (79%), Gaps = 8/318 (3%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNL+RFWNFP     F + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQKRFNLVRFWNFP----VFLETHRNSIRAVVGNASTGADA  56

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  57    --ELIDGLPKLEIISSFSVGIDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  114

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+   W+     FQ  ++FSGKSVGI+GLGRIG AIAKRAEAF+C +SY+SR
Sbjct  115   RLCECDRYVRSRKWEYG--DFQLATKFSGKSVGILGLGRIGTAIAKRAEAFSCPVSYYSR  172

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
               K +  YKYYPTV+ELA N  ILVVAC LT ET HI+NR V+D+LG  GV+INI RG H
Sbjct  173   RVKPDLGYKYYPTVVELAQNSDILVVACPLTDETRHIVNRHVMDALGAKGVLINIGRGPH  232

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL EGRLGGA LDVFE EP V EELF ++NVVLLPH G +TVET NAMADLV
Sbjct  233   VDEQELVNALTEGRLGGAALDVFEQEPHVPEELFPLENVVLLPHVGSSTVETENAMADLV  292

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  293   VANLEAHFAGKSLLTPVV  310



>ref|XP_009106776.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Brassica 
rapa]
Length=310

 Score =   376 bits (965),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 210/318 (66%), Positives = 250/318 (79%), Gaps = 8/318 (3%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNL+RFWNFP     F + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELQKRFNLVRFWNFP----VFLETHRNSIRAVVGNASTGADA  56

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++SVG+DK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  57    --ELIDGLPKLEIISSFSVGIDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  114

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+   W+     FQ  ++FSGKSVGI+GLGRIG AIAKRAEAF+C +SY+SR
Sbjct  115   RLCECDRYVRSRKWEYG--DFQLATKFSGKSVGILGLGRIGTAIAKRAEAFSCPVSYYSR  172

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
               K +  YKYYPTV+ELA N  ILVVAC LT ET HI+NR V+D+LG  GV+INI RG H
Sbjct  173   RVKPDLGYKYYPTVVELAQNSDILVVACPLTDETRHIVNRHVMDALGAKGVLINIGRGPH  232

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL EGRLGGA LDVFE EP V EELF ++NVVLLPH G +TVET NAMADLV
Sbjct  233   VDEEELVNALTEGRLGGAALDVFEQEPHVPEELFPLENVVLLPHVGSSTVETENAMADLV  292

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  293   VANLEAHFAGKSLLTPVV  310



>ref|XP_010098078.1| Glyoxylate reductase [Morus notabilis]
 gb|EXB74515.1| Glyoxylate reductase [Morus notabilis]
Length=349

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/359 (57%), Positives = 246/359 (69%), Gaps = 53/359 (15%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+I VLM  PMNAYLE QL  RFNL + W  P   A F + NA SVRA++ NA  GAD 
Sbjct  1     MESICVLMPIPMNAYLERQLEKRFNLFKLWTVPQK-AQFIKDNADSVRAVIGNATSGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVG+DKVDL KCKEKGIRVTNTPDVLTDDVAD+AIGL+LA+LR
Sbjct  60    --ELIDALPKLEIVASFSVGIDKVDLKKCKEKGIRVTNTPDVLTDDVADLAIGLMLALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFS------------GKSVgiiglg----------  644
             ++ E DRFV+ G WK+    ++ T++FS            G++V                
Sbjct  118   RLCESDRFVRSGKWKLG--AYKLTTKFSGKTVGIIGLGRIGQAVATRAEAFDCPISYYSR  175

Query  643   --------------------riglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELA  524
                                 RIG A+A RAEAF+C ISY+SRSQK +  YKYYPTV+ELA
Sbjct  176   SQKADVKRDSPHRQPIIGLGRIGQAVATRAEAFDCPISYYSRSQKADVKYKYYPTVVELA  235

Query  523   SNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGA  344
             +N  ILVVACALT ET HI+NR+V+D+LGP G      RG HVDE EL+SALVEGRLGGA
Sbjct  236   ANSDILVVACALTEETRHIVNREVMDALGPKG------RGPHVDERELVSALVEGRLGGA  289

Query  343   GLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
             GLDV+E+EPEV EELFG++NVVLLPH G  T ETR AMADLV+ NLEAHF+ KPLLT V
Sbjct  290   GLDVYENEPEVPEELFGLENVVLLPHVGSGTNETRQAMADLVIGNLEAHFLKKPLLTPV  348



>ref|XP_009800851.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nicotiana sylvestris]
Length=311

 Score =   375 bits (964),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/318 (63%), Positives = 242/318 (76%), Gaps = 7/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME IGVL+  P++ YL+ +L  RF L ++W  P       ++++ S+RA+V N   GA+ 
Sbjct  1     MEGIGVLLMRPLSNYLQQELTKRFTLFKYWEIPSESL---KLHSNSIRAVVGNGVQGAN-  56

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++S GLDK+DL KCKE+GIRVT+TPD LTDDVAD+AI L LA LR
Sbjct  57    -SALIDSLPRLEIVSSHSSGLDKIDLVKCKERGIRVTSTPDALTDDVADMAILLTLATLR  115

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DRFV+ G+WK     F+ T++FSGKSVGI+GLGRIG AIAKRAEAF C+ISY SR
Sbjct  116   RICEADRFVRNGIWK--EKDFKLTTKFSGKSVGIVGLGRIGSAIAKRAEAFGCSISYTSR  173

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             SQK  + Y YYP V +LASNCQILVVACALT ET HIINR+VID++GP+ VVINIARG H
Sbjct  174   SQKPESTYTYYPHVSDLASNCQILVVACALTDETRHIINREVIDAMGPHEVVINIARGSH  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL EGRLGGAGLDV E EPE    L G+DNVVL PH   +T+ETR  MADLV
Sbjct  234   IDEPELVSALAEGRLGGAGLDVLEYEPEAPVLLAGLDNVVLSPHVAASTLETRKDMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF +KPLLT V+
Sbjct  294   VANLEAHFSDKPLLTPVI  311



>ref|NP_001150094.1| glyoxylate reductase [Zea mays]
 gb|ACG37807.1| glyoxylate reductase [Zea mays]
 gb|ACR34451.1| unknown [Zea mays]
Length=315

 Score =   375 bits (962),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 251/320 (78%), Gaps = 7/320 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVL+  P NAYLE +L  RF L RFW  P  +  F + +A +VRA+V NA  GAD 
Sbjct  1     MESLGVLLLHPFNAYLEQELDRRFRLYRFWETPREE--FLRAHAGAVRAVVGNASYGADA  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVG+D+VDLAKC+++GIRVTNTPDVLTDDVAD+A+GL +AVLR
Sbjct  59    --ALIDALPALEIVASFSVGIDRVDLAKCRDRGIRVTNTPDVLTDDVADLAVGLAIAVLR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I + DR+V+ GLWK +   +  T++FSGK VGIIGLGRIG A+AKR EAF+C +SYH R
Sbjct  117   RIPQADRYVRAGLWK-SRGDYTLTTRFSGKRVGIIGLGRIGQAVAKRVEAFDCPVSYHQR  175

Query  577   SQKLNT--NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             +++  T  +Y YYP+V+ELA+N  +LVVAC L  +T HI++R+V+++LGP+GV+IN+ RG
Sbjct  176   TEQRATYPSYTYYPSVVELAANSDVLVVACPLNAQTRHIVSREVMEALGPSGVLINVGRG  235

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
              HVDE E+++AL +GRLGGAGLDVFEDEP V E L G+DNVVLLPH G  T ETR AMAD
Sbjct  236   PHVDEREMVAALADGRLGGAGLDVFEDEPNVPEALLGMDNVVLLPHVGSGTNETRKAMAD  295

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEAH ++KPLLT VV
Sbjct  296   LVLGNLEAHVLSKPLLTPVV  315



>ref|XP_004967419.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Setaria italica]
Length=317

 Score =   374 bits (960),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 197/320 (62%), Positives = 248/320 (78%), Gaps = 5/320 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAF--FAQINAASVRALVVNAFVGA  944
             ME++GVL+  PMNAYLE +L  R  L RFW  P       F + +A S+RA+V NA  GA
Sbjct  1     MESLGVLLLHPMNAYLEQELDRRCRLHRFWEAPPGPPRDEFLRAHAGSIRAVVGNASYGA  60

Query  943   DLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAV  764
             D     ID LP LEI++++SVG+D+VDLAKC+E+GIRVTNTPDVLTDDVAD+A+GL +AV
Sbjct  61    DA--ALIDALPALEIVASFSVGIDRVDLAKCRERGIRVTNTPDVLTDDVADLAVGLAIAV  118

Query  763   LRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYH  584
             LR+I + DRFV+ GLWK A   +  T++FSGK VGIIGLGRIGLA+AKR EAF+C ++Y+
Sbjct  119   LRRIPQADRFVRAGLWK-AKGDYALTTRFSGKRVGIIGLGRIGLAVAKRVEAFDCPVNYY  177

Query  583   SRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
              R+++   NY YYP+V+ELA+N  +LVVAC L  +T HI+NR+V+D+LGP GV+INI RG
Sbjct  178   QRTKQDYPNYTYYPSVVELAANSDLLVVACPLNAQTRHIVNREVMDALGPKGVLINIGRG  237

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
              HVDE EL++ALVEGRLGGAGLDVFEDEP V E LF +DNVV++PH G  T ETR  MAD
Sbjct  238   PHVDEPELVAALVEGRLGGAGLDVFEDEPNVPEALFTMDNVVVVPHIGSGTNETRKGMAD  297

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEAH + KPLLT V+
Sbjct  298   LVLGNLEAHVLKKPLLTPVL  317



>dbj|BAD82415.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [Oryza 
sativa Japonica Group]
 dbj|BAG95040.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   374 bits (959),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 248/319 (78%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             M+++GVL+  PMNAYLE +L  R  L R W  P D    + + +A+S+RA+V  A  G D
Sbjct  1     MDSLGVLLVAPMNAYLEQELDRRCRLFRLWESPADRRDDYLRAHASSIRAVVPYALQGVD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI+S++SVG+D+VDL  C  +G+RVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--AMIDALPSLEIVSSFSVGIDRVDLDACLRRGVRVTNTPDVLTDDVADLAVGLAIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ G WK +   F  T++FSGK VGI+GLGRIGLA+AKRAEAF+C ISYHS
Sbjct  119   RKIPQADRYVRAGKWK-SKGDFTLTTRFSGKRVGILGLGRIGLAVAKRAEAFDCPISYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K    YK+YP V++LA+NC +LVVAC+L PET HI+NR+VID+LGP GV+INIARG 
Sbjct  178   RSEKPFPKYKFYPNVVDLAANCDVLVVACSLNPETRHIVNRKVIDALGPEGVLINIARGA  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE ELISAL+E RLGGAGLDVFEDEP   E+LF +DNVVL+PH G  T ET  AMADL
Sbjct  238   HVDEPELISALLEKRLGGAGLDVFEDEPFAPEQLFELDNVVLVPHVGSDTEETCWAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V++NLEAH +N+PLLT V+
Sbjct  298   VLQNLEAHALNQPLLTPVI  316



>gb|AGW27202.1| putative hydroxyphenylpyruvate reductase 2 [Salvia miltiorrhiza]
Length=313

 Score =   374 bits (959),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 197/318 (62%), Positives = 239/318 (75%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             MEN+GV+M  PM+AYLE QL  RF L + W  P    F  +  A SV A+V +  +GAD 
Sbjct  1     MENVGVMMTTPMSAYLEQQLQQRFTLFKLWESPSRTQFLTR-RADSVNAVVGDTKIGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+STYSVGLDK+DL KC+E+GIRVTNTPDVLTDDVAD+AIGL L  LR
Sbjct  59    -SELIDSLPRLEIVSTYSVGLDKIDLDKCRERGIRVTNTPDVLTDDVADLAIGLALTTLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   D FV+ G W+  +  FQ  ++FSGKSVGI+GLGRIG AIAKRA+AF C I YHSR
Sbjct  118   RICACDAFVRNGSWR--NGDFQLATKFSGKSVGILGLGRIGSAIAKRAKAFGCTIGYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K  T+Y+Y+   ++LA+NC+IL VAC+LT ET HI+NR+VID+LGP GV++N+ RG  
Sbjct  176   TKKQITDYRYHSNAVDLAANCRILFVACSLTDETRHIVNREVIDALGPGGVLVNVGRGAL  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL EGRLGGAGLDVFE+EP V E  F + NVVLLPH G  TVET N MADLV
Sbjct  236   VDEHELVSALCEGRLGGAGLDVFENEPHVPELFFELVNVVLLPHVGTDTVETSNTMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLE HF+ KPLLT V+
Sbjct  296   VANLECHFLKKPLLTPVI  313



>ref|XP_003565909.1| PREDICTED: hydroxyphenylpyruvate reductase isoform X1 [Brachypodium 
distachyon]
Length=316

 Score =   373 bits (958),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 253/319 (79%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFW-NFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF LLR W + PDS A F + NA+++RA+V NA   AD
Sbjct  1     MESLGVLLLHPMNAYLEQELDRRFRLLRLWESPPDSRADFLRANASAIRAVVGNAGYNAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDLAKC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--ALIDALPSLEIVASFSVGIDRVDLAKCRERGIRVTNTPDVLTDDVADLAVGLAIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I + DR+V+ GLWK A   +  T++FSGK VGIIGLGRIGLA+A R EAF+C ++Y+ 
Sbjct  119   RRIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVGIIGLGRIGLAVATRVEAFDCPVNYYQ  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K   NY YYPTV+ELASN  +LVVAC L  +T HI+NR+VI++LGP GV+INI RG 
Sbjct  178   RTKKEYPNYTYYPTVLELASNSDVLVVACPLNEQTRHIVNREVIEALGPKGVLINIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SALVEGRLGGAGLDVFEDEP V E LF +DNVVL+PH G  T ETR AMADL
Sbjct  238   HVDEPELVSALVEGRLGGAGLDVFEDEPNVPEALFALDNVVLVPHVGSGTHETRKAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH + KPLLT VV
Sbjct  298   VLGNLEAHVLKKPLLTPVV  316



>gb|KEH28789.1| D-glycerate dehydrogenase/hydroxypyruvate reductase [Medicago 
truncatula]
Length=313

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 203/318 (64%), Positives = 249/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M  I VL+   +  YL+ +L+ R+NL R W+FP       Q + AS+RA+V NA  GAD 
Sbjct  1     MGLIDVLLVAKVIPYLDQELNKRYNLFRIWDFPQKSQLLTQ-HGASIRAVVGNASAGAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I+ LP LEI+S+YSVG+D +DL  CKEKGIRVTNTPDVLTDDVAD+AI LIL +LR
Sbjct  59    -SNLIEALPKLEIVSSYSVGVDMIDLNMCKEKGIRVTNTPDVLTDDVADLAICLILTLLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DRFV+ G WK     ++ T++FSGK++GIIG+GRIG A+AKRAE FNC+I Y+SR
Sbjct  118   RILECDRFVRSGNWKRG--DYKLTTKFSGKTIGIIGMGRIGTAVAKRAEGFNCSICYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK    YKYYP++IELASNC ILVVAC LT ETHHIINR+VI++LGP GV+INI RG H
Sbjct  176   TQKQEPKYKYYPSLIELASNCDILVVACPLTEETHHIINREVINALGPKGVLINIGRGKH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SAL+EGRLGGAGLDV+E+EP V EELFG++NVVLLPH G  TVETR AMADL+
Sbjct  236   VDEPELVSALLEGRLGGAGLDVYENEPHVPEELFGLENVVLLPHIGSGTVETRAAMADLL  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+ KPLLT +V
Sbjct  296   LGNLEAHFLGKPLLTPLV  313



>ref|XP_010254093.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Nelumbo nucifera]
Length=313

 Score =   371 bits (953),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 207/318 (65%), Positives = 248/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME +GVLM  P +AYLE +L  RF L RFW   +   F  + N+  +RA+V NA  G D 
Sbjct  1     METVGVLMTKPFSAYLEEELDKRFKLFRFWESSNRKEFLKE-NSHLIRAVVGNATAGCDA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP LEI+S +SVGLDKVDL KCKE+GIRVTNTPDVLTDDVAD+A+ LILAVLR
Sbjct  60    --EMIGLLPKLEIVSNFSVGLDKVDLVKCKERGIRVTNTPDVLTDDVADLALALILAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   DR+V  G W   +  F+ T++FSGKSVGI+GLGRIG AIAKRA AF C ISY+SR
Sbjct  118   RICACDRYVTSGSW--INGNFKLTTKFSGKSVGILGLGRIGSAIAKRANAFGCPISYYSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K NT+YKYYP+ +ELA+NC+ILV+ACALT ETHHI+NR+VID+LGP G++INI RG H
Sbjct  176   SEKSNTDYKYYPSAVELAANCEILVIACALTEETHHIVNREVIDALGPQGIIINIGRGSH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SALVEGRL GAGLDVFE+EP+V E+LFG+DNVVLL H G  TVET   MADLV
Sbjct  236   IDEPELVSALVEGRLAGAGLDVFENEPQVPEQLFGLDNVVLLSHVGSDTVETCKEMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+NKPLLT  V
Sbjct  296   IANLEAHFLNKPLLTPAV  313



>ref|XP_006343075.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum tuberosum]
Length=312

 Score =   371 bits (952),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 237/317 (75%), Gaps = 7/317 (2%)
 Frame = -2

Query  1114  ENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLL  935
             E +GVL+  P++ Y++ +L  RF L ++W  P       ++++  +RA+V N   GAD  
Sbjct  3     EIVGVLLMRPLSNYIQQELAKRFTLFKYWEIPSESL---KLHSDVIRAVVGNGVQGAD--  57

Query  934   DVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRK  755
                ID LP LEI+S++S GLDK+DL KCKE+GIRVT+ PD  TDDVAD AI L +A LR+
Sbjct  58    SALIDSLPRLEIVSSHSSGLDKIDLVKCKERGIRVTSAPDGPTDDVADTAILLTIATLRR  117

Query  754   ISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRS  575
             I   DRFV+ G+WK     F  T++FSGKSVGI+GLGRIG +IAKRAEAF C+ISYHSRS
Sbjct  118   ICVADRFVRNGIWK--EKDFNLTAKFSGKSVGIVGLGRIGSSIAKRAEAFGCSISYHSRS  175

Query  574   QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHV  395
             QK  + Y YY  VI+LASNCQILVVACALT ETHHIINR+VID+LGPNGVVINIARG H+
Sbjct  176   QKSESTYTYYSRVIDLASNCQILVVACALTDETHHIINREVIDALGPNGVVINIARGSHI  235

Query  394   DEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVV  215
             DE EL+SAL EGRLGGAGLD  E EPEV  +L  +DNVVL PH    TVETR  MADLV+
Sbjct  236   DEPELVSALAEGRLGGAGLDGLEHEPEVPTQLASLDNVVLSPHTAAGTVETRKEMADLVI  295

Query  214   RNLEAHFMNKPLLTRVV  164
              NLEA+F NKPLLT V+
Sbjct  296   ANLEAYFSNKPLLTPVL  312



>ref|XP_002454895.1| hypothetical protein SORBIDRAFT_03g000950 [Sorghum bicolor]
 gb|EES00015.1| hypothetical protein SORBIDRAFT_03g000950 [Sorghum bicolor]
Length=485

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/315 (62%), Positives = 249/315 (79%), Gaps = 5/315 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVL+  P+NAYLE +L  R  L RFW  P  +  F + +A +VRA+V NA  GAD 
Sbjct  1     MESLGVLLLHPVNAYLEQELDRRCRLYRFWESPREE--FLRAHAGAVRAVVGNANYGADA  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVG+D+VDLAKC+E+GIRVTNTPDVLTDDVAD+A+GL +AVLR
Sbjct  59    --ALIDALPALEIVASFSVGIDRVDLAKCRERGIRVTNTPDVLTDDVADLAVGLAIAVLR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I + DR+V+ GLWK +   +  T++FSGK V I+GLGRIGLAIAKRAE+F C+ISY+SR
Sbjct  117   RIPQADRYVRAGLWK-SRGDYTLTTRFSGKRVAILGLGRIGLAIAKRAESFGCSISYNSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K   NYK+Y  V++LA+NC +L+VAC+L  ETHHI+NR+VID+LGP GV++N+ RG H
Sbjct  176   SEKPFPNYKFYANVVDLAANCDVLIVACSLNAETHHIVNREVIDALGPEGVLVNVGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL+SALVE RLGGAGLDV+E EP V E LFG+DNVV++PH G  T ET  AMADLV
Sbjct  236   VDEPELVSALVEKRLGGAGLDVYEHEPVVPERLFGLDNVVVVPHVGSDTEETCRAMADLV  295

Query  217   VRNLEAHFMNKPLLT  173
             + NLEAH  N+PLLT
Sbjct  296   LGNLEAHASNEPLLT  310


 Score =   209 bits (531),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 140/176 (80%), Gaps = 2/176 (1%)
 Frame = -2

Query  685  SQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNT--NYKYYPTVIELASNCQ  512
            + FSGK VGIIGLGRIG A+A+R EAF+C +SY+ R+++ +   NY YYP+V+ELASN  
Sbjct  310  TPFSGKRVGIIGLGRIGQAVARRVEAFDCPVSYYQRTEQASVYPNYTYYPSVVELASNSD  369

Query  511  ILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDV  332
            +LVVAC L   T HI++R+V+++LGP GV+INI RG HVDE E+++AL +GRLGGAGLDV
Sbjct  370  VLVVACPLNASTRHIVSREVMEALGPKGVLINIGRGPHVDEPEMVAALADGRLGGAGLDV  429

Query  331  FEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
            FEDEP V E L  +DNVVL+PH G  T ETR AMADLV+ NLEAH ++KPLLT VV
Sbjct  430  FEDEPNVPEALLAMDNVVLVPHVGSGTYETRKAMADLVLGNLEAHVLSKPLLTPVV  485



>ref|XP_002284520.1| PREDICTED: hydroxyphenylpyruvate reductase [Vitis vinifera]
 emb|CBI36124.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   367 bits (943),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 195/318 (61%), Positives = 240/318 (75%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             MENI VL+  P+  YL  +L  RF + +F     +     +I + S+RA+V  +  GAD 
Sbjct  1     MENICVLLTYPVPEYLVQKLEKRFTVFKFREVASNPQLLREI-SNSIRAIVGTSVCGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YSVG DK+DL KCKE+GI VTNTPDVLTDDVAD AIGL LA LR
Sbjct  60    --GLIDALPKLEIVASYSVGFDKIDLVKCKERGITVTNTPDVLTDDVADSAIGLALATLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++   DRFV+ G WK     F+ T++FSGKS+GI+GLGRIG AIAKRAEAF  +ISYHSR
Sbjct  118   RMCVCDRFVRSGKWKKG--DFELTTKFSGKSIGIVGLGRIGSAIAKRAEAFGSSISYHSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K  +NYKYY  +I+LA+NCQIL VACALT ETHHI++R+VID+LGP G++INI RG H
Sbjct  176   SEKPESNYKYYSNIIDLATNCQILFVACALTKETHHIVDRKVIDALGPKGIIINIGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL+EGRL GAGLDVFE EPEV EEL G++NVVL PH G  TVET  AM+DLV
Sbjct  236   IDEPELVSALLEGRLAGAGLDVFEHEPEVPEELLGLENVVLQPHAGSDTVETSVAMSDLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEA F NKP+LT V+
Sbjct  296   IDNLEACFQNKPVLTPVI  313



>ref|XP_008655043.1| PREDICTED: glyoxylate reductase isoform X1 [Zea mays]
Length=313

 Score =   367 bits (942),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/318 (59%), Positives = 249/318 (78%), Gaps = 5/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVL+  P NAYLE +L  RF L RFW  P  +  F + +A +VRA+V NA  GAD 
Sbjct  1     MESLGVLLLHPFNAYLEQELDRRFRLYRFWETPREE--FLRAHAGAVRAVVGNASYGADA  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI++++SVG+D+VDLAKC+++GIRVTNTPDVLTDDVAD+A+GL +AVLR
Sbjct  59    --ALIDALPALEIVASFSVGIDRVDLAKCRDRGIRVTNTPDVLTDDVADLAVGLAIAVLR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I + DR+V+ GLWK +   +  T++ SGK VGI+GLGRIG AIAKRAEAF C+ISY SR
Sbjct  117   RIPQADRYVRAGLWK-SRGDYTLTTRLSGKRVGILGLGRIGSAIAKRAEAFGCSISYSSR  175

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K   +YK++ + ++LA+NC +L+V C+LT ETHH+++R+VID+LGP GV++N+ RG H
Sbjct  176   SEKPFPDYKFHVSAVDLAANCDVLIVTCSLTAETHHVVSREVIDALGPEGVLVNVGRGAH  235

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL+EGRLGGAGLDV+E EP   E+L G+DNVVL+PH G  T ET  AMADLV
Sbjct  236   VDEPELVAALLEGRLGGAGLDVYEHEPLAPEQLLGLDNVVLVPHVGSDTEETCRAMADLV  295

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAH  ++PLLT V+
Sbjct  296   LANLEAHASDEPLLTPVI  313



>ref|XP_004235671.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Solanum lycopersicum]
Length=311

 Score =   367 bits (941),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 239/318 (75%), Gaps = 7/318 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M+ IGVL+  P++ Y++ +L  RF L ++W  P       ++++  +RA+V N   GA+ 
Sbjct  1     MDEIGVLLMRPLSNYIQQELAKRFTLFKYWEIPSESL---KLHSDIIRAVVGNGVQGAN-  56

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+S++S GLDK+DL KCKE+GIRVT+TP+  TDDVAD+AI L +A LR
Sbjct  57    -SALIDSLPRLEIVSSHSSGLDKIDLVKCKERGIRVTSTPNGPTDDVADMAILLAIATLR  115

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I   DRFV+ G+W+     F  T++FSGKSVGI+GLGRIG AIAKRAEAF C ISYHSR
Sbjct  116   RICVADRFVRNGIWQ--EKDFNLTAKFSGKSVGIVGLGRIGSAIAKRAEAFGCPISYHSR  173

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +QK  + Y YY  VI+LASNCQILVVACALT ETHHIINR+VID+LGPNG+VINIARG H
Sbjct  174   TQKPESTYTYYSHVIDLASNCQILVVACALTDETHHIINREVIDALGPNGIVINIARGSH  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE EL+SAL EGRLGGAGLD  E EPEV  +L  +DNVVL PH    TVETR  MADLV
Sbjct  234   IDEPELVSALAEGRLGGAGLDGLEHEPEVPTQLASLDNVVLSPHTAAGTVETRREMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEA+F NKPLLT V+
Sbjct  294   IANLEAYFSNKPLLTPVL  311



>ref|XP_009394191.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Musa acuminata 
subsp. malaccensis]
Length=316

 Score =   363 bits (933),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 243/318 (76%), Gaps = 4/318 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAF-FAQINAASVRALVVNAFVGAD  941
             ME++GVL+   ++ YLE +L  RF L R W  P +    F + NA ++RA+V +  +GAD
Sbjct  1     MESLGVLLTALIDPYLEAELDRRFKLFRLWELPPAQRREFLRENAEAIRAVVGSPALGAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++ + VGLDKVDL +C+++G+RV  TPDV+TDD AD+AIGL +A +
Sbjct  61    A--EMIDLLPRLEIVANFGVGLDKVDLRRCRDRGVRVVYTPDVVTDDTADLAIGLAIAAM  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I + DR+++ G WK     ++  S+FSGK+VGI+GLGRIG A+AKRAE F C I Y S
Sbjct  119   RRICDSDRYLRDGSWK-GKGDYKLASKFSGKTVGILGLGRIGQAVAKRAEGFGCPICYCS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K +TNYKYYP+V+ELA+NCQ+LVVAC LT ETHHIINR+VID+LGP GV++N+ RG 
Sbjct  178   RSEKRHTNYKYYPSVLELAANCQVLVVACPLTEETHHIINREVIDALGPKGVLVNVGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL++GRLG AGLDVFE EP V E+LFG+DNVVL+PH G  T+ET  AMADL
Sbjct  238   HVDECELVSALLDGRLGAAGLDVFEHEPHVPEQLFGLDNVVLVPHIGTDTLETSKAMADL  297

Query  220   VVRNLEAHFMNKPLLTRV  167
             ++ NLEAH  N+PLLT V
Sbjct  298   ILENLEAHVSNRPLLTPV  315



>ref|NP_001185444.1| glyoxylate/hydroxypyruvate reductase A HPR2 [Arabidopsis thaliana]
 gb|AEE36316.1| glyoxylate/hydroxypyruvate reductase A HPR2 [Arabidopsis thaliana]
Length=294

 Score =   362 bits (929),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 194/318 (61%), Positives = 232/318 (73%), Gaps = 24/318 (8%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++YLE++L  RFNLLRFW  P+      + +  S+RA+V NA  GAD 
Sbjct  1     MESIGVLMMCPMSSYLENELEKRFNLLRFWTSPEKSVLL-ETHRNSIRAVVGNASAGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LPNLEI+S++SVGLDK+DL KCKEKGIRVTNTPDVLT+DVAD+AIGLILA+LR
Sbjct  60    Q--LISDLPNLEIVSSFSVGLDKIDLGKCKEKGIRVTNTPDVLTEDVADLAIGLILALLR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ E DR+V+ G WK             G ++             KRAEAF+C I+Y+SR
Sbjct  118   RLCECDRYVRSGKWKQGRI---------GTAIA------------KRAEAFSCPINYYSR  156

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  YKYYPTV++LA N  ILVVAC LT +T HI++RQV+D+LG  GV+INI RG H
Sbjct  157   TIKPDVAYKYYPTVVDLAQNSDILVVACPLTEQTRHIVDRQVMDALGAKGVLINIGRGPH  216

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE ELI AL EGRLGGA LDVFE EP V EELFG++NVVLLPH G  TVETRNAMADLV
Sbjct  217   VDEQELIKALTEGRLGGAALDVFEQEPHVPEELFGLENVVLLPHVGSGTVETRNAMADLV  276

Query  217   VRNLEAHFMNKPLLTRVV  164
             V NLEAHF  K LLT VV
Sbjct  277   VGNLEAHFSGKSLLTPVV  294



>ref|XP_010230652.1| PREDICTED: hydroxyphenylpyruvate reductase isoform X2 [Brachypodium 
distachyon]
Length=316

 Score =   362 bits (929),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 255/319 (80%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFW-NFPDSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF LLR W + PDS A F + NA+++RA+V NA   AD
Sbjct  1     MESLGVLLLHPMNAYLEQELDRRFRLLRLWESPPDSRADFLRANASAIRAVVGNAGYNAD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDLAKC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--ALIDALPSLEIVASFSVGIDRVDLAKCRERGIRVTNTPDVLTDDVADLAVGLAIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I + DR+V+ GLWK A   +  T++FSGK VGI+GLGRIGLAIAKRAEAF C+ISYHS
Sbjct  119   RRIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVGILGLGRIGLAIAKRAEAFGCSISYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K   NY+++  V++LA+NC +LVVAC+L  ETHHI++R+V+ +LGP GV+INI RG 
Sbjct  178   RSEKPFPNYRFFTNVVDLAANCDVLVVACSLNAETHHIVSRKVMVALGPEGVLINIGRGA  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+  +LG AGLDVFE EP   E+LFG+DNVVL+PH G  T ET  AMADL
Sbjct  238   HVDEPELVSALLAKQLGAAGLDVFEHEPFAPEQLFGLDNVVLVPHIGSDTEETCMAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V++NLEAH +NKPLLT V+
Sbjct  298   VLKNLEAHALNKPLLTPVI  316



>ref|XP_008462163.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Cucumis melo]
Length=335

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 247/319 (77%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGV M  PM  YLE  L  RFNL + WN P DSD  F Q NA S+RA+V     GAD
Sbjct  23    MESIGVAMTTPMFGYLEQNLERRFNLFKLWNHPLDSD--FLQHNAQSIRAVVGCTTSGAD  80

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID  PNLEI++T+SVGLDK+DL KC EKGIRV NTPDVLTDDVAD AIGL +AVL
Sbjct  81    AH--LIDTFPNLEIVATFSVGLDKIDLPKCLEKGIRVVNTPDVLTDDVADAAIGLAMAVL  138

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+ISE DRFV+ G W     +F   ++F+GKSVGI+GLGRIG AIAKRAEAF C I Y S
Sbjct  139   RRISESDRFVRSGSWMKD--EFGLATRFNGKSVGILGLGRIGSAIAKRAEAFGCNIGYFS  196

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K ++ YKY+P+V++LA+N QIL V+C LT ET HI+NR+VID+LGPNG++IN+ RG 
Sbjct  197   RTEKHHSGYKYFPSVLDLAANSQILFVSCTLTEETKHIVNREVIDALGPNGILINVGRGA  256

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HV+E+EL+SAL+E RLGGAGLDVFE+EP V E+L  ++NVVLLPH G  T+ET  AMADL
Sbjct  257   HVNESELVSALLERRLGGAGLDVFENEPHVPEKLLELNNVVLLPHVGTDTIETSIAMADL  316

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+RNLEAHF N+PL+T V+
Sbjct  317   VIRNLEAHFRNEPLITPVI  335



>ref|XP_003597747.1| Glyoxylate reductase [Medicago truncatula]
 gb|AES67998.1| D-glycerate dehydrogenase/hydroxypyruvate reductase [Medicago 
truncatula]
Length=314

 Score =   362 bits (928),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 204/319 (64%), Positives = 246/319 (77%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PMN  LE QL NRFNL + WN+P   +F ++ +A S+RALV N  +GAD 
Sbjct  1     MESIGVLMTYPMNTNLEEQLSNRFNLFKLWNYPSFQSF-SETHANSIRALVCNTKIGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+STYSVG DK+DL KC+EKGI VTNTPDVLTDDVAD+AI L LAV R
Sbjct  60    --NTIDSLPNLEIVSTYSVGFDKIDLKKCREKGICVTNTPDVLTDDVADLAIALALAVFR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D +VK  LWK +   +  TS+FSGK+VGI+GLGRIG AIAKRA AF C +SYHSR
Sbjct  118   KIPMSDGYVKSELWKCS--DYPLTSKFSGKAVGIVGLGRIGSAIAKRAAAFGCPVSYHSR  175

Query  577   SQKLNT-NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             S+K    +YKYYP + +LA+N QILVVACALT ET HI+NR+VID+LGP GV+INI RG 
Sbjct  176   SEKPEAGSYKYYPNIPDLAANSQILVVACALTDETRHIVNREVIDALGPKGVIINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              +D+ EL++ALVE RLGGAGLDV E+EP+V+EEL G++NVVL PH G  TVET N M+DL
Sbjct  236   IIDQPELVAALVERRLGGAGLDVLENEPDVSEELIGLENVVLTPHIGSDTVETCNDMSDL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             ++ NLEAHF  KPLL  V+
Sbjct  296   LIANLEAHFNGKPLLAPVL  314



>ref|XP_008462161.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cucumis 
melo]
Length=319

 Score =   359 bits (921),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 196/317 (62%), Positives = 245/317 (77%), Gaps = 14/317 (4%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGA--DL  938
             NIGV M  PM++YLE QL  RFNL + W     D+  A+    S+RA+V +  VGA  DL
Sbjct  5     NIGVAMTNPMSSYLEEQLERRFNLFKLWKSTTLDSHTAK----SIRAVVCSTQVGATADL  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
             +D F    P LEI++T+SVGLDKVDL KC EKGIRVTNTPDVLTDDVAD AIGL +AVLR
Sbjct  61    IDSF----PALEIVATFSVGLDKVDLKKCMEKGIRVTNTPDVLTDDVADAAIGLAIAVLR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I E DRFV+ G W     +F+ TS+FSGKSVGIIGLGRIG AIAKRA+AF C I+Y SR
Sbjct  117   RICECDRFVRSGSWLTR--EFRLTSKFSGKSVGIIGLGRIGSAIAKRAQAFGCTINYFSR  174

Query  577   SQK-LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             ++K  +T+YKY+P ++++A N QI+ V+CALT ET HI+NR+V+D+LGPNG++IN+ RG 
Sbjct  175   TEKHQHTDYKYFPKLLDMAKNSQIMFVSCALTEETKHIVNREVLDALGPNGILINVGRGA  234

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELF-GIDNVVLLPHHGCATVETRNAMAD  224
             HVDE ELISAL+EGRLGGAGLDV+E+EP V E+L   ++N VLLPH G  T++T  AMAD
Sbjct  235   HVDEPELISALLEGRLGGAGLDVYENEPHVAEQLIHQLENTVLLPHVGSDTIDTNIAMAD  294

Query  223   LVVRNLEAHFMNKPLLT  173
             LV+ NLEAHF N+PL+T
Sbjct  295   LVIANLEAHFKNQPLIT  311



>ref|NP_001042479.1| Os01g0228600 [Oryza sativa Japonica Group]
 dbj|BAB78682.1| putative D-isomer specific 2-hydroxyacid dehydrogenase [Oryza 
sativa Japonica Group]
 dbj|BAF04393.1| Os01g0228600 [Oryza sativa Japonica Group]
 dbj|BAG91540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87120.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 242/319 (76%), Gaps = 4/319 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             M+++GVL+  PMNAYLE +L  R  L R W  P D    + + +A+S+RA+V  A  G D
Sbjct  1     MDSLGVLLVAPMNAYLEQELDRRCRLFRLWESPADRRDDYLRAHASSIRAVVPYALQGVD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI+S++SVG+D+VDL  C  +G+RVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--AMIDALPSLEIVSSFSVGIDRVDLDACLRRGVRVTNTPDVLTDDVADLAVGLAIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ G WK +   F  T++FSGK VGIIGLGRIGLA+AKR EAF+C ++Y+ 
Sbjct  119   RKIPQADRYVRAGKWK-SKGDFTLTTRFSGKRVGIIGLGRIGLAVAKRVEAFDCPVNYYQ  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R+++ +  Y YYP+V+ELA++  +LVVAC L   T HI+NR+V+++LGP GV+INI RG 
Sbjct  178   RTKQDHPGYTYYPSVVELAASSDVLVVACPLNEHTRHIVNREVMEALGPRGVLINIGRGP  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDEA +++AL +GRLGGAGLDVFEDEP V E L G+DNVVL+PH G AT ETR AMADL
Sbjct  238   HVDEAAMVAALADGRLGGAGLDVFEDEPNVPEALLGMDNVVLVPHVGSATHETRTAMADL  297

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH   KPLLT+VV
Sbjct  298   VLGNLEAHVAGKPLLTQVV  316



>ref|XP_004141767.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cucumis 
sativus]
 gb|KGN45380.1| hypothetical protein Csa_7G446950 [Cucumis sativus]
Length=313

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 243/319 (76%), Gaps = 7/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME+IGV M   M  YLE  L  RFNL + WN P DSD  F Q+NA SVRA+V     GAD
Sbjct  1     MESIGVAMTTQMFTYLEQNLEGRFNLFKLWNHPLDSD--FLQLNAQSVRAVVGCTKSGAD  58

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID  PNLEI++T+SVGLDK+DL KC EKGIRV NTPDVLTDDVAD AIGL +AVL
Sbjct  59    AR--LIDTFPNLEIVATFSVGLDKIDLPKCLEKGIRVVNTPDVLTDDVADAAIGLAMAVL  116

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+ISE DRFV+ G W      F   ++F+GKSVGIIGLGRIG AIAKRA AF C I Y S
Sbjct  117   RRISESDRFVRSGSWMKN--DFGLGTRFNGKSVGIIGLGRIGSAIAKRAVAFGCPIGYFS  174

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K +  YKY+P+V++LA+N QIL V+C LT ET HI+NR+VID+LGPNG++IN+ RG 
Sbjct  175   RTEKHHRGYKYFPSVLDLAANSQILFVSCTLTEETKHIVNREVIDALGPNGILINVGRGA  234

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HV+E EL+SAL+E RLGGAGLDVFE+EP V E+L  ++NVVLLPH G  T+ET  AMADL
Sbjct  235   HVNETELVSALLERRLGGAGLDVFENEPHVPEQLLELNNVVLLPHVGTDTIETSIAMADL  294

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+RNLEAHF N+PL+T V+
Sbjct  295   VIRNLEAHFRNEPLITPVI  313



>ref|XP_006833317.1| hypothetical protein AMTR_s00109p00059250 [Amborella trichopoda]
 gb|ERM98595.1| hypothetical protein AMTR_s00109p00059250 [Amborella trichopoda]
Length=315

 Score =   357 bits (915),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+ GVLM  PM  YL+ ++  RF + + W  P+   F ++ NAAS++A+V ++ VGA  
Sbjct  1     MESFGVLMTQPMMPYLQEEISRRFKIFKLWEAPNQAKFLSE-NAASIQAIVGDSAVGAKA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                FID LPNLEI++T SVGLD +DL  CKEKGIRVTNTPDVLTD VAD+ IGLI+  +R
Sbjct  60    --EFIDALPNLEIVATCSVGLDAIDLEMCKEKGIRVTNTPDVLTDCVADLTIGLIICTIR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++   DR V++G W +    ++ T++FSGK+VGIIGLGRIGLAIA+RAEAF C I+Y+SR
Sbjct  118   QLHMADRHVREGKW-ITFGNYKLTTRFSGKTVGIIGLGRIGLAIARRAEAFGCPITYYSR  176

Query  577   SQKLN-TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             S+K +  NYKYY  V ELA+N  ILVVAC LT ETHHII+ QVI++LGP GV++NI RG 
Sbjct  177   SEKPDFRNYKYYSNVTELATNSDILVVACPLTEETHHIISLQVIEALGPQGVLVNIGRGA  236

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              VDE E+++AL++GRLGGAG+DVFE EPEV  ELFG+DNVVL+PH G AT ETR  MADL
Sbjct  237   LVDEPEMVTALLDGRLGGAGIDVFEHEPEVPMELFGLDNVVLVPHVGSATWETRKEMADL  296

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V+ NLEAH + KPLLT VV
Sbjct  297   VLGNLEAHVLKKPLLTAVV  315



>gb|AFK44882.1| unknown [Medicago truncatula]
Length=314

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 244/319 (76%), Gaps = 6/319 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM  PMN  LE QL NR NL + WN+P   +F ++ +A S+RALV N  +GAD 
Sbjct  1     MESIGVLMTYPMNTNLEEQLSNRLNLFKLWNYPSFQSF-SETHANSIRALVCNTKIGADA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+STYSVG DK+DL KC+EKGI VTNTPDVLTDDVAD+AI L LAV R
Sbjct  60    --NTIDSLPNLEIVSTYSVGFDKIDLKKCREKGICVTNTPDVLTDDVADLAIALALAVFR  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI   D +VK  LWK +   +  TS+FSGK+VGI+GLGRIG AIAKRA AF C +SY SR
Sbjct  118   KIPMSDGYVKSELWKCS--DYPLTSKFSGKAVGIVGLGRIGSAIAKRAAAFGCPVSYPSR  175

Query  577   SQKLNT-NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             S+K    +YKYYP + +LA+N QILVVACALT ET HI+NR+VID+LGP GV+INI RG 
Sbjct  176   SEKPEAGSYKYYPNIPDLAANSQILVVACALTDETRHIVNREVIDALGPKGVIINIGRGP  235

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              +D+ EL++ALVE RLGGAGLDV E+EP+V+EEL G++NVVL PH G  TVET N M+DL
Sbjct  236   IIDQPELVAALVERRLGGAGLDVLENEPDVSEELIGLENVVLTPHIGSDTVETCNDMSDL  295

Query  220   VVRNLEAHFMNKPLLTRVV  164
             ++ NLEAHF  KPLL  V+
Sbjct  296   LIANLEAHFNGKPLLAPVL  314



>ref|XP_011072371.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Sesamum indicum]
Length=314

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 239/314 (76%), Gaps = 5/314 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDS-DAFFAQINAASVRALVVNAFVGADLLDVF  926
             VL+  P++AY++ +L  R+ L +FW  P      F + ++ S+RA+V N   G D     
Sbjct  5     VLLIRPLSAYIQQELSKRYILFKFWQEPPHLRREFLRKHSNSIRAVVANGAQGPDA--EM  62

Query  925   IDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISE  746
             ID LP LEI++++S GLDK+DL KC+E+GI VT TPD LTD+VAD+AI L LA +R+I E
Sbjct  63    IDLLPLLEIVASHSSGLDKIDLDKCRERGITVTYTPDALTDEVADMAILLTLATMRRICE  122

Query  745   GDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKL  566
              D++V++  WK  +  F+ T++FSGK+VGIIGLGRIG AIAKRAEAF C+I YHSRSQK 
Sbjct  123   ADQYVRRSEWK--NVDFKLTTKFSGKAVGIIGLGRIGSAIAKRAEAFGCSIGYHSRSQKP  180

Query  565   NTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEA  386
             N+ YKYY +V++LAS+ QIL++ACALT ET HI+NR VID+LG NGVV+NIARG H+DEA
Sbjct  181   NSRYKYYTSVVDLASDSQILIIACALTHETRHIVNRDVIDALGKNGVVVNIARGSHIDEA  240

Query  385   ELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNL  206
             ELISAL EGRLGGAGLDV E+EPE   +L G+DNVVL PH G +TVETR  +ADLVV+ L
Sbjct  241   ELISALAEGRLGGAGLDVLENEPEAPTQLLGLDNVVLSPHVGASTVETRKVLADLVVQAL  300

Query  205   EAHFMNKPLLTRVV  164
             +AHF  KPL T V+
Sbjct  301   DAHFSGKPLPTPVI  314



>emb|CDM82380.1| unnamed protein product [Triticum aestivum]
Length=471

 Score =   355 bits (912),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 187/300 (62%), Positives = 237/300 (79%), Gaps = 4/300 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF L RFW+ P D  A F + NA+++RA+V NA   AD
Sbjct  3     MESLGVLLLHPMNAYLEQELDRRFRLFRFWDSPPDGRAEFLRANASAIRAVVGNAGYNAD  62

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDL KC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  63    A--ALIDALPSLEIVASFSVGIDRVDLPKCRERGIRVTNTPDVLTDDVADLAVGLAIAAL  120

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ GLWK A   +  T++FSGK V I+GLGRIGLAIAKRAEAF C+ISYHS
Sbjct  121   RKIPQADRYVRAGLWK-AKGDYTLTARFSGKRVAILGLGRIGLAIAKRAEAFGCSISYHS  179

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K   NYK++  V++LA+NC +L+VAC+L  ETHHI+NR+V+D+LG +GV+INI RG 
Sbjct  180   RSEKPFPNYKFFTNVVDLAANCDVLIVACSLNAETHHIVNRKVMDALGRDGVLINIGRGA  239

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE EL+SAL+E RLG AGLDVFE EP V E+LF +DNVVL+PH G  T ET  AMADL
Sbjct  240   HVDEPELVSALLEKRLGAAGLDVFEHEPFVPEQLFSLDNVVLVPHVGSDTEETCKAMADL  299


 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 139/172 (81%), Gaps = 0/172 (0%)
 Frame = -2

Query  679  FSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVV  500
            FSGK VGIIGLGRIGLAIA R EAF+C ++Y+ R++K   NY YYP+V+ELA+N  ILVV
Sbjct  300  FSGKRVGIIGLGRIGLAIATRVEAFDCPVNYYQRTKKDYPNYTYYPSVVELAANSDILVV  359

Query  499  ACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDE  320
            AC L  +T HI+NR+VI+ LGP GV+INI RG HVDE EL+SALVEGRLGGAGLDVFEDE
Sbjct  360  ACPLNEQTRHIVNREVIEVLGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEDE  419

Query  319  PEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
            P V E LF +DNVVL+PH G  T ETR AMADLV+ NLEAH + KPLLT VV
Sbjct  420  PNVPEALFALDNVVLVPHVGSGTHETRQAMADLVLGNLEAHVLKKPLLTPVV  471



>gb|EPS70836.1| hypothetical protein M569_03919 [Genlisea aurea]
Length=319

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 238/322 (74%), Gaps = 7/322 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME +GV+M   M  YLE +L  RF L + W  P    F A ++   ++A VV+  + AD 
Sbjct  1     MEKVGVVMTSAMCGYLERELAERFALFKLWESPSESRFLA-LHGDEIKAAVVDPNLAAD-  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 I  LP+LEI++TYSVG D +DL +C+E+GIRVTNTPDVL DDVAD+AIGL +AVLR
Sbjct  59    -SDLIHSLPHLEIVATYSVGFDNIDLNRCRERGIRVTNTPDVLADDVADVAIGLAIAVLR  117

Query  757   KISEGDRFVKKGLWKMAHFQ-FQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             KI   D FV+ G W+ +  + F+ TS+FSGKS+GIIGLGRIG AIAKRA+AF C I+YHS
Sbjct  118   KICRCDGFVRSGSWRRSGGEEFELTSRFSGKSIGIIGLGRIGSAIAKRAQAFGCKINYHS  177

Query  580   RSQKLNT--NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             R+QK N+  NY Y+ +V++LASN QIL+V+C+LT +T  I+ R+VID+LGP GV++N+ R
Sbjct  178   RNQKPNSSSNYTYFSSVLDLASNSQILIVSCSLTDQTRRIVGRRVIDALGPEGVLVNVGR  237

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G HVDEAEL+SAL EGRLGGAGLDV+EDEP V E   G+ NVVLLPH G  TVET   MA
Sbjct  238   GAHVDEAELVSALREGRLGGAGLDVYEDEPRVRESFLGMKNVVLLPHVGSDTVETSRDMA  297

Query  226   DLVVRNLEAHFMNK-PLLTRVV  164
             DLVV NLE HF+ K PLLT V+
Sbjct  298   DLVVANLELHFLKKQPLLTPVI  319



>gb|EMS68593.1| Glyoxylate reductase [Triticum urartu]
Length=570

 Score =   358 bits (920),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 194/328 (59%), Positives = 243/328 (74%), Gaps = 24/328 (7%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  PMNAYLE +L  RF L RFW+ P D  A F + NA+++RA+V NA   AD
Sbjct  3     MESLGVLLLHPMNAYLEQELDRRFRLFRFWDSPPDGRAEFLRANASAIRAVVGNASYNAD  62

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI++++SVG+D+VDL KC+E+GIRVTNTPDVLTDDVAD+A+GL +A L
Sbjct  63    A--ALIDALPSLEIVASFSVGIDRVDLPKCRERGIRVTNTPDVLTDDVADLAVGLSIAAL  120

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ GLWK A   +  T++FSGK VGIIGLGRIGLAIA R EAF+C ++Y+ 
Sbjct  121   RKIPQADRYVRAGLWK-AKGDYTLTTRFSGKRVGIIGLGRIGLAIATRVEAFDCPVNYYQ  179

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R++K   +Y YYP+V+ELA+N  ILVVAC L  +T HI+NR+VI++LGP G++INI RG 
Sbjct  180   RTKKDYPSYTYYPSVVELAANSDILVVACPLNEQTRHIVNREVIEALGPKGLLINIGRGP  239

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHH--------------  263
             HVDE EL+SALVEGRLGGAGLDVFEDEP V E LF +DNVVL+PH               
Sbjct  240   HVDEPELVSALVEGRLGGAGLDVFEDEPNVPEALFTLDNVVLVPHDEPNVPEALFTLDNV  299

Query  262   ------GCATVETRNAMADLVVRNLEAH  197
                   G  T ETR AMADLV+ NLEAH
Sbjct  300   VLVPHVGSGTHETRQAMADLVLGNLEAH  327



>ref|XP_003546452.1| PREDICTED: hydroxyphenylpyruvate reductase-like isoform 1 [Glycine 
max]
Length=303

 Score =   348 bits (894),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/318 (58%), Positives = 236/318 (74%), Gaps = 15/318 (5%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME+IGVLM CPM++Y++ +L  RFNL + W++P   AF AQ +A S+RALV +A VG D 
Sbjct  1     MESIGVLMTCPMHSYIQEELAKRFNLFKLWHYPSFSAF-AQAHAHSIRALVASAKVGVDA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LPNLEI+STYSVG D +DL KC+ + I VTNTP+VLTDDVAD+AI L L++L 
Sbjct  60    --ATIDSLPNLEIVSTYSVGYDNIDLHKCRHRAIPVTNTPNVLTDDVADVAIALALSLLC  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +I       +   W       QFT + SGK+VGI+GLGRIG AIAKRAE F C +SYHSR
Sbjct  118   RICP-----RNSTW-------QFTPKLSGKAVGIVGLGRIGWAIAKRAEGFGCPVSYHSR  165

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K  T YKYY  +I+LA+N ++L VAC L+ ET HI+NR VID+LGP G++IN+ RG H
Sbjct  166   SEKSETGYKYYSHIIDLAANSEVLFVACTLSEETRHIVNRGVIDALGPKGILINVGRGPH  225

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE EL++AL+EGRLGGAGLDVFE+EPEV E+L G++N+V+ PH G  T+ET  AM DLV
Sbjct  226   VDEPELVAALIEGRLGGAGLDVFENEPEVPEDLLGLENLVMTPHVGTDTLETCIAMGDLV  285

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+  PL T V+
Sbjct  286   IANLEAHFLGNPLFTPVL  303



>ref|XP_010521520.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Tarenaya hassleriana]
Length=311

 Score =   346 bits (887),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 235/320 (73%), Gaps = 14/320 (4%)
 Frame = -2

Query  1114  ENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLL  935
             ++IGVLM C M+ YLE +L N F +++ W    S          S+RA+V N  +GAD  
Sbjct  3     KSIGVLMTCSMSTYLEKELENHFTVIKPWKNGVS-------AGDSIRAVVCNTKLGADAH  55

Query  934   DVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRK  755
                ID LP+LEI+STYSVGLDK+DL KC+E GIRVTNTPDVLTDDVAD+AIGLILAVLRK
Sbjct  56    --LIDSLPSLEIVSTYSVGLDKIDLLKCREMGIRVTNTPDVLTDDVADLAIGLILAVLRK  113

Query  754   ISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRS  575
             I   D F++ G W  A   F    +FSGKSVGIIGLGRIG AIAKRA AF C I YHSR+
Sbjct  114   IVAADGFLRSGHWHSA--SFGLGRKFSGKSVGIIGLGRIGSAIAKRAAAFGCPIGYHSRT  171

Query  574   QKLNTN---YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             +K   +   Y+YY  VI LA    ILVVACALT ET HII+R+VID+LGP+G++INI RG
Sbjct  172   KKPEADAEAYRYYSDVITLAKESDILVVACALTEETRHIIDRKVIDALGPHGILINIGRG  231

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
             GHVDE  L++AL+EGR+ GAGLDV+E+EP+V EEL  ++NVVL+PH G  T ET   MAD
Sbjct  232   GHVDEPALVAALLEGRICGAGLDVYENEPQVPEELLQMENVVLVPHVGSDTEETCRDMAD  291

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LVVRNL AHF N+PLLT VV
Sbjct  292   LVVRNLLAHFKNEPLLTPVV  311



>gb|EEC70231.1| hypothetical protein OsI_01001 [Oryza sativa Indica Group]
Length=469

 Score =   350 bits (899),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 185/300 (62%), Positives = 232/300 (77%), Gaps = 4/300 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             M+++GVL+  PMNAYLE +L  R  L R W  P D    + + +A+S+RA+V  A  G D
Sbjct  1     MDSLGVLLVAPMNAYLEQELDRRCRLFRLWESPADRRDDYLRAHASSIRAVVPYAPQGVD  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP+LEI+S++SVG+D+VDL  C+ +G+RVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    A--AMIDALPSLEIVSSFSVGIDRVDLDACRRRGVRVTNTPDVLTDDVADLAVGLAIAAL  118

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKI + DR+V+ G WK +   F  T++FSGK VGI+GLGRIGLA+AKRAEAF+C ISYHS
Sbjct  119   RKIPQADRYVRAGKWK-SKGDFTLTTRFSGKRVGILGLGRIGLAVAKRAEAFDCPISYHS  177

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS+K    YK+YP V++LA+NC +LVVAC+L PET HI+NR+VID+LGP GV+INIARG 
Sbjct  178   RSEKPFPKYKFYPNVVDLAANCDVLVVACSLNPETRHIVNRKVIDALGPEGVLINIARGA  237

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
             HVDE ELISAL+E RLGGAGLDVFEDEP   E+LF +DNVVL+PH G  T ET  AMADL
Sbjct  238   HVDEPELISALLEKRLGGAGLDVFEDEPFAPEQLFELDNVVLVPHVGSDTEETCRAMADL  297


 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 140/172 (81%), Gaps = 0/172 (0%)
 Frame = -2

Query  679  FSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVV  500
            FSGK VGIIGLGRIGLA+AKR EAF+C ++Y+ R+++ +  Y YYP+V+ELA++  +LVV
Sbjct  298  FSGKRVGIIGLGRIGLAVAKRVEAFDCPVNYYQRTKQDHPGYTYYPSVVELAASSDVLVV  357

Query  499  ACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDE  320
            AC L   T HI+NR+V+++LGP GV+INI RG HVDEA +++AL +GRLGGAGLDVFEDE
Sbjct  358  ACPLNEHTRHIVNREVMEALGPRGVLINIGRGPHVDEAAMVAALADGRLGGAGLDVFEDE  417

Query  319  PEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
            P V E L G+DNVVL+PH G AT ETR AMADLV+ NLEAH   KPLLT+VV
Sbjct  418  PNVPEALLGMDNVVLVPHVGSATHETRTAMADLVLGNLEAHVAGKPLLTQVV  469



>gb|AGW27203.1| putative hydroxyphenylpyruvate reductase 3 [Salvia miltiorrhiza]
Length=319

 Score =   345 bits (885),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/317 (59%), Positives = 238/317 (75%), Gaps = 7/317 (2%)
 Frame = -2

Query  1108  IGVLMACPMNAYLEHQLHNRFNLLRFWNFPDS--DAFFAQINAASVRALVVNAFVGADLL  935
             IGVL+  P++ YL+ +L  R+ L +FW  P +    F  + ++ S++A+V N   GAD  
Sbjct  8     IGVLLLRPLSPYLQQELSKRYALFKFWESPPNLRREFLGE-HSNSIKAVVCNGVQGADA-  65

Query  934   DVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRK  755
                ID LP LEI++++S GLDK+DL +C+E+GIRVT TPD LTD+VAD+AI LILA  R+
Sbjct  66    -EIIDALPLLEIVASHSSGLDKIDLDRCRERGIRVTYTPDALTDEVADMAILLILATSRR  124

Query  754   ISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRS  575
             I   D+ V+   WK A   F+ TS+FSGKSVGIIGLGRIG AIAKRAEAF C I YHSRS
Sbjct  125   ICAADQHVRSAEWKNA--DFKLTSKFSGKSVGIIGLGRIGSAIAKRAEAFGCRIGYHSRS  182

Query  574   QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHV  395
              K N+ YKYYP++ +LAS+ QI+VV+CALT ETHHI+NR V+D+LG +G++INIARG H+
Sbjct  183   LKPNSRYKYYPSLTDLASDSQIIVVSCALTRETHHIVNRGVMDTLGRDGIIINIARGSHI  242

Query  394   DEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVV  215
             D+AELISAL EGRLGGAGLDV E EPEV + L  +DNVVL PH G +T ETR  +ADLVV
Sbjct  243   DQAELISALAEGRLGGAGLDVLEHEPEVPDLLAQLDNVVLSPHAGASTYETRKTLADLVV  302

Query  214   RNLEAHFMNKPLLTRVV  164
              +LEAHF NKPLL  V+
Sbjct  303   GHLEAHFSNKPLLNAVI  319



>ref|XP_007150632.1| hypothetical protein PHAVU_005G168600g [Phaseolus vulgaris]
 gb|ESW22626.1| hypothetical protein PHAVU_005G168600g [Phaseolus vulgaris]
Length=306

 Score =   344 bits (882),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/318 (58%), Positives = 235/318 (74%), Gaps = 12/318 (4%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             ME++GVLM CPM++Y++ +L  RFNL + W+FP S A FA+++  SVRA+V +  VG D 
Sbjct  1     MESVGVLMTCPMHSYIQEELAKRFNLFKLWHFP-SFAAFAEVHGNSVRAVVASVKVGVDA  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+STYSVG D +DL KC+EK I VTNTP+VLTDDVAD+AI L L++  
Sbjct  60    --AAIDSLPKLEIVSTYSVGYDNIDLRKCREKDIPVTNTPNVLTDDVADLAIALALSLFC  117

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             +IS   R         ++     T + SGK+VGIIGLGRIG AIA+RAEAF C I YHSR
Sbjct  118   RISHSPR---------SNSAPHITPKLSGKAVGIIGLGRIGWAIARRAEAFGCPIGYHSR  168

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S+K  + YKYY  V++LA+  ++LVVAC LTPET HI+NR V+D+LGP G++INI RG H
Sbjct  169   SEKAESGYKYYSNVLDLAAESEVLVVACTLTPETRHIVNRGVLDALGPKGILINIGRGPH  228

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDEAEL+ AL EGR+GGAGLDVFE EP+V EEL  ++NVVL PH G  TVET  AMA+LV
Sbjct  229   VDEAELVWALREGRVGGAGLDVFEKEPDVREELVRLENVVLTPHVGSDTVETCMAMAELV  288

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NLEAHF+  PLLT ++
Sbjct  289   IANLEAHFLGNPLLTPII  306



>ref|XP_004141768.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cucumis 
sativus]
 gb|KGN45381.1| hypothetical protein Csa_7G446960 [Cucumis sativus]
Length=320

 Score =   343 bits (880),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 190/315 (60%), Positives = 236/315 (75%), Gaps = 11/315 (3%)
 Frame = -2

Query  1108  IGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDV  929
             IGV M    ++YLE QL  RFN+ + W  P  D   A+    S+RA+V N   GAD    
Sbjct  6     IGVAMTNSTSSYLEQQLERRFNVFKLWECPTLDPDTAK----SIRAVVCNTQAGADA--D  59

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
              ID LP LE+++T+SVGLDKVDL KC EKGIRVTNTP+VLT+DVAD AIGL +AVLR+I 
Sbjct  60    LIDSLPALEMVATFSVGLDKVDLKKCMEKGIRVTNTPNVLTEDVADAAIGLAIAVLRRIC  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             E DRFV+ G W     +F  T++FSGK +GIIGLGRIG AIAKRA+AF C I+Y SR+ K
Sbjct  120   ECDRFVRSGSW--LSREFGLTTKFSGKPIGIIGLGRIGSAIAKRAQAFGCTINYFSRTVK  177

Query  568   LN-TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVD  392
              + T+YKY+PT +ELA N QI+ V+CALT ET HI+NR+V+D+LGPNG++IN+ RG HVD
Sbjct  178   HHLTDYKYFPTPLELAKNSQIMFVSCALTKETKHIVNREVLDALGPNGILINVGRGAHVD  237

Query  391   EAELISALVEGRLGGAGLDVFEDEPEVNEELFG--IDNVVLLPHHGCATVETRNAMADLV  218
             ++ELISAL+EGRLGGAGLDVFE+EP V E+L     D  VLLPH G  T++T  AMADLV
Sbjct  238   QSELISALLEGRLGGAGLDVFENEPHVPEQLIHELQDKTVLLPHVGSDTIDTNIAMADLV  297

Query  217   VRNLEAHFMNKPLLT  173
             + NLEAHF N+PL+T
Sbjct  298   IANLEAHFKNQPLIT  312



>emb|CBI36125.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   338 bits (868),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 185/248 (75%), Positives = 214/248 (86%), Gaps = 2/248 (1%)
 Frame = -2

Query  907  LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
            +EI+S++SVGLDK+DL +CKEKGIRVTNTPDVLT+DVAD+A+ LILA LR+I E DR+V+
Sbjct  1    MEIVSSFSVGLDKIDLVRCKEKGIRVTNTPDVLTEDVADLALALILATLRRICESDRYVR  60

Query  727  KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             G WK     F+ T++F+GKSVGIIGLGRIG AIAKRAE F+C ISYHSR++K  TNYKY
Sbjct  61   SGSWKKG--DFKLTTKFTGKSVGIIGLGRIGSAIAKRAEGFSCPISYHSRTEKPGTNYKY  118

Query  547  YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
            YP+V+ELASNCQILVVACALTPET HIINR+VI++LGP GVVINI RG HVDE EL+SAL
Sbjct  119  YPSVVELASNCQILVVACALTPETRHIINREVINALGPKGVVINIGRGLHVDEPELVSAL  178

Query  367  VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
            VEGRLGGAGLDVFE+EP V EEL  +DNVVLLPH G  TVETR  MADLV+ NLEAHF+N
Sbjct  179  VEGRLGGAGLDVFENEPNVPEELLAMDNVVLLPHVGSGTVETRKDMADLVLGNLEAHFLN  238

Query  187  KPLLTRVV  164
            KPLLT VV
Sbjct  239  KPLLTPVV  246



>ref|XP_002984586.1| hypothetical protein SELMODRAFT_156743 [Selaginella moellendorffii]
 gb|EFJ14231.1| hypothetical protein SELMODRAFT_156743 [Selaginella moellendorffii]
Length=316

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 228/312 (73%), Gaps = 4/312 (1%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             VLMA PM   LE  L ++F LLR W   D  A   Q ++  ++ALVVN    A      I
Sbjct  6     VLMAVPMLPDLELALDSKFRLLRLWQAEDPGAMLRQ-HSGQIQALVVNHKFEASA--AVI  62

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP LEI+S++SVGLDK+DL KCKE+G+ VTNTPDVLTD+ AD+A+ L+L  +R+I   
Sbjct  63    DALPRLEIVSSFSVGLDKIDLKKCKERGVAVTNTPDVLTDETADLAMALLLGTMRRICPA  122

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DR+V++GLW + H  F  + + SGK +GI+GLGRIG AIAKRAE F+CAISY SR +K  
Sbjct  123   DRYVREGLWPV-HGDFPLSHKVSGKRIGIVGLGRIGSAIAKRAEGFSCAISYSSREKKPG  181

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y +Y ++++LA +   L+VACALTPET H+++R+VID+LGP G ++NIARG  VDEAE
Sbjct  182   VPYAHYSSLVDLARDSDALIVACALTPETRHLVSREVIDALGPEGTLVNIARGPIVDEAE  241

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+ ALV+ RLG AGLDVFE+EP+V +EL G+DNVVLLPH G  T +TR AM DLVVRNLE
Sbjct  242   LVQALVDKRLGAAGLDVFEEEPQVPQELLGMDNVVLLPHVGSGTWDTRRAMGDLVVRNLE  301

Query  202   AHFMNKPLLTRV  167
             AHF  K L+T V
Sbjct  302   AHFSGKSLVTPV  313



>gb|EMS65296.1| Glyoxylate reductase [Triticum urartu]
Length=321

 Score =   334 bits (856),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 223/282 (79%), Gaps = 3/282 (1%)
 Frame = -2

Query  1009  AFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRV  830
             A F + NA+++RA+V  A+ G   L   ID LP+LEI+ ++SVG+D VDL KC+E+GIRV
Sbjct  43    AEFLRANASAIRAVV--AYPGYSALAALIDALPSLEIVVSFSVGIDHVDLPKCRERGIRV  100

Query  829   TNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiig  650
             TNTPDVLTDDVAD+A+GL +A LR+I + DRFV+ GLWK A   +  T++FSGK VGIIG
Sbjct  101   TNTPDVLTDDVADLAVGLAVAALRRIPQADRFVRAGLWK-AKGDYALTTRFSGKRVGIIG  159

Query  649   lgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHH  470
             LGRIGLAIA R EAF+C ++Y+ R++K   +Y YYP+V+ LA++  +LVVAC+L  +T H
Sbjct  160   LGRIGLAIATRVEAFDCPVNYYQRTKKDYPSYTYYPSVVGLAASSDVLVVACSLNEQTRH  219

Query  469   IINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGI  290
             I+NR+VI++LGP GV+INI RG HVDE EL+SALVEGRLGGAGLDVFEDEP V E LF +
Sbjct  220   IVNREVIEALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFEDEPNVPESLFTL  279

Query  289   DNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             DNVVL+PH G  T ETR AMADLV+ NLEAH + KPLLT V+
Sbjct  280   DNVVLVPHMGSGTHETRKAMADLVLDNLEAHVLKKPLLTPVI  321



>ref|XP_002978650.1| hypothetical protein SELMODRAFT_109271 [Selaginella moellendorffii]
 gb|EFJ20097.1| hypothetical protein SELMODRAFT_109271 [Selaginella moellendorffii]
Length=316

 Score =   331 bits (849),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 177/312 (57%), Positives = 226/312 (72%), Gaps = 4/312 (1%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             VLMA PM   LE  L ++F LLR W   D  A   Q ++  ++ALVVN    A      I
Sbjct  6     VLMAVPMLPDLELALDSKFRLLRLWQAEDPGAMLRQ-HSGQIQALVVNHKFEASA--AVI  62

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP LEI+S++SVGLDK+DL KCKE+G+ VTNTPDVLTD+ AD+A+ L+L  +R+I   
Sbjct  63    DALPRLEIVSSFSVGLDKIDLKKCKERGVAVTNTPDVLTDETADLAMALLLGTMRRICPA  122

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DR+V++GLW + H  F  + + SGK +GI+GLGRIG AIAKRAE F+C ISY SR +K  
Sbjct  123   DRYVREGLWPV-HGDFPLSHKVSGKRIGIVGLGRIGSAIAKRAEGFSCGISYFSREKKPG  181

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y +Y ++++LA +   L+VACALTPET H+++R+VID+LGP G ++NIARG  VDEAE
Sbjct  182   VPYAHYSSLVDLARDSDALIVACALTPETRHLVSREVIDALGPEGTLVNIARGPIVDEAE  241

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+ ALV+ RLG AGLDVFE EP+V +EL G+DNVVLLPH G  T +TR AM DLVVRNLE
Sbjct  242   LVQALVDKRLGAAGLDVFEAEPQVPQELLGMDNVVLLPHVGSGTWDTRRAMGDLVVRNLE  301

Query  202   AHFMNKPLLTRV  167
             AHF  K L+T V
Sbjct  302   AHFSGKSLVTPV  313



>tpg|DAA46911.1| TPA: glyoxylate reductase [Zea mays]
Length=320

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 231/320 (72%), Gaps = 2/320 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  P++ YLE +L  R  LLR W  P D    F + +A+S+RA+V+    G  
Sbjct  1     MESLGVLLLHPLDTYLEQELDRRCRLLRLWEVPHDRRGEFLRAHASSIRAVVIGGGSGFG  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++ Y+VG D VDL +C+E+G+RVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    GNPALIDDLPRLEIIACYAVGYDCVDLTRCRERGVRVTNTPDVLTDDVADLAVGLAIAAL  120

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I   D +V+ GLWK     +  T++FSGK VGIIGLGRIGL+IAKR E F C + Y+ 
Sbjct  121   RRIPHADSYVRAGLWKANDGHYGLTTRFSGKRVGIIGLGRIGLSIAKRVEGFGCPVCYYQ  180

Query  580   RS-QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             R+ Q    NY Y PTV++LA+N  +LVVAC+L  ++  I++R+VI++LGP GV++N+ RG
Sbjct  181   RTRQDAYPNYIYLPTVLQLAANSDVLVVACSLNEQSRGIVSREVIEALGPTGVLVNVGRG  240

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
              HVDE EL++AL +GRLGGAGLDVF+ EP+V + L  +DNVVL PH G  T ETR AMAD
Sbjct  241   AHVDEPELVAALADGRLGGAGLDVFQAEPDVPQALMALDNVVLAPHMGSGTHETRKAMAD  300

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEAH +N PLLT VV
Sbjct  301   LVLANLEAHALNMPLLTPVV  320



>ref|NP_001147460.1| glyoxylate reductase [Zea mays]
 gb|ACG27614.1| glyoxylate reductase [Zea mays]
Length=320

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 231/320 (72%), Gaps = 2/320 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFVGAD  941
             ME++GVL+  P++ YLE +L  R  LLR W  P D    F + +A+S+RA+V+    G  
Sbjct  1     MESLGVLLLHPLDTYLEQELDRRCRLLRLWEVPHDRRGEFLRAHASSIRAVVIGGGSGFG  60

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  ID LP LEI++ Y+VG D VDL +C+E+G+RVTNTPDVLTDDVAD+A+GL +A L
Sbjct  61    GNPALIDDLPRLEIIACYAVGYDCVDLTRCRERGVRVTNTPDVLTDDVADLAVGLAIAAL  120

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I   D +V+ GLWK     +  T++FSGK VGIIGLGRIGL+IAKR E F C + Y+ 
Sbjct  121   RRIPHADSYVRAGLWKANDGHYGLTTRFSGKRVGIIGLGRIGLSIAKRVEGFGCPVCYYQ  180

Query  580   RS-QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             R+ Q    NY Y PTV++LA+N  +LVVAC+L  ++  I++R+VI++LGP GV++N+ RG
Sbjct  181   RTRQDAYPNYIYLPTVLQLAANSDVLVVACSLNEQSRGIVSREVIEALGPTGVLVNVGRG  240

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
              HVDE EL++AL +GRLGGAGLDVF+ EP+V + L  +DNVVL PH G  T ETR AMAD
Sbjct  241   AHVDEPELVAALADGRLGGAGLDVFQAEPDVPQALMALDNVVLAPHMGSGTHETRMAMAD  300

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEAH +N PLLT VV
Sbjct  301   LVLANLEAHALNMPLLTPVV  320



>ref|XP_001771114.1| predicted protein [Physcomitrella patens]
 gb|EDQ64115.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 219/305 (72%), Gaps = 8/305 (3%)
 Frame = -2

Query  1075  YLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVV--NAFVGADLLDVFIDRLPNLE  902
             YL   L ++FNLL  W   + D + A + A  VRA+V   N+ V A LL+    +LP +E
Sbjct  8     YLRDSLESKFNLLPLWEQSNKDEYLASV-ADCVRAVVTSTNSVVDAKLLE----KLPKVE  62

Query  901   ILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKG  722
             I+S++SVG DKVD+A CKE+GI VTNTPDVLTDD AD+AI L+L  +R+I   DR+V+KG
Sbjct  63    IVSSFSVGTDKVDVAYCKERGIAVTNTPDVLTDDCADLAIALLLTTMRQICSADRYVRKG  122

Query  721   LWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYP  542
              W      +  + + SGK +GI+GLGRIG A+AKRAEAF C I Y++RS K +  Y+YY 
Sbjct  123   CWP-KQGDYPLSYKMSGKDLGIVGLGRIGKAVAKRAEAFGCKIKYYARSDKKDVPYEYYG  181

Query  541   TVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVE  362
             +V+ELA N  +LVV CA T ET  II+++V+D+LGP G ++NI+RGG VDE EL+ AL+E
Sbjct  182   SVLELAKNSDMLVVCCAFTKETAKIIDKRVLDALGPEGFLVNISRGGVVDEPELVKALLE  241

Query  361   GRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKP  182
              RLGGAGLDV+E+EP V +EL+ +DNVVLLPH    T++TR AMADLV  NLEAHF  KP
Sbjct  242   CRLGGAGLDVYENEPHVPQELWNMDNVVLLPHVASGTLDTRRAMADLVSGNLEAHFSGKP  301

Query  181   LLTRV  167
             L T V
Sbjct  302   LFTPV  306



>ref|XP_006643938.1| PREDICTED: hydroxyphenylpyruvate reductase-like [Oryza brachyantha]
Length=254

 Score =   308 bits (789),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 202/255 (79%), Gaps = 1/255 (0%)
 Frame = -2

Query  928  FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
             +D LP LEI++++SVG+D+VDLA C+E+GIRVTNTPDVLTDDVAD+A+GL +A LRKI 
Sbjct  1    MLDALPALEIVASFSVGIDRVDLAGCRERGIRVTNTPDVLTDDVADLAVGLAIATLRKIP  60

Query  748  EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
            + DR+V+ G WK +   F  T++FSGK VGIIGLGRIGLA+AKR EAF+C ++Y+ R+++
Sbjct  61   QADRYVRAGRWK-SKGGFTLTTRFSGKRVGIIGLGRIGLAVAKRVEAFDCPVNYYQRTKQ  119

Query  568  LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
               NY YYP+V+ELA+N  +LVVAC L   T HI+NR+V+++LGP GV+INI RG HVDE
Sbjct  120  AYPNYTYYPSVVELAANSDVLVVACPLNEHTRHIVNREVMEALGPKGVLINIGRGPHVDE  179

Query  388  AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
             E+++AL +GRL GA    FEDEP V E LF +DNVVL+PH G AT ETR AMADLV+ N
Sbjct  180  PEMVAALADGRLRGAXXXXFEDEPNVPEALFAMDNVVLVPHVGSATHETRTAMADLVLAN  239

Query  208  LEAHFMNKPLLTRVV  164
            LEAH   KPLLT+VV
Sbjct  240  LEAHVAGKPLLTQVV  254



>gb|ACJ84562.1| unknown [Medicago truncatula]
Length=247

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/252 (62%), Positives = 196/252 (78%), Gaps = 6/252 (2%)
 Frame = -2

Query  1117  MENIGVLMAC-PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
             M +IGVL+    +  YLE +L+ R+NL R W+FP       Q + AS+RA+V +AF GAD
Sbjct  1     MGSIGVLLVSHQVIPYLEQELNKRYNLFRLWDFPQKSQLLTQ-HGASIRAVVGDAFAGAD  59

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
                  I+  P LEI+S++SVG+DK+DL KCKEKGIRVTNTP VLTD+VAD+AIGL+L +L
Sbjct  60    --SDLIEAPPKLEIVSSFSVGVDKIDLGKCKEKGIRVTNTPGVLTDEVADLAIGLMLTLL  117

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R+I E DR+V+ G WK  H  ++ T++FSGK+VGIIGLGRIG AIAKRAE FNC ISY+S
Sbjct  118   RRICECDRYVRGGNWK--HGDYKLTTKFSGKTVGIIGLGRIGAAIAKRAEGFNCPISYYS  175

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R+QK  + YKYYP+V+ELASNC ILVVAC LT ETHHIINR+VI++LGP G +INI RG 
Sbjct  176   RTQKQESKYKYYPSVVELASNCDILVVACPLTEETHHIINREVINALGPKGFLINIGRGK  235

Query  400   HVDEAELISALV  365
             HVDE EL+SAL+
Sbjct  236   HVDEPELVSALL  247



>gb|AIY25103.1| hydroxyphenylpyruvate reductase, partial [Ocimum basilicum var. 
purpurascens]
Length=204

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 178/206 (86%), Gaps = 2/206 (1%)
 Frame = -2

Query  838  IRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVg  659
            IRVTNTPDVLTDDVAD+AIGL+LAVLR+I E D++V+ G WK     F+ T++FS K VG
Sbjct  1    IRVTNTPDVLTDDVADLAIGLMLAVLRRICECDKYVRSGAWKFG--DFKLTTKFSSKRVG  58

Query  658  iiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPE  479
            IIGLGRIGLA+A+RA+AF+C ISY SRS+K NT+YKYY +V+ELASN  ILVVACALTPE
Sbjct  59   IIGLGRIGLAVAERAQAFDCPISYCSRSKKPNTDYKYYDSVVELASNSDILVVACALTPE  118

Query  478  THHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEEL  299
            T HI+NRQVID+LGP GV+INI RGGHVDE EL+SALVEGRLGGAGLDVFE EPEV E+L
Sbjct  119  TTHIVNRQVIDALGPKGVLINIGRGGHVDEPELVSALVEGRLGGAGLDVFEREPEVPEQL  178

Query  298  FGIDNVVLLPHHGCATVETRNAMADL  221
            FG+DNVVLLPH G  TVETR AMA+L
Sbjct  179  FGLDNVVLLPHIGSGTVETRKAMANL  204



>ref|XP_004159022.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Cucumis 
sativus]
Length=359

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 205/265 (77%), Gaps = 3/265 (1%)
 Frame = -2

Query  955  FVGADLLDVFIDRLPNLEILSTYS-VGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIG  779
             +GA L D ++ R   +   S  + +GLDK+DL KC EKGIRV NTPDVLTDDVAD AIG
Sbjct  97   LLGAFLADSYLGRFLTIGFGSIATFLGLDKIDLPKCLEKGIRVVNTPDVLTDDVADAAIG  156

Query  778  LILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNC  599
            L +AVLR+ISE DRFV+ G W      F   ++F+GKSVGIIGLGRIG AIAKRA AF C
Sbjct  157  LAMAVLRRISESDRFVRSGSWMKN--DFGLGTRFNGKSVGIIGLGRIGSAIAKRAVAFGC  214

Query  598  AISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVI  419
             I Y SR++K +  YKY+P+V++LA+N QIL V+C LT ET HI+NR+VID+LGPNG++I
Sbjct  215  PIGYFSRTEKHHRGYKYFPSVLDLAANSQILFVSCTLTEETKHIVNREVIDALGPNGILI  274

Query  418  NIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETR  239
            N+ RG HV+E EL+SAL+E RLGGAGLDVFE+EP V E+L  ++NVVLLPH G  T+ET 
Sbjct  275  NVGRGAHVNETELVSALLERRLGGAGLDVFENEPHVPEQLLELNNVVLLPHVGTDTIETS  334

Query  238  NAMADLVVRNLEAHFMNKPLLTRVV  164
             AMADLV+RNLEAHF N+PL+T V+
Sbjct  335  IAMADLVIRNLEAHFRNEPLITPVI  359



>ref|XP_001751565.1| predicted protein [Physcomitrella patens]
 gb|EDQ83882.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 168/305 (55%), Positives = 221/305 (72%), Gaps = 8/305 (3%)
 Frame = -2

Query  1075  YLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVV--NAFVGADLLDVFIDRLPNLE  902
             YL   L ++FNLL      + D + A +   SVRA+V   N+ VGA LL+    +LPN+E
Sbjct  23    YLRDSLESKFNLLVLSEHTNRDEYLA-MAGGSVRAVVTSTNSVVGAKLLE----KLPNVE  77

Query  901   ILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKG  722
             I++++SVGLDKVDL  CK+KGI VTNTP+VLT+D AD+AI L+LA +R+I   DR+V+KG
Sbjct  78    IVASFSVGLDKVDLDYCKQKGIVVTNTPEVLTEDCADLAIALLLATMRQICSADRYVRKG  137

Query  721   LWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYP  542
              W      +  + + SGK +GI+GLGRIG A+AKRAEAF C I Y++RS K +  Y+Y+ 
Sbjct  138   CWP-KQGTYPLSYKMSGKDLGIVGLGRIGKAVAKRAEAFGCKIKYYARSDKKDVPYEYFS  196

Query  541   TVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVE  362
             +V+ELA N  +LVV CA T ET  II+R+V+D+LGP G ++NI+RGG VDE EL+ AL+E
Sbjct  197   SVLELAKNSTMLVVCCAFTKETAKIIDRRVLDALGPEGFLVNISRGGVVDEPELVKALLE  256

Query  361   GRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKP  182
              RLGGAGLDV+E+EP V +EL+ +DNVVLLPH    T ETR AMADL+  NLEAHF  KP
Sbjct  257   CRLGGAGLDVYENEPIVPQELWNMDNVVLLPHVASGTWETRRAMADLISGNLEAHFSGKP  316

Query  181   LLTRV  167
             +LT V
Sbjct  317   VLTPV  321



>ref|XP_008789393.1| PREDICTED: LOW QUALITY PROTEIN: hydroxyphenylpyruvate reductase 
[Phoenix dactylifera]
Length=392

 Score =   290 bits (741),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 217/342 (63%), Gaps = 39/342 (11%)
 Frame = -2

Query  1108  IGVLMACPMNAYLEHQLHNRFNLLRFWNFPD---SDAFFAQINAASVRALVVNAFVGADL  938
             +GVL+  PMN YLE +L  R    R W  P     D  F    A S+R +V NA VG D 
Sbjct  54    LGVLLTFPMNXYLESELDRRGQHFRLWESPPILWKD--FLPAKAPSIRTVVGNAAVGTD-  110

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 ID LP LEI+++YS+GLDKVDLA+C+E+GIRVT  PDVLTD+ AD+AIGL +A LR
Sbjct  111   -GETIDGLPRLEIMASYSIGLDKVDLARCREQGIRVTYNPDVLTDNAADLAIGLPVASLR  169

Query  757   KISEGDRFVKKGLWKMA-----------------------HFQFQFTSQ-----FSGKSV  662
              + E +R+V    WK                          F +  +S       SGK+V
Sbjct  170   WLCEAERYVXAWSWKAKGGLQARHSDEVEETISLISSSEEEFAYSDSSSEDEFNVSGKTV  229

Query  661   giiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTP  482
             GIIGLG+IG A+A RAEAF   + YHSRS+K N N  + P+V+ELA++C +LVVAC  T 
Sbjct  230   GIIGLGKIGAAVADRAEAFGRPVCYHSRSKKPNINKYHXPSVLELAADCDMLVVACX-TE  288

Query  481   ETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEE  302
             ETHHIINR+V D+LGP G++ NI RG  V E ELISALVEGRLG A L+V E EP V EE
Sbjct  289   ETHHIINRKVTDALGPKGMLANIGRGPQVYEPELISALVEGRLGAAALNVCEHEPPVPEE  348

Query  301   LFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLL  176
             LFG++NVVL PH G  T +    MADLV  NLEAH +NKPLL
Sbjct  349   LFGMENVVLTPHVGSTTXKV---MADLVPGNLEAHVLNKPLL  387



>ref|WP_012649277.1| MULTISPECIES: dihydrofolate reductase [Rhizobium/Agrobacterium 
group]
 ref|YP_002540514.1| D-2-hydroxyacid dehydrogenase [Agrobacterium radiobacter K84]
 gb|ACM28919.1| D-2-hydroxyacid dehydrogensase protein [Agrobacterium radiobacter 
K84]
 gb|KEA03557.1| dihydrofolate reductase [Agrobacterium rhizogenes]
Length=311

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 215/318 (68%), Gaps = 10/318 (3%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADL  938
              + +L  CP+  +LE +L  RF + R +   D   F A  N  S+RA V    +G  ADL
Sbjct  2     TVDILQLCPLTPFLEAELAKRFAVHRLFEMEDKAGFLAA-NGDSIRAAVTGGHLGIPADL  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
             + V    LP LEI++   VG DKVDLA+ K +GIRV+NTPDVLT DVAD+A+GLILA  R
Sbjct  61    VAV----LPKLEIVAINGVGFDKVDLAEAKRRGIRVSNTPDVLTADVADLALGLILAFGR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++   D +V+ G W +A      +++ +G+  GI GLGRIG+AIA+R E F+  ISY +R
Sbjct  117   QLPRADAYVRAGKWLLA--DMGLSTRVAGRRYGIFGLGRIGMAIARRLEGFDARISYSAR  174

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S++ +  Y Y+ T+  LA+NC +L++A A T ET H++N +V+D+LGPNG +IN+ARG  
Sbjct  175   SKR-DVPYDYHETLAALAANCDVLILAAAATAETRHVVNAEVLDALGPNGTLINVARGSL  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  L+ AL + R+GGA LDVFEDEP V EELFG+DNV+L PH G AT ETR AMADLV
Sbjct  234   VDERALVDALQDRRIGGAALDVFEDEPRVPEELFGMDNVLLAPHLGSATHETRRAMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF    L T VV
Sbjct  294   LANLDAHFAGTRLPTAVV  311



>dbj|GAJ92169.1| putative hydroxyacid oxidoreductase [Rhizobium rhizogenes NBRC 
13257]
Length=311

 Score =   284 bits (727),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 213/318 (67%), Gaps = 10/318 (3%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADL  938
              + +L  CP+  +LE +L  RF + R +   D   F A  N  S+RA V    +G  ADL
Sbjct  2     TVDILQLCPLTPFLEAELAKRFAVHRLFEMEDKAGFLAA-NGDSIRAAVTGGHLGIPADL  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
               V    LP LEI++   VG DKVDLA+ K +GIRV+NTPDVLT DVAD+A+GLILA  R
Sbjct  61    AAV----LPKLEIVAINGVGFDKVDLAEAKRRGIRVSNTPDVLTADVADLALGLILAFGR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++   D +V+ G W  A      +++ +G+  GI GLGRIG+AIA+R E F+  ISY +R
Sbjct  117   QLPRADAYVRAGKWLSA--DMGLSTRVAGRRYGIFGLGRIGMAIARRLEGFDARISYSAR  174

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S++ +  Y Y+ T+  LA+NC +L++A A T ET H++N +V+D+LGPNG ++N+ARG  
Sbjct  175   SKR-DVPYDYHETLAALAANCDVLILAAAATAETRHVVNAEVLDALGPNGTLVNVARGSL  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  LI AL   R+GGA LDVFEDEP V EELFG+DNV+L PH G AT ETR AMADLV
Sbjct  234   VDERALIVALRGRRIGGAALDVFEDEPRVPEELFGMDNVLLAPHLGSATHETRRAMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF   PL T VV
Sbjct  294   LANLDAHFAGTPLPTAVV  311



>ref|WP_007689257.1| dihydrofolate reductase [Rhizobium sp. AP16]
 gb|EJK88212.1| lactate dehydrogenase-like oxidoreductase [Rhizobium sp. AP16]
Length=311

 Score =   279 bits (714),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 212/318 (67%), Gaps = 10/318 (3%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADL  938
              + +L  CP+  +LE +L  RF + R +   D   F A  N  S+RA V    +G  ADL
Sbjct  2     TVDILQLCPLTPFLEAELAKRFAVHRLFEMEDKAGFLAA-NGDSIRAAVTGGHLGIPADL  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
               V    LP LEI++   VG DKVDLA+ K + IRV+NTPDVLT DVAD+A+GLILA  R
Sbjct  61    AAV----LPKLEIVAINGVGFDKVDLAEAKRRDIRVSNTPDVLTADVADLALGLILAFGR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++   D +V+ G W  A      +++ +G+  GI GLGRIG+AIA+R E F+  ISY +R
Sbjct  117   QLPRADAYVRAGKWLSA--DMGLSTRVAGRRYGIFGLGRIGMAIARRLEGFDARISYSAR  174

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S++ +  Y Y+ T+  LA+NC +L++A A T ET H++N +V+D+LGPNG ++N+ARG  
Sbjct  175   SKR-DVPYDYHETLAALAANCDVLILAAAATAETRHVVNAEVLDALGPNGTLVNVARGSL  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  L+ AL + R+GGA LDVFEDEP V EELF +DNV+L PH G AT ETR AMADLV
Sbjct  234   VDERALVVALRDRRIGGAALDVFEDEPRVPEELFEMDNVLLAPHLGSATYETRRAMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF   PL T VV
Sbjct  294   LANLDAHFAGTPLPTAVV  311



>ref|XP_008232825.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Prunus 
mume]
Length=327

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/321 (48%), Positives = 214/321 (67%), Gaps = 4/321 (1%)
 Frame = -2

Query  1120  HMENIGVLMACPMN--AYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG  947
             H E   VL+  P     +LE    ++FN L+ W+ P     F   +A SV+AL+ +A  G
Sbjct  7     HSELPQVLVLLPPGCFTFLESNYSHKFNFLKAWDSPLPQDQFLATHAGSVQALLSSAN-G  65

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
               +    +  LP+L+++ T S GLD VDLA+C+ +G+ + +TP + T+DVAD+A+GL+L 
Sbjct  66    PTITANILQMLPSLKVIVTTSAGLDHVDLAECRSRGVAIASTPKIFTEDVADMAVGLLLD  125

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             V+RKIS GDR+V+ GLW      +   S+  GK VGI+GLG IGL +AKR EAF C I Y
Sbjct  126   VMRKISAGDRYVRDGLWA-TRGDYALGSKIGGKRVGIVGLGNIGLEVAKRLEAFGCNILY  184

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             +SR++K   +Y +Y  + ELA+N   LV+ CALT ETHH+IN++V+ +LG +GV++NI R
Sbjct  185   NSRTEKPFVSYPFYSDISELAANSDALVICCALTAETHHMINKKVLLALGRDGVIVNIGR  244

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G  +DE E++  LV+G +GGAGLDVFEDEPEV +ELF +DNVVL PH+   T E   A+ 
Sbjct  245   GAVIDEKEMVRCLVKGEIGGAGLDVFEDEPEVPQELFALDNVVLSPHYATYTSECFMALC  304

Query  226   DLVVRNLEAHFMNKPLLTRVV  164
             +LV  N EA F NKPLL+  V
Sbjct  305   ELVAGNFEAFFSNKPLLSPAV  325



>ref|WP_012978154.1| dihydrofolate reductase [Azospirillum lipoferum]
 ref|YP_003452895.1| D-isomer specific 2-hydroxyacid dehydrogenase [Azospirillum sp. 
B510]
 dbj|BAI76351.1| D-isomer specific 2-hydroxyacid dehydrogenase [Azospirillum sp. 
B510]
Length=312

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 203/313 (65%), Gaps = 5/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L+  PM   +E  L   + + R    PD D   A+I    VRA+V     G  + +  +
Sbjct  5     ILLVEPMMPAMEQALDAAYIVHRLSAAPDRDRLIAEIGG-RVRAVVTGG--GTGVANAVV  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP LE+++   VG D VDL   + +G+RVTNTPDVLTDDVAD+AIGL++A  R++  G
Sbjct  62    DALPTLELIAINGVGTDAVDLEHARSRGVRVTNTPDVLTDDVADLAIGLMIAASRRMMVG  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DRFV+ G W     +     + SGK +G++GLGRIG AIAKRAEAF   ++Y +R  +  
Sbjct  122   DRFVRAGQWPKG--KLPLARKVSGKRLGVLGLGRIGEAIAKRAEAFGMTVAYTNRKPREG  179

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
              +Y++  + + LA    ILVVA +  P+  +++ R ++D+LGP+G++IN+ARG  VDE E
Sbjct  180   VSYRFVASPVALARESDILVVAASAGPDARNMVGRAMLDALGPDGILINVARGSVVDEPE  239

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L++AL EGR+GGAGLDVF  EP V E  FG+D VVL PH   ATVETR AMA LV+ NLE
Sbjct  240   LLAALTEGRIGGAGLDVFAAEPTVPEGFFGLDTVVLQPHQASATVETRTAMAQLVLDNLE  299

Query  202   AHFMNKPLLTRVV  164
             AHF  +PL T VV
Sbjct  300   AHFAGRPLPTAVV  312



>ref|WP_014250214.1| dihydrofolate reductase [Azospirillum lipoferum]
 ref|YP_005041462.1| 2-oxo/hydroxy acid reductase [Azospirillum lipoferum 4B]
 emb|CBS91393.1| 2-oxo/hydroxy acid reductase [Azospirillum lipoferum 4B]
Length=312

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 205/313 (65%), Gaps = 5/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L+  PM   +E  L   + + R    PD D   A++ A   RA+V     G  + +  I
Sbjct  5     ILLVEPMMPAIEQALDAAYTVHRLSAAPDRDRLVAEL-ADRARAVVTGG--GTGVKNAVI  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP L I++   VG D VDL  C+ +G+RVTNTPDVLTDDVAD+AIGL++A  R+++ G
Sbjct  62    DALPKLGIVAINGVGTDAVDLEHCRGRGVRVTNTPDVLTDDVADLAIGLLIATSRRMAVG  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DRFV+ G W     +     + SGK +G++GLGRIG AIAKRAEAF   I+Y +R  +  
Sbjct  122   DRFVRAGQWPKG--KLPLARKVSGKRLGVLGLGRIGEAIAKRAEAFGMTIAYTNRKPREG  179

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y++  + ++LA    ILVVA +  P+  +++ R+++D+LGP+G+++N+ARG  VDE E
Sbjct  180   VPYRFVASPVDLARESDILVVAASAGPDARNMVGRELLDALGPDGILVNVARGSVVDEPE  239

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L++AL EGRLGGAGLDVF DEP V E  +G+DNVVL PH   ATVETR AM  LV+ NL+
Sbjct  240   LLAALTEGRLGGAGLDVFADEPNVPEGFYGLDNVVLQPHQASATVETRTAMGQLVLDNLD  299

Query  202   AHFMNKPLLTRVV  164
             A F  +PL T VV
Sbjct  300   AFFAGRPLPTAVV  312



>ref|XP_007220744.1| hypothetical protein PRUPE_ppa025117mg [Prunus persica]
 gb|EMJ21943.1| hypothetical protein PRUPE_ppa025117mg [Prunus persica]
Length=327

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 213/321 (66%), Gaps = 4/321 (1%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAY--LEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG  947
             H E   VL+  P   +  LE    ++F  L+ W+ P     F   +A SV+AL+ +A  G
Sbjct  7     HSELPQVLVLLPPGCFTLLESNYSHKFKFLKAWDSPLPQDQFLATHAGSVQALLSSAN-G  65

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
               +    +  LP+L+++ T SVG+D +DLA+C+ +G+ + +TP + T+DVAD+A+GL+L 
Sbjct  66    PTITANILQMLPSLKVIVTTSVGIDHLDLAECRSRGVAIASTPKIFTEDVADMAVGLLLD  125

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             V+RKIS GDR+V+ GLW      +   S+  GK VGI+GLG IGL +AKR EAF C I Y
Sbjct  126   VMRKISAGDRYVRDGLWA-TRGDYALGSKIGGKRVGIVGLGNIGLEVAKRLEAFGCNILY  184

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             +SR++K   +Y +Y  + ELA+N   LV+ CALT ETHH+IN++V+ +LG +GV++NI R
Sbjct  185   NSRTEKPFVSYPFYSDICELAANSDALVICCALTAETHHLINKKVLLALGRDGVIVNIGR  244

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G  +DE E++  LV G +GGAGLDVFEDEPEV EELF +DNVVL PH+   T E   A+ 
Sbjct  245   GAIIDEKEMVRCLVIGEIGGAGLDVFEDEPEVPEELFALDNVVLSPHYATYTPECFMALC  304

Query  226   DLVVRNLEAHFMNKPLLTRVV  164
             +LV  N EA F NKPLL+  V
Sbjct  305   ELVAGNFEAFFSNKPLLSPAV  325



>ref|XP_009148581.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Brassica 
rapa]
Length=322

 Score =   275 bits (702),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 154/308 (50%), Positives = 206/308 (67%), Gaps = 5/308 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDV-FIDRLP  911
             P  AY++  L   F LL     PD    F   +AASV A V    +G   +D   +  LP
Sbjct  16    PTLAYMDDHLSRNFRLLNAHLSPDPLPLFLSRHAASVTAFV---NIGRLKIDAELLSHLP  72

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             +L++L   SVG D VDLA+CK +GI VTN  D  +DDVAD A+GL+L+VLR+I  GDR+V
Sbjct  73    SLQLLVCTSVGTDHVDLAECKRRGIAVTNAGDAFSDDVADCAVGLLLSVLRRIPAGDRYV  132

Query  730   KKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYK  551
             + G W     QFQ   + SGK VGIIGLG IG  IAKR E F C ISY+SR+QK +  Y+
Sbjct  133   RSGNWSKPG-QFQLGIKVSGKRVGIIGLGSIGSRIAKRLEPFGCIISYNSRTQKQSIPYR  191

Query  550   YYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISA  371
             YY  V+ LA++  +LV+ C+LT +T H++NR+V++SLG  GV+IN+ RGG +DE E++  
Sbjct  192   YYSDVLSLAADNDVLVLCCSLTDQTRHVVNREVMESLGKEGVIINVGRGGLIDEEEMVKC  251

Query  370   LVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFM  191
             LVEG +GGAGLDVFE EP+V EELFG+DNVVL PH   AT     ++A++ + NL+A F 
Sbjct  252   LVEGVIGGAGLDVFEKEPQVPEELFGMDNVVLSPHAAVATPGALESVAEVAIANLKAFFS  311

Query  190   NKPLLTRV  167
             N+PL++ V
Sbjct  312   NQPLVSPV  319



>ref|WP_026871361.1| hypothetical protein [Inquilinus limosus]
Length=311

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 197/300 (66%), Gaps = 7/300 (2%)
 Frame = -2

Query  1063  QLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYS  884
             +L     + R W   D +    ++ A  VR +V    V A+    F+DR P LEI+  + 
Sbjct  19    ELEANCTVHRLWEAADREELIRRV-APEVRGIVTGPGVSAE----FMDRFPALEIIGNFG  73

Query  883   VGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAH  704
             VG DKVD    K +G+RVTNTP VL D+VAD+ + L+LA  R++  GDRFV+ G W    
Sbjct  74    VGYDKVDTVHAKSRGVRVTNTPGVLDDEVADLGLLLMLATARRLCVGDRFVRAGKW--LE  131

Query  703   FQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELA  524
                       GK +G++G+GRIG A+A+RA+ F  +I++H    K   +Y YYP ++ LA
Sbjct  132   GGLPLARSLRGKRLGVVGMGRIGQAVAERAKIFGLSIAWHGPRAKPEIDYPYYPDLVALA  191

Query  523   SNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGA  344
              +  +LV+ C     THHI+NR VI++LGP G+++NIARG  VDE E+++ALV+GRLG A
Sbjct  192   RDSDVLVLCCPGGAATHHIVNRAVIEALGPEGILVNIARGTVVDEPEMVAALVDGRLGAA  251

Query  343   GLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             GLDVFE EP+V E L+G+DNVVL PH G ATVETRNAMADLVVRNL AHF  KPLLT VV
Sbjct  252   GLDVFEHEPKVPEALYGLDNVVLQPHVGSATVETRNAMADLVVRNLLAHFAGKPLLTPVV  311



>gb|EYU21461.1| hypothetical protein MIMGU_mgv1a013906mg [Erythranthe guttata]
Length=207

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 172/209 (82%), Gaps = 2/209 (1%)
 Frame = -2

Query  790  IAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAE  611
            +A+ L LA LR+I   DRFV++G WK +   F  T++FSGKSVGIIGLGRIG AIA+RAE
Sbjct  1    MAVLLTLATLRRICAADRFVRRGEWKKS--DFNLTTKFSGKSVGIIGLGRIGSAIARRAE  58

Query  610  AFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPN  431
            AF C+I YHSRSQK N+ YK+YP+V+ LAS+ QIL+VACALT ET HII+R VID+LG N
Sbjct  59   AFGCSIGYHSRSQKPNSRYKFYPSVLNLASDSQILIVACALTQETRHIIDRHVIDALGRN  118

Query  430  GVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCAT  251
            G+++NIARG H+DEAELISALVEGRL GAGLDV E+EP+V   L G+DN+VL PH G +T
Sbjct  119  GIIVNIARGSHIDEAELISALVEGRLAGAGLDVLENEPQVPNALIGLDNIVLSPHVGAST  178

Query  250  VETRNAMADLVVRNLEAHFMNKPLLTRVV  164
            VETR AMADLVV+NLEAHF +KPLLT V+
Sbjct  179  VETRKAMADLVVQNLEAHFSDKPLLTPVI  207



>ref|WP_034832238.1| hypothetical protein [Inquilinus limosus]
 gb|KGM35457.1| hypothetical protein P409_04335 [Inquilinus limosus MP06]
Length=311

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/300 (50%), Positives = 197/300 (66%), Gaps = 7/300 (2%)
 Frame = -2

Query  1063  QLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYS  884
             +L     + R W   D +A   ++ A  VR +V    V A+    F+DR P LEI+  + 
Sbjct  19    ELEANCTVHRLWEAEDREALIQRV-APEVRGIVTGPGVSAE----FMDRFPALEIIGNFG  73

Query  883   VGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAH  704
             VG DKVD A  K +G+RVTNTP VL D+VAD+ + L+LA  R++  GDRFV+ G W    
Sbjct  74    VGYDKVDTAHAKSRGVRVTNTPGVLDDEVADLGLLLMLATARRLCVGDRFVRAGKWTQG-  132

Query  703   FQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELA  524
                       GK +G++G+GRIG A+A+RA+ F  +I++H    K   ++ YYP ++ LA
Sbjct  133   -GLPLARSLRGKRLGVVGMGRIGQAVAERAKVFGLSIAWHGPRVKPEIDHPYYPDLVALA  191

Query  523   SNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGA  344
              +  +LV+ C     THHI+NR VI++LGP G+++NIARG  VDE E++SALV+GRLG A
Sbjct  192   KDSDVLVLCCPGGAATHHIVNRAVIEALGPEGILVNIARGTVVDEPEMVSALVDGRLGAA  251

Query  343   GLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             GLDVFE EP V E L+ +DNVVL PH G ATVETRNAMADLVVRNL AHF  +PLLT VV
Sbjct  252   GLDVFEHEPTVPEALYKLDNVVLQPHVGSATVETRNAMADLVVRNLLAHFAGQPLLTPVV  311



>ref|XP_006417223.1| hypothetical protein EUTSA_v10008209mg [Eutrema salsugineum]
 gb|ESQ35576.1| hypothetical protein EUTSA_v10008209mg [Eutrema salsugineum]
Length=322

 Score =   272 bits (696),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 207/310 (67%), Gaps = 9/310 (3%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDV---FIDR  917
             P   Y +  L   F +L   +  D    F   +A+SVRA     FV    L++    +  
Sbjct  16    PSLDYFDELLSRNFRVLNLHDSSDPLPIFLSRHASSVRA-----FVNVGRLEIDAELLSH  70

Query  916   LPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDR  737
             LP+L++L   SVG D VDLA+C  +G+ VTN  D  ++DVAD A+GL+++VLR+I  GDR
Sbjct  71    LPSLQLLVCTSVGTDHVDLAECMRRGVAVTNAGDAFSEDVADCAVGLLISVLRRIPAGDR  130

Query  736   FVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTN  557
             FV+ G W  +   FQ  ++ SGK VGI+GLG IG  IAKR EAF C ISY+SRSQK +  
Sbjct  131   FVRSGNWAKSG-NFQLGTKVSGKRVGIVGLGSIGSLIAKRLEAFGCIISYNSRSQKQSIP  189

Query  556   YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELI  377
             Y+Y P ++ LA+N  +LV+ CALT +T HI+NR+V++SLG NGV+IN+ RGG +DE E++
Sbjct  190   YQYSPDILSLAANNDVLVLCCALTDQTRHIVNREVMESLGKNGVIINVGRGGLIDEKEMV  249

Query  376   SALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAH  197
               LVEG +GGAGLDVFE+EP+V EELFG+DNVVL PH   AT  + N +  + + NL+A 
Sbjct  250   KCLVEGVIGGAGLDVFENEPKVPEELFGLDNVVLSPHAAVATPGSLNNVTQVALANLKAF  309

Query  196   FMNKPLLTRV  167
             F N+PL++ V
Sbjct  310   FSNQPLISPV  319



>ref|XP_004155807.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
sativus]
Length=327

 Score =   272 bits (695),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 205/306 (67%), Gaps = 5/306 (2%)
 Frame = -2

Query  1075  YLEHQLHNRFNLLRFW--NFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLE  902
             YLE Q  NRF  L+ W  N P +   F    A S +AL++       L    ID LP+L+
Sbjct  24    YLESQFSNRFLFLKPWLYNLPLTQ--FLTSYAQSTQALLIRGGGNTQLTSTIIDCLPSLK  81

Query  901   ILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKG  722
             ++ T SVG+D +D  + + +G+ + N  ++ ++D AD+A+GL++ VLRKIS GDRFV++G
Sbjct  82    LVVTSSVGVDHLDFPELRRRGVAIANAGNLFSEDTADMAVGLLIDVLRKISAGDRFVRQG  141

Query  721   LWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYP  542
             LW      F    + SGK +GI+GLG+IG  +AKR E F C ISY+SR++K    Y YYP
Sbjct  142   LWSKKE-DFPPGLKLSGKRIGIVGLGKIGSEVAKRLEGFGCKISYNSRTKKSMAPYSYYP  200

Query  541   TVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVE  362
              V ELA+N + L++ CALT ET+H+IN++V+ +LG +GV++NI RG  +DE E+I  L +
Sbjct  201   NVYELAANTEALIICCALTKETYHLINKEVMLALGKDGVIVNIGRGLIIDEKEMIRCLTQ  260

Query  361   GRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKP  182
             G +GGAGLDVFE+EP V EELF +DNVVL PH    T E++  ++ LVV NLEA F NKP
Sbjct  261   GEIGGAGLDVFENEPNVPEELFNLDNVVLSPHAAVMTYESKVELSKLVVNNLEAFFSNKP  320

Query  181   LLTRVV  164
             L++ VV
Sbjct  321   LVSPVV  326



>ref|XP_010533732.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Tarenaya 
hassleriana]
 ref|XP_010533733.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Tarenaya 
hassleriana]
 ref|XP_010533734.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Tarenaya 
hassleriana]
Length=320

 Score =   270 bits (689),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 211/313 (67%), Gaps = 4/313 (1%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAA-SVRALVVNAFVGADLLDVF  926
             V++  P   +L+ +L   F LL     PD    F + +A  SVRA+ V   V   +    
Sbjct  8     VVLRSPSLQFLDDRLSRNFRLLFAHTSPDPIPVFLRRSAVESVRAITVVGLV--PVTAEI  65

Query  925   IDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISE  746
             I  LP+LE++   SVG+D +D+A+CK +GI VTN  D  ++DVAD A+GL+  VLR+IS 
Sbjct  66    ISLLPSLEVIVCTSVGVDHIDVAECKGRGIAVTNAGDAFSEDVADFAVGLLFDVLRRISA  125

Query  745   GDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKL  566
              DRFV+ G W   + ++    +  GK VGI+GLG IG  +AKR E F C +SY+SR++K 
Sbjct  126   ADRFVRSGHWAR-NGEYPLGFKMGGKRVGIVGLGSIGSLVAKRLEPFGCIVSYNSRTRKA  184

Query  565   NTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEA  386
             +  Y YYP ++ LA++ +IL++ C+LT +THHIINR+V++ LG  GV+IN+ RGG +DE 
Sbjct  185   DVPYAYYPDIVSLAADNEILILCCSLTDKTHHIINREVMEKLGKGGVIINVGRGGLIDEK  244

Query  385   ELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNL  206
             E++S LV+G +GGAGLDVFE EP+V EELFG+DNVVL PH    T E+ + +A++ +RNL
Sbjct  245   EMVSGLVKGEIGGAGLDVFEKEPDVPEELFGLDNVVLSPHVAVLTPESLDCVAEMALRNL  304

Query  205   EAHFMNKPLLTRV  167
             +A F N+PL++ V
Sbjct  305   KAFFSNQPLVSPV  317



>ref|XP_010056262.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
Length=345

 Score =   270 bits (689),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 207/308 (67%), Gaps = 8/308 (3%)
 Frame = -2

Query  1078  AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPN  908
             + ++  L + F  L+ W  P   D F +  +A +  A+  +    V AD+L     RLP 
Sbjct  33    SLIDRPLPDGFLFLKPWESPLPFDDFLSSADARAAEAIYSSGREPVTADMLR----RLPE  88

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
               ++ T S GL+ +DLA+C+ +G+ +  + DV TDDVAD+A+GL++ VLRK+S  DR+V+
Sbjct  89    ARLVVTTSAGLNHIDLAECRRRGVAIACSGDVYTDDVADLAVGLLIDVLRKLSASDRYVR  148

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             +G W+ +  +F   S+  GK VGI+GLGRIG  +AKR EAF CAISYHSR +K   +Y +
Sbjct  149   RGSWR-SEGEFALGSKLGGKRVGIVGLGRIGEEVAKRLEAFGCAISYHSRKKKPYVSYTF  207

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             YP V ELA+NC  +V+ C LT +THH+INR+V+ +LG +GV++NI RG  +DE E++  L
Sbjct  208   YPNVHELATNCDAIVICCGLTEKTHHMINREVLLALGKDGVIVNIGRGPIIDEKEMVQLL  267

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+G LGGAGLDVFE+EP V EEL  +DNVVL PH    T ET + + DLVV NLEA F N
Sbjct  268   VQGELGGAGLDVFENEPSVPEELLTLDNVVLSPHRAVYTPETLSNLCDLVVGNLEAFFSN  327

Query  187   KPLLTRVV  164
             KPLL+ V 
Sbjct  328   KPLLSPVT  335



>ref|XP_010476225.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Camelina 
sativa]
Length=322

 Score =   269 bits (687),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 212/309 (69%), Gaps = 7/309 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNA--FVGADLLDVFIDRL  914
             P   +++  L   F +L      +    F   +A+S RA VV    FV A++L      L
Sbjct  16    PSLDFMDEILSRNFRILNTDTSSEPLPIFLSRHASSARAFVVVGRFFVTAEILSY----L  71

Query  913   PNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRF  734
             P+L++L   SVG D VDLA+CK +G+ VTN  +  +DDVAD A+GL+++VLR+I  GDRF
Sbjct  72    PSLQLLVCGSVGFDHVDLAECKRRGVVVTNARNAFSDDVADCAVGLLISVLRRIPAGDRF  131

Query  733   VKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNY  554
             ++ G W+  + +F+  S+ SGK VGI+G G IG  +AKR E F+C ISY+SRS+K +  Y
Sbjct  132   IRSGDWE-KYGEFRLGSKVSGKRVGILGFGSIGSFVAKRLEGFDCVISYNSRSEKPSVPY  190

Query  553   KYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELIS  374
             +YY  ++ LA+N  +LV+ C+LT +THHI+NR+V++SLG +GV+IN+ RG  +DE E++ 
Sbjct  191   RYYSDILSLAANNDVLVLCCSLTEQTHHIVNREVMESLGKDGVIINVGRGKLIDEKEMVK  250

Query  373   ALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHF  194
              LV+G +GGAGLDVFE+EP V EELFG++NVVL PH G AT  + + +A++ + NL+A F
Sbjct  251   CLVDGVIGGAGLDVFENEPAVPEELFGLENVVLSPHSGVATQGSLDNVAEITLANLKAFF  310

Query  193   MNKPLLTRV  167
              N+PLL+ V
Sbjct  311   SNRPLLSPV  319



>ref|XP_007218334.1| hypothetical protein PRUPE_ppa008547mg [Prunus persica]
 gb|EMJ19533.1| hypothetical protein PRUPE_ppa008547mg [Prunus persica]
Length=327

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 209/321 (65%), Gaps = 4/321 (1%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAY--LEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG  947
             H E   VL+  P   +  LE    ++F  L+ W+ P     F   +A SV+AL+ ++  G
Sbjct  7     HSELPQVLVLLPPGCFTLLESNYSHKFKFLKAWDSPLPQDQFLATHAGSVQALL-SSVKG  65

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
               +    +  LP+L+++ T   G+D +DLA+C+ +G+ + +TP + T+DVAD+A+GL+L 
Sbjct  66    PTITANILQMLPSLKVIVTTGAGIDHLDLAECRSRGVAIASTPKIFTEDVADMAVGLLLD  125

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             V+RKIS GDR+V+ GLW      +   S+  G  VGI+GLG IG+ +AKR EAF C I Y
Sbjct  126   VMRKISAGDRYVRDGLWA-TRGDYALGSKIGGNRVGIVGLGNIGVEVAKRLEAFGCNILY  184

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             +SR++K   +Y +Y  + ELA+N   LV+ CALT ETHH+IN++V   LG +GV++N+ R
Sbjct  185   NSRTEKPFVSYPFYSDICELAANSDALVICCALTAETHHLINKKVSLKLGRDGVIVNVGR  244

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G  +DE E++  LV+G +GGAGLDVFEDEPEV EELF +DNVVL PH+   T E   A+ 
Sbjct  245   GAIIDEKEMVRCLVKGEIGGAGLDVFEDEPEVPEELFALDNVVLSPHYATYTPECFMALC  304

Query  226   DLVVRNLEAHFMNKPLLTRVV  164
             +LV  N EA F NKPLL+  V
Sbjct  305   ELVAGNFEAFFSNKPLLSPAV  325



>ref|XP_004133897.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
sativus]
Length=335

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 206/316 (65%), Gaps = 5/316 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFW--NFPDSDAFFAQINAASVRALVVNAFVG  947
              +  I +L    +  YLE Q  NRF  L+ W  N P +   F    A S +AL++     
Sbjct  9     ELPQILILGPPSIFPYLESQFSNRFLFLKPWLYNLPLTQ--FLTSYAQSTQALLIRGGGN  66

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
               L    ID LP+L+++ T SVG+D +D  + + +G+ + N  ++ ++D AD+A+GL++ 
Sbjct  67    TQLTSTIIDCLPSLKLVVTSSVGVDHLDFPELRRRGVAIANAGNLFSEDTADMAVGLLID  126

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             VLRKIS GDRFV++GLW      F    + SGK +GI+GLG+IG  +AKR E F C ISY
Sbjct  127   VLRKISAGDRFVRQGLWSKKE-DFPPGLKLSGKRIGIVGLGKIGSEVAKRLEGFGCKISY  185

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             +SR++K    Y YYP V ELA+N + L++ CALT ET+H+IN++V+ +LG +GV++NI R
Sbjct  186   NSRTKKSMAPYSYYPNVYELAANTEALIICCALTKETYHLINKEVMLALGKDGVIVNIGR  245

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G  +DE E+I  L +G +GGAGLDVFE+EP V EELF +DNVVL PH    T E++  ++
Sbjct  246   GLIIDEKEMIRCLTQGEIGGAGLDVFENEPNVPEELFNLDNVVLSPHAAVMTYESKVELS  305

Query  226   DLVVRNLEAHFMNKPL  179
              LVV NLEA F NKPL
Sbjct  306   KLVVNNLEAFFSNKPL  321



>ref|XP_004308425.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Fragaria 
vesca subsp. vesca]
Length=326

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 205/319 (64%), Gaps = 2/319 (1%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGAD  941
              +  + VL   P  A LE     +FNLL+ W+ P     F   +A SV+AL+     G  
Sbjct  8     ELPTVLVLQRSPTIALLEPSCSQKFNLLKAWDSPLPQDQFLTTHAGSVQALIAPVH-GPP  66

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
             +    +  LP+L+ ++T S GLD VDLA+C+ +G+ V N      +D AD+A+GL + V+
Sbjct  67    ITAQILQSLPSLKFITTTSAGLDHVDLAECQRRGVAVANASKAFAEDAADMAVGLFIDVM  126

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             RKIS  +R+V+ GLW      +   S+  GK+VGI+GLG IGL +AKR EAF C + Y+S
Sbjct  127   RKISASNRYVRDGLWA-TRGDYPLGSKIGGKTVGIVGLGNIGLGVAKRLEAFGCRVLYNS  185

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             RS++ + +Y+YY  V ELA+    L++ CALT +THH+IN++V+ +LG  GV++N+ RG 
Sbjct  186   RSERPSLSYRYYSDVCELAAESDALIICCALTEQTHHMINKEVLCALGREGVIVNVGRGA  245

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              +DE E++  LV G + GAGLDVFE+EP+V +ELFG+DNVVL PH    T E+   ++++
Sbjct  246   IIDEKEMVRCLVRGEIAGAGLDVFENEPDVPKELFGLDNVVLSPHQAVVTPESMVGLSEV  305

Query  220   VVRNLEAHFMNKPLLTRVV  164
             V  NLEA F NKPLL+  V
Sbjct  306   VTENLEAFFSNKPLLSPAV  324



>emb|CDY57070.1| BnaCnng31510D [Brassica napus]
Length=322

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 205/308 (67%), Gaps = 5/308 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDV-FIDRLP  911
             P  AY++  L   F LL     PD    F   +AASV A V    +G   +D   +  LP
Sbjct  16    PTLAYMDDHLSRNFRLLNAHLSPDPLPLFLSRHAASVTAFV---NIGRLKIDAELLSHLP  72

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             +L++L   SVG D VDLA+CK +GI VTN  +  +DDVAD A+GL+++VLR+I  GDR+V
Sbjct  73    SLQLLVCTSVGTDHVDLAECKRRGIAVTNAGEAFSDDVADCAVGLLISVLRRIPAGDRYV  132

Query  730   KKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYK  551
             + G W     QFQ   + SG+ VGIIGLG IG  +AKR E F C ISY+SR+QK +  Y+
Sbjct  133   RSGNWSKPG-QFQLGIKVSGRRVGIIGLGSIGSRVAKRLEPFGCIISYNSRTQKQSIPYR  191

Query  550   YYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISA  371
             YY  V+ LA++  +LV+ C+LT +T H++NR+V++SLG  GV+IN+ RGG +DE E++  
Sbjct  192   YYSDVLSLAADNDVLVLCCSLTDQTMHVVNREVMESLGKEGVIINVGRGGLIDEEEMVKC  251

Query  370   LVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFM  191
             LVEG +GGAGLDVFE EP+V EELF +DNVVL PH   AT     ++A++ + NL+A F 
Sbjct  252   LVEGVIGGAGLDVFEKEPQVPEELFVMDNVVLSPHAAVATPGALESVAEVAIANLKAFFK  311

Query  190   NKPLLTRV  167
             N+PL++ V
Sbjct  312   NQPLVSPV  319



>ref|XP_010494315.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Camelina 
sativa]
Length=322

 Score =   266 bits (680),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 212/309 (69%), Gaps = 7/309 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNA--FVGADLLDVFIDRL  914
             P   +++  L   F +L   N  +    F   +A+S RA VV    FV A++L      L
Sbjct  16    PSLDFMDEILSRNFRILNTNNSSEPLPIFLSRHASSARAFVVVGRFFVTAEILSY----L  71

Query  913   PNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRF  734
             P+L++L   SVG+D VDLA+CK + + VTN  +  +DDVAD A+GL+++VLR+I  GDRF
Sbjct  72    PSLQLLVCGSVGVDHVDLAECKRRRVVVTNARNAFSDDVADCAVGLLISVLRRIPAGDRF  131

Query  733   VKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNY  554
             ++ G W+ +  +F+  S+ SGK VGI+G G IG  +AKR E F+C ISY+SRS+K +  Y
Sbjct  132   IRSGDWEKSG-EFRLGSKVSGKRVGILGFGSIGSFVAKRLEGFDCVISYNSRSEKPSVPY  190

Query  553   KYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELIS  374
             +YY  ++ LA+N  +LV+ C+LT +THHI+NR+V++SLG +GV+IN+ RG  +DE E++ 
Sbjct  191   RYYSDILSLAANNDVLVLCCSLTEQTHHIVNREVMESLGKDGVIINVGRGKLIDEKEMVK  250

Query  373   ALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHF  194
              L +G +GGAGLDVFE+EP V EELFG++NVVL PH G AT  + + +A++ + NL+A F
Sbjct  251   CLADGVIGGAGLDVFENEPAVPEELFGLENVVLSPHSGVATQGSLDNVAEITLANLKAFF  310

Query  193   MNKPLLTRV  167
              N+PLL+ V
Sbjct  311   SNRPLLSPV  319



>gb|KGN56572.1| hypothetical protein Csa_3G124910 [Cucumis sativus]
Length=332

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 205/311 (66%), Gaps = 10/311 (3%)
 Frame = -2

Query  1075  YLEHQLHNRFNLLRFW--NFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLE  902
             YLE Q  NRF  L+ W  N P +   F    A S +AL++       L    ID LP+L+
Sbjct  24    YLESQFSNRFLFLKPWLYNLPLTQ--FLTSYAQSTQALLIRGGGNTQLTSTIIDCLPSLK  81

Query  901   ILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVAD-----IAIGLILAVLRKISEGDR  737
             ++ T SVG+D +D  + + +G+ + N  ++ ++D AD     +A+GL++ VLRKIS GDR
Sbjct  82    LVVTSSVGVDHLDFPELRRRGVAIANAGNLFSEDTADMAGGGVAVGLLIDVLRKISAGDR  141

Query  736   FVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTN  557
             FV++GLW      F    + SGK +GI+GLG+IG  +AKR E F C ISY+SR++K    
Sbjct  142   FVRQGLWSKKE-DFPPGLKLSGKRIGIVGLGKIGSEVAKRLEGFGCKISYNSRTKKSMAP  200

Query  556   YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELI  377
             Y YYP V ELA+N + L++ CALT ET+H+IN++V+ +LG +GV++NI RG  +DE E+I
Sbjct  201   YSYYPNVYELAANTEALIICCALTKETYHLINKEVMLALGKDGVIVNIGRGLIIDEKEMI  260

Query  376   SALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAH  197
               L +G +GGAGLDVFE+EP V EELF +DNVVL PH    T E++  ++ LVV NLEA 
Sbjct  261   RCLTQGEIGGAGLDVFENEPNVPEELFNLDNVVLSPHAAVMTYESKVELSKLVVNNLEAF  320

Query  196   FMNKPLLTRVV  164
             F NKPL++ VV
Sbjct  321   FSNKPLVSPVV  331



>ref|XP_008438123.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
melo]
Length=320

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 212/322 (66%), Gaps = 7/322 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMN--AYLEHQLHNRFNLLRFW--NFPDSDAFFAQINAASVRALVVNAFV  950
             ME   VL+  P +   YLE Q  NRF  L+ W  N P +   F    A S +AL++    
Sbjct  1     MELPQVLVLGPPSIFPYLESQFPNRFFFLKPWLYNLPLTQ--FLTSYAQSTQALLIRGGG  58

Query  949   GADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLIL  770
                L    ID LP+L+++ T SVG+D +DL + + +G+ + N  ++ ++D AD+A+GL++
Sbjct  59    STQLTSAIIDCLPSLKLVVTSSVGVDHLDLPELRRRGVAIANAGNLFSEDAADMAVGLLI  118

Query  769   AVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAIS  590
              VLRK+S GDRFV++GLW      F    + SGK +GI+GLG+IG  +AKR E F C +S
Sbjct  119   DVLRKVSAGDRFVRQGLWSKKG-DFPPGLKLSGKRIGIVGLGKIGSEVAKRLEGFGCKVS  177

Query  589   YHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIA  410
             Y+SR++K    Y YY  V ELA+N + L++ CALT ET+ +IN++V+ +LG +GV++N+ 
Sbjct  178   YNSRTKKSMAPYSYYSNVYELAANTEALIICCALTKETYRLINKEVMQALGKDGVIVNVG  237

Query  409   RGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAM  230
             RG  +DE E+I  L++G +GGAGLDVFE+EP V EELF +DNVVL PH+   T E++  +
Sbjct  238   RGLIIDEKEMIRCLIQGEIGGAGLDVFENEPNVPEELFNLDNVVLSPHNAVMTYESKVEL  297

Query  229   ADLVVRNLEAHFMNKPLLTRVV  164
             + LVV NLEA F N PL++ VV
Sbjct  298   SKLVVNNLEAFFSNTPLVSPVV  319



>ref|XP_002889940.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66199.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=322

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 207/309 (67%), Gaps = 7/309 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGA-DLLDVFIDRLP  911
             P   +++  L   F  L      +S   F   +A+S RA VV   VG   + +  +  LP
Sbjct  16    PSLTFMDETLSREFRTLITDTSSESLPSFLSRHASSARAFVV---VGRLPVTEELLSHLP  72

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             +L+IL   SVG+D +DLA CK + + +TN  +  +DDVAD A+GL+L+VLR+I   DR+V
Sbjct  73    SLQILVCTSVGIDHIDLAACKRRDLVITNAGNAFSDDVADCAVGLLLSVLRRIPAADRYV  132

Query  730   KKGLWKMAHF-QFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNY  554
             + G W  A F  FQ  S+   K V ++  G+IG  +AKR E+F C ISY+SRSQK +++Y
Sbjct  133   RSGNW--AKFGDFQLGSKVCSKKVFVVVTGKIGSFVAKRLESFGCIISYNSRSQKQSSSY  190

Query  553   KYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELIS  374
             +YYP ++ LA++  +LV+ C+LT ETHHI+NR+V++SLG +GV++N+ RGG +DE E++ 
Sbjct  191   RYYPDILSLAADNDVLVLCCSLTDETHHIVNREVMESLGKDGVIVNVGRGGLIDEKEMVK  250

Query  373   ALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHF  194
              LVEG +GGAGLDVFE+EP V EELFG+DNVVL PH   AT  + + +A++ + NL A F
Sbjct  251   CLVEGVIGGAGLDVFENEPAVPEELFGLDNVVLSPHLAVATSGSLDNVAEIGLANLRAFF  310

Query  193   MNKPLLTRV  167
              N+PLL+ V
Sbjct  311   SNRPLLSPV  319



>gb|KCW72900.1| hypothetical protein EUGRSUZ_E01342 [Eucalyptus grandis]
Length=264

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -2

Query  928  FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
             + RLP   ++ T S GL+ +DLA+C+ +G+ +  + DV TDDVAD+A+GL++ VLRK+S
Sbjct  1    MLRRLPEARLVVTTSAGLNHIDLAECRRRGVAIACSGDVYTDDVADLAVGLLIDVLRKLS  60

Query  748  EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
              DR+V++G W+ +  +F   S+  GK VGI+GLGRIG  +AKR EAF CAISYHSR +K
Sbjct  61   ASDRYVRRGSWR-SEGEFALGSKLGGKRVGIVGLGRIGEEVAKRLEAFGCAISYHSRKKK  119

Query  568  LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
               +Y +YP V ELA+NC  +V+ C LT +THH+INR+V+ +LG +GV++NI RG  +DE
Sbjct  120  PYVSYTFYPNVHELATNCDAIVICCGLTEKTHHMINREVLLALGKDGVIVNIGRGPIIDE  179

Query  388  AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
             E++  LV+G LGGAGLDVFE+EP V EEL  +DNVVL PH    T ET + + DLVV N
Sbjct  180  KEMVQLLVQGELGGAGLDVFENEPSVPEELLTLDNVVLSPHRAVYTPETLSNLCDLVVGN  239

Query  208  LEAHFMNKPLLTRV  167
            LEA F NKPLL+ V
Sbjct  240  LEAFFSNKPLLSPV  253



>ref|XP_010661599.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 isoform 
X2 [Vitis vinifera]
Length=321

 Score =   264 bits (675),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 210/321 (65%), Gaps = 7/321 (2%)
 Frame = -2

Query  1120  HMENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VG  947
              +  + VL   P+    E Q   +F+ LR W  P   A F   +AASV+A++ +    + 
Sbjct  4     QLPQVLVLRPPPVFTLFETQFSQKFHFLRAWESPLPTAEFLATHAASVKAVLCSGSTPIT  63

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
             AD+L      LP+L+++ T S GL+ ++L +C+ + I + N  ++ +DD AD+A+GL++ 
Sbjct  64    ADILR----HLPSLQLIVTTSAGLNHINLPECRRRSISIANAGEIFSDDCADLAVGLLMD  119

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             VLRKIS  DRF++ GLW +    +   S+  GK VGI+GLG IGL +AKR EAF C I Y
Sbjct  120   VLRKISAADRFIRAGLWPI-RGDYPLGSKLGGKRVGIVGLGSIGLEVAKRLEAFGCIILY  178

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             +SR +K N +Y +Y  V ELA+N   L++ CALT ET H+IN++V+ +LG  GV+INI R
Sbjct  179   NSRRKKANISYPFYSNVCELAANSNALIICCALTDETRHMINKEVMKALGKEGVIINIGR  238

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G  +DE EL+  LV+G +GGAGLDVFE+EP+V +ELF +DNVVL PH    T E+ + + 
Sbjct  239   GAIIDEKELVQCLVQGEIGGAGLDVFENEPDVPKELFTLDNVVLSPHVAVFTQESFSDLY  298

Query  226   DLVVRNLEAHFMNKPLLTRVV  164
             DL+V NLEA F NK LL+ V+
Sbjct  299   DLMVGNLEAFFSNKTLLSPVL  319



>ref|WP_024898012.1| dihydrofolate reductase [Ochrobactrum rhizosphaerae]
Length=311

 Score =   263 bits (673),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 152/316 (48%), Positives = 206/316 (65%), Gaps = 6/316 (2%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLD  932
             ++ +L  CP+   +E  L+ ++ + R++   D +AF    +A  V+ +V    +G  + +
Sbjct  2     SVEILQLCPLIPAMEQSLNEQYKVHRWFEIADQNAFL-NAHADKVKGVVTGGHIG--IPN  58

Query  931   VFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKI  752
                DRLP LEI++   VG DKVDL K +++G  V+NTPDVLT DVAD AIGLI+A  R I
Sbjct  59    ELADRLPALEIVAINGVGFDKVDLPKARQRGYGVSNTPDVLTTDVADTAIGLIIAQARHI  118

Query  751   SEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQ  572
             +  D  V+KG W  A  +    ++ SG+  GI GLGRIG AIA+R E F+  +SY  R+ 
Sbjct  119   ASADAHVRKGNWPKA--EIGLGTRVSGRRYGIFGLGRIGKAIARRLEGFDGQVSYTGRA-  175

Query  571   KLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVD  392
             K + +Y YYP+++ELA NC +LV+A A + ET H IN  V+ +LG NGV+INIARG  VD
Sbjct  176   KQDVDYDYYPSLLELAQNCDVLVIAAAASAETRHAINADVLAALGSNGVLINIARGSLVD  235

Query  391   EAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVR  212
             E  L+ AL  G+L GAGLDVFE+EP V  EL+ + NVVL PH G  T +TR AMADLV+ 
Sbjct  236   EVALVKALQSGQLDGAGLDVFENEPTVPAELYDMPNVVLTPHIGSGTHQTRKAMADLVLA  295

Query  211   NLEAHFMNKPLLTRVV  164
             NL AHF  K L+T VV
Sbjct  296   NLSAHFSGKELVTPVV  311



>emb|CDX98054.1| BnaA06g08050D [Brassica napus]
Length=345

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 207/330 (63%), Gaps = 26/330 (8%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDV-FIDRLP  911
             P  AY++  L   F LL     PD    F   +AASV A V    +G   +D   +  LP
Sbjct  16    PTLAYMDDHLSRNFRLLNAHLSPDPLPVFLSRHAASVTAFV---NIGRLKIDAELLSHLP  72

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             +L++L   SVG D VDLA+CK +GI VTN  D  +DDVAD A+GL+L+VLR+I  GDR+V
Sbjct  73    SLQLLVCTSVGTDHVDLAECKRRGIAVTNAGDAFSDDVADCAVGLLLSVLRRIPAGDRYV  132

Query  730   KKGLW-KMAHFQFQFTSQ---------------------FSGKSVgiiglgriglaiAKR  617
             + G W K   FQ    ++                      SGK VGIIGLG IG  IAKR
Sbjct  133   RSGNWSKPGQFQLGIKTKRYIVVGYRESVDKDENYLMNLVSGKRVGIIGLGSIGSRIAKR  192

Query  616   AEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLG  437
              E F C ISY+SR+QK +  Y+YY  V+ LA++  +LV+ C+LT +T H++NR+V++SLG
Sbjct  193   LEPFGCIISYNSRTQKQSIPYRYYSDVLSLAADNDVLVLCCSLTDQTRHVVNREVMESLG  252

Query  436   PNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGC  257
               GV+IN+ RGG +DE E++  LVEG +GGAGLDVFE EP+V EELFG+DNVVL PH   
Sbjct  253   KEGVIINVGRGGLIDEEEMVKCLVEGVIGGAGLDVFEKEPQVPEELFGMDNVVLSPHAAV  312

Query  256   ATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
             AT     ++A++ + NL+A F N+PL++ V
Sbjct  313   ATPGALESVAEVAIANLKAFFSNQPLVSPV  342



>ref|NP_172716.1| glyoxylate/hydroxypyruvate reductase HPR3 [Arabidopsis thaliana]
 sp|Q9LE33.1|HPR3_ARATH RecName: Full=Glyoxylate/hydroxypyruvate reductase HPR3; AltName: 
Full=NAD(P)H-dependent hydroxypyruvate reductase 3; Short=AtHPR3; 
Short=HPR 3 [Arabidopsis thaliana]
 gb|AAF79644.1|AC025416_18 F5O11.29 [Arabidopsis thaliana]
 gb|AAF88077.1|AC025417_5 T12C24.9 [Arabidopsis thaliana]
 gb|AAS49098.1| At1g12550 [Arabidopsis thaliana]
 dbj|BAD95166.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28896.1| glyoxylate/hydroxypyruvate reductase HPR3 [Arabidopsis thaliana]
Length=323

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 201/282 (71%), Gaps = 6/282 (2%)
 Frame = -2

Query  1009  AFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRV  830
             +FF + +A+S RA V++  +   + D  +  LP+L+IL   SVG+D +DLA CK +GI +
Sbjct  44    SFFPR-HASSARAFVISGRL--PVTDELLSHLPSLQILVCTSVGIDHIDLAACKRRGIVI  100

Query  829   TNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHF-QFQFTSQFSGKSVgii  653
             TN  +  +DDVAD A+GL+++VLR+I   DR+V+ G W  A F  FQ  S+ SGK VGI+
Sbjct  101   TNAGNAFSDDVADCAVGLLISVLRRIPAADRYVRSGNW--AKFGDFQLGSKVSGKRVGIV  158

Query  652   glgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETH  473
             GLG IG  +AKR E+F C ISY+SRSQK ++ Y+YY  ++ LA N  +LV+ C+LT ETH
Sbjct  159   GLGSIGSFVAKRLESFGCVISYNSRSQKQSSPYRYYSDILSLAENNDVLVLCCSLTDETH  218

Query  472   HIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFG  293
             HI+NR+V++ LG +GVVIN+ RG  +DE E++  LV+G +GGAGLDVFE+EP V +ELFG
Sbjct  219   HIVNREVMELLGKDGVVINVGRGKLIDEKEMVKCLVDGVIGGAGLDVFENEPAVPQELFG  278

Query  292   IDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
             +DNVVL PH   AT  + + +A + + NL+A F N+PLL+ V
Sbjct  279   LDNVVLSPHFAVATPGSLDNVAQIALANLKAFFSNRPLLSPV  320



>ref|XP_010056260.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
 gb|KCW72897.1| hypothetical protein EUGRSUZ_E01339 [Eucalyptus grandis]
Length=361

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 207/308 (67%), Gaps = 8/308 (3%)
 Frame = -2

Query  1078  AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPN  908
             + L+  L + F  L+ W  P   D F +  +A S  A++ +A   V ADLL     RLP 
Sbjct  57    SLLDRPLPDGFRFLKPWESPLPLDGFLSSADARSAEAILTSARAPVNADLLR----RLPE  112

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
             + ++ + S G + +DLA+C+ +GI V    D  +++VAD+A+GL++ VLRK+S  DR+V+
Sbjct  113   VRLVISTSAGHNHIDLAECRRRGIAVAGAGDTKSEEVADLAVGLLIDVLRKVSASDRYVR  172

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             +GLW  +  +F   S+  GK VGIIGLGRIGL +AKR EAF CA+SY+SR +K   +Y +
Sbjct  173   RGLWS-SEGEFALGSKLGGKRVGIIGLGRIGLEVAKRLEAFGCAVSYNSRKKKPYVSYPF  231

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             Y  + ELA+NC +LV+ C L  +THH+INR+V+ +LG  GV++NI RG  ++E E++  L
Sbjct  232   YSNICELATNCDVLVICCGLNEQTHHMINREVLLALGKEGVIVNIGRGPIINEKEMVQLL  291

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+G LGGAGLDVFE EP V EEL G+DNVVL PH    T ET + + DL++ NLEA F N
Sbjct  292   VQGELGGAGLDVFEKEPYVPEELLGLDNVVLSPHAAVLTPETVSNLCDLIIGNLEAFFSN  351

Query  187   KPLLTRVV  164
             KPLL+ V+
Sbjct  352   KPLLSPVL  359



>ref|XP_004306883.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Fragaria 
vesca subsp. vesca]
Length=334

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/302 (46%), Positives = 206/302 (68%), Gaps = 7/302 (2%)
 Frame = -2

Query  1063  QLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPNLEILST  890
             +L  +F +L+ W  P     F   +A S++AL+V  +  V AD+L+    +LP L+++ T
Sbjct  36    ELCAKFPVLKAWESPLPLDQFLSTHAGSIQALLVRGYLKVNADILE----QLPALKLVLT  91

Query  889   YSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKM  710
              SVG++ +D+A+C+ +GI V N  +  ++DVADIA+GL + VLRK+S  DR+V++G W  
Sbjct  92    ISVGVNHIDMAECRRRGISVANVGNAYSEDVADIAVGLYIDVLRKLSAADRYVRQGFWS-  150

Query  709   AHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIE  530
             +   +   S+  GK VGIIGLG IG  +AKR EAF C ISY+SR +K + +Y +YP V E
Sbjct  151   SKGNYPLGSKLGGKRVGIIGLGSIGSEVAKRLEAFGCIISYNSRREKPSLSYPFYPNVSE  210

Query  529   LASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLG  350
             LA+N   L++ CALT +THH+IN++V+  LG  GV++N+ RG  +DE EL+  LV G + 
Sbjct  211   LAANSDALIICCALTDQTHHMINKEVLALLGREGVIVNVGRGAIIDEKELVKCLVSGEIR  270

Query  349   GAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTR  170
             GAG DVFE+EP+V EELF +DNVVL PH   +T+E+  +M +++  NLEA F NKPL++ 
Sbjct  271   GAGFDVFENEPQVPEELFALDNVVLSPHKAVSTLESSQSMNEMMTANLEAFFSNKPLVSP  330

Query  169   VV  164
             V+
Sbjct  331   VM  332



>ref|WP_007880036.1| 2-hydroxyacid dehydrogenase [Ochrobactrum sp. CDB2]
 gb|EMG52089.1| 2-hydroxyacid dehydrogenase [Ochrobactrum sp. CDB2]
Length=297

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/303 (50%), Positives = 197/303 (65%), Gaps = 6/303 (2%)
 Frame = -2

Query  1072  LEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILS  893
             +E  L+ ++ + R++   D   F    N   +R +V    +G  + +   DRLP LEI++
Sbjct  1     MEQSLNEQYEVHRWFEMADQSEFL-NANGNRIRGVVTGGHIG--IPNELADRLPALEIVA  57

Query  892   TYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWK  713
                VG DKVDL+K +++G RV+NTPDVLT DVAD AIGL++A  R I+  D  V+KG W 
Sbjct  58    INGVGFDKVDLSKARQRGYRVSNTPDVLTTDVADTAIGLVIAQARHIAAADAHVRKGGWS  117

Query  712   MAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVI  533
              +  +    ++ SG+  GI GLGRIG AIAKR E F   ISY  R+ K +  Y YYP++ 
Sbjct  118   KS--EIGLGTRVSGRRYGIFGLGRIGKAIAKRLEGFEGKISYTGRA-KQDVGYDYYPSLT  174

Query  532   ELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRL  353
             ELA NC +LV+A A + ET H I+  V+ +LGP+GV+INIARG  VDE  L+ AL  G+L
Sbjct  175   ELAKNCDVLVIAAAASAETRHSIDAAVLAALGPDGVLINIARGSLVDEGALVKALQLGQL  234

Query  352   GGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLT  173
             GGAGLDVFEDEP V  EL+ + NVVL PH G  T +TR AMADLV+ NL AHF  K L+T
Sbjct  235   GGAGLDVFEDEPNVPLELYEMSNVVLTPHIGSGTHQTRKAMADLVLANLSAHFSGKELVT  294

Query  172   RVV  164
              VV
Sbjct  295   PVV  297



>ref|WP_003497843.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EGP55360.1| D-isomer specific 2-hydroxyacid dehydrogenase [Agrobacterium 
tumefaciens F2]
Length=311

 Score =   261 bits (668),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/313 (50%), Positives = 198/313 (63%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  AAS++A+V    +G D      
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEAASIKAVVTGGHIGVD--PELA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LP LEI++   VG DKVDL + + +G RVTNTPDVLT+DVAD+AIGL + +LR++   
Sbjct  62    ACLPALEIVAINGVGFDKVDLDQARARGFRVTNTPDVLTEDVADLAIGLSIMLLRQLVRA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK    +    ++ S +  GI GLGRIG AIA R EAFN  ISY SR QK  
Sbjct  122   DHHVRSGEWKKG--ELPLGNKASRRRYGIYGLGRIGRAIATRLEAFNAEISYFSR-QKQE  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y Y+PT + LAS C +L+VA A TPET H INR+V+++LGP+GV+INIARG  VDE  
Sbjct  179   VAYDYHPTPVSLASACDVLIVAAAATPETKHAINREVLEALGPDGVLINIARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  L  G L GA LDVFE+EP V EEL G+ NVVL PH G AT ETR  M  LV+ NL+
Sbjct  239   LVDILSSGGLKGAALDVFENEPHVPEELIGMRNVVLAPHIGAATHETRLQMGALVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF    L T VV
Sbjct  299   AHFAGNDLPTPVV  311



>ref|XP_010056265.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
 gb|KCW72903.1| hypothetical protein EUGRSUZ_E01347 [Eucalyptus grandis]
Length=337

 Score =   262 bits (670),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 205/311 (66%), Gaps = 14/311 (5%)
 Frame = -2

Query  1069  EHQLHNR-----FNLLRFWN--FPDSDAFFAQINAASVRALVVNAF--VGADLLDVFIDR  917
             +  +HNR     F  L+ W    P  D   +  +A +  A++ +    V AD+L     R
Sbjct  30    QFSVHNRPLPDTFRFLKPWESPLPLDDFLSSSADARTAEAILTSGKTPVTADMLR----R  85

Query  916   LPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDR  737
             LP + ++ T S GL+ +D+A+C+ +GI + N  D  ++DVAD+A+GL++ VLRK+S GDR
Sbjct  86    LPGVRLVVTTSTGLNHIDVAECRRRGIAIANAGDAYSEDVADLAVGLLIDVLRKVSAGDR  145

Query  736   FVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTN  557
             +V++G W     +F+  S+  GK VGI+GLGRIGL +AKR EAF CAISY+SR  K N +
Sbjct  146   YVRRGSWS-GEGEFELGSKLGGKRVGIVGLGRIGLKVAKRLEAFGCAISYNSRKTKPNVS  204

Query  556   YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELI  377
             Y +Y  V ELA+NC  L++ C L  +THH+I R+V+ +LG  GVV+NI RG  +DE E++
Sbjct  205   YPFYSNVCELATNCDALIICCDLNEQTHHMITREVLLALGKEGVVVNIGRGSIIDEKEMV  264

Query  376   SALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAH  197
               LV+G LGGAGLDVFE+EP V EEL  +DNVVL PH    T E+ + + DLV+ NLEA 
Sbjct  265   QLLVQGELGGAGLDVFENEPNVPEELLALDNVVLSPHTAVFTPESFSDLCDLVIENLEAF  324

Query  196   FMNKPLLTRVV  164
             F NKPLL+ V+
Sbjct  325   FSNKPLLSPVL  335



>ref|WP_020810587.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EPR20497.1| dihydrofolate reductase [Agrobacterium radiobacter DSM 30147]
 gb|KDR88952.1| dihydrofolate reductase [Agrobacterium tumefaciens GW4]
Length=311

 Score =   261 bits (666),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF A    AS+R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEGELAERFTVHRLFEAADKAAFLAD-KGASIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDLA+ K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLAEAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y YY ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYYDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL +G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALADGTIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|XP_010058441.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
 gb|KCW72899.1| hypothetical protein EUGRSUZ_E01341 [Eucalyptus grandis]
Length=330

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 207/308 (67%), Gaps = 8/308 (3%)
 Frame = -2

Query  1078  AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPN  908
             + ++  L + F  L+ W  P   D F +  +A S  A++ +A   V ADLL     RLP 
Sbjct  26    SLIDRPLPDGFRFLKPWESPLPFDDFLSSADARSAEAILTSARAPVTADLLR----RLPE  81

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
             + ++ + S G + +DLA+C+ +GI V    D  +++VAD+A+GL++ VLRK+S  DR+V+
Sbjct  82    VHLVVSTSAGHNHIDLAECRRRGIAVAGAGDTKSEEVADLAVGLLIDVLRKVSASDRYVR  141

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             +GLW  +  +F   S+  GK VGIIGLGRIGL +AKR EAF CA+SY+SR +K   +Y +
Sbjct  142   RGLWS-SEGEFALGSKLGGKRVGIIGLGRIGLEVAKRLEAFGCAVSYNSRKKKPYVSYPF  200

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             Y  V ELA+NC +LV+ C L  +THH+INR+V+ +LG  GV++NI RG  ++E E++  L
Sbjct  201   YSNVCELATNCDVLVICCGLNEQTHHMINREVLLALGKEGVIVNIGRGPIINEKEMVQLL  260

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+G LGGAGLDVFE EP V EEL G+DNVVL PH    T ET + + DL++ NLEA F N
Sbjct  261   VQGELGGAGLDVFEKEPYVPEELLGLDNVVLSPHAAVLTPETVSNLCDLIIGNLEAFFSN  320

Query  187   KPLLTRVV  164
             KPLL+ V+
Sbjct  321   KPLLSPVL  328



>ref|XP_009400965.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Musa 
acuminata subsp. malaccensis]
Length=330

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 152/318 (48%), Positives = 203/318 (64%), Gaps = 7/318 (2%)
 Frame = -2

Query  1114  ENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRAL-VVNAF-VGAD  941
             E   +L+  P +A L+  L  RF LL+ W  P     F   +AA VRAL V+N F V   
Sbjct  14    ERPQLLLLRPPSAALDEVLSARFELLKSWESPLPLDRFLASHAADVRALLVINLFTVDGS  73

Query  940   LLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVL  761
             LLD     LP L  + T S G++ +DLA+C  +GI V N  +V + +VA+ A+GL++ VL
Sbjct  74    LLDA----LPALRFVCTTSAGVNHIDLAECARRGIAVANAGNVFSQEVAEYAVGLLIDVL  129

Query  760   RKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHS  581
             R++S  DR+V++GLW      +   S+   K VGI+GLG IG  +AKR +AF C ISY S
Sbjct  130   RRVSACDRYVRRGLWPRGG-DYPLGSKLGCKRVGIVGLGSIGSEVAKRLQAFGCPISYFS  188

Query  580   RSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGG  401
             R +K    Y Y P+V +LA+   +LV+ACALT ETHHIIN+ V+ +LG +G+VIN+ RG 
Sbjct  189   RCRKPQFPYTYVPSVADLAAQSDVLVLACALTHETHHIINKDVMAALGKDGIVINVGRGA  248

Query  400   HVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADL  221
              VDEAEL+  L+ G +GGAGLDVFE EP V EELFG+DNVVL PH    T E+ + +  L
Sbjct  249   LVDEAELVKRLMRGEIGGAGLDVFEHEPAVPEELFGVDNVVLSPHVAMQTFESSSDLCQL  308

Query  220   VVRNLEAHFMNKPLLTRV  167
                NLEA F ++PLLT V
Sbjct  309   TAANLEAFFSDRPLLTSV  326



>ref|XP_006417222.1| hypothetical protein EUTSA_v10008292mg [Eutrema salsugineum]
 gb|ESQ35575.1| hypothetical protein EUTSA_v10008292mg [Eutrema salsugineum]
Length=305

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 203/300 (68%), Gaps = 3/300 (1%)
 Frame = -2

Query  1075  YLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEIL  896
             +++  L  RF +L     PD  + F   +AASVRA+V    +   +   FI +LP+LEI+
Sbjct  3     FMDEPLSQRFTVLYTHTSPDPISDFLTSHAASVRAVVSVGRL--PITAEFISKLPSLEIV  60

Query  895   STYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLW  716
                SVG D VDL +CK +G+ VTN  D   +DVAD+A+GL+++VLR+I   DR+++ G W
Sbjct  61    VCASVGFDHVDLDECKRRGVTVTNAGDAYGEDVADLAVGLLISVLRRIPALDRYIRSGQW  120

Query  715   KMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTV  536
                 + + F S+   K VGI+GLG IG  IAKR E F C ISY+SRS K +  Y Y+P V
Sbjct  121   TRL-WDYPFGSKLDKKKVGILGLGSIGSLIAKRLEPFGCVISYNSRSPKPDVPYIYHPEV  179

Query  535   IELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGR  356
             + LA+   +L+++C+LT ETHHI++R+V+++LG NGV+INI RGG +DE E++  LVEG 
Sbjct  180   LSLAAANDVLILSCSLTDETHHIVDRKVMETLGKNGVIINIGRGGLIDEKEMVKCLVEGV  239

Query  355   LGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLL  176
             L G GLDVF++EPEV EELFG++NVVL PH    T E+ N + ++ + NL+A F ++PL+
Sbjct  240   LWGVGLDVFDNEPEVPEELFGLENVVLSPHSAGMTAESLNNVTEVALSNLKAFFSDQPLI  299



>ref|XP_010934080.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Elaeis 
guineensis]
Length=327

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 193/295 (65%), Gaps = 3/295 (1%)
 Frame = -2

Query  1051  RFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLD  872
             +F++LR W  P     F   +A SVRAL++++ V  D  D  +D LP L  + T S G++
Sbjct  31    KFHVLRPWESPLPRDQFLAAHAGSVRALLISSLVTLD--DATLDALPRLGCVVTTSAGVN  88

Query  871   KVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQ  692
              +DLA C  +GI V N   V + D AD A+GL++ VLR++S  DR+V++GLW +    + 
Sbjct  89    HIDLAACARRGIAVANAGTVFSADAADYAVGLLIDVLRRVSTSDRYVRRGLWPVKG-DYP  147

Query  691   FTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQ  512
                +  GK VGI+GLG IG   AKR  AF C I Y+SR  K +  YKY+P V +LA+   
Sbjct  148   LGFKLGGKRVGIVGLGSIGSETAKRLVAFGCTILYYSRKNKPSVPYKYFPNVCDLAAESD  207

Query  511   ILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDV  332
             +L+V+CALT ETHHIIN+ V+ +LG  G+++N+ RG  VDEAEL+  L++G LGGAGLDV
Sbjct  208   VLIVSCALTSETHHIINKDVMTALGKEGIIVNVGRGPLVDEAELVRRLMQGELGGAGLDV  267

Query  331   FEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
             FE+EP V +ELF +DNVVL PH    T E+   +  L+V NLEA F N+PLLT V
Sbjct  268   FENEPAVPKELFLMDNVVLTPHRAIFTSESLADLGQLLVANLEAFFSNRPLLTPV  322



>ref|XP_006664931.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Oryza 
brachyantha]
Length=323

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 202/320 (63%), Gaps = 13/320 (4%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFW--NFPDSDAFFAQINAASVRALVVNAF------VG  947
             VL+ C +      +   RF LL F+    P   AF A + A S    V   F      VG
Sbjct  5     VLLLCRLAPETFAEFAGRFRLLDFYASELP-IHAFLAAVAADSDPPRVALVFGRGPVGVG  63

Query  946   ADLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILA  767
             A+LLD     +P+L  + T S G++ VDL +C  +G++V N   V + DVAD A+GL++ 
Sbjct  64    AELLDA----VPSLRCIITVSAGVNHVDLPECARRGVQVANAAGVYSADVADQAVGLLVD  119

Query  766   VLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISY  587
             VLR +S GDR V++GLW    +     S+  GK VGIIGLG IG AIA+R  AF C +SY
Sbjct  120   VLRHVSAGDRHVRRGLWPEHGYFIPLGSKIGGKRVGIIGLGSIGSAIARRLVAFGCVVSY  179

Query  586   HSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIAR  407
             HSR +K +  Y Y+P+  +LA++  +LVVACALT ET HI++R V+D+LG  GVV+N+AR
Sbjct  180   HSRRRKEDVPYAYFPSARDLAASSDVLVVACALTAETRHIVDRGVLDALGERGVVVNVAR  239

Query  406   GGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMA  227
             G +VDEAEL+ ALVEGR+ GAGLDVFEDEP V  EL  +DNVVL  H    T E+   M 
Sbjct  240   GANVDEAELVRALVEGRVAGAGLDVFEDEPNVPPELMAMDNVVLTAHQAVFTPESMADMG  299

Query  226   DLVVRNLEAHFMNKPLLTRV  167
              LVV NLEA F  +PL+TRV
Sbjct  300   RLVVTNLEAFFAGEPLVTRV  319



>ref|WP_003521698.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens]
 gb|EMS97627.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens str. Cherry 
2E-2-2]
Length=311

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 200/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             ++  CP+   LE +L  RF + R +   D  AF A+   AS+R +V    +G  L     
Sbjct  5     IVQLCPLIPALEGELAERFTVHRLFEAADKSAFLAE-KGASIRGVVTGGHIG--LPTDIG  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LPNLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ + 
Sbjct  62    AALPNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLPQA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++ +
Sbjct  122   DQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR-D  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y YY ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE  
Sbjct  179   VAYDYYDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ NL+
Sbjct  239   LVEALANGTIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  K L T VV
Sbjct  299   AHFAGKELPTPVV  311



>gb|KFK43523.1| hypothetical protein AALP_AA1G136500 [Arabis alpina]
Length=322

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 194/278 (70%), Gaps = 4/278 (1%)
 Frame = -2

Query  991  NAASVRALVVNAFVGADLLDV---FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNT  821
            N+ S +A +   FV   LL V    + +LP+L+I+   SVG+D +DLA CK +G+ VTN 
Sbjct  43   NSLSSQAALARGFVNIGLLPVTEELLSKLPSLQIIVLTSVGVDHIDLAACKRRGVVVTNA  102

Query  820  PDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgr  641
             D  ++DVAD A+GL+++VLR+I   DR+V+ G W +    F   S+ SGK VGI+GLG 
Sbjct  103  GDAFSEDVADTAVGLLISVLRRIPAADRYVRSGNW-VDSGDFILGSKVSGKRVGIVGLGS  161

Query  640  iglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIIN  461
            IG  +A+R E F C ISYHSRSQK +T ++YYP ++ LA+  ++LV+ C+LT +T HI+N
Sbjct  162  IGSHVARRLEPFGCIISYHSRSQKPDTTFRYYPDILSLAAENEVLVLCCSLTDKTRHIVN  221

Query  460  RQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNV  281
            R+V++SLG +GV+IN+ RGG +DE E++  LV+G +GGAGLDVFE EP V EEL G+DN+
Sbjct  222  REVMESLGKDGVIINVGRGGLIDEKEMVKCLVQGVIGGAGLDVFEKEPVVPEELIGLDNI  281

Query  280  VLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
            VL PH   AT  + N + ++   NL+A F N+PL++ V
Sbjct  282  VLSPHSAMATAGSLNNVGEVAFANLKAFFSNQPLISPV  319



>ref|XP_009626262.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Nicotiana 
tomentosiformis]
Length=318

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 204/320 (64%), Gaps = 6/320 (2%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQ--LHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGA  944
             ME   +L+  P   ++ HQ     +F LL+ +  P S   F Q +A S +AL+   +  +
Sbjct  1     MELPELLVIHPPPVFIIHQQQFSQKFKLLKAYESPLSTELFLQAHAQSTKALI--CYGKS  58

Query  943   DLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAV  764
              +    +  LP+L ++ T S G + ++L +C+ + I V NT DV ++D ADI +GL++ V
Sbjct  59    PITSDILRHLPSLGLVVTASTGFNHINLPECRRRSIAVANTADVFSEDTADIGVGLLIDV  118

Query  763   LRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYH  584
             LRKIS GDRFV+ G+W   + Q+   S+  GK VGI+GLG IGL +A R EAF C ISY+
Sbjct  119   LRKISSGDRFVRSGIWP-KNVQYPLGSKLGGKHVGIVGLGNIGLKVATRLEAFGCTISYN  177

Query  583   SRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             SR QK    Y +YP V ELA NC ILV+ C LT ET H+I++ V+ +LG +G++INIARG
Sbjct  178   SR-QKKPVPYDFYPNVCELAFNCNILVICCTLTIETRHMIDKDVLKALGKDGILINIARG  236

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
               VDE EL+  LVEG + GAGLDVFE+EP+V +EL  +DNVVL PH    T E       
Sbjct  237   PIVDEKELVKLLVEGEIAGAGLDVFENEPKVPQELIALDNVVLTPHRAAFTEEAFRDAFQ  296

Query  223   LVVRNLEAHFMNKPLLTRVV  164
             LV+ NLEA F NKPL++ V+
Sbjct  297   LVLANLEAFFSNKPLISPVI  316



>ref|WP_035243208.1| dihydrofolate reductase [Agrobacterium tumefaciens]
Length=311

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 205/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             +L  CP+   LE +L  RF + R +   D  AF ++   A++R +V    +G  AD+   
Sbjct  5     ILQLCPLIPALEQELAQRFIVHRLFEAADKAAFLSE-KGAAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDLA+ K++G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLAEAKQRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIA+R E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIARRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              + +Y YY ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVSYDYYDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  D V L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSSGTIGGAALDVFEDEPRVPEALFAFDTVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKDLPTPVV  311



>ref|XP_007051988.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein, 
putative [Theobroma cacao]
 gb|EOX96145.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein, 
putative [Theobroma cacao]
Length=333

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 206/313 (66%), Gaps = 3/313 (1%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             VL   P+  +   QL  +F  L+ W  P     F  I+A SV+AL+        L  + +
Sbjct  22    VLEPPPVFKFHGDQLLKKFQFLKAWESPLPLDQFLTIHAHSVQALLSPGTHPVTLETLRL  81

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LP+L ++ T SVGL+ +DL +C+ +GI + N  ++ ++DVAD+A+GL++ VLRKIS  
Sbjct  82    --LPSLGLIVTTSVGLNHIDLPECRRRGISIANAGNLYSEDVADLAVGLLIDVLRKISVA  139

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DR+VK+ LW  +  +F    +  G+ VGI+GLG IG  +AKR +AF C+I Y+SR +K +
Sbjct  140   DRYVKRQLWP-SEGEFPLGIKLRGRQVGIVGLGSIGFEVAKRLDAFGCSILYNSRRKKPS  198

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
              +Y YY  + ELASNC +L++ CALT +THH+IN++V+ ++G  GV++N+ RG  +DE E
Sbjct  199   IHYPYYSNICELASNCDVLIICCALTDKTHHMINKEVLLAMGKKGVIVNVGRGAIIDEQE  258

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             ++  L+ G + GAGLDVFE EP+V +ELF +DNVVL PH    + ET  A+ DLVV N E
Sbjct  259   MVGCLMRGEIAGAGLDVFEKEPDVPKELFDLDNVVLSPHRAVHSQETLMALCDLVVGNFE  318

Query  202   AHFMNKPLLTRVV  164
             A F NKPLLT VV
Sbjct  319   AFFSNKPLLTPVV  331



>ref|WP_035224930.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 emb|CDN94693.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens]
Length=311

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 201/315 (64%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF A    AS+R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEEELAERFTVHRLFETADKAAFLAD-KGASIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y YY ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYYDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSNGTIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKDLPTPVV  311



>ref|XP_006305294.1| hypothetical protein CARUB_v10009669mg, partial [Capsella rubella]
 gb|EOA38192.1| hypothetical protein CARUB_v10009669mg, partial [Capsella rubella]
Length=336

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 207/309 (67%), Gaps = 7/309 (2%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVV--NAFVGADLLDVFIDRL  914
             P   +++  L+  F +L      +    F   +A+SVRA VV     + A++L      L
Sbjct  30    PSLTFMDEILNRNFRILNADTSSEPLPIFLDRHASSVRAFVVVGRLPITAEILS----HL  85

Query  913   PNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRF  734
             P+L+IL   SVG++ VDLA+C  +GI VTN  +  +DDVAD A+GL+L+VLR+I  GDR+
Sbjct  86    PSLQILICTSVGINHVDLAECMRRGIAVTNARNAFSDDVADFAVGLLLSVLRRIPTGDRY  145

Query  733   VKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNY  554
             V+ G W+     F   S+ SGK VGI+G G IG  IAKR E F+C ISY+SRS+K +  Y
Sbjct  146   VRSGDWEKLG-GFPLGSKVSGKRVGIVGFGSIGSVIAKRLEGFDCVISYNSRSEKPSIPY  204

Query  553   KYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELIS  374
             +Y+P ++ LA+N  +LV+ C+LT +THHI+NR+V++SLG +GV+IN+ RG  +DE E+I 
Sbjct  205   RYFPDILSLAANNDVLVLCCSLTEQTHHIVNREVMESLGKDGVIINVGRGSLIDEKEMIK  264

Query  373   ALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHF  194
              LV+G +GGAGLDVFE+EP V EEL  +DNVVL PH   AT  + + + ++ + NL+A F
Sbjct  265   CLVDGVIGGAGLDVFENEPAVPEELLRLDNVVLSPHSAVATQGSLDNVTEITLANLKAFF  324

Query  193   MNKPLLTRV  167
              N+PLL +V
Sbjct  325   SNQPLLFQV  333



>ref|XP_008232839.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Prunus 
mume]
Length=332

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 138/311 (44%), Positives = 204/311 (66%), Gaps = 2/311 (1%)
 Frame = -2

Query  1099  LMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFID  920
             L+  P  A +E    ++F+ L+ W  P     F +  A SV+ L+ +A +G  +    + 
Sbjct  21    LLPNPCFALVEANNSHKFHFLKAWVSPLPQDQFLETQAGSVQVLLSSA-IGPPITAQILH  79

Query  919   RLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGD  740
              LP+L+++ T S GL+ VDLA+C+ +G+ + +   +  +DVAD+ +GL+L V+R IS  D
Sbjct  80    LLPSLKLIVTISAGLNHVDLAECRARGVAIASASKIFAEDVADVGVGLLLDVMRNISASD  139

Query  739   RFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNT  560
             RFV+ G W ++   F   S+  GK VGI+GLG IGL +AKR EAF C+I Y+SR +K   
Sbjct  140   RFVRDGFW-VSKGDFALGSKIGGKRVGIVGLGNIGLEVAKRLEAFGCSILYNSRKKKPFV  198

Query  559   NYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAEL  380
             +Y ++P V ELA+N  +LV+ C L  +THH+IN++V+ +LG  GV++N+ RG  +DE E+
Sbjct  199   SYPFFPDVCELAANSDVLVICCGLNAQTHHMINKKVLLALGREGVIVNVGRGAIIDEKEM  258

Query  379   ISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEA  200
             +  LV G +GGAGLDVFE+EP V +ELF +DNVVL PH    T E   A+ +LV+ NLEA
Sbjct  259   VQCLVRGEIGGAGLDVFENEPHVPKELFALDNVVLSPHQAALTPECFTALRELVIGNLEA  318

Query  199   HFMNKPLLTRV  167
              F NKPLL++V
Sbjct  319   FFSNKPLLSQV  329



>ref|WP_003519674.1| D-isomer specific 2-hydroxyacid dehydrogenase [Agrobacterium 
tumefaciens]
 gb|EMS99572.1| D-isomer specific 2-hydroxyacid dehydrogenase [Agrobacterium 
tumefaciens str. Cherry 2E-2-2]
Length=311

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 199/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  A S++A+V    +G  L     
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEATSIKAVVTGGHIG--LAPDLA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP LEI++   VG DKVDL + + +G RVTNTPDVLT+DVAD+AIGL + +LR++   
Sbjct  62    DCLPALEIVAINGVGFDKVDLTQARARGFRVTNTPDVLTEDVADLAIGLSVMLLRQLVSA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK A  +    ++ S +  G+ GLGRIG AIA R EAF+  ISY SR +K  
Sbjct  122   DHHVRSGEWKKA--EMPLGNKASRRRYGVYGLGRIGRAIAARLEAFDAEISYFSR-RKQE  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y Y+ T + LAS C +L+VA A TPET H INR+V+++LGP+GV++N+ARG  VDE  
Sbjct  179   VAYGYHSTAVSLASACDVLIVAAAATPETRHAINREVLEALGPDGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  LV G L GA LDVFE+EP V E L G+ NVVL PH G AT ETR  M  LV+ NL+
Sbjct  239   LVDILVAGGLKGAALDVFENEPHVPEALIGMRNVVLAPHIGAATHETRLQMGALVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  + L T VV
Sbjct  299   AHFAGQDLPTAVV  311



>ref|WP_003505982.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EHH05632.1| D-isomer specific 2-hydroxyacid dehydrogenase [Agrobacterium 
tumefaciens CCNWGS0286]
 gb|EPR20378.1| dihydrofolate reductase [Agrobacterium radiobacter DSM 30147]
Length=311

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 200/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  AAS++A+V    +G  +     
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEAASIKAVVTGGHIG--VAPELA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LP LEI++   VG DKVDL + + +G RVTNTPDVLT+DVAD+AIGL + +LR++   
Sbjct  62    AGLPALEIVAINGVGFDKVDLDQARARGFRVTNTPDVLTEDVADLAIGLSVMLLRQLVRA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK    +    ++ S +  GI GLGRIG AIA R EAFN  ISY SR QK +
Sbjct  122   DHHVRSGEWKRG--EMPLGNKASRRRYGIYGLGRIGRAIAVRLEAFNAEISYFSR-QKQD  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y+Y+ T + LA +C +L+VA A TPET H INR+V+++LGP+GV++N+ARG  VDE  
Sbjct  179   VAYEYHSTAMSLARDCDVLIVAAAATPETKHAINREVLEALGPDGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  LV G L GA LDVFE+EP V E L G+ NVVL PH G AT ETR  M  LV+ NL+
Sbjct  239   LVDVLVAGGLKGAALDVFENEPHVPEALIGMRNVVLAPHIGAATHETRLEMGALVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  + L T VV
Sbjct  299   AHFAGRDLPTAVV  311



>ref|XP_004974992.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Setaria 
italica]
Length=326

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 204/317 (64%), Gaps = 6/317 (2%)
 Frame = -2

Query  1105  GVLMACPMNAYLEHQLHNRFNLLRFWNFPDS-DAFFAQINAAS--VRALVVNAFVGADLL  935
             G+L+    +A     L  RF +L F+    +  AF A   A     RA +V A  GA L+
Sbjct  9     GLLLLRRSDATFSAALRARFRVLDFYASGAALRAFLATAAAEPDPPRAALVVA-SGAILV  67

Query  934   DV-FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
             D  F+D +P+L  + T   G+D +DLA C  +G+ V     + + DVAD A+GL++ VLR
Sbjct  68    DAAFLDTVPSLRCVVTTGAGVDHIDLAGCARRGVAVAGAGQIFSVDVADHAVGLLIDVLR  127

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++S  DR+V+ GLW +A   +  TS+ SGK VGIIGLG IG  IAKR +AF C +SYHSR
Sbjct  128   RVSAADRYVRAGLW-LAQGYYPLTSKLSGKRVGIIGLGSIGSLIAKRLDAFGCVVSYHSR  186

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             + K +  Y+Y+P  + LA++   LVVACAL   T  I+ R+V+D+LGP GVV+NIARGG+
Sbjct  187   APKASAPYRYFPDAVALAADSDALVVACALNDATRRIVGRRVLDTLGPGGVVVNIARGGN  246

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE ELI+AL EGR+ GAGLDVFE+EP+V  EL  +DNVVL  H    T E+   + DL+
Sbjct  247   VDEQELIAALREGRIAGAGLDVFENEPQVPPELREMDNVVLTAHEAVFTEESTADLRDLM  306

Query  217   VRNLEAHFMNKPLLTRV  167
             + NLEA F  KPLLT V
Sbjct  307   IGNLEAFFSGKPLLTPV  323



>ref|WP_022686984.1| dihydrofolate reductase [Sphingomonas phyllosphaerae]
Length=317

 Score =   256 bits (654),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 142/317 (45%), Positives = 199/317 (63%), Gaps = 4/317 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M +I +LMA PM A +   L   F L R W  PD+DAF A+ + A++R +  NA  G   
Sbjct  1     MNDIPILMAAPMPATVIDALDRHFTLHRLWEQPDADAFLAR-HGAAIRGIAANALAGRID  59

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
               +F DRLP LEI++ + VG D +D     E+G+ VTNTP VL  +VAD+ +GL+LA +R
Sbjct  60    AGLF-DRLPALEIVANFGVGYDNIDARAAAERGVMVTNTPGVLDAEVADLTLGLLLATIR  118

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             ++ + DR+V+ G W  A F    T    G++VGIIGLG IG  IA+R EAF+ AI+YH R
Sbjct  119   RLPQADRYVRDGRWPDAPFPLSPT--LRGRTVGIIGLGAIGKQIARRLEAFDVAIAYHGR  176

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             +++ + +Y YY T + LA  C +L+     +  T H++   V+D+LG +G+ +N+ARG  
Sbjct  177   TRQRDVDYAYYDTPVALAGACDVLIAIVPGSASTQHLVGAAVLDALGRDGIFVNVARGSV  236

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  LI+AL  G +  AGLDV+ DEP V E L  +DNVVLLPH G A+  TR AM  LV
Sbjct  237   VDEPALIAALQSGTILAAGLDVYADEPNVPEALRALDNVVLLPHLGSASEHTRAAMGQLV  296

Query  217   VRNLEAHFMNKPLLTRV  167
             V NL + F  + ++T V
Sbjct  297   VDNLTSWFSQRRVVTPV  313



>ref|WP_020009163.1| MULTISPECIES: dihydrofolate reductase [Agrobacterium]
Length=311

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 200/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  AAS++A+V    +G  +     
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEAASIKAVVTGGHIG--VAPELA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LP LEI++   VG DKVDL + + +G RVTNTPDVLT+DVAD+A+GL + +LR++   
Sbjct  62    AGLPALEIVAINGVGFDKVDLDQARARGFRVTNTPDVLTEDVADLAVGLSVMLLRQLVRA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK    +    ++ S +  GI GLGRIG AIA R EAFN  ISY SR QK +
Sbjct  122   DHHVRSGEWKRG--EMPLGNKASRRRYGIYGLGRIGRAIAVRLEAFNAEISYFSR-QKQD  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y+Y+ T + LA +C +L+VA A TPET H INR+V+++LGP+GV++N+ARG  VDE  
Sbjct  179   VAYEYHSTAMSLARDCDVLIVAAAATPETKHAINREVLEALGPDGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  LV G L GA LDVFE+EP V E L G+ NVVL PH G AT ETR  M  LV+ NL+
Sbjct  239   LVDVLVAGGLKGAALDVFENEPHVPEALIGMRNVVLAPHIGAATHETRLEMGALVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  + L T VV
Sbjct  299   AHFAGRDLPTAVV  311



>ref|XP_011093187.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Sesamum 
indicum]
Length=328

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 198/301 (66%), Gaps = 3/301 (1%)
 Frame = -2

Query  1069  EHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILST  890
             + Q  +RF +LR W  P S   F    A + +A +++   G       +  LP++ ++ T
Sbjct  28    DKQFSSRFRVLRPWESPLSLPQFLAAGAQNTQAALISG--GFRFTSSVLHHLPSIRLVVT  85

Query  889   YSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKM  710
              S G++ +DL +C+ +GI V N   + + DVAD+A+GL+L VLR+IS G+RFVK GLW +
Sbjct  86    TSAGINHIDLVECRRRGIAVANAASIFSADVADLAVGLLLDVLRRISAGNRFVKSGLWPV  145

Query  709   AHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIE  530
                 +    +  GK VGI+GLG IGL +AKR EAF CAISY SR +K + +Y +YP + +
Sbjct  146   -QGAYPLGFKLGGKKVGIVGLGSIGLYVAKRLEAFGCAISYSSRKEKPSVSYAFYPDICK  204

Query  529   LASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLG  350
             LA+N  ILV+ CALT +THH+INR+V+ +LG  GV++NIARG  VDE EL+S L  G + 
Sbjct  205   LAANSDILVICCALTEQTHHMINREVLLALGKEGVLVNIARGAVVDEKELVSCLQNGEIS  264

Query  349   GAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTR  170
             GAGLDVFE+EP V +EL+ +DNVVL PH    T E+   + +L+  NLEA F NKPLL+ 
Sbjct  265   GAGLDVFENEPSVPKELYELDNVVLSPHFAVFTEESMWDLYELMCGNLEAFFSNKPLLSL  324

Query  169   V  167
             +
Sbjct  325   I  325



>ref|WP_003505668.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EHH06148.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens CCNWGS0286]
Length=311

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 150/313 (48%), Positives = 199/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             ++  CP+   LE +L  RF + R +   D  AF A+    ++R +V    +G  L     
Sbjct  5     IVQLCPLIPALEQELAERFTVHRLFEAADKAAFLAE-KGGAIRGVVTGGHIG--LPTDIG  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LPNLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GLILA  RK+ + 
Sbjct  62    AALPNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLILAQARKLPQA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +RS++ +
Sbjct  122   DQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARSRR-D  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE  
Sbjct  179   VAYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ NL+
Sbjct  239   LVEALSNGAIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  K L T VV
Sbjct  299   AHFAGKELPTPVV  311



>ref|WP_020009854.1| MULTISPECIES: dihydrofolate reductase [Agrobacterium]
Length=311

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 201/315 (64%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF A+    ++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEGELAERFTVHRLFEAADKAAFLAE-KGGAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +RS++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARSRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ N
Sbjct  237   TALVEALSNGAIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|XP_006445206.1| hypothetical protein CICLE_v10020981mg [Citrus clementina]
 ref|XP_006490962.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Citrus 
sinensis]
 gb|ESR58446.1| hypothetical protein CICLE_v10020981mg [Citrus clementina]
Length=341

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 199/302 (66%), Gaps = 7/302 (2%)
 Frame = -2

Query  1054  NRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGL  875
             N+F  L+ W  P     F + +A SV A++ +   GA +    +  +P + ++ T S GL
Sbjct  39    NKFKFLKAWESPLPLDQFLKTHAQSVEAILSSG--GAPVTAETLRLMPAVRLVMTTSAGL  96

Query  874   DKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAH---  704
             + +D+A+C+ +GI V NT +V ++DVAD+A+GL++ +LR IS  DRFVK+ L        
Sbjct  97    NHIDIAECRRRGITVANTGNVFSEDVADLAVGLLIDLLRNISASDRFVKQWLRPRQAAEG  156

Query  703   --FQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIE  530
               +     S+  GK VGI+GLG IG  +AKR +AF C+ISY+SR++K + +Y +Y  V E
Sbjct  157   DCYSLGIGSKLGGKRVGIVGLGSIGSLVAKRLDAFGCSISYNSRTKKPSVSYPFYSNVCE  216

Query  529   LASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLG  350
             LA+NC IL++ C LT ETHH+IN+QV+ +LG  GVVINI RG  +DE EL+  LV+G + 
Sbjct  217   LAANCDILIICCGLTAETHHMINKQVLSALGKEGVVINIGRGPIIDEQELVRCLVQGEIK  276

Query  349   GAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTR  170
             GAGLDVFE+EP+V +EL  +DNVVL PH    T ET      LVV NLEA F NKPLLT+
Sbjct  277   GAGLDVFENEPDVPKELLALDNVVLSPHCAIFTWETFKDRQKLVVENLEAFFSNKPLLTK  336

Query  169   VV  164
             +V
Sbjct  337   IV  338



>ref|WP_010974076.1| MULTISPECIES: dihydrofolate reductase [Agrobacterium tumefaciens 
complex]
 ref|NP_355974.1| 2-hydroxyacid dehydrogenase [Agrobacterium fabrum str. C58]
 gb|AAK88759.1| 2-hydroxyacid dehydrogenase [Agrobacterium fabrum str. C58]
 gb|KEY54110.1| dihydrofolate reductase [Agrobacterium tumefaciens]
Length=311

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF ++   A++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEEELAQRFTVHRLFEAADKAAFLSE-KGAAIRGVVTGGHIGLPADVGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDL + K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLGEAKRRGFRVSNTPDVLTADVADLALGLVLAQARKVP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++ ELA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYHDSIEELAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  +NV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSSGMIGGAALDVFEDEPRVPEALFAFENVTLAPHIGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  + L T VV
Sbjct  297   LDAHFAGRELPTPVV  311



>ref|XP_010056258.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
 gb|KCW72893.1| hypothetical protein EUGRSUZ_E01337 [Eucalyptus grandis]
 gb|KCW72894.1| hypothetical protein EUGRSUZ_E01337 [Eucalyptus grandis]
Length=336

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/311 (46%), Positives = 204/311 (66%), Gaps = 8/311 (3%)
 Frame = -2

Query  1087  PMNAYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAFV--GADLLDVFIDR  917
             P    ++  L + F  L+ W  P   D F A  +  S  A++ +  V   AD+L     R
Sbjct  29    PHFTLIDRPLPDGFRFLKPWESPLPFDDFLASDDVRSAEAILTSQGVPVTADMLR----R  84

Query  916   LPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDR  737
             LP + ++ T S GL+ +DLA+C+ +G+ V    +V +++VAD+AIGL++ VLRK+S GDR
Sbjct  85    LPAVRLVLTTSAGLNHIDLAECRRRGVAVAGAGEVYSEEVADLAIGLLIDVLRKVSAGDR  144

Query  736   FVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTN  557
             +V++G W     +F   S+  GK  G++GLGRIGL +AKR EAF C +SY+SR +K    
Sbjct  145   YVRRGSWS-GEGEFALGSKLGGKRAGVVGLGRIGLEVAKRLEAFGCTVSYNSRKKKPYVL  203

Query  556   YKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELI  377
             Y +Y  V ELA+NC +LV+ C L  +THH+INR+V+ +LG  GV++NI RG  +DE E++
Sbjct  204   YPFYSDVRELATNCDVLVICCGLNEQTHHMINREVLLALGKEGVIVNIGRGSIIDEKEMV  263

Query  376   SALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAH  197
               LV+G LGGAGLDVFE+EP+V EEL  +DNVVL PH    T E+ + + +LVV NLEA 
Sbjct  264   QLLVQGELGGAGLDVFENEPKVPEELLALDNVVLSPHTAVFTTESLSELCNLVVGNLEAF  323

Query  196   FMNKPLLTRVV  164
             F +KPLL+ V+
Sbjct  324   FSDKPLLSPVL  334



>ref|WP_004431336.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EHJ97259.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens 5A]
 gb|AHK04446.1| D-3-phosphoglycerate dehydrogenase [Agrobacterium tumefaciens 
LBA4213 (Ach5)]
Length=311

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 205/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF ++   A++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEQELAQRFTVHRLFEAADKVAFLSE-KGAAIRGVVTGGHIGLPADVGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 +PNLEI++   VG DKVDLA+ K +G+RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----IPNLEIVAINGVGFDKVDLAEAKRRGLRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVPYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  +NV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSSGTIGGAALDVFEDEPRVPEALFAFENVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|XP_010056263.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
 ref|XP_010056264.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
Length=336

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 141/308 (46%), Positives = 200/308 (65%), Gaps = 8/308 (3%)
 Frame = -2

Query  1078  AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPN  908
             + L+  L + F  L+ W  P     F +  +A +  A++ +    V A++L     RLP 
Sbjct  32    SVLDRPLPDTFRFLKPWKSPLPLGDFLSSADARAAEAILTSGMTPVTAEMLR----RLPG  87

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
             + ++ T S GL+ +D+A+C+ +GI V N  D  ++DVAD+A+GL++ VLRK+S  D +V+
Sbjct  88    VRLVVTTSAGLEHIDVAECRRRGIAVANAGDAYSEDVADLAVGLLIDVLRKVSASDWYVR  147

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             +G W     +F   S+  GK VGI+GLGR GL +AKR EAF CA+SY+SR  K   +Y +
Sbjct  148   RGSWS-GEGEFALGSKLGGKRVGIVGLGRTGLKVAKRLEAFGCAVSYNSRKAKPYVSYPF  206

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             +  V ELA+NC  LV+ C L  ETHH+I R+V+ +LG  GVV+NI RG  +DE E++  L
Sbjct  207   HSNVCELATNCDALVICCGLNEETHHMITREVLLALGKEGVVVNIGRGSIIDEKEMVQLL  266

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+G LGGAGLDVFE+EP V EEL  +DNVVL PH    T E+ + + DLV+ NLEA F N
Sbjct  267   VQGELGGAGLDVFENEPNVPEELLALDNVVLSPHRAIFTQESLSDLCDLVIGNLEAFFSN  326

Query  187   KPLLTRVV  164
             KPLL+ V+
Sbjct  327   KPLLSPVL  334



>ref|WP_035200409.1| dihydrofolate reductase [Agrobacterium tumefaciens]
Length=311

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF ++   A++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEKELAQRFTVHRLFEAADKAAFLSE-KGAAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDLA+ K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLAEAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVPYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  +NV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSSGTIGGAALDVFEDEPRVPEALFTFENVTLAPHIGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|XP_010053876.1| PREDICTED: LOW QUALITY PROTEIN: glyoxylate/hydroxypyruvate reductase 
HPR3-like [Eucalyptus grandis]
Length=323

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/298 (47%), Positives = 200/298 (67%), Gaps = 7/298 (2%)
 Frame = -2

Query  1051  RFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPNLEILSTYSVG  878
             +F +LR W  P     F   +A S RA + +    V A LLD+    LP+L  + T S G
Sbjct  29    KFAVLRAWESPLPLPGFLSAHAQSARAPLCSGATRVTAALLDL----LPSLXFVVTTSAG  84

Query  877   LDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQ  698
             L+ +DL +C+ +G+ V N  +V +DDVAD A+GL LAVLR++S  DRFV++GLW      
Sbjct  85    LNHIDLPECRRRGMAVANAGEVFSDDVADAAVGLALAVLRRVSAADRFVRRGLWA-EEGD  143

Query  697   FQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASN  518
             F   S+ +GK VGI+GLG IGL +AKR EAF C +SY+SR++K + +Y +Y  V ELA+N
Sbjct  144   FALGSKLAGKRVGIVGLGSIGLRVAKRLEAFGCPVSYNSRTKKPSVSYPFYANVYELAAN  203

Query  517   CQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGL  338
               I ++ CALT +THH+I++ V+ +LG +G++IN+ RG  +DE EL+ +LV G + GAGL
Sbjct  204   SDIFIICCALTEQTHHMIDKSVLLALGKDGILINVGRGAIIDEKELVQSLVRGEIRGAGL  263

Query  337   DVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRVV  164
             DVFE+EP V EEL  +DNV+L PH    T E+   +A+L++ NLEA F N+PL+T V+
Sbjct  264   DVFENEPNVPEELLSLDNVILSPHVAVFTEESFQDLAELMIANLEAFFSNEPLITPVI  321



>ref|XP_004134340.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
sativus]
 ref|XP_004155868.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
sativus]
 gb|KGN56571.1| hypothetical protein Csa_3G124900 [Cucumis sativus]
Length=325

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 143/303 (47%), Positives = 201/303 (66%), Gaps = 3/303 (1%)
 Frame = -2

Query  1072  LEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILS  893
             LE Q  N+F+ L+ W        F    A S +AL++   V   L    +D LP+L+++ 
Sbjct  25    LESQFPNKFHYLKPWLSQLPLHQFLTSYAQSTQALLIP--VSPPLNSPILDCLPSLKLVV  82

Query  892   TYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWK  713
             T S G++ ++ A+ + +GI V    +V ++DVAD+A+GL++ VLRK+S GDRFVK+ L  
Sbjct  83    TVSAGVEHLNFAELRGRGIAVAYAGNVFSEDVADMAVGLLIDVLRKVSAGDRFVKQRLQP  142

Query  712   MAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVI  533
             +    F   S+ SGK +GI+GLG+IG  +AKR E F C ISY+SR++K   +Y YY  V 
Sbjct  143   IKP-DFPLRSKLSGKQIGIVGLGKIGSEVAKRLEGFGCRISYNSRTKKPLVSYSYYSNVH  201

Query  532   ELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRL  353
             ELA+NC++L++ C LT ETHH+INR+V+  LG +GV+INI RG  +DE E+I  L+EG +
Sbjct  202   ELATNCEVLIICCGLTEETHHMINREVMLELGKDGVIINIGRGAVIDEKEMIRCLIEGEI  261

Query  352   GGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLT  173
             GGAGLDVFE EPE+ ++LF +DNVVL PH    T E+   +A L V NLEA F NKPLL+
Sbjct  262   GGAGLDVFEFEPEIPKQLFTLDNVVLSPHTAVTTHESFVGIAKLAVENLEAFFSNKPLLS  321

Query  172   RVV  164
               V
Sbjct  322   PYV  324



>ref|XP_009400796.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Musa 
acuminata subsp. malaccensis]
Length=330

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 199/316 (63%), Gaps = 3/316 (1%)
 Frame = -2

Query  1114  ENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLL  935
             E   VL+  P  + L   L  RF LLR W  P     F   +AA VRAL+V   V  D  
Sbjct  14    ERPQVLLLRPPLSVLHEALSARFQLLRPWESPLPFDRFLAAHAAGVRALLVTGLVPVD--  71

Query  934   DVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRK  755
                +D LP L  + T S G++ +DLA+C  +GI V N   + + DVAD A+GL++ VLR+
Sbjct  72    GPLLDALPALRFIVTTSSGVNHIDLAECARRGIAVANAGTIFSLDVADYAVGLLIDVLRR  131

Query  754   ISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRS  575
             +S  DR+V +GLW  A   +   S+   K VGI+GLG IG  IAKR EAF C+ISY SRS
Sbjct  132   VSASDRYVHRGLWPRAG-DYPLGSKLGSKRVGIVGLGSIGSEIAKRLEAFGCSISYFSRS  190

Query  574   QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHV  395
             +K +  Y Y+P+V +LA+   +LV++CALT ET+HII+R V+ +LG +G++IN+ RG  V
Sbjct  191   RKPHVPYTYFPSVRDLATESDVLVLSCALTEETYHIISRDVMSALGKDGIIINVGRGALV  250

Query  394   DEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVV  215
             DEAE +  L++  +GGAGLDVFE EP V EEL  +DNVVL  H    T+E  + +  L++
Sbjct  251   DEAEFVKHLMQREIGGAGLDVFEHEPAVPEELCCMDNVVLSAHFAVHTLEMSSELCQLMI  310

Query  214   RNLEAHFMNKPLLTRV  167
              NL A F ++PLLT V
Sbjct  311   ANLNAFFSDRPLLTPV  326



>ref|XP_008439355.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
melo]
Length=322

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 142/301 (47%), Positives = 201/301 (67%), Gaps = 4/301 (1%)
 Frame = -2

Query  1072  LEHQLHNRFNLLRFWNFPDSDAF-FAQINAASVRALVVNAFVGADLLDVFIDRLPNLEIL  896
             LE Q  N+F  L+ W FP      F    A S +AL++   V   L    +D LP+L+++
Sbjct  21    LESQFPNKFRYLKPWLFPQLPLHQFLTSYAQSTQALLMP--VIPLLNSATLDCLPSLKLV  78

Query  895   STYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLW  716
              T S G++ ++LA  + +GI V    +V ++DVAD+A+GL++ VLRK+S GDRFVK+ L 
Sbjct  79    VTASAGVEHLNLADLRGRGIAVAYAGNVFSEDVADMAVGLLIDVLRKVSAGDRFVKQRL-  137

Query  715   KMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTV  536
             +     F   S+ SGK +GI+GLG+IG  +A+R E F C ISY+SR++K   +Y YY  V
Sbjct  138   QPTKLHFPLGSKLSGKQIGIVGLGKIGTEVARRLEGFGCTISYNSRTKKPLVSYSYYSNV  197

Query  535   IELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGR  356
              ELA+NC++L++ C LT ET H+INR+V+ +LG +GV+INI RG  ++E E+I  L+EG 
Sbjct  198   HELATNCEVLIICCGLTEETRHMINREVMLALGKDGVIINIGRGAVIEEKEMIRCLIEGE  257

Query  355   LGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLL  176
             +GGAGLDVFE EPE+ ++LF +DNVVL PH    T E+   MA L V NLEA F NKPL+
Sbjct  258   IGGAGLDVFEFEPEIPKQLFTLDNVVLSPHAAITTHESFGGMAKLAVENLEAFFSNKPLV  317

Query  175   T  173
             +
Sbjct  318   S  318



>ref|XP_005973367.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2-like [Pantholops 
hodgsonii]
Length=311

 Score =   253 bits (646),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 200/315 (63%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF A+    ++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEQELAQRFTVHRLFEAADKAAFLAE-KGGAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F   ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFYARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSNGTIGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|WP_019566714.1| dihydrofolate reductase [Agrobacterium sp. 10MFCol1.1]
Length=311

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 149/318 (47%), Positives = 203/318 (64%), Gaps = 10/318 (3%)
 Frame = -2

Query  1111  NIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADL  938
             N  ++  CP+   LE +L  RF + R +   D   F ++   A++R +V    +G  AD+
Sbjct  2     NTEIVQLCPLIPALEQELAQRFTVHRLFEAADKVTFLSE-KGAAIRGVVTGGHIGLPADI  60

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                    LPNLEI++   VG DKVDLA+ K +G RV+NTPDVLT DVAD+A+GL+LA  R
Sbjct  61    GAA----LPNLEIVAINGVGFDKVDLAEAKRRGFRVSNTPDVLTADVADLALGLVLAQAR  116

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+ + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R
Sbjct  117   KLPQADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTAR  174

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
              ++ +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  
Sbjct  175   DRR-DVPYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSL  233

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  L+ AL  G +GGA LDVFEDEP V E LF  +NV L PH G  T +TR AMADLV
Sbjct  234   VDEKALVEALSSGTIGGAALDVFEDEPRVPEALFTFENVTLAPHIGSGTHQTRRAMADLV  293

Query  217   VRNLEAHFMNKPLLTRVV  164
             + NL+AHF  K L T VV
Sbjct  294   LANLDAHFAGKELPTPVV  311



>ref|WP_020810952.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|EPR20024.1| dihydrofolate reductase [Agrobacterium radiobacter DSM 30147]
Length=311

 Score =   253 bits (645),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 201/315 (64%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF A+   A++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEQELAERFTVHRLFEAADKAAFLAE-KGAAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 L NLEI++   VG DKVDL   K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LSNLEIVAINGVGFDKVDLTDAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +RS++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARSRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  DNV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSNGVVGGAALDVFEDEPRVPEALFAFDNVTLAPHVGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|WP_035225056.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 emb|CDN94773.1| D-isomer specific 2-hydroxyacid dehydrogenase [Agrobacterium 
tumefaciens]
Length=311

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 199/313 (64%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  AAS++A+V    +G  L     
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEAASIKAVVTGGHIG--LAPDLA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D LP LEI++   VG DKVDL + + +G RVTNT DVLT+DVAD+AIGL + +LR++   
Sbjct  62    DCLPALEIVAINGVGFDKVDLDQARARGFRVTNTADVLTEDVADLAIGLSIMLLRQLVSA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK A  +    ++ S +  GI GLGRIG AIA R EAF+  ISY SR +K +
Sbjct  122   DHHVRSGEWKKA--EMPLGNKASRRRYGIYGLGRIGRAIAARLEAFDAEISYFSR-RKQD  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y Y+ T + LAS C +L+VA A TPET H INR+V+ +LGP+GV++N+ARG  VDE  
Sbjct  179   VAYGYHSTAVSLASACDVLIVAAATTPETRHAINREVLAALGPDGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  LV G L GA LDVF++EP V E L G+ NVVL PH G AT ETR  M  LV+ NL+
Sbjct  239   LVDILVAGGLKGAALDVFQNEPHVPEALIGMRNVVLAPHIGAATHETRLQMGALVLANLD  298

Query  202   AHFMNKPLLTRVV  164
             AHF  + L T VV
Sbjct  299   AHFAGQDLPTAVV  311



>ref|WP_013761076.1| MULTISPECIES: dihydrofolate reductase [Agrobacterium]
 ref|YP_004442980.1| 2-hydroxyacid dehydrogenase [Agrobacterium sp. H13-3]
 gb|ADY65889.1| 2-hydroxyacid dehydrogenase [Agrobacterium sp. H13-3]
Length=311

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 148/315 (47%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   +  AF ++   A++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEQELAQRFTVHRLFEAAEKAAFLSE-KGAAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LPNLEI++   VG DKVDLA+ K +G RV+NTPDVLT DVAD+A+GL+LA  RK+ 
Sbjct  64    ----LPNLEIVAINGVGFDKVDLAEAKRRGFRVSNTPDVLTADVADLALGLVLAQARKLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D+ V+ G W         +++ +G+  GI GLGRIG AIAKR E F+  ISY +R+++
Sbjct  120   QADQHVRTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIAKRLEGFDARISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y Y+ ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE
Sbjct  178   -DVPYDYHDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               L+ AL  G +GGA LDVFEDEP V E LF  +NV L PH G  T +TR AMADLV+ N
Sbjct  237   KALVEALSSGTIGGAALDVFEDEPRVPEALFTFENVTLAPHIGSGTHQTRRAMADLVLAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  K L T VV
Sbjct  297   LDAHFAGKELPTPVV  311



>ref|XP_008462451.1| PREDICTED: hydroxyphenylpyruvate reductase-like, partial [Cucumis 
melo]
Length=186

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 155/186 (83%), Gaps = 0/186 (0%)
 Frame = -2

Query  721  LWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYP  542
            ++K         SQFSGKSVGIIGLGRIGLAIAKRAEAFNC ISYHSR++K ++ YKYY 
Sbjct  1    IYKSTKNCIAIASQFSGKSVGIIGLGRIGLAIAKRAEAFNCPISYHSRTKKEDSKYKYYS  60

Query  541  TVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVE  362
             ++ELASN  IL++ACALT ETHHI+NR+VID+LGP GV+INI RG HVDE EL++ALVE
Sbjct  61   NLLELASNSDILIIACALTKETHHIVNREVIDALGPKGVLINIGRGSHVDEPELVAALVE  120

Query  361  GRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKP  182
            GRLGGAGLDVFE+EPEV +ELF ++NVVL+PH G  TVETR  MADLV+ NLE+HF NKP
Sbjct  121  GRLGGAGLDVFENEPEVPQELFALENVVLVPHIGSGTVETRKEMADLVLGNLESHFSNKP  180

Query  181  LLTRVV  164
            LLT VV
Sbjct  181  LLTPVV  186



>ref|WP_035264890.1| dihydrofolate reductase [Agrobacterium tumefaciens]
 gb|KDR86457.1| dihydrofolate reductase [Agrobacterium tumefaciens GW4]
Length=311

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 198/313 (63%), Gaps = 6/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L   P+   +E +L  RF + R+    D  AF  Q  AAS++A+V    +G  L     
Sbjct  5     LLQTYPLQPQIEAELQKRFRVHRWHEISDKQAFL-QAEAASIKAVVTGGHIG--LAPDLA  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
               LP LEI++   VG DKVDL + + +G RVTNTPDVLT+DVAD+AIGL + +LR++   
Sbjct  62    ACLPALEIVAINGVGFDKVDLDQARARGFRVTNTPDVLTEDVADLAIGLSIMLLRQLVSA  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             D  V+ G WK A  +    ++ S +  GI GLGRIG AIA R EAF+  ISY SR +K +
Sbjct  122   DHHVRSGEWKKA--EMPLGNKASRRRYGIYGLGRIGRAIAARLEAFDAEISYFSR-RKQD  178

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y Y+ T + LAS C +L+VA A TPET H INR+V+ +LGP+GV++N+ARG  VDE  
Sbjct  179   VAYGYHSTAVSLASACDVLIVAAAATPETRHAINREVLAALGPDGVLVNVARGSLVDEKA  238

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L+  L+ G L GA LDVFE+EP V E L  + NVVL PH G AT ETR  M  LV+ NLE
Sbjct  239   LVDILMAGGLKGAALDVFENEPHVPEALIAMRNVVLAPHIGAATHETRLQMGALVLANLE  298

Query  202   AHFMNKPLLTRVV  164
             AHF  + L T VV
Sbjct  299   AHFAGQDLPTAVV  311



>ref|XP_006491460.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Citrus 
sinensis]
Length=312

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/302 (45%), Positives = 201/302 (67%), Gaps = 5/302 (2%)
 Frame = -2

Query  1072  LEHQL--HNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEI  899
             LE Q    N+F  L+ +        F  ++A SV+A+  +A  GA +    +  LP + +
Sbjct  8     LEEQFFTSNKFQYLKAYESALPLHEFLTLHAHSVKAIFSSA--GAPVTAEILRLLPEVRL  65

Query  898   LSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGL  719
             +   S GL+ +D+ +C+ +G+ + N  +V ++DVAD A+GL++ VLRK+S  D FV++GL
Sbjct  66    VVATSAGLNHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGL  125

Query  718   WKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPT  539
             W + + +F   S+  GK VGI+GLG IG  +AKR EAF C +SY+SR++K +  Y +YP 
Sbjct  126   WPI-NAEFPLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPFYPD  184

Query  538   VIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEG  359
             V ELA+N  +L++ CALT +THH+IN+QV+ +LG  GV+IN+ RG  +DE E++  L+ G
Sbjct  185   VCELAANSDVLIICCALTDQTHHLINKQVLLALGKKGVIINVGRGAIIDEKEMVGCLLRG  244

Query  358   RLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPL  179
              +GGAGLDVFE+EP+V E+LF +DNVVL PH    T E+   + +L V NLEA F NKPL
Sbjct  245   EIGGAGLDVFENEPDVPEQLFALDNVVLSPHSAVFTPESFKDVCELAVANLEAFFSNKPL  304

Query  178   LT  173
             LT
Sbjct  305   LT  306



>ref|WP_014197341.1| dihydrofolate reductase [Azospirillum brasilense]
 ref|YP_004984622.1| 2-oxo/hydroxy acid reductase [Azospirillum brasilense Sp245]
 emb|CCC99836.1| 2-oxo/hydroxy acid reductase [Azospirillum brasilense Sp245]
Length=312

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 199/313 (64%), Gaps = 5/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L+   M   +E  L   + + R    PD D   A++    VRA+V     G  + +  +
Sbjct  5     ILLVESMMPDIEAALDAGYTVHRLAGAPDRDQLVAEVGP-RVRAVVTGG--GTGVSNAIM  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D  PNL I++   VG D VDL     +G+RVTNTPDVLTDDVAD+AIGL++A  R++  G
Sbjct  62    DACPNLGIVAINGVGTDAVDLKHAAGRGVRVTNTPDVLTDDVADLAIGLMIAGSRRMMVG  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DRFV+ G W           + +GK +GI+GLGRIG+AIA+RA  F   I+Y +R  + +
Sbjct  122   DRFVRAGRWPGGGLPL--ARKVTGKRLGILGLGRIGMAIAQRAAGFGMDIAYTNRKPRSD  179

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y++  + ++LA    IL+VA +  P+  +++NR VI++LGP+G+++N+ARG  VDE E
Sbjct  180   VPYRFVASPVDLARESDILIVAASAGPDARNMVNRAVIEALGPDGLLVNVARGAVVDEPE  239

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L++AL +GRLGGA LDVF +EP   E LFG+DNVVL PH   ATVETR AM +LV+ NL 
Sbjct  240   LVAALADGRLGGAALDVFANEPHAPEALFGLDNVVLQPHQASATVETRMAMGNLVLANLS  299

Query  202   AHFMNKPLLTRVV  164
             A F  +PL T VV
Sbjct  300   AFFAGQPLPTAVV  312



>ref|XP_002511757.1| glycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF50426.1| glycerate dehydrogenase, putative [Ricinus communis]
Length=328

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 196/302 (65%), Gaps = 7/302 (2%)
 Frame = -2

Query  1069  EHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVN--AFVGADLLDVFIDRLPNLEIL  896
             E     +F  L+ +  P     F   +A SV+A++ +  A V AD+L      LP++ ++
Sbjct  28    ESFTSTKFRYLKAYESPLPLHQFLAQHAQSVQAILSSGGAPVTADILRF----LPSVRVI  83

Query  895   STYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLW  716
              T S GL+++DL +C+ +GI + N  DV + DVAD+AIGL++ VLR IS  DR+VK+GLW
Sbjct  84    VTTSAGLNQIDLPECRRRGISIANAGDVYSADVADLAIGLLIDVLRNISASDRYVKQGLW  143

Query  715   KMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTV  536
               +   +    + SGK +GI+GLG IG  +AKR +AF C ISY+SR QK   +Y +YP V
Sbjct  144   S-SKGDYPLGFKLSGKRIGIVGLGSIGYEVAKRLDAFGCYISYNSRKQKFYVSYPFYPNV  202

Query  535   IELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGR  356
              ELA+NC  LV+ C LT +T H+IN QV  +LG NGVV+NI RG  +DE ELI  LVEG 
Sbjct  203   CELAANCDALVICCGLTDQTFHMINEQVFSALGKNGVVVNIGRGPIIDEKELIRCLVEGE  262

Query  355   LGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLL  176
             + GAGLDVFE+EP + +E   ++NVVL PH    T E+   +++LVV NLEA F NKPLL
Sbjct  263   IAGAGLDVFENEPNIPQEFVSMNNVVLSPHCAVFTPESMKDLSELVVGNLEAFFANKPLL  322

Query  175   TR  170
             + 
Sbjct  323   SE  324



>ref|XP_010058443.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
Length=336

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 204/306 (67%), Gaps = 8/306 (3%)
 Frame = -2

Query  1072  LEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVN--AFVGADLLDVFIDRLPNLE  902
             L H L + F+ L+ W  P   D F +  ++ S  A++ +  A V AD+L     RLP + 
Sbjct  34    LNHPLPDNFHFLKPWESPLPFDDFLSSADSRSAEAILTSGRAPVTADMLR----RLPRVR  89

Query  901   ILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKG  722
             I+   SVGL+ ++LA+C  +GI V    D  +++VAD+A+GL++ VLRK+S  DR V+ G
Sbjct  90    IVVNASVGLNHINLAECGRRGIAVAGAGDTKSEEVADLAVGLLIDVLRKVSASDRSVRHG  149

Query  721   LWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYP  542
             LW  +  +F   S+  GK VGI+GLGRIGL +AKR EAF CAISY+SR +K +  Y +Y 
Sbjct  150   LWS-SEGEFALGSKLGGKRVGIVGLGRIGLEVAKRVEAFGCAISYNSREKKPHIPYPFYS  208

Query  541   TVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVE  362
              V +LA+N   LV+ C LT +THH+++R+V+ +LG  GV++NI RG  +DE E++  LV 
Sbjct  209   NVRDLAANSDALVICCGLTEQTHHMVDREVLLALGKEGVIVNIGRGPIIDEKEMVQLLVR  268

Query  361   GRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKP  182
             G LGG GLDVFE+EP+V EEL G+DNVVL PH    T ET + + DL+V NLEA F NKP
Sbjct  269   GELGGVGLDVFENEPDVPEELLGLDNVVLSPHVADFTPETISNLCDLIVGNLEAFFSNKP  328

Query  181   LLTRVV  164
             LL+ V+
Sbjct  329   LLSPVL  334



>ref|WP_027316374.1| dehydrogenase [Microvirga flocculans]
Length=323

 Score =   251 bits (642),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 193/317 (61%), Gaps = 4/317 (1%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADL  938
             M    +LM  PM   +   L   F L R W   D +AF   I    +R +  +   G  L
Sbjct  1     MSRTDILMTAPMMPVVIETLDKAFTLHRLWEQDDREAFLETIGP-RIRGIATSTLYGR-L  58

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 +DRLP++EI++++ VG D VD A+   +GI VTNTP VL D+VAD+ IGL+LA LR
Sbjct  59    EASLLDRLPSVEIIASFGVGYDNVDAAEAARRGIVVTNTPGVLDDEVADLTIGLLLATLR  118

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             KI + DR++++G W  A F    T     + VGI+GLGRIG AIA+R   F+  I+YH R
Sbjct  119   KIPQADRYLREGQWLKAPFPLSAT--LRERKVGIVGLGRIGKAIARRLSGFDVGIAYHGR  176

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             S++ +  Y YYPTV +LA    +L+V     P T H+I+ QV+ +LGPNGV+IN+ARG  
Sbjct  177   SRQPDVAYPYYPTVTDLAQASDVLIVITPGGPSTRHLIDAQVLQALGPNGVLINVARGSV  236

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE  LI AL  G +  AGLDV+EDEP V +EL  +++VVLLPH    +V TR AM  LV
Sbjct  237   VDEQALIEALRSGTILSAGLDVYEDEPRVPQELIAMEHVVLLPHVASGSVHTRKAMGKLV  296

Query  217   VRNLEAHFMNKPLLTRV  167
               NL A F +K  LT V
Sbjct  297   ADNLIAWFDDKGPLTPV  313



>gb|EGP56235.1| 2-hydroxyacid dehydrogenase [Agrobacterium tumefaciens F2]
Length=301

 Score =   251 bits (640),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 148/309 (48%), Positives = 201/309 (65%), Gaps = 10/309 (3%)
 Frame = -2

Query  1084  MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDVFIDRLP  911
             M   LE +L  RF + R +   D  AF ++   A++R +V    +G  AD+       LP
Sbjct  1     MIPALEQELAQRFIVHRLFEAADKAAFLSE-KGAAIRGVVTGGHIGLPADIGAA----LP  55

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             NLEI++   VG DKVDLA+ K++G RV+NTPDVLT DVAD+A+GL+LA  RK+ + D+ V
Sbjct  56    NLEIVAINGVGFDKVDLAEAKQRGFRVSNTPDVLTADVADLALGLVLAQARKLPQADQHV  115

Query  730   KKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYK  551
             + G W         +++ +G+  GI GLGRIG AIA+R E F+  ISY +R+++ + +Y 
Sbjct  116   RTGQWLKG--DMGLSTRVAGRRYGIFGLGRIGQAIARRLEGFDARISYTARNRR-DVSYD  172

Query  550   YYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISA  371
             YY ++  LA+NC +L++A A T ET HI+N  V+ +LGP GV++N+ARG  VDE  L+ A
Sbjct  173   YYDSIEALAANCDVLIIAAAATAETRHIVNADVLKALGPQGVLVNVARGSLVDEKALVEA  232

Query  370   LVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFM  191
             L  G +GGA LDVFEDEP V E LF  D V L PH G  T +TR AMADLV+ NL+AHF 
Sbjct  233   LSSGTIGGAALDVFEDEPRVPEALFAFDTVTLAPHVGSGTHQTRRAMADLVLANLDAHFA  292

Query  190   NKPLLTRVV  164
              K L T VV
Sbjct  293   GKDLPTPVV  301



>emb|CAH67836.1| B0616E02-H0507E05.12 [Oryza sativa Indica Group]
Length=316

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 204/314 (65%), Gaps = 14/314 (4%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VGADLLDV  929
             V++  P+       L  RF   RF    D+D    + NAA  RA++V A   V ADL   
Sbjct  13    VILPRPLYPEFAAALDGRF---RFVLAADAD----EGNAAEARAVLVPALTPVSADL---  62

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
              + RLP LEI+   S G+D +DL  C+ +GI VTN  +V   DVAD A+GL++AVLR+++
Sbjct  63    -VARLPKLEIVVATSTGVDHIDLDACRRRGISVTNAGEVFAPDVADYAVGLVVAVLRRVA  121

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
               + ++++G W  A   +   ++ SGK VGI+GLG IG  +A+R  AF C I+Y+SRS K
Sbjct  122   AAEAYLRRGRWA-ADGDYPLATKVSGKRVGIVGLGSIGGLVARRLAAFGCVIAYNSRSPK  180

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  YK+YP+V ELA+   +LV++CALT ET  ++ R+V+++LG  GV++N+ RGG VDE
Sbjct  181   ASAPYKFYPSVRELAAESDVLVLSCALTEETRRMVGREVMEALGKGGVLVNVGRGGLVDE  240

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
             AEL+  L EG LGGAGLDV+E+EPEV  EL+G+DNVVL  H    T E+   + D+V  N
Sbjct  241   AELVRCLREGVLGGAGLDVYENEPEVPPELWGMDNVVLSDHRAVITPESIQGVVDVVKAN  300

Query  208   LEAHFMNKPLLTRV  167
             L+A F  KPL+++V
Sbjct  301   LDAFFSGKPLVSQV  314



>gb|EZQ05679.1| dihydrofolate reductase [Azospirillum brasilense]
 gb|AIB14067.1| dihydrofolate reductase [Azospirillum brasilense]
Length=312

 Score =   251 bits (640),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 199/313 (64%), Gaps = 5/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L+   M   +E  L   + + R    PD D   A++    VRA+V     G  + +  +
Sbjct  5     ILLVESMMPDIEAALDAGYTVHRLAGAPDRDRLVAEVGP-RVRAVVTGG--GTGVSNAVM  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D   NL I++   VG D VDL     +G+RVTNTPDVLTDDVAD+AIGL++A  R++  G
Sbjct  62    DACANLGIVAINGVGTDAVDLKHAASRGVRVTNTPDVLTDDVADLAIGLMIAGSRRMMVG  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DRFV+ G W           + +GK +GI+GLGRIG+AIA+RA  F   I+Y +R  + +
Sbjct  122   DRFVRAGRWPGGGLPL--ARKVTGKRLGILGLGRIGMAIAQRAAGFGMDIAYTNRKPRAD  179

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
              +Y++  + ++LA    IL+VA +  P+  +++NR VI++LGP+G+++N+ARG  VDE E
Sbjct  180   VSYRFVASPVDLARESDILIVAASAGPDARNMVNRAVIEALGPDGLLVNVARGAVVDEPE  239

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L++AL EGRLGGA LDVF +EP   E LFG+DNVVL PH   ATVETR AM +LV+ NL 
Sbjct  240   LVAALAEGRLGGAALDVFANEPHAPEALFGLDNVVLQPHQASATVETRMAMGNLVLANLS  299

Query  202   AHFMNKPLLTRVV  164
             A F  +PL T VV
Sbjct  300   AFFAGQPLPTAVV  312



>ref|NP_001052017.1| Os04g0107500 [Oryza sativa Japonica Group]
 emb|CAE02766.2| OSJNBb0085F13.13 [Oryza sativa Japonica Group]
 dbj|BAF13931.1| Os04g0107500 [Oryza sativa Japonica Group]
 dbj|BAG90226.1| unnamed protein product [Oryza sativa Japonica Group]
Length=316

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 143/314 (46%), Positives = 204/314 (65%), Gaps = 14/314 (4%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VGADLLDV  929
             V++  P+       L  RF   RF    D+D    + NAA  RA++V A   V ADL   
Sbjct  13    VILLRPLYPEFAAALDGRF---RFVLAADAD----EGNAAEARAVLVPALTPVSADL---  62

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
              + RLP LEI+   S G+D +DL  C+ +GI VTN  +V   DVAD A+GL++AVLR+++
Sbjct  63    -VARLPKLEIVVATSTGVDHIDLDACRRRGISVTNAGEVFAPDVADYAVGLVVAVLRRVA  121

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
               + ++++G W  A   +   ++ SGK VGI+GLG IG  +A+R  AF C I+Y+SRS K
Sbjct  122   AAEAYLRRGRWA-ADGDYPLATKVSGKRVGIVGLGSIGGLVARRLAAFGCVIAYNSRSPK  180

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  YK+YP+V ELA+   +LV++CALT ET  ++ R+V+++LG  GV++N+ RGG VDE
Sbjct  181   ASAPYKFYPSVRELAAESDVLVLSCALTEETRRMVGREVMEALGKGGVLVNVGRGGLVDE  240

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
             AEL+  L EG LGGAGLDV+E+EPEV  EL+G+DNVVL  H    T E+   + D+V  N
Sbjct  241   AELVRCLREGVLGGAGLDVYENEPEVPPELWGMDNVVLSDHRAVITPESIQGVVDVVKAN  300

Query  208   LEAHFMNKPLLTRV  167
             L+A F  KPL+++V
Sbjct  301   LDAFFSGKPLVSQV  314



>ref|XP_008783586.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Phoenix 
dactylifera]
Length=404

 Score =   253 bits (646),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 141/295 (48%), Positives = 188/295 (64%), Gaps = 3/295 (1%)
 Frame = -2

Query  1051  RFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGLD  872
             +F+LLR W  P     F   +A SVRAL+++  V  D     +D LP L  + T S G++
Sbjct  108   KFHLLRPWESPLPRDQFLAAHAGSVRALLISGLVTLDA--ATLDALPRLGCVVTTSAGVN  165

Query  871   KVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQFQ  692
              +DLA C  +GI V N   V + D AD A+GL++ VLR++S  DR+V++GLW +    + 
Sbjct  166   HIDLAACARRGIAVANAGTVFSPDAADYAVGLLIDVLRRVSASDRYVRRGLWPVKG-DYP  224

Query  691   FTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNCQ  512
                +   K VGI+GLG IG   AKR EAF C I Y+SR  K +  YKY P V +LA+   
Sbjct  225   LGFKLGSKRVGIVGLGSIGSQTAKRLEAFGCTILYYSRKNKPSVPYKYLPNVCDLAAESD  284

Query  511   ILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLDV  332
             +LVV+CALT ETHHIIN+ V+ +LG  G++IN+ RG  VDE EL+  L++G LGGAGLDV
Sbjct  285   VLVVSCALTSETHHIINKDVMAALGKEGIIINVGRGPLVDEDELVRRLMQGELGGAGLDV  344

Query  331   FEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLTRV  167
             FE+EP V +ELF +DNVVL PH    T E+   +  L+  NLEA F N+PLLT V
Sbjct  345   FENEPAVPKELFLMDNVVLSPHRAVFTSESFADLGQLLAANLEAFFSNRPLLTPV  399



>ref|XP_004155806.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Cucumis 
sativus]
 gb|KGN56573.1| hypothetical protein Csa_3G124920 [Cucumis sativus]
Length=327

 Score =   251 bits (640),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 204/315 (65%), Gaps = 9/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAY--LEHQLHNRFNLLRFWNFPDSDAFFAQI---NAASVRALVVNAFVGADL  938
             VL+  P + +  LE Q  NRF  L+ W   DS+    Q    NA SVRA +V    G  +
Sbjct  13    VLVLSPPSVFTSLESQFQNRFQFLKPW---DSNLPLLQFLISNAQSVRACLVTPGDGLAV  69

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
                 +D LP+L+ + T S G+D +++A+ + +G+ +    ++ + DVAD+A+GL++ VLR
Sbjct  70    SSAILDCLPSLKFVVTASAGVDHLNVAELRRRGVAIAYAGNLFSQDVADMAVGLLIDVLR  129

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
              +S GDRFV++GLW      F    + +GK +GI+GLG+IG  +AKR E F C ISY+SR
Sbjct  130   NVSAGDRFVRQGLWA-TQMDFSLGLKLTGKRIGIVGLGKIGSEVAKRLEGFGCRISYNSR  188

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
             ++K    Y +Y  V ELA+NC +L++  +LT ET H+INR+V+ +LG +GV+IN+ RG  
Sbjct  189   TKKPLVPYSHYSNVHELATNCDVLIICSSLTEETRHLINREVMVALGKDGVIINVGRGAI  248

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             +DE  +I  L++G + GAGLDVFEDEPE+ ++LF +DNVVL PH    T E+   + +L 
Sbjct  249   IDEKAMIEYLIQGEIKGAGLDVFEDEPEIPKQLFNLDNVVLSPHVAVTTTESIAGLIELA  308

Query  217   VRNLEAHFMNKPLLT  173
             + NLEA F NKPL++
Sbjct  309   LENLEAFFSNKPLVS  323



>gb|KDO85915.1| hypothetical protein CISIN_1g020160mg [Citrus sinensis]
Length=330

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/294 (45%), Positives = 198/294 (67%), Gaps = 3/294 (1%)
 Frame = -2

Query  1054  NRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFIDRLPNLEILSTYSVGL  875
             N+F  L+ +        F  ++A SV+A+  +A  GA +    +  LP + ++   S GL
Sbjct  34    NKFQYLKAYESALPLHEFLTLHAHSVKAIFSSA--GAPVTAEILRLLPEVRLVVATSAGL  91

Query  874   DKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWKMAHFQF  695
             + +D+ +C+ +G+ + N  +V ++DVAD A+GL++ VLRK+S  D FV++GLW + + +F
Sbjct  92    NHIDVVECRRRGVALANAGNVFSEDVADYALGLLIDVLRKLSAADCFVRQGLWPI-NAEF  150

Query  694   QFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVIELASNC  515
                S+  GK VGI+GLG IG  +AKR EAF C +SY+SR++K +  Y +YP V ELA+N 
Sbjct  151   PLGSKLGGKRVGIVGLGSIGSEVAKRLEAFGCCVSYNSRNKKPSVTYPFYPDVCELAANS  210

Query  514   QILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRLGGAGLD  335
              +L++ CALT +THH+IN+QV+ +LG  GV+IN+ RG  +DE E++  L+ G +GGAGLD
Sbjct  211   DVLIICCALTDQTHHLINKQVLLALGKKGVIINVGRGAIIDEKEMVGCLLRGEIGGAGLD  270

Query  334   VFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLT  173
             VFE+EP+V E+LF +DNVVL PH    T E+   + +L V NLEA F NKPLLT
Sbjct  271   VFENEPDVPEQLFALDNVVLSPHSAVFTPESFKDVCELAVANLEAFFSNKPLLT  324



>gb|KCW72898.1| hypothetical protein EUGRSUZ_E01340, partial [Eucalyptus grandis]
Length=306

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 139/305 (46%), Positives = 198/305 (65%), Gaps = 8/305 (3%)
 Frame = -2

Query  1078  AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVN--AFVGADLLDVFIDRLPN  908
             + L+  L + F  L+ W  P   D F +  +A    A++ N  A V AD+L     RLP 
Sbjct  2     SLLDRPLPDNFRFLKPWESPLPLDDFLSSADARPAEAILTNGRAPVTADMLR----RLPG  57

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
             + ++ T S G++ +DLA+C+ +GI V    D  ++DVAD+A+GL++ VLRK+S  DR V+
Sbjct  58    VRLVFTSSAGVNHIDLAECRRRGIAVAGAGDAYSEDVADLAVGLLIDVLRKVSASDRHVR  117

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
             +GLW  +  +   +S+  GK VGI+GLG+IGL +AKR EAF CA+SY+SR  K    Y +
Sbjct  118   RGLWS-SEGEVALSSKLGGKRVGIVGLGKIGLKVAKRLEAFGCAVSYNSRKTKPCVPYPF  176

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             Y  V ELA+NC  LV+ C L  +THH+I R+V+ +LG  GV++N+ RG  VDE E++  L
Sbjct  177   YSDVSELAANCDALVICCGLNEQTHHMITREVLLALGKEGVIVNVGRGSIVDEKEMVQLL  236

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+  L GAGLDVFE+EP++ EEL  +DNVVL PH    T E+ + + DL + NLEA F N
Sbjct  237   VQAELRGAGLDVFENEPDIPEELLALDNVVLSPHSAVFTPESFSDICDLAIGNLEAFFSN  296

Query  187   KPLLT  173
             KPLL+
Sbjct  297   KPLLS  301



>ref|WP_035676338.1| dihydrofolate reductase [Azospirillum brasilense]
Length=312

 Score =   250 bits (638),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/313 (45%), Positives = 200/313 (64%), Gaps = 5/313 (2%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGADLLDVFI  923
             +L+   M   +E  L   + + RF   PD D   A++    VRA+V     G  + +  +
Sbjct  5     ILLVESMMPDIEAALDAGYTVHRFAGAPDRDRLVAEVGP-RVRAVVTGG--GTGVSNAVM  61

Query  922   DRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEG  743
             D   NL I++   VG D VDL     +G+RVTNTPDVLTDDVAD+AIGL++A  R++  G
Sbjct  62    DACTNLGIVAINGVGTDAVDLKHAAGRGVRVTNTPDVLTDDVADLAIGLMIAGSRRMMVG  121

Query  742   DRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLN  563
             DRFV+ G W   +       + +GK +GI+GLGRIG+AIA+RA  F   I+Y +R  + +
Sbjct  122   DRFVRAGRWP--NGGLPLARKVTGKRLGILGLGRIGMAIAQRAAGFGMDIAYTNRKPRSD  179

Query  562   TNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAE  383
               Y++  + ++LA    IL+VA +  P+  +++NR VI++LGP+G+++N+ARG  VDE E
Sbjct  180   VPYRFVASPVDLARESDILIVAASAGPDARNMVNRAVIEALGPDGLLVNVARGAVVDEPE  239

Query  382   LISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLE  203
             L++AL +GRLGGA LDVF +EP   E LFG+DNVVL PH   ATVETR AM +LV+ NL 
Sbjct  240   LVAALTDGRLGGAALDVFANEPHAPEALFGLDNVVLQPHQASATVETRMAMGNLVLTNLS  299

Query  202   AHFMNKPLLTRVV  164
             A F  +PL T VV
Sbjct  300   AFFAGQPLPTAVV  312



>ref|XP_003633919.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 isoform 
X1 [Vitis vinifera]
Length=341

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 205/305 (67%), Gaps = 7/305 (2%)
 Frame = -2

Query  1072  LEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAF--VGADLLDVFIDRLPNLEI  899
              +++   +F LL+ W  P     F   +A SV+A+V ++   + +D+L      LP+L++
Sbjct  40    FQYKFSPKFQLLKAWESPLPTTLFLTTHAHSVKAVVSSSSSPITSDILR----HLPSLQL  95

Query  898   LSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGL  719
             +   +VGL+++DL +C+ +GI + N   +L++D AD+ +GL + VL+KIS GDRFV+ GL
Sbjct  96    VVATTVGLNQIDLPECRRRGISIANAGKILSEDCADMGVGLFIDVLKKISAGDRFVRSGL  155

Query  718   WKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPT  539
             W +    F   S+  GK VGI+GLG IGL +AKR EAF C I Y+SR +K N +Y +Y  
Sbjct  156   WPIQK-DFPLGSKLGGKRVGIVGLGSIGLEVAKRLEAFGCIILYNSRRKKANISYPFYSN  214

Query  538   VIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEG  359
             V ELA+N   L++ CALT ET H+IN++V+ +LG  GV+INI RG  +DE EL+  LV+G
Sbjct  215   VCELAANSNALIICCALTDETRHMINKEVMKALGKEGVIINIGRGAIIDEKELVQCLVQG  274

Query  358   RLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPL  179
              +GGAGLDVFE+EP+V +ELF +DNVVL PH    T E+ + + DL+V NLEA F NK L
Sbjct  275   EIGGAGLDVFENEPDVPKELFTLDNVVLSPHVAVFTQESFSDLYDLMVGNLEAFFSNKTL  334

Query  178   LTRVV  164
             L+ V+
Sbjct  335   LSPVL  339



>emb|CDP13464.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 199/302 (66%), Gaps = 14/302 (5%)
 Frame = -2

Query  1060  LHNRFNLLRFWNFPD--SDAFFAQINAASVRAL--VVNAFVGADLLDVFIDRLPNLEILS  893
             L +RF  L     P+  SD+ F+ +   +VR L  V N+ V ++ LD    + P+LE + 
Sbjct  20    LEDRFQFLN----PNTSSDSLFSSL-VGTVRILLCVANSPVNSETLD----KYPSLECVV  70

Query  892   TYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVKKGLWK  713
               + GL+ +DLA+C+ +GIRVTN  DV  DD  D A+GL++  LR+IS  DRFV+ G W 
Sbjct  71    GSTTGLNHIDLAECRRRGIRVTNAGDVFADDAVDYAVGLLIDTLRRISVADRFVRGGSWA  130

Query  712   MAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKYYPTVI  533
             +   QF  +    GK VGI G+G IG  I+KR +AF C+I+Y+SR  K N ++ +Y +V 
Sbjct  131   IKG-QFPLSYNVWGKRVGIAGMGSIGRRISKRLQAFGCSIAYNSRKPKANISFPFYASVQ  189

Query  532   ELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISALVEGRL  353
             ELASN  ILVV CALT ET HII+R V+ +LG  G+++NI RG  +DE E++  LV+G +
Sbjct  190   ELASNVDILVVCCALTNETRHIISRDVMKALGKEGIIVNIGRGSLIDEKEMVKLLVKGEI  249

Query  352   GGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMNKPLLT  173
             GGAGLDVFE+EP V +EL+ +DNVVL PH G A  E+   + ++++ N+EA F NKPLL+
Sbjct  250   GGAGLDVFENEPVVPQELYALDNVVLSPHRGGAVPESLLRLQEIMIANIEAFFANKPLLS  309

Query  172   RV  167
              +
Sbjct  310   EI  311



>ref|XP_010056261.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Eucalyptus 
grandis]
Length=336

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 204/315 (65%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMAC-PMN-AYLEHQLHNRFNLLRFWNFP-DSDAFFAQINAASVRALVVN--AFVGADL  938
             VL+ C P+  + L+  L + F  L+ W  P   D F +  +A    A++ N  A V AD+
Sbjct  22    VLLLCHPIEFSLLDRPLPDNFRFLKPWESPLPLDDFLSSADARPAEAILTNGRAPVTADM  81

Query  937   LDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLR  758
             L     RLP + ++ T S G++ +DLA+C+ +GI V    D  ++DVAD+A+GL++ VLR
Sbjct  82    LR----RLPGVRLVFTSSAGVNHIDLAECRRRGIAVAGAGDAYSEDVADLAVGLLIDVLR  137

Query  757   KISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSR  578
             K+S  DR V++GLW  +  +   +S+  GK VGI+GLG+IGL +AKR EAF CA+SY+SR
Sbjct  138   KVSASDRHVRRGLWS-SEGEVALSSKLGGKRVGIVGLGKIGLKVAKRLEAFGCAVSYNSR  196

Query  577   SQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGH  398
               K    Y +Y  V ELA+NC  LV+ C L  +THH+I R+V+ +LG  GV++N+ RG  
Sbjct  197   KTKPCVPYPFYSDVSELAANCDALVICCGLNEQTHHMITREVLLALGKEGVIVNVGRGSI  256

Query  397   VDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLV  218
             VDE E++  LV+  L GAGLDVFE+EP++ EEL  +DNVVL PH    T E+ + + DL 
Sbjct  257   VDEKEMVQLLVQAELRGAGLDVFENEPDIPEELLALDNVVLSPHSAVFTPESFSDICDLA  316

Query  217   VRNLEAHFMNKPLLT  173
             + NLEA F NKPLL+
Sbjct  317   IGNLEAFFSNKPLLS  331



>ref|XP_009626264.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Nicotiana 
tomentosiformis]
Length=326

 Score =   249 bits (637),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 146/308 (47%), Positives = 203/308 (66%), Gaps = 6/308 (2%)
 Frame = -2

Query  1081  NAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNA--FVGADLLDVFIDRLPN  908
             N Y E QL ++F  L+ W        F   +A SV+A++ +   FVG  +    +  LP+
Sbjct  21    NIYGE-QLSHKFRFLKPWESSLPSEQFISTHAQSVQAMISSPKDFVG-KISSSLLCLLPS  78

Query  907   LEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFVK  728
             L ++ T S G++ +DL +C+ +GI V N   V ++DVAD A+GL++ VLRKIS  DRFVK
Sbjct  79    LRVIVTTSAGVNHIDLVECRRRGISVANAVSVFSEDVADFAVGLLIDVLRKISVADRFVK  138

Query  727   KGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYKY  548
              GLW + H  F   S+  G+ VGI+GLG IGL +AKR EAF C ISY SR +K   +Y +
Sbjct  139   NGLWSL-HVDFPLCSKVGGRKVGIVGLGSIGLKVAKRLEAFGCIISYQSRKKK-PVSYPF  196

Query  547   YPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISAL  368
             YP V ELA+ C +LV+ CALT +T H+IN++V+ +LG  GV+INIARG  ++E EL+  L
Sbjct  197   YPDVHELATKCDVLVICCALTEQTRHLINKEVLLALGKGGVIINIARGSVINEMELVKCL  256

Query  367   VEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFMN  188
             V+G + GAGLDVFE+EP V EEL  +DNVVL  H  C T ++   + +L+  NLEA F+N
Sbjct  257   VQGEIAGAGLDVFENEPNVPEELLSLDNVVLTRHVACCTEDSFRDLYELISGNLEAFFLN  316

Query  187   KPLLTRVV  164
             KPLL+ V+
Sbjct  317   KPLLSPVL  324



>ref|XP_004306882.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Fragaria 
vesca subsp. vesca]
Length=323

 Score =   249 bits (636),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 206/317 (65%), Gaps = 9/317 (3%)
 Frame = -2

Query  1102  VLMACPMNAYL--EHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNA--FVGADLL  935
             VL+  P  A++  E    ++FN+LR W  P     F   +A SV+AL+  A   V ADLL
Sbjct  10    VLIINPPPAFICFESHFTHKFNILRAWESPLPLDQFLTTHAHSVQALLCRAETPVNADLL  69

Query  934   DVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRK  755
              +    LP L+I+ + S G D+VD A+C+ +GI VTN  +  ++DVAD+A+GL L V RK
Sbjct  70    RL----LPALKIVVSASTGADQVDKAECRRRGIAVTNAGNAYSEDVADLAVGLFLDVNRK  125

Query  754   ISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRS  575
             IS  D +V++GLW  +   +   S+  GK VG++GLG IG  +AKR EAF C ISY+SRS
Sbjct  126   ISAADSYVRRGLWS-SRGDYSLGSKIGGKRVGVVGLGSIGYEVAKRLEAFGCKISYNSRS  184

Query  574   QKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHV  395
             ++ + +Y +Y  V ELA++   L++ C LT ET H+IN++V+ +LG +GVV+NI RG  +
Sbjct  185   KRQSLSYPFYSNVSELAADNDALIICCGLTDETRHMINKEVLSALGKDGVVVNIGRGAII  244

Query  394   DEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVV  215
             DE  L+  LV G + GAGLDVFE+EP + +E+  +DNVVL PH    TVE+     ++++
Sbjct  245   DEKALVRCLVNGEIRGAGLDVFENEPHIPKEIVAMDNVVLSPHKAVYTVESVKEGGEVMI  304

Query  214   RNLEAHFMNKPLLTRVV  164
              NLEA F NKPL+T V+
Sbjct  305   ANLEAFFSNKPLVTPVI  321



>ref|WP_037169103.1| 2-hydroxyacid dehydrogenase [Rhizobium sp. CF258]
Length=313

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 149/319 (47%), Positives = 200/319 (63%), Gaps = 9/319 (3%)
 Frame = -2

Query  1117  MENIGVLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVGA--  944
             M    VLM  P  A+    L +R+ + R W   D DAF A+ +A S+RA+     +GA  
Sbjct  1     MSKPEVLMIGPYPAWDMEDLDSRYVIHRLWEAKDRDAFLAE-HAGSIRAIATRGELGASA  59

Query  943   DLLDVFIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAV  764
             DL+     RLP LEI+S Y VG D +DL   +E GIRVTNTPDVLT+DVAD+ + L+LA 
Sbjct  60    DLMK----RLPKLEIVSCYGVGTDAIDLRFARENGIRVTNTPDVLTEDVADLGMALMLAA  115

Query  763   LRKISEGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYH  584
              R++  GD +V++G W   +     T++  GK +G++G+GRIG A A+RA AF+C+ISY 
Sbjct  116   ARQLPAGDAYVREGHWVKGNMAL--TTRVCGKRIGVVGMGRIGAAFARRAAAFDCSISYF  173

Query  583   SRSQKLNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARG  404
             +R+ K +  Y +   +I LA     LVV  A    T  I+  +VID+LGP+G+ +NI+RG
Sbjct  174   ARTPKPDLPYTFVGDLIALARQSDFLVVTLAGGEGTRGIVTAEVIDALGPDGIFVNISRG  233

Query  403   GHVDEAELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMAD  224
               VDEA L+ AL +GR+ GAGLDVF +EP ++    G+ N VL PHHG  TVETR AM  
Sbjct  234   TTVDEAALLDALEQGRIRGAGLDVFLNEPAIDSRFVGLRNTVLQPHHGSGTVETRQAMGK  293

Query  223   LVVRNLEAHFMNKPLLTRV  167
             LV  NL AHF   PLLT V
Sbjct  294   LVRDNLAAHFSGAPLLTPV  312



>gb|KCW72902.1| hypothetical protein EUGRSUZ_E01346 [Eucalyptus grandis]
Length=263

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/255 (51%), Positives = 177/255 (69%), Gaps = 1/255 (0%)
 Frame = -2

Query  928  FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
             + RLP + ++ T S GL+ +D+A+C+ +GI V N  D  ++DVAD+A+GL++ VLRK+S
Sbjct  8    MLRRLPGVRLVVTTSAGLEHIDVAECRRRGIAVANAGDAYSEDVADLAVGLLIDVLRKVS  67

Query  748  EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
              D +V++G W     +F   S+  GK VGI+GLGR GL +AKR EAF CA+SY+SR  K
Sbjct  68   ASDWYVRRGSWS-GEGEFALGSKLGGKRVGIVGLGRTGLKVAKRLEAFGCAVSYNSRKAK  126

Query  568  LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
               +Y ++  V ELA+NC  LV+ C L  ETHH+I R+V+ +LG  GVV+NI RG  +DE
Sbjct  127  PYVSYPFHSNVCELATNCDALVICCGLNEETHHMITREVLLALGKEGVVVNIGRGSIIDE  186

Query  388  AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
             E++  LV+G LGGAGLDVFE+EP V EEL  +DNVVL PH    T E+ + + DLV+ N
Sbjct  187  KEMVQLLVQGELGGAGLDVFENEPNVPEELLALDNVVLSPHRAIFTQESLSDLCDLVIGN  246

Query  208  LEAHFMNKPLLTRVV  164
            LEA F NKPLL+ V+
Sbjct  247  LEAFFSNKPLLSPVL  261



>ref|WP_034497901.1| dihydrofolate reductase [Agrobacterium sp. 33MFTa1.1]
Length=311

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 201/315 (64%), Gaps = 10/315 (3%)
 Frame = -2

Query  1102  VLMACPMNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNAFVG--ADLLDV  929
             ++  CP+   LE +L  RF + R +   D  AF  +    ++R +V    +G  AD+   
Sbjct  5     IVQLCPLIPALEEELAQRFTVHRLFEVSDRAAFLTE-KGGAIRGVVTGGHIGLPADIGAA  63

Query  928   FIDRLPNLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKIS  749
                 LP LEI++   VG DKVDLA+ K +G RV+NTPDVLT DVAD+A+GLILA  R++ 
Sbjct  64    ----LPKLEIVAINGVGFDKVDLAEAKRRGFRVSNTPDVLTADVADLALGLILAQARRLP  119

Query  748   EGDRFVKKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQK  569
             + D++V+ G W M       +++ +G+  GI G GRIG AIA+R E F+  ISY +R+++
Sbjct  120   QADQYVRTGQWLMG--DMGLSTRVAGRRYGIFGFGRIGQAIARRLEGFDAHISYTARNRR  177

Query  568   LNTNYKYYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDE  389
              +  Y YY ++  LA+NC +L++A A T ET HI+  +V+++LGP GV++N+ARG  VDE
Sbjct  178   -DVAYDYYDSIEALAANCDVLIIAAAATAETRHIVGAEVLNALGPQGVLVNVARGSLVDE  236

Query  388   AELISALVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRN  209
               LI AL  G + GA LDVFEDEP V + LF  + V L PH G  T +TR AMADLV+ N
Sbjct  237   KALIEALSNGVIAGAALDVFEDEPRVPDALFAFETVTLAPHIGSGTHQTRRAMADLVIAN  296

Query  208   LEAHFMNKPLLTRVV  164
             L+AHF  + L T VV
Sbjct  297   LDAHFAGRELPTPVV  311



>ref|XP_009780940.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3-like [Nicotiana 
sylvestris]
Length=326

 Score =   249 bits (635),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 145/309 (47%), Positives = 201/309 (65%), Gaps = 6/309 (2%)
 Frame = -2

Query  1084  MNAYLEHQLHNRFNLLRFWNFPDSDAFFAQINAASVRALVVNA--FVGADLLDVFIDRLP  911
              N Y E QL ++F  L+ W        F   +A SV+A++ +   FVG     +F   LP
Sbjct  20    FNIYGE-QLSHKFQFLKPWESSLPLEQFISTHAQSVQAMISSPKDFVGKISSSLFC-LLP  77

Query  910   NLEILSTYSVGLDKVDLAKCKEKGIRVTNTPDVLTDDVADIAIGLILAVLRKISEGDRFV  731
             +L ++ T S G++ +DL +C+ +GI V N   V ++DVAD A+GL++ VLRKIS  DRFV
Sbjct  78    SLRVIVTSSAGVNHIDLLECRRRGISVANAVSVFSEDVADFAVGLLIDVLRKISVADRFV  137

Query  730   KKGLWKMAHFQFQFTSQFSGKSVgiiglgriglaiAKRAEAFNCAISYHSRSQKLNTNYK  551
             K GLW + H  F   S+  G+ VGI+GLG IGL +AKR EAF C ISY SR +K   +Y 
Sbjct  138   KNGLWPL-HGDFPLCSKVGGRKVGIVGLGSIGLKVAKRLEAFGCIISYQSRKKK-PVSYP  195

Query  550   YYPTVIELASNCQILVVACALTPETHHIINRQVIDSLGPNGVVINIARGGHVDEAELISA  371
             +YP V ELA+ C +LV+ CALT +T H+IN++V+ +LG  GV+INIARG  ++E EL+  
Sbjct  196   FYPDVHELATKCDVLVICCALTEQTRHLINKEVLLALGKGGVIINIARGSVINEMELVQC  255

Query  370   LVEGRLGGAGLDVFEDEPEVNEELFGIDNVVLLPHHGCATVETRNAMADLVVRNLEAHFM  191
             LV+  + GAGLDVFE+EP V E+LF +DNVVL  H    T  +   + +L+  NLEA F+
Sbjct  256   LVQREIAGAGLDVFENEPNVPEDLFSLDNVVLTRHVAACTENSFRDLYELISGNLEAFFL  315

Query  190   NKPLLTRVV  164
             NKPLL+ V+
Sbjct  316   NKPLLSPVL  324



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3249488224448