BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81079_g1_i1 len=1082 path=[1:0-1081]

Length=1082
                                                                      Score     E

ref|XP_008236375.1|  PREDICTED: transcription factor MYB44-like         238   7e-72   
ref|XP_007199299.1|  hypothetical protein PRUPE_ppa023154mg             237   8e-72   
ref|XP_008373085.1|  PREDICTED: transcription factor MYB44-like         233   3e-70   
ref|XP_007155887.1|  hypothetical protein PHAVU_003G240200g             232   6e-70   
gb|ADL36760.1|  MYB domain class transcription factor                   231   1e-69   
ref|XP_011088207.1|  PREDICTED: transcription factor MYB44-like         230   3e-69   
gb|KDP45901.1|  hypothetical protein JCGZ_15461                         224   2e-67   
ref|XP_006487005.1|  PREDICTED: transcription factor MYB44-like         224   3e-67   
ref|NP_001268121.1|  sucrose responsive element binding protein         224   1e-66   
ref|XP_003524661.1|  PREDICTED: transcription factor MYB44              223   2e-66   
ref|XP_010271172.1|  PREDICTED: transcription factor MYB44-like         224   2e-66   
ref|XP_002285389.1|  PREDICTED: transcription factor MYB44              223   5e-66   Vitis vinifera
ref|NP_001238087.1|  MYB transcription factor MYB50                     222   7e-66   
ref|NP_001235715.1|  MYB transcription factor MYB68                     220   1e-65   
ref|XP_010244270.1|  PREDICTED: transcription factor MYB44              222   1e-65   
ref|XP_010095320.1|  Transcription factor                               220   4e-65   
gb|KDO59816.1|  hypothetical protein CISIN_1g040502mg                   218   5e-65   
ref|XP_006422932.1|  hypothetical protein CICLE_v10029124mg             217   2e-64   
gb|EYU25477.1|  hypothetical protein MIMGU_mgv1a010338mg                218   4e-64   
ref|XP_010059753.1|  PREDICTED: transcription factor MYB44-like         219   4e-64   
ref|XP_003611666.1|  R2R3-MYB transcription factor                      218   5e-64   
gb|AFK47194.1|  unknown                                                 217   9e-64   
ref|XP_007227715.1|  hypothetical protein PRUPE_ppa008979mg             216   2e-63   
ref|XP_006844027.1|  hypothetical protein AMTR_s00006p00225600          216   2e-63   
ref|XP_010092183.1|  Transcription factor                               216   3e-63   
ref|XP_007156759.1|  hypothetical protein PHAVU_002G015100g             215   3e-63   
emb|CAN75196.1|  hypothetical protein VITISV_014739                     215   3e-63   Vitis vinifera
ref|XP_010096284.1|  Transcription factor                               214   5e-63   
ref|XP_010691674.1|  PREDICTED: transcription factor MYB44-like         213   7e-63   
ref|XP_008452606.1|  PREDICTED: transcription factor MYB44-like         213   8e-63   
gb|AFK46950.1|  unknown                                                 214   9e-63   
ref|XP_006425988.1|  hypothetical protein CICLE_v10026107mg             214   1e-62   
ref|NP_001275856.1|  putative R2R3-Myb transcription factor             214   1e-62   
ref|NP_001275798.1|  putative R2R3-MYB transcription factor             213   2e-62   
ref|XP_008220277.1|  PREDICTED: transcription factor MYB44-like         214   2e-62   
ref|XP_004141275.1|  PREDICTED: transcription factor MYB44-like         212   2e-62   
gb|AHN50422.1|  R2R3-type MYB transcription factor                      211   3e-62   
ref|XP_004142878.1|  PREDICTED: transcription factor MYB44-like         212   4e-62   
dbj|BAJ40867.1|  transcriptional factor MYB-1                           213   4e-62   
gb|KDO84060.1|  hypothetical protein CISIN_1g022144mg                   212   4e-62   
ref|XP_006434697.1|  hypothetical protein CICLE_v10001979mg             212   5e-62   
dbj|BAC53938.1|  Myb-like protein                                       213   5e-62   Nicotiana tabacum [American tobacco]
ref|XP_009586849.1|  PREDICTED: transcription factor MYB44-like         213   6e-62   
ref|XP_002285015.1|  PREDICTED: transcription factor MYB44-like         212   7e-62   Vitis vinifera
ref|XP_007160886.1|  hypothetical protein PHAVU_001G025200g             211   8e-62   
ref|XP_009398678.1|  PREDICTED: transcription factor MYB44-like         214   8e-62   
gb|AFH03055.1|  R2R3-MYB transcription factor MYB3                      211   9e-62   
ref|XP_002310702.1|  hypothetical protein POPTR_0007s10490g             212   1e-61   Populus trichocarpa [western balsam poplar]
gb|AGL76985.1|  MYB transcription factor                                211   1e-61   
ref|XP_004163238.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    209   1e-61   
ref|XP_011006987.1|  PREDICTED: transcription factor MYB44-like         212   1e-61   
gb|EYU37627.1|  hypothetical protein MIMGU_mgv1a026376mg                210   2e-61   
gb|ABQ10819.1|  putative R2R3-Myb transcription factor                  211   2e-61   Citrus sinensis [apfelsine]
ref|XP_007136715.1|  hypothetical protein PHAVU_009G068000g             209   3e-61   
ref|XP_004305954.1|  PREDICTED: transcription factor MYB44-like         209   4e-61   
emb|CBI19466.3|  unnamed protein product                                208   4e-61   
ref|XP_011017151.1|  PREDICTED: transcription factor MYB44-like         209   6e-61   
gb|ABQ10818.1|  putative R2R3-Myb transcription factor                  210   6e-61   Citrus sinensis [apfelsine]
ref|XP_002518677.1|  r2r3-myb transcription factor, putative            207   7e-61   Ricinus communis
emb|CAN81361.1|  hypothetical protein VITISV_028904                     209   8e-61   Vitis vinifera
gb|KEH31491.1|  myb transcription factor                                207   1e-60   
ref|XP_008444592.1|  PREDICTED: transcription factor MYB44-like         208   1e-60   
ref|XP_009392116.1|  PREDICTED: transcription factor MYB44-like         211   1e-60   
ref|XP_010679545.1|  PREDICTED: transcription factor MYB44              209   1e-60   
gb|ABR28330.1|  MYB transcription factor MYB8                           207   2e-60   
gb|AHB59592.1|  putative R2R3 MYB protein 4                             208   2e-60   
ref|NP_001235731.1|  MYB transcription factor MYB178                    204   2e-60   
emb|CDP02540.1|  unnamed protein product                                209   3e-60   
gb|AHB59606.1|  putative MYB-related protein 20                         209   3e-60   
ref|XP_010556427.1|  PREDICTED: transcription factor MYB44-like         207   4e-60   
ref|XP_002302428.2|  hypothetical protein POPTR_0002s12410g             207   6e-60   Populus trichocarpa [western balsam poplar]
gb|EYU36318.1|  hypothetical protein MIMGU_mgv1a022221mg                206   1e-59   
ref|NP_001235142.1|  MYB transcription factor MYB112                    205   2e-59   
ref|XP_007042527.1|  Myb domain protein 73, putative                    203   3e-59   
ref|XP_009587267.1|  PREDICTED: transcription factor MYB44-like         204   3e-59   
ref|XP_004141899.1|  PREDICTED: transcription factor MYB44-like         205   3e-59   
ref|XP_009372447.1|  PREDICTED: transcription factor MYB44-like         205   3e-59   
ref|XP_006374871.1|  hypothetical protein POPTR_0014s02260g             205   3e-59   
gb|KDP41681.1|  hypothetical protein JCGZ_16088                         205   3e-59   
ref|XP_008440323.1|  PREDICTED: transcription factor MYB44              205   3e-59   
gb|ABL97967.1|  R2R3-MYB transcription factor                           203   5e-59   Brassica rapa
ref|XP_010531261.1|  PREDICTED: transcription factor MYB44              204   7e-59   
ref|XP_006411909.1|  hypothetical protein EUTSA_v10025742mg             204   8e-59   
ref|XP_010057256.1|  PREDICTED: transcription factor MYB44-like         203   8e-59   
ref|XP_011029247.1|  PREDICTED: transcription factor MYB44-like         204   1e-58   
gb|KDP31997.1|  hypothetical protein JCGZ_12458                         204   1e-58   
ref|XP_011074411.1|  PREDICTED: transcription factor MYB44-like         204   1e-58   
ref|XP_009360105.1|  PREDICTED: transcription factor MYB44-like         203   1e-58   
ref|XP_006404809.1|  hypothetical protein EUTSA_v10000438mg             203   1e-58   
gb|AHN60131.1|  MYB transcription factor 77                             202   1e-58   
gb|AEO27498.1|  MYB2                                                    203   2e-58   
emb|CDY22442.1|  BnaC03g61550D                                          202   2e-58   
ref|XP_004291065.1|  PREDICTED: transcription factor MYB44-like         203   2e-58   
ref|XP_006339846.1|  PREDICTED: transcription factor MYB44-like         204   2e-58   
ref|XP_009588514.1|  PREDICTED: transcription factor MYB44              204   2e-58   
gb|AGN52056.1|  MYB-related transcription factor                        201   3e-58   
ref|XP_009418521.1|  PREDICTED: transcription factor MYB44-like         203   3e-58   
ref|XP_010315996.1|  PREDICTED: transcription factor MYB44-like         204   4e-58   
gb|AAG08960.1|AF122052_1  tuber-specific and sucrose-responsive e...    202   4e-58   Solanum tuberosum [potatoes]
ref|XP_006660414.1|  PREDICTED: transcription factor MYB44-like         202   4e-58   
gb|ABV02031.1|  sucrose responsive element binding factor 1             201   4e-58   Nicotiana langsdorffii x Nicotiana sanderae
emb|CDY30608.1|  BnaAnng03830D                                          201   4e-58   
ref|XP_009798591.1|  PREDICTED: transcription factor MYB44              203   5e-58   
ref|NP_001237693.1|  MYB transcription factor MYB70                     201   5e-58   
gb|AGN52088.1|  MYB-related transcription factor                        202   5e-58   
ref|XP_011097391.1|  PREDICTED: transcription factor MYB44              204   5e-58   
ref|XP_008360495.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    198   5e-58   
ref|XP_003575562.1|  PREDICTED: transcription factor MYB44-like         202   8e-58   
gb|AGN52031.1|  MYB-related transcription factor                        201   1e-57   
ref|XP_007047395.1|  Myb domain protein 73, putative                    201   1e-57   
gb|AAG08959.1|AF122051_1  tuber-specific and sucrose-responsive e...    202   1e-57   Solanum tuberosum [potatoes]
ref|XP_008799576.1|  PREDICTED: transcription factor MYB44-like         202   1e-57   
ref|XP_010547980.1|  PREDICTED: transcription factor MYB44-like         201   2e-57   
gb|KDO79069.1|  hypothetical protein CISIN_1g021071mg                   199   2e-57   
gb|ACJ85153.1|  unknown                                                 196   2e-57   Medicago truncatula
ref|XP_010547530.1|  PREDICTED: transcription factor MYB44-like         200   3e-57   
ref|XP_008351390.1|  PREDICTED: transcription factor MYB44-like         198   3e-57   
gb|AFK48638.1|  unknown                                                 198   3e-57   
ref|XP_002313145.1|  hypothetical protein POPTR_0009s09890g             197   3e-57   Populus trichocarpa [western balsam poplar]
ref|NP_001235688.1|  MYB transcription factor MYB61                     199   3e-57   
ref|XP_008391509.1|  PREDICTED: transcription factor MYB44-like         200   3e-57   
emb|CDY44045.1|  BnaA08g15610D                                          199   3e-57   
ref|XP_009795719.1|  PREDICTED: transcription factor MYB44-like         200   4e-57   
ref|XP_011099313.1|  PREDICTED: transcription factor MYB44-like         201   4e-57   
ref|XP_009109365.1|  PREDICTED: transcription factor MYB44-like         199   4e-57   
ref|NP_001062562.1|  Os09g0106700                                       199   6e-57   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD34048.1|  myb-related transcription factor-like                  199   6e-57   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08096.1|  hypothetical protein OsI_30362                          199   6e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_009103434.1|  PREDICTED: transcription factor MYB44              199   6e-57   
ref|XP_002462029.1|  hypothetical protein SORBIDRAFT_02g013010          201   6e-57   Sorghum bicolor [broomcorn]
gb|AHN19846.1|  MYB6                                                    199   7e-57   
gb|AHN19845.1|  MYB6                                                    199   7e-57   
dbj|BAJ86460.1|  predicted protein                                      199   8e-57   
ref|XP_008811216.1|  PREDICTED: transcription factor MYB44-like         201   8e-57   
ref|XP_010548433.1|  PREDICTED: transcription factor MYB44 isofor...    199   8e-57   
ref|XP_010548432.1|  PREDICTED: transcription factor MYB44 isofor...    199   8e-57   
ref|XP_006294656.1|  hypothetical protein CARUB_v10023692mg             198   9e-57   
ref|XP_004511885.1|  PREDICTED: transcription factor MYB44-like         199   1e-56   
ref|XP_010943207.1|  PREDICTED: transcription factor MYB44-like         200   1e-56   
ref|XP_002524926.1|  r2r3-myb transcription factor, putative            199   1e-56   Ricinus communis
ref|XP_004287994.1|  PREDICTED: transcription factor MYB44-like         198   1e-56   
ref|XP_007205522.1|  hypothetical protein PRUPE_ppa008450mg             199   1e-56   
ref|XP_010550347.1|  PREDICTED: transcription factor MYB44-like         198   1e-56   
ref|XP_010101670.1|  Transcription factor                               198   1e-56   
gb|ADL36764.1|  MYB domain class transcription factor                   198   2e-56   
ref|XP_010437245.1|  PREDICTED: transcription factor MYB44-like         198   2e-56   
ref|XP_009367649.1|  PREDICTED: transcription factor MYB44              198   2e-56   
emb|CDX75635.1|  BnaA01g00670D                                          197   2e-56   
ref|XP_004238123.1|  PREDICTED: transcription factor MYB44-like         198   2e-56   
ref|NP_001151336.1|  sucrose responsive element binding protein         199   2e-56   Zea mays [maize]
gb|AFH03065.1|  R2R3-MYB transcription factor MYB13                     199   2e-56   
emb|CDP01282.1|  unnamed protein product                                198   2e-56   
gb|ADX60118.1|  MYB-RELATED transcription factor                        199   3e-56   
ref|XP_010928389.1|  PREDICTED: transcription factor MYB44-like         199   3e-56   
emb|CDX69287.1|  BnaC01g01660D                                          197   3e-56   
gb|AFS65096.1|  sucrose responsive element-binding protein              199   3e-56   
ref|XP_006367421.1|  PREDICTED: transcription factor MYB44-like         197   3e-56   
ref|XP_011001142.1|  PREDICTED: transcription factor MYB44-like         195   3e-56   
ref|XP_008462845.1|  PREDICTED: transcription factor MYB44-like         197   3e-56   
ref|XP_010417080.1|  PREDICTED: transcription factor MYB44-like         197   3e-56   
ref|XP_002877726.1|  myb family transcription factor                    196   3e-56   
gb|AAZ20429.1|  MYB6                                                    197   4e-56   Malus domestica [apple tree]
ref|XP_002510155.1|  r2r3-myb transcription factor, putative            196   4e-56   Ricinus communis
gb|ADN33728.1|  MYB transcription factor                                194   4e-56   
gb|AHN60125.1|  MYB transcription factor 44                             197   4e-56   
ref|XP_009137661.1|  PREDICTED: transcription factor MYB44              197   4e-56   
gb|AIK01747.1|  MYB                                                     197   4e-56   
ref|XP_004501595.1|  PREDICTED: transcriptional activator Myb-like      194   5e-56   
emb|CDY01420.1|  BnaA07g11930D                                          195   7e-56   
ref|XP_008338349.1|  PREDICTED: transcription factor MYB44-like         196   7e-56   
ref|XP_009418325.1|  PREDICTED: transcription factor MYB44-like         197   9e-56   
emb|CDX72621.1|  BnaC07g46430D                                          194   1e-55   
ref|XP_009396271.1|  PREDICTED: transcription factor MYB44-like         196   1e-55   
ref|XP_002306488.2|  hypothetical protein POPTR_0005s18620g             197   1e-55   Populus trichocarpa [western balsam poplar]
ref|NP_190575.1|  myb domain protein 77                                 195   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286095.1|  hypothetical protein CARUB_v10007638mg             196   1e-55   
ref|XP_010432074.1|  PREDICTED: transcription factor MYB44-like         196   1e-55   
emb|CAA74604.1|  R2R3-MYB transcription factor                          195   1e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CAA90810.1|  MYB-related protein                                    195   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|NP_195443.1|  myb domain protein 73                                 195   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404067.1|  hypothetical protein EUTSA_v10010581mg             195   2e-55   
emb|CDY12830.1|  BnaC07g16030D                                          193   3e-55   
gb|AFV73403.1|  R2R3-MYB transcription factor                           195   3e-55   
ref|NP_001237709.1|  MYB transcription factor MYB81                     193   3e-55   
ref|XP_010558924.1|  PREDICTED: transcription factor MYB44-like i...    194   4e-55   
ref|XP_011010210.1|  PREDICTED: transcription factor MYB44-like         195   4e-55   
ref|NP_001183628.1|  putative MYB DNA-binding domain superfamily ...    193   4e-55   
gb|ABN11121.1|  MYB transcription factor                                195   4e-55   Capsicum annuum
ref|XP_002880492.1|  hypothetical protein ARALYDRAFT_481200             194   6e-55   
gb|AAM65553.1|  putative MYB family transcription factor                194   7e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AHB59591.1|  putative R2R3 MYB protein 3                             192   8e-55   
ref|XP_010464243.1|  PREDICTED: transcription factor MYB44              193   9e-55   
ref|XP_010472329.1|  PREDICTED: transcription factor MYB44-like         193   9e-55   
ref|XP_010429274.1|  PREDICTED: transcription factor MYB44-like         193   9e-55   
gb|KFK28404.1|  hypothetical protein AALP_AA8G510400                    193   1e-54   
ref|NP_179910.1|  myb domain protein 70                                 193   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010070607.1|  PREDICTED: transcription factor MYB44-like         194   1e-54   
ref|XP_010268609.1|  PREDICTED: transcriptional activator Myb-like      190   1e-54   
gb|ADL36765.1|  MYB domain class transcription factor                   193   2e-54   
gb|KFK34266.1|  hypothetical protein AALP_AA5G122700                    193   2e-54   
ref|NP_001287808.1|  transcription factor MYB44-like                    193   2e-54   
ref|XP_009115687.1|  PREDICTED: transcription factor MYB44-like         191   2e-54   
emb|CDY23023.1|  BnaC07g31640D                                          192   2e-54   
ref|XP_009354151.1|  PREDICTED: transcription factor MYB44-like         192   2e-54   
emb|CDY57355.1|  BnaC08g48630D                                          191   2e-54   
ref|XP_009395856.1|  PREDICTED: transcription factor MYB44-like         194   2e-54   
ref|XP_008351984.1|  PREDICTED: transcription factor MYB44-like         192   3e-54   
ref|XP_010444669.1|  PREDICTED: transcription factor MYB44-like         192   3e-54   
ref|XP_010446682.1|  PREDICTED: transcription factor MYB44-like         192   3e-54   
emb|CDY02098.1|  BnaA03g40690D                                          191   3e-54   
ref|XP_009138487.1|  PREDICTED: transcription factor MYB44-like         191   3e-54   
ref|XP_010426549.1|  PREDICTED: transcription factor MYB44-like         192   4e-54   
ref|XP_008367655.1|  PREDICTED: transcription factor MYB44-like         192   4e-54   
emb|CDY38933.1|  BnaA04g13540D                                          191   4e-54   
ref|XP_009396365.1|  PREDICTED: transcription factor MYB44-like         193   4e-54   
ref|XP_006393928.1|  hypothetical protein EUTSA_v10004676mg             191   5e-54   
ref|XP_009140453.1|  PREDICTED: transcription factor MYB44              191   5e-54   
ref|XP_006279745.1|  hypothetical protein CARUB_v10027659mg             191   5e-54   
ref|XP_003603000.1|  Myb transcription factor                           189   6e-54   
ref|XP_004151866.1|  PREDICTED: transcription factor MYB44-like         191   7e-54   
ref|XP_009415461.1|  PREDICTED: transcription factor MYB44-like         192   7e-54   
ref|XP_002866710.1|  AtMYB44/AtMYBr1                                    191   7e-54   
emb|CAA90809.1|  MYB-related protein                                    191   7e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64847.1|  myb-related protein, 33.3K                              191   9e-54   Arabidopsis thaliana [mouse-ear cress]
emb|CDX89554.1|  BnaC04g35730D                                          190   1e-53   
ref|XP_010515371.1|  PREDICTED: transcription factor MYB44-like         190   1e-53   
ref|NP_201531.1|  transcription factor MYB44                            191   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAK96490.1|  AT5g67300/K8K14_2                                       191   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293134.1|  hypothetical protein CARUB_v10019440mg             190   2e-53   
gb|EYU34554.1|  hypothetical protein MIMGU_mgv1a011398mg                189   2e-53   
ref|XP_010484518.1|  PREDICTED: transcription factor MYB44-like         189   2e-53   
ref|XP_009136534.1|  PREDICTED: transcription factor MYB44-like         189   3e-53   
gb|EPS70032.1|  myb-like protein                                        184   4e-53   
gb|KFK30351.1|  hypothetical protein AALP_AA7G250300                    189   5e-53   
ref|XP_010268711.1|  PREDICTED: transcription factor MYB44-like         186   1e-52   
ref|XP_009385523.1|  PREDICTED: transcription factor MYB44-like         189   1e-52   
ref|XP_011030579.1|  PREDICTED: transcription factor MYB44-like         186   1e-52   
ref|XP_009394543.1|  PREDICTED: transcription factor MYB44-like         187   2e-52   
emb|CDP07617.1|  unnamed protein product                                185   4e-52   
ref|XP_004238184.1|  PREDICTED: transcription factor MYB44-like         183   1e-51   
ref|NP_001147631.1|  LOC100281240                                       185   1e-51   Zea mays [maize]
ref|XP_006354921.1|  PREDICTED: transcription factor MYB44-like         183   2e-51   
gb|AAG08961.1|AF122053_1  tuber-specific and sucrose-responsive e...    183   2e-51   Solanum tuberosum [potatoes]
gb|ABD60291.2|  R2R3-MYB transcription factor MYB6                      182   2e-51   
ref|XP_002975777.1|  hypothetical protein SELMODRAFT_103999             178   3e-51   
emb|CDX68566.1|  BnaC01g26440D                                          184   3e-51   
ref|XP_002298748.1|  hypothetical protein POPTR_0001s30750g             182   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_002973727.1|  hypothetical protein SELMODRAFT_99462              177   5e-51   
gb|KDP44734.1|  hypothetical protein JCGZ_01234                         181   1e-50   
emb|CDX83109.1|  BnaA01g21090D                                          178   1e-50   
ref|XP_007136655.1|  hypothetical protein PHAVU_009G062700g             180   1e-50   
dbj|BAK08030.1|  predicted protein                                      182   1e-50   
gb|ABC86569.1|  MYB transcription factor TaMYB1                         182   2e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004951630.1|  PREDICTED: transcription factor MYB44-like         182   2e-50   
ref|XP_009620130.1|  PREDICTED: transcription factor MYB44-like         181   2e-50   
ref|XP_006374997.1|  hypothetical protein POPTR_0014s03440g             180   2e-50   
ref|XP_002438718.1|  hypothetical protein SORBIDRAFT_10g024950          182   2e-50   Sorghum bicolor [broomcorn]
ref|XP_009101651.1|  PREDICTED: transcription factor MYB44-like         182   2e-50   
gb|ABQ51222.1|  R2R3-MYB transcription factor MYB6                      183   2e-50   Picea glauca
ref|NP_001235925.1|  MYB transcription factor MYB124                    179   2e-50   
ref|XP_002451692.1|  hypothetical protein SORBIDRAFT_04g005940          182   3e-50   Sorghum bicolor [broomcorn]
ref|XP_001753678.1|  predicted protein                                  174   4e-50   
ref|XP_008796508.1|  PREDICTED: transcription factor MYB44-like         180   4e-50   
gb|EAZ22021.1|  hypothetical protein OsJ_05678                          181   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010098722.1|  Transcription factor                               179   4e-50   
ref|XP_009780273.1|  PREDICTED: transcription factor MYB44-like         179   5e-50   
ref|NP_001046131.1|  Os02g0187700                                       181   5e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002961364.1|  hypothetical protein SELMODRAFT_77255              174   5e-50   
ref|XP_011030396.1|  PREDICTED: transcription factor MYB44-like         179   5e-50   
ref|XP_006578007.1|  PREDICTED: transcription factor MYB44-like         178   5e-50   
ref|XP_011083803.1|  PREDICTED: transcription factor MYB44-like         178   6e-50   
gb|ABQ51225.1|  R2R3-MYB transcription factor MYB9                      184   6e-50   Picea glauca
gb|ABD60281.1|  R2R3-MYB transcription factor MYB7                      182   6e-50   Pinus taeda
gb|ABR16702.1|  unknown                                                 184   6e-50   Picea sitchensis
gb|ABD60288.2|  R2R3-MYB transcription factor MYB9                      179   7e-50   
ref|NP_001159044.1|  MYB transcription factor TaMYB1                    180   1e-49   Zea mays [maize]
ref|XP_010932223.1|  PREDICTED: transcription factor MYB44-like         178   1e-49   
ref|XP_001753593.1|  predicted protein                                  174   1e-49   
ref|XP_002528315.1|  r2r3-myb transcription factor, putative            178   1e-49   Ricinus communis
gb|KDP38397.1|  hypothetical protein JCGZ_04322                         177   2e-49   
ref|XP_011074463.1|  PREDICTED: transcription factor MYB44-like         177   2e-49   
ref|NP_001058148.1|  Os06g0637500                                       179   4e-49   
ref|XP_011000247.1|  PREDICTED: transcription factor MYB44-like         177   4e-49   
ref|XP_004169452.1|  PREDICTED: transcriptional activator Myb-like      176   4e-49   
ref|XP_004152727.1|  PREDICTED: transcriptional activator Myb-like      176   4e-49   
ref|XP_008444647.1|  PREDICTED: transcription factor MYB44-like         176   4e-49   
ref|XP_006595859.1|  PREDICTED: transcription factor MYB44-like         176   5e-49   
gb|ABD60290.2|  R2R3-MYB transcription factor MYB7                      177   5e-49   
ref|XP_007008918.1|  Myb domain protein 73                              176   5e-49   
ref|XP_011017241.1|  PREDICTED: transcriptional activator Myb-like      176   7e-49   
ref|XP_009345765.1|  PREDICTED: transcription factor MYB44-like         176   8e-49   
ref|XP_007017355.1|  Myb domain protein 77                              176   8e-49   
ref|XP_004965791.1|  PREDICTED: transcription factor MYB44-like         178   8e-49   
ref|XP_002272706.1|  PREDICTED: myb-related protein B                   176   8e-49   
ref|XP_007221111.1|  hypothetical protein PRUPE_ppa017892mg             175   1e-48   
gb|KDO68919.1|  hypothetical protein CISIN_1g046570mg                   176   1e-48   
ref|XP_001762255.1|  predicted protein                                  171   1e-48   
gb|EMS67867.1|  Transcription factor MYB44                              176   2e-48   
ref|XP_002510273.1|  r2r3-myb transcription factor, putative            175   2e-48   
ref|XP_002301201.1|  hypothetical protein POPTR_0002s13030g             175   2e-48   
ref|XP_010253806.1|  PREDICTED: transcription factor MYB44-like         175   2e-48   
gb|EAZ37752.1|  hypothetical protein OsJ_22090                          177   2e-48   
ref|XP_004157388.1|  PREDICTED: transcription factor MYB44-like         172   2e-48   
gb|ABQ51223.1|  R2R3-MYB transcription factor MYB7                      178   2e-48   
gb|EYU40230.1|  hypothetical protein MIMGU_mgv1a021015mg                171   2e-48   
dbj|BAJ95362.1|  predicted protein                                      176   2e-48   
ref|XP_001765018.1|  predicted protein                                  171   2e-48   
gb|AHB59589.1|  putative R2R3 MYB protein 1                             174   2e-48   
ref|XP_010105436.1|  Transcription factor                               174   3e-48   
ref|XP_006435772.1|  hypothetical protein CICLE_v10032317mg             176   3e-48   
gb|EYU36282.1|  hypothetical protein MIMGU_mgv1a013600mg                173   3e-48   
ref|XP_002311241.1|  hypothetical protein POPTR_0008s07100g             174   4e-48   
ref|XP_004140809.1|  PREDICTED: transcription factor MYB44-like         173   4e-48   
ref|XP_009785340.1|  PREDICTED: myb protein-like                        174   4e-48   
ref|XP_010666145.1|  PREDICTED: myb protein-like                        174   5e-48   
gb|AIB05744.1|  MYB transcription factor                                175   6e-48   
ref|XP_004148201.1|  PREDICTED: uncharacterized protein LOC101207929    174   8e-48   
ref|XP_010059771.1|  PREDICTED: transcription factor MYB44-like         173   8e-48   
ref|XP_007141751.1|  hypothetical protein PHAVU_008G222600g             173   8e-48   
ref|XP_004491024.1|  PREDICTED: transcription factor MYB44-like         173   8e-48   
ref|NP_001132112.1|  uncharacterized protein LOC100193529               175   1e-47   
ref|XP_010061776.1|  PREDICTED: transcription factor MYB44-like         172   1e-47   
ref|XP_008789179.1|  PREDICTED: transcription factor MYB44-like         174   1e-47   
ref|XP_004963854.1|  PREDICTED: transcription factor MYB44-like         176   1e-47   
ref|XP_010031187.1|  PREDICTED: myb-related protein A-like              173   1e-47   
ref|XP_003518439.1|  PREDICTED: transcription factor MYB44              172   1e-47   
ref|XP_008234066.1|  PREDICTED: transcriptional activator Myb-like      172   2e-47   
gb|ACF87327.1|  unknown                                                 174   3e-47   
ref|XP_008452503.1|  PREDICTED: transcriptional activator Myb-like      171   3e-47   
ref|XP_007223827.1|  hypothetical protein PRUPE_ppa010735mg             171   3e-47   
ref|XP_008220156.1|  PREDICTED: transcription factor MYB44-like         171   4e-47   
ref|XP_002439611.1|  hypothetical protein SORBIDRAFT_09g016570          174   4e-47   
ref|XP_004308944.1|  PREDICTED: myb-related protein A-like              171   5e-47   
ref|XP_006434842.1|  hypothetical protein CICLE_v10002239mg             171   5e-47   
ref|XP_010920799.1|  PREDICTED: transcription factor MYB44-like         171   8e-47   
ref|XP_010526144.1|  PREDICTED: transcriptional activator Myb-like      169   8e-47   
gb|KEH25080.1|  disease resistance protein (TIR-NBS-LRR class), p...    182   9e-47   
ref|XP_002284237.1|  PREDICTED: transcription factor MYB44              169   9e-47   
ref|XP_009387830.1|  PREDICTED: transcription factor MYB44-like         170   1e-46   
ref|XP_009412621.1|  PREDICTED: transcription factor MYB44-like         170   1e-46   
ref|XP_004141241.1|  PREDICTED: myb-related protein A-like              169   1e-46   
ref|XP_009600873.1|  PREDICTED: transcription factor MYB44-like         172   1e-46   
ref|XP_008239060.1|  PREDICTED: transcription factor MYB44              172   1e-46   
emb|CCA29104.1|  putative MYB transcription factor                      170   1e-46   
gb|AGN52029.1|  MYB-related transcription factor                        169   1e-46   
emb|CCA29118.1|  putative MYB transcription factor                      170   2e-46   
ref|XP_006843647.1|  hypothetical protein AMTR_s00007p00169630          171   2e-46   
ref|XP_009370160.1|  PREDICTED: transcriptional activator Myb-like      169   2e-46   
ref|XP_008378059.1|  PREDICTED: transcriptional activator Myb-like      170   4e-46   
ref|XP_004291141.1|  PREDICTED: transcription factor MYB98-like         169   4e-46   
ref|XP_003549412.2|  PREDICTED: myb-like protein A-like                 169   4e-46   
ref|XP_004173919.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    168   4e-46   
ref|XP_009400144.1|  PREDICTED: transcription factor MYB44-like         169   5e-46   
ref|XP_010937896.1|  PREDICTED: transcription factor MYB44-like         169   5e-46   
ref|XP_008374172.1|  PREDICTED: transcriptional activator Myb-like      168   1e-45   
emb|CDP06538.1|  unnamed protein product                                171   2e-45   
gb|EPS60436.1|  hypothetical protein M569_14368                         168   2e-45   
ref|XP_009407576.1|  PREDICTED: myb-like protein AA                     170   3e-45   
ref|XP_008369404.1|  PREDICTED: transcription factor MYB23-like         166   3e-45   
ref|XP_011084888.1|  PREDICTED: transcriptional activator Myb-like      166   4e-45   
ref|XP_009367403.1|  PREDICTED: transcriptional activator Myb-like      166   4e-45   
ref|XP_008352004.1|  PREDICTED: transcription factor MYB44-like         166   4e-45   
ref|NP_001044814.1|  Os01g0850400                                       170   5e-45   
ref|XP_009416214.1|  PREDICTED: myb-related protein 315-like            170   5e-45   
gb|EAY76504.1|  hypothetical protein OsI_04445                          170   5e-45   
ref|XP_008785463.1|  PREDICTED: myb-like protein Q                      169   7e-45   
ref|NP_001141619.2|  MYB transcription factor                           169   7e-45   
ref|XP_008649548.1|  PREDICTED: transcription factor MYB48-like         169   9e-45   
ref|XP_002489094.1|  hypothetical protein SORBIDRAFT_0088s002210        167   1e-44   
ref|XP_002458769.1|  hypothetical protein SORBIDRAFT_03g039950          169   1e-44   
ref|XP_003616662.1|  Myb transcription factor                           166   1e-44   
ref|XP_010504436.1|  PREDICTED: myb-related protein B-like              169   1e-44   
ref|XP_010923173.1|  PREDICTED: myb-like protein Q                      168   1e-44   
ref|XP_004246368.1|  PREDICTED: myb-related protein 315                 168   1e-44   
ref|XP_006645018.1|  PREDICTED: uncharacterized protein LOC102712209    169   2e-44   
ref|XP_008792655.1|  PREDICTED: transcription factor MYB44-like         165   2e-44   
ref|XP_008805112.1|  PREDICTED: myb-related protein B-like              164   2e-44   
ref|XP_006291267.1|  hypothetical protein CARUB_v10017397mg             168   2e-44   
ref|XP_009402306.1|  PREDICTED: myb-like protein AA                     167   2e-44   
ref|XP_006363093.1|  PREDICTED: myb-like protein AA-like                168   2e-44   
ref|XP_004970585.1|  PREDICTED: myb-related protein 306-like            168   2e-44   
gb|EYU25387.1|  hypothetical protein MIMGU_mgv1a013005mg                164   2e-44   
ref|XP_003545242.1|  PREDICTED: myb-related protein 306-like            167   4e-44   
ref|XP_010931159.1|  PREDICTED: trichome differentiation protein ...    167   4e-44   
gb|KHN20881.1|  Transcription factor MYB44                              167   4e-44   
ref|XP_010427363.1|  PREDICTED: myb-related protein B-like              168   4e-44   
ref|XP_002276375.1|  PREDICTED: uncharacterized protein LOC100256309    167   4e-44   
ref|XP_009783755.1|  PREDICTED: myb-related protein B-like              167   4e-44   
ref|XP_010516160.1|  PREDICTED: myb-like protein A                      167   5e-44   
ref|XP_002527890.1|  r2r3-myb transcription factor, putative            167   5e-44   
ref|XP_009613649.1|  PREDICTED: myb-related protein B                   166   5e-44   
ref|XP_010256736.1|  PREDICTED: uncharacterized protein LOC104597...    168   5e-44   
emb|CBI19574.3|  unnamed protein product                                169   6e-44   
ref|XP_011094946.1|  PREDICTED: uncharacterized protein LOC105174515    167   7e-44   
gb|KDP24518.1|  hypothetical protein JCGZ_25082                         167   7e-44   
ref|XP_008674458.1|  PREDICTED: transcription factor MYB44-like         163   7e-44   
gb|AGN52077.1|  MYB-related transcription factor                        166   8e-44   
ref|XP_007160819.1|  hypothetical protein PHAVU_001G019200g             160   1e-43   
ref|XP_008448879.1|  PREDICTED: transcription factor MYB86              166   1e-43   
gb|EYU43428.1|  hypothetical protein MIMGU_mgv1a012392mg                162   1e-43   
ref|XP_004162756.1|  PREDICTED: uncharacterized LOC101212170            166   1e-43   
ref|XP_004147900.1|  PREDICTED: uncharacterized protein LOC101212170    166   1e-43   
ref|XP_010922579.1|  PREDICTED: transcription factor MYB44-like         162   1e-43   
ref|XP_010648804.1|  PREDICTED: transcription factor MYB44-like         163   1e-43   
gb|AHB59593.1|  putative R2R3 MYB protein 5                             165   1e-43   
ref|XP_006297844.1|  hypothetical protein CARUB_v10013882mg             166   2e-43   
ref|XP_006407701.1|  hypothetical protein EUTSA_v10021963mg             166   2e-43   
ref|XP_006435568.1|  hypothetical protein CICLE_v10031463mg             167   2e-43   
ref|XP_007205315.1|  hypothetical protein PRUPE_ppa006851mg             166   2e-43   
ref|XP_006486452.1|  PREDICTED: uncharacterized protein LOC102618168    167   2e-43   
ref|XP_010101850.1|  Transcription factor                               166   2e-43   
gb|KDO69257.1|  hypothetical protein CISIN_1g012494mg                   167   2e-43   
ref|XP_003566355.1|  PREDICTED: transcription factor MYB44-like         163   2e-43   
ref|XP_009615291.1|  PREDICTED: transcription factor MYB122-like        166   2e-43   
gb|KHG04525.1|  Transcription factor MYB44 -like protein                166   2e-43   
emb|CDX72208.1|  BnaC08g26660D                                          165   2e-43   
ref|XP_009781248.1|  PREDICTED: transcription factor MYB122-like        166   2e-43   
gb|KFK34814.1|  hypothetical protein AALP_AA5G196700                    165   3e-43   
ref|XP_010262707.1|  PREDICTED: uncharacterized protein LOC104601164    166   4e-43   
ref|XP_006848033.1|  hypothetical protein AMTR_s00029p00183640          164   4e-43   
ref|XP_008239931.1|  PREDICTED: uncharacterized protein LOC103338495    165   4e-43   
gb|EYU41812.1|  hypothetical protein MIMGU_mgv1a023010mg                164   4e-43   
ref|XP_010464561.1|  PREDICTED: myb-related protein B-like              164   5e-43   
ref|XP_010690407.1|  PREDICTED: uncharacterized protein LOC104903953    165   6e-43   
ref|XP_006403424.1|  hypothetical protein EUTSA_v10010431mg             164   6e-43   
ref|XP_009116273.1|  PREDICTED: uncharacterized protein LOC103841480    164   6e-43   
gb|EPS67829.1|  hypothetical protein M569_06945                         158   6e-43   
emb|CBH32525.1|  Myb-like DNA-binding domain containing protein,e...    166   6e-43   
gb|KFK38309.1|  hypothetical protein AALP_AA3G097200                    163   7e-43   
ref|XP_010232563.1|  PREDICTED: uncharacterized protein LOC100827463    166   7e-43   
gb|KEH28952.1|  myb transcription factor                                163   8e-43   
ref|XP_010239722.1|  PREDICTED: transcription factor MYB44-like         161   8e-43   
gb|AAS10070.1|  MYB transcription factor                                164   8e-43   
ref|NP_191132.1|  myb domain protein 109                                164   8e-43   
emb|CDY27271.1|  BnaA09g35310D                                          163   1e-42   
ref|XP_010533876.1|  PREDICTED: myb-related protein Myb4-like           162   1e-42   
ref|XP_010470301.1|  PREDICTED: myb-related protein B-like              164   1e-42   
ref|XP_009351142.1|  PREDICTED: myb-related protein 306-like            164   1e-42   
ref|XP_011038690.1|  PREDICTED: transcriptional activator Myb-like      164   1e-42   
ref|XP_004964242.1|  PREDICTED: transcriptional activator Myb-like      160   1e-42   
ref|XP_010031265.1|  PREDICTED: myb-related protein B                   164   1e-42   
gb|KDP44844.1|  hypothetical protein JCGZ_01344                         164   1e-42   
ref|NP_001055277.1|  Os05g0350900                                       161   1e-42   
ref|XP_010486483.1|  PREDICTED: myb protein-like                        163   2e-42   
ref|XP_011036027.1|  PREDICTED: transcription factor MYB76-like         163   2e-42   
ref|XP_010543715.1|  PREDICTED: transcription factor MYB44-like         157   2e-42   
ref|XP_002315183.2|  hypothetical protein POPTR_0010s20220g             163   2e-42   
ref|XP_008233695.1|  PREDICTED: transcription factor RAX2-like          164   2e-42   
ref|XP_010037759.1|  PREDICTED: myb-related protein A                   162   3e-42   
ref|XP_008392894.1|  PREDICTED: myb-related protein 306-like            162   3e-42   
ref|XP_002276341.1|  PREDICTED: transcription factor RAX1               162   3e-42   
ref|XP_006646750.1|  PREDICTED: transcriptional activator Myb-like      157   3e-42   
ref|XP_007009127.1|  Myb domain protein 25, putative                    162   3e-42   
ref|XP_008388098.1|  PREDICTED: transcription factor MYB44-like         162   4e-42   
ref|XP_007026835.1|  R2r3-myb transcription factor, putative            162   4e-42   
ref|XP_010558349.1|  PREDICTED: myb-like protein Q                      162   5e-42   
gb|EAY77443.1|  hypothetical protein OsI_05437                          157   9e-42   
ref|XP_009346994.1|  PREDICTED: myb-related protein 306-like            161   9e-42   
ref|XP_003520943.1|  PREDICTED: transcription factor MYB44-like         160   9e-42   
ref|NP_001045573.1|  Os01g0977300                                       157   9e-42   
emb|CDP14078.1|  unnamed protein product                                161   1e-41   
ref|XP_006480929.1|  PREDICTED: myb-related protein B-like              160   1e-41   
gb|KHG29583.1|  Transcription factor MYB44 -like protein                161   1e-41   
ref|XP_002878045.1|  hypothetical protein ARALYDRAFT_486007             160   1e-41   
ref|XP_002882609.1|  ATMYB1                                             160   1e-41   
gb|AGN52047.1|  MYB-related transcription factor                        161   1e-41   
ref|XP_006429252.1|  hypothetical protein CICLE_v10012003mg             160   1e-41   
gb|KDO58018.1|  hypothetical protein CISIN_1g017566mg                   160   1e-41   
ref|XP_010534544.1|  PREDICTED: transcription factor MYB86-like         159   2e-41   
ref|XP_010553060.1|  PREDICTED: transcription factor MYB44              160   2e-41   
ref|NP_187534.1|  myb domain protein 1                                  160   2e-41   
ref|XP_003516915.1|  PREDICTED: myb protein-like                        159   2e-41   
gb|ADL36766.1|  MYB domain class transcription factor                   160   2e-41   
ref|XP_008345508.1|  PREDICTED: transcription factor MYB59-like         160   3e-41   
ref|XP_008370028.1|  PREDICTED: transcription factor MYB59-like         159   3e-41   
gb|AAZ20427.1|  MYB2                                                    159   4e-41   
ref|XP_006355677.1|  PREDICTED: myb-related protein B-like              159   4e-41   
ref|NP_001288045.1|  transcription factor MYB86-like                    159   5e-41   
ref|XP_011076754.1|  PREDICTED: uncharacterized protein LOC105160924    160   5e-41   
ref|XP_009344337.1|  PREDICTED: transcription factor MYB86-like         159   8e-41   
ref|XP_010106095.1|  Transcription factor                               159   9e-41   
dbj|BAK05308.1|  predicted protein                                      155   1e-40   
ref|XP_004239924.1|  PREDICTED: transcription factor MYB39              157   1e-40   
ref|XP_006575526.1|  PREDICTED: transcription factor MYB104-like        158   2e-40   
gb|EEC79030.1|  hypothetical protein OsI_19572                          154   3e-40   
gb|KCW50449.1|  hypothetical protein EUGRSUZ_J00189                     152   3e-40   
ref|XP_004307600.1|  PREDICTED: myb protein-like                        157   4e-40   
emb|CDY20494.1|  BnaC04g05500D                                          154   1e-39   
emb|CAE00856.1|  MYBY1 protein                                          151   2e-39   
ref|XP_006294397.1|  hypothetical protein CARUB_v10023414mg             154   3e-39   
ref|XP_009123435.1|  PREDICTED: myb protein-like                        154   4e-39   
gb|AEI89704.1|  transcription factor MYB1 protein                       154   4e-39   
ref|XP_010256737.1|  PREDICTED: uncharacterized protein LOC104597...    154   4e-39   
ref|XP_002881682.1|  predicted protein                                  153   5e-39   
gb|EPS64975.1|  hypothetical protein M569_09804                         150   8e-39   
ref|XP_010505683.1|  PREDICTED: uncharacterized protein LOC104782447    153   8e-39   
ref|XP_010508952.1|  PREDICTED: uncharacterized protein LOC104785436    153   8e-39   
gb|KHN13094.1|  Myb-related protein B                                   154   8e-39   
ref|XP_009143276.1|  PREDICTED: myb-like protein AA                     152   9e-39   
ref|XP_010517362.1|  PREDICTED: uncharacterized protein LOC104792825    153   9e-39   



>ref|XP_008236375.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=302

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 145/298 (49%), Positives = 186/298 (62%), Gaps = 36/298 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS +ED+ L++LV+ HGARNWSLISKS+PGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  19   DRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCNQLSPEVEHRAFT  78

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE+IA  HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK+SA+ G+++G      
Sbjct  79   PEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSAISGNDDGATIDDN  138

Query  600  RILKRADSADVTVT--------AAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP  445
             +     +A   V+         +P G  V              +D+G  A+ S  +  P
Sbjct  139  HVRPEKKTATAAVSFSGLCYSPGSPSGSDV--------------SDSGAPAISSSHVFRP  184

Query  444  LQAVEPRLVSE---KEND-------PSTVLTLSLPAPGSNDGVS-SLQRDQPSYRRGDST  298
            +      L  E    +ND       PST+LTLSL  PG +D  S  L   + + RR + T
Sbjct  185  VARTGGVLTRESPPSQNDSKNEAHEPSTLLTLSL--PGVDDTPSHELPILESAARRVEGT  242

Query  297  EAAAPAPVKsestltlspellsLMQDMIRKEVETYYSALVIK-DGVRNAEVKRIGLGK  127
             +  P    + +T++   E LS+MQ+MIR EV +Y   + +  +GVRNA VKRI + K
Sbjct  243  ASLQPETSNAGNTMSFGTEFLSVMQEMIRTEVRSYMEGMCLHSEGVRNAGVKRIAIRK  300



>ref|XP_007199299.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
 gb|EMJ00498.1| hypothetical protein PRUPE_ppa023154mg [Prunus persica]
Length=292

 Score =   237 bits (605),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 186/290 (64%), Gaps = 20/290 (7%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS +ED+ L++LV+ HGARNWSLISKS+PGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  9    DRVKGPWSPDEDEKLRQLVQHHGARNWSLISKSVPGRSGKSCRLRWCNQLSPEVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE+IA  HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK+SA+ G+++G  P   
Sbjct  69   PEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSAISGNDDG--PTID  126

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
                R +    T   +  GL      S  S      +D+G  A+ S  +  P+      L
Sbjct  127  DNHFRPEKKTATAAVSFSGL----CYSPGSPSGSDVSDSGAPAISSSHVFRPVARTGGVL  182

Query  420  VSE---KEND-------PSTVLTLSLPAPGSNDGVS-SLQRDQPSYRRGDSTEAAAPAPV  274
              E    +ND       PST+LTLSL  PG +D  S  L   + + RR + T +  P   
Sbjct  183  TRESPPSQNDRKNEAHEPSTLLTLSL--PGVDDTPSHELPVLESAARRVEGTASLQPETS  240

Query  273  KsestltlspellsLMQDMIRKEVETYYSALVIK-DGVRNAEVKRIGLGK  127
             + +TL+   E LS+MQ+MIR EV +Y   + +  +GVRNA VKRI + K
Sbjct  241  NAGNTLSFGTEFLSVMQEMIRTEVRSYMEGMCLHSEGVRNAGVKRIAISK  290



>ref|XP_008373085.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=302

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 144/291 (49%), Positives = 188/291 (65%), Gaps = 23/291 (8%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS +ED+ L+++V+++GARNWS+ISKS+PGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  20   DRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCNQLSPEVEHRAFT  79

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE+IA  HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK+SA+  + +G     G
Sbjct  80   PEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSALSPNEDGATIDEG  139

Query  600  --RILKRADSADVTVT------AAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP  445
              R  K+A +A V+ +       +P G  VS      S  S         A    R + P
Sbjct  140  ILRPEKKAATAAVSFSGLCYSPGSPSGSDVSESDVPASSSSQVFRPVARTAAIVTRESPP  199

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAP---V  274
             Q         +  +PST+LTLSL  PG+   +  L  ++ +  RG  T +  P     V
Sbjct  200  SQT--------EWCEPSTLLTLSL--PGAESALHELPTNESAPHRGQRTASLQPEKETNV  249

Query  273  KsestltlspellsLMQDMIRKEVETYY--SALVIKDGVRNAEVKRIGLGK  127
             + +T++  PE +S+MQ+MIRKEV +Y   +A    +GVRNA VKRIG+ +
Sbjct  250  NNSNTMSFGPEFMSVMQEMIRKEVRSYMEGAACSQGEGVRNAGVKRIGISR  300



>ref|XP_007155887.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
 gb|ESW27881.1| hypothetical protein PHAVU_003G240200g [Phaseolus vulgaris]
Length=289

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 141/294 (48%), Positives = 186/294 (63%), Gaps = 25/294 (9%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLVE+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  8    DMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE-----  622
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++ + +     
Sbjct  68   FTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMNAEDPAAAA  127

Query  621  -GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP  445
             G  P+P   LKR+ SA     A PPG       S        ++  G  +   V   +P
Sbjct  128  AGYSPQP---LKRSVSAGA---ALPPG-------SPSGSDVSETSAPGVVSPSHVFRPVP  174

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPS-YRRGDSTEAAAPAPVKs  268
            ++ V     S +++ P+T L+LSLP   S++  +     Q + +  G  T  A PA    
Sbjct  175  VRPVVETASSCEDDGPTTSLSLSLPGVESSEASNRATAMQANPFAIGPVTNVAIPAAEVG  234

Query  267  estltlspellsLMQDMIRKEVETYY---SALVIK--DGVRNAEVKRIGLGKTN  121
               L LS E +++M +MI+KEV +Y    S +  +  DG RNA VKRIG+ + +
Sbjct  235  MGALNLSAEFMAVMHEMIKKEVRSYMEQQSGMCFQGVDGFRNASVKRIGISRVD  288



>gb|ADL36760.1| MYB domain class transcription factor [Malus domestica]
Length=289

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/291 (49%), Positives = 187/291 (64%), Gaps = 23/291 (8%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS +ED+ L+++V+++GARNWS+ISKS+PGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  7    DRVKGPWSPDEDEKLRQIVQRYGARNWSVISKSVPGRSGKSCRLRWCNQLSPEVEHRAFT  66

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE+IA  HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK+SA+  + +G     G
Sbjct  67   PEEDEIIAGAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSALSPNEDGATIDEG  126

Query  600  --RILKRADSADVTVT------AAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP  445
              R  K+  +A V+ +       +P G  VS      S  S         A    R + P
Sbjct  127  ILRPEKKTATAAVSFSGLCYSPGSPSGSDVSESDVPASSSSQVFRPVARTAAIVTRESPP  186

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAP---V  274
             Q         +  +PST+LTLSL  PG+   +  L  ++ +  RG  T +  P     V
Sbjct  187  SQT--------EWCEPSTLLTLSL--PGAESALHELPTNESAPHRGQRTASLQPEKETNV  236

Query  273  KsestltlspellsLMQDMIRKEVETYY--SALVIKDGVRNAEVKRIGLGK  127
             + +T++  PE +S+MQ+MIRKEV +Y   +A    +GVRNA VKRIG+ +
Sbjct  237  NNSNTMSFGPEFMSVMQEMIRKEVRSYMEGAACSQGEGVRNAGVKRIGISR  287



>ref|XP_011088207.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=286

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 184/294 (63%), Gaps = 31/294 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+LL+KLV++HGARNWSLIS+SIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  9    DRIKGPWSPEEDELLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPEVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             +EDE+I K HAQ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK++A   +   GE R  
Sbjct  69   ADEDEIILKAHAQFGNKWATIARLLNGRTDNAIKNHWNSTLKRKFAAETAAVGVGEERLA  128

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQA---VE  430
            ++L+R  S DV+ TA   G                S+ +   +  +V+ + PL     V 
Sbjct  129  QVLRRTGSGDVS-TAMTNGF--------SPQSLCPSDSDTCDSGNNVKFSFPLPTNALVL  179

Query  429  PRLVSEKENDPS---TVLTLSLPAPGSNDGV--------SSLQRDQPSYRRGDSTEAAAP  283
            PR  +  E +     T LTL LP  GS+  V        ++     PS+ R      AA 
Sbjct  180  PRAAAADEENSDGELTALTLCLPGTGSDSSVKMTGEKDSTATALTHPSHHR---LSHAAE  236

Query  282  APVKsestltlspellsLMQDMIRKEVETYYSALVIKDGVRNAEVKRIGLGKTN  121
              +K +  L+L PELL++MQ+MIR EV  Y S     + +  A VKRIG+ K N
Sbjct  237  VDLK-KKRLSLGPELLAVMQEMIRTEVRNYLSE---HEEIIPA-VKRIGISKLN  285



>gb|KDP45901.1| hypothetical protein JCGZ_15461 [Jatropha curcas]
 gb|AIT52203.1| MYB family protein [Jatropha curcas]
Length=267

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 168/271 (62%), Gaps = 26/271 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED LL+K V++HGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT
Sbjct  8    DRVKGPWSPEEDQLLQKFVQRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  67

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR--  607
            PEEDE+I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKYSA + S +G   R  
Sbjct  68   PEEDEIIINAHAKQGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSAAM-SEDGTTDRLQ  126

Query  606  -PGRILKRADSADVTVTAAPPGLRVs-----rdsssdsdisyssnDNGPAAVRSVRLALP  445
             P R  K A       + +P G  VS       SSS       +  +  A V +  L+  
Sbjct  127  PPAR--KFAKITSFCNSPSPSGSDVSDVGLPVTSSSSHHNQEQNLFHRRAGVMTTPLSYQ  184

Query  444  LQAVEPRLVSEKENDP--STVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVK  271
            +++  PR  SE  ND   ST LTLSLP  G          +  S R  DS E     P+K
Sbjct  185  VESTPPR-ESETSNDDDLSTELTLSLPGKG-------FYGELLSRRESDSQE----LPIK  232

Query  270  sestltlsp-ellsLMQDMIRKEVETYYSAL  181
                      E L++MQ+MIRKEV  Y + +
Sbjct  233  CIEKTMTFKPEFLTVMQEMIRKEVRNYMAGV  263



>ref|XP_006487005.1| PREDICTED: transcription factor MYB44-like [Citrus sinensis]
Length=252

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 141/288 (49%), Positives = 174/288 (60%), Gaps = 49/288 (17%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+RVKGPWS EED LL KLV+++GARNWS+ISKSIPGRSGKSCRLRWCNQLSPEVEHR F
Sbjct  7    SERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTF  66

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI------GSNE  622
            TP+EDE+I K HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKY+         G +E
Sbjct  67   TPDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDE  126

Query  621  GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL  442
              E    R  KR+  +   ++ +P G  VS                           LP+
Sbjct  127  DSEDSDEREKKRSAVSVSGISCSPSGSDVSDS------------------------GLPV  162

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQR-DQPSYRRGDSTEAAAPAPVKse  265
            +  E      +  D ST LTL LP       V+ L++ D  S R  DS +       K+ 
Sbjct  163  RVFESESRYNEVFDVSTDLTLGLP-------VTELKKCDSVSQRENDSDDD------KTS  209

Query  264  stltlspellsLMQDMIRKEVETYYSALVIKDGVRNAEVKRIGLGKTN  121
            +T +  PE LS+MQ+MIR EV  Y     +++ VRNA  KRIG+ K +
Sbjct  210  NTPSFGPEFLSVMQEMIRNEVRNY-----MEEAVRNAGFKRIGISKID  252



>ref|NP_001268121.1| sucrose responsive element binding protein [Vitis vinifera]
 gb|AAY28930.1| sucrose responsive element binding protein [Vitis vinifera]
Length=312

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 184/310 (59%), Gaps = 36/310 (12%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D+DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DADRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK SA+      G   
Sbjct  67   FTSEEDDTIMRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSAITEDGSFGGDY  126

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ---A  436
            P   LKR+ SA      +  GL +S  S   SD+S SS       V S  +  P+     
Sbjct  127  PPHPLKRSVSAGAAAPVS--GLYLSPSSPCGSDVSDSSL----PVVSSSHVYRPVARTGG  180

Query  435  VEPRLVSEKENDPSTVLTLSLP----------APGSNDG--------VSSLQRDQPSYRR  310
            + P   +   NDP T L+LSLP          AP  N          + ++   Q     
Sbjct  181  IIPPETTSSSNDPPTSLSLSLPGVDSCEVSNRAPEPNHAPPANPIQMIPTMAPLQQIPMH  240

Query  309  GDSTEAAAPAPVKsestl---tlspellsLMQDMIRKEVETYYSAL------VIKDGVRN  157
              +  A  PA V S+        S ELL++MQ+MIRKEV  Y + L      +  DG+RN
Sbjct  241  QHNQPATVPATVLSQGEKPFIPFSAELLAVMQEMIRKEVRNYTAGLEQNGVCLQADGIRN  300

Query  156  AEVKRIGLGK  127
            A VKRIG+ K
Sbjct  301  AAVKRIGISK  310



>ref|XP_003524661.1| PREDICTED: transcription factor MYB44 [Glycine max]
Length=295

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 142/302 (47%), Positives = 183/302 (61%), Gaps = 35/302 (12%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLVE+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  8    DMDRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK ++ + + +     
Sbjct  68   FTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMMAGDEAVAV  127

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV----RSVRLALPLQ  439
              R LKR+ SA   V   PPG             S  S  + P  V      V   +P++
Sbjct  128  SPRPLKRSFSAGAAVP--PPG---------SPSGSDFSESSAPGVVSVSPSHVFRPVPVR  176

Query  438  AVEPRLVSEKEND---PSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKs  268
             +     S+ + D   P+T L+LSLP   S + +S+     P          AAPAPV +
Sbjct  177  PIVETASSQDDADDAGPATSLSLSLPGVESAE-ISNRATTVPVM---PVNTVAAPAPVPA  232

Query  267  es---tltlspellsLMQDMIRKEVETY----------YSALVIKDGVRNAEVKRIGLGK  127
            E     L LS E +++M +MIRKEV +Y          +  + + +G RN  VKRIG+ +
Sbjct  233  EVGLGALNLSGEFMAVMHEMIRKEVRSYMEQQKNGMMCFQGMEMMEGFRNVSVKRIGISR  292

Query  126  TN  121
             +
Sbjct  293  VD  294



>ref|XP_010271172.1| PREDICTED: transcription factor MYB44-like [Nelumbo nucifera]
Length=329

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 185/326 (57%), Gaps = 51/326 (16%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DVDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEEDE I K HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+V   + G +  
Sbjct  67   FTPEEDETIIKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSVT-EDSGVDGH  125

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
              + LKR+ SA   +   PP   +   S S    S  S+ + P  + S  +  P+     
Sbjct  126  ASQPLKRSVSAGAAI---PPVSALYLSSPSSPSGSDVSDSSLP-VMSSSHVYRPVARTGG  181

Query  426  RL-----------VSEKENDPSTVLTLSLPA-------------------PGSNDGVSS-  340
             L            S   NDP T L+LSLP                    P ++  VS  
Sbjct  182  ILPPQQPPQPQLETSSSTNDPPTCLSLSLPGADSCEVSNHVSGSNHAPNPPNTSHLVSPL  241

Query  339  ---------LQRDQPSYRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYS  187
                     LQ+  P+       E A+PA    +  +  S E LS+M +MI+KEV  Y S
Sbjct  242  SLPPPAAVLLQQVSPAPHHTQFNEFASPAGPVEKPFMPFSTEFLSVMHEMIKKEVRNYMS  301

Query  186  ALVIK------DGVRNAEVKRIGLGK  127
             L  K      DG+RNA VKRIG+ K
Sbjct  302  GLEQKGLCLQADGIRNAAVKRIGISK  327



>ref|XP_002285389.1| PREDICTED: transcription factor MYB44 [Vitis vinifera]
Length=303

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 141/299 (47%), Positives = 177/299 (59%), Gaps = 23/299 (8%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DRVKGPWS +ED  L+ LV+++GARNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    EADRVKGPWSPQEDQALQCLVKRYGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS-------  628
            FTPEED  I + HA+ GNKWATIARMLNGRTDNAIKNHWNSTLKRK++A I         
Sbjct  67   FTPEEDRRIIEAHAKYGNKWATIARMLNGRTDNAIKNHWNSTLKRKFAAEIEQVPAPVSV  126

Query  627  -NEGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLA  451
             NEG  P   +      S   T     PG     D S       SS +      R+  + 
Sbjct  127  DNEGSRPEKRQSSGGGPSMPATGLCLSPGSPTGSDVSDTGFPVVSSPNLYRPVARTGAVQ  186

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLPAPGS--NDGVSSLQRDQPSYRRGDSTE---AAA  286
            +P Q  EP   S K++DP T LTLSLP   +  N+  S      P + +  S E   A  
Sbjct  187  VPPQQFEP---SSKKDDPPTALTLSLPGTETYENEYESPPLDSAPRHNKLASPEKQPALT  243

Query  285  PAPVKsestltlspellsLMQDMIRKEVETYYSALVIKD-------GVRNAEVKRIGLG  130
             A  ++   +T   +   ++QDMI+ EV+ Y S L I +        +RNA + RIG+G
Sbjct  244  FAMPENPEPMTFGSDFFLMIQDMIKTEVKNYMSGLEINEICSQSEGNIRNAAINRIGMG  302



>ref|NP_001238087.1| MYB transcription factor MYB50 [Glycine max]
 gb|ABH02824.1| MYB transcription factor MYB50 [Glycine max]
 gb|KHN12962.1| Transcription factor MYB44 [Glycine soja]
Length=297

 Score =   222 bits (565),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 179/308 (58%), Gaps = 41/308 (13%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ +  ++  +P   
Sbjct  62   AEEDDTIIRAHARFGNKWATIARLLHGRTDNAIKNHWNSTLKRKCSSTM-IDDNTQP---  117

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS-VRLALP--LQAVE  430
              LKR+ SA   +  +  GL ++  +      S  S  + P A  S V   +P  ++ + 
Sbjct  118  --LKRSVSAGAAIPVS-TGLYMNPPTPGSPSGSDVSESSLPVASSSHVFRPVPRTVKVLP  174

Query  429  PRLVSEKENDPSTVLTLSLPAPG-------SNDGVSSLQRDQPSYRRGD---------ST  298
            P   +   NDP T L+LSLP  G       SN     +    P   R +         S 
Sbjct  175  PVETTSSSNDPPTSLSLSLPGVGVVDSSEVSNRTTEPIHFTPPMPHRSNTMPLLPMMTSV  234

Query  297  EAAAPAPVKsestltlspellsLMQDMIRKEVETYYS---------ALVIKDGVRNAEVK  145
             A   AP         S E  S+MQ+MIRKEV +Y              + DG RNA VK
Sbjct  235  SATVMAPFN------FSAEFRSVMQEMIRKEVRSYIELHNQNGMCFQAAVNDGFRNASVK  288

Query  144  RIGLGKTN  121
            RIG+ + +
Sbjct  289  RIGISRVD  296



>ref|NP_001235715.1| MYB transcription factor MYB68 [Glycine max]
 gb|ABH02831.1| MYB transcription factor MYB68 [Glycine max]
Length=259

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/284 (47%), Positives = 167/284 (59%), Gaps = 34/284 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV+ +G RNWS+ISKSIPGRSGKSCRLRWCNQLSPEVE RPFT
Sbjct  2    DRIKGPWSPEEDEALRRLVQTYGPRNWSVISKSIPGRSGKSCRLRWCNQLSPEVERRPFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EEDE I K HA+ GNKWATIAR LNGRTDNAIKNHWNSTLKRK S  +      EPRP 
Sbjct  62   AEEDEAILKAHARFGNKWATIARFLNGRTDNAIKNHWNSTLKRKCSEPL-----SEPRP-  115

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
              LKR+     TV+ +  G  +S                     RSV + +         
Sbjct  116  --LKRS----ATVSGSQSGSDLSDSGLPI------------ILARSVSVTVAPSNHLAET  157

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltlspe  241
             S    DP+T+L+LSLP   S DG +    + P   +G S       P+        S E
Sbjct  158  ASSSVTDPATLLSLSLPGFDSCDGAN----NGPGPNQGPSCGPFQEIPMLGSQKQLFSQE  213

Query  240  llsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGK  127
             + +MQ+MIR EV  Y S L      +  D +RN+ ++R+G+G+
Sbjct  214  FMKVMQEMIRVEVRNYMSVLERNGVCMQTDAIRNSVLERMGIGR  257



>ref|XP_010244270.1| PREDICTED: transcription factor MYB44 [Nelumbo nucifera]
Length=330

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 183/328 (56%), Gaps = 55/328 (17%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  8    DQDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI--GSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++   GS +G  
Sbjct  68   FTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTDEGSVDGHV  127

Query  612  PRPGRILKRADSADVTVTAAPP----GLRVsrdsssdsdisyssnDNGPAAV-RSVR---  457
             +P   LKR+ SA   +   PP     L      S       S     P+ V R V    
Sbjct  128  NQP---LKRSVSAGAAI---PPVSALYLSSPSSPSGSDVSDSSLPVISPSHVYRPVARTG  181

Query  456  --LALPLQAVEPRLVSEKENDPSTVLTLSLPA----------PGSNDGV---------SS  340
              L    Q       S   NDP T L+LSLP           PGSN            SS
Sbjct  182  GILPPQQQQQPQLETSSSTNDPPTSLSLSLPGADSCEASNHVPGSNHATNPSQPSQLASS  241

Query  339  L-----------QRDQPSYRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETY  193
            L           Q  QP +   +  E A  AP   +  +   PE LS+MQ+MI+KEV  Y
Sbjct  242  LSLPPPTVVPLQQVSQPPHHT-EYNEFATSAPPAEKPFMPFCPEFLSVMQEMIKKEVRNY  300

Query  192  YSAL------VIKDGVRNAEVKRIGLGK  127
               L         DG+RNA VKRIG+ K
Sbjct  301  MLGLEQNGLCFRADGIRNAVVKRIGISK  328



>ref|XP_010095320.1| Transcription factor [Morus notabilis]
 gb|EXB59531.1| Transcription factor [Morus notabilis]
Length=304

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 147/302 (49%), Positives = 183/302 (61%), Gaps = 25/302 (8%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI----GSNEGGE  613
            P+EDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S +     G    G 
Sbjct  62   PDEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSTMFDDCNGHGYDGS  121

Query  612  PRPGRILKRADSADVTVTAAPPGLRVs---rdsssdsdisyssnDNGPAAVRSVRLALPL  442
                + LKR+ SA   +  +  GL +S      S  SD S     + P++    R     
Sbjct  122  FAAQQPLKRSVSAGSAMPVS-TGLFMSPGSPSGSDVSDSSVPVVISPPSSSYVYRPVART  180

Query  441  QAVEPRLV--SEKENDPSTVLTLSLPAPGSNDGVSSLQRDQP---SYRRGDSTEAAAPA-  280
             AV P  V  +   NDP T L+LSLP   S D   +     P   ++    +   AAPA 
Sbjct  181  GAVLPPPVEAASSSNDPPTSLSLSLPGVDSCDSNQNASSPLPPTVNFLTAVTPSTAAPAL  240

Query  279  --PVKsestltlspellsLMQDMIRKEVETYYSALVIK---------DGVRNAEVKRIGL  133
                ++ + +  S ELL++MQ+MIRKEV +Y + L  +         DG RN  VKRIG+
Sbjct  241  ASDAENGAFVPFSQELLAVMQEMIRKEVRSYMAGLEQQSNNGVCSAVDGFRNVAVKRIGI  300

Query  132  GK  127
             K
Sbjct  301  SK  302



>gb|KDO59816.1| hypothetical protein CISIN_1g040502mg [Citrus sinensis]
Length=252

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 137/288 (48%), Positives = 169/288 (59%), Gaps = 49/288 (17%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+RVKGPWS EED LL KLV+++GARNWS+ISKSIPGRSGKSCRLRWCNQLSPEVEHR F
Sbjct  7    SERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTF  66

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI------GSNE  622
            TP+EDE+I K HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKY+         G +E
Sbjct  67   TPDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDE  126

Query  621  GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL  442
              E    R  KR+  +   ++ +P G  VS                           LP+
Sbjct  127  DSEDSDEREKKRSAVSVSGISCSPSGSDVSDS------------------------GLPV  162

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQR-DQPSYRRGDSTEAAAPAPVKse  265
            +  E      +  D ST LTL LP       V+ L++ D  S +  +S +       K+ 
Sbjct  163  RVFESECRYNEVFDVSTDLTLGLP-------VTELKKCDSVSQQENNSDDD------KTS  209

Query  264  stltlspellsLMQDMIRKEVETYYSALVIKDGVRNAEVKRIGLGKTN  121
            +T +   E LS+MQ+MIR EV  Y         VRNA  KR G+ K +
Sbjct  210  NTPSFGLEFLSVMQEMIRNEVRNYMEV-----AVRNAGFKRTGINKID  252



>ref|XP_006422932.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
 gb|ESR36172.1| hypothetical protein CICLE_v10029124mg [Citrus clementina]
Length=252

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/288 (48%), Positives = 170/288 (59%), Gaps = 49/288 (17%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+RVKGPWS EED LL KLV+++GARNWS+ISKSIPGRSGKSCRLRWCNQLSPEVEHR F
Sbjct  7    SERVKGPWSPEEDQLLLKLVQRYGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRTF  66

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI------GSNE  622
            TP+EDE+I K HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKY+         G +E
Sbjct  67   TPDEDEIIIKAHARYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYAETTRSALAAGVDE  126

Query  621  GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL  442
              E    R  KR+  +   ++ +P G  VS                           LP+
Sbjct  127  DSEDSDEREKKRSAVSVSGISCSPSGSDVSDS------------------------GLPV  162

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQR-DQPSYRRGDSTEAAAPAPVKse  265
            +  E      +  D ST LTL LP       V+ L++ D  S +  +S +       K+ 
Sbjct  163  RVFESESRYNEVFDVSTDLTLGLP-------VTELKKCDSVSQQENNSDDD------KTS  209

Query  264  stltlspellsLMQDMIRKEVETYYSALVIKDGVRNAEVKRIGLGKTN  121
            +T +  PE LS+MQ+MIR EV  Y         VRNA  KR G+ K +
Sbjct  210  NTPSFGPEFLSVMQEMIRNEVRNYMEV-----AVRNAGFKRTGINKID  252



>gb|EYU25477.1| hypothetical protein MIMGU_mgv1a010338mg [Erythranthe guttata]
Length=315

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 182/313 (58%), Gaps = 34/313 (11%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            DSDR+KGPWS EED+LL++LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  6    DSDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  65

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            F+PEEDE I + HA+ GNKWATIARML GRTDNAIKNHWNSTLKRK  ++       +P 
Sbjct  66   FSPEEDETIVRAHAKFGNKWATIARMLCGRTDNAIKNHWNSTLKRKCVSMSEEFNNFDPE  125

Query  606  PGRILKRADSADVTVTA------APPGLRVsrdsssdsdisyssnDNG------PAAVRS  463
                LKR+ S     +A      +P G  +S  S S   I       G      P   R 
Sbjct  126  AQPPLKRSASLGPATSAFCFNPGSPSGSDMSDSSHSGHLIYRPIARTGGISQSPPDPTRE  185

Query  462  --VRLALPLQAVEPRL--VSE------KENDPS-TVLTLSLPAPGSNDGVSSLQRDQPSY  316
                L+L L   +P L  ++E       E DP+  V  + +P    N  +SSL    P  
Sbjct  186  PVTSLSLSLPGSDPNLNTITEPIHNPIPEPDPNHAVKPMMVPPKHPNQMISSL--PPPPL  243

Query  315  RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL--------VIKDGVR  160
            +    + AA PA V        S E L++MQDM+RKEV  Y + +        +  + +R
Sbjct  244  QTYQFSPAAQPAGV-VGEKQFFSAEFLAVMQDMVRKEVRNYMAGVEPEPNGFCMQTEAIR  302

Query  159  NAEVKRIGLGKTN  121
            NA VKR+G+ K +
Sbjct  303  NAVVKRMGISKID  315



>ref|XP_010059753.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW66164.1| hypothetical protein EUGRSUZ_F000021 [Eucalyptus grandis]
Length=339

 Score =   219 bits (557),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 181/333 (54%), Gaps = 57/333 (17%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D+DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  13   DADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  72

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI--GSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S+    G ++   
Sbjct  73   FTPEEDEAIVRAHARFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSSACSAGGDDADA  132

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV  433
                + LKR+ S   T T     +     S S    S  S+   P  + S R+  P+   
Sbjct  133  LAEQQPLKRSASLG-TPTGGNNAVSDLFFSPSSPSGSDLSDSGLPVGMPSPRVFRPVART  191

Query  432  EPRL----------VSEKENDPSTVLTLSLP----APGSNDGVSSLQRDQPSYR------  313
             P +           S    DP T+L+LSLP    A  SN G +S     P  R      
Sbjct  192  GPIMPALSGQHADASSSTTTDPPTLLSLSLPGSDMAEVSNHGSASGSVPTPDSRPSPTLF  251

Query  312  -----------------------------RGDSTEAAAPAPVKsestltlspellsLMQD  220
                                          GD  EAAA            + + +++MQ+
Sbjct  252  SARTQTMQATPPPPPPPLPPPPPIHHLGHYGDRMEAAA-----GYEKQFFNADFMAVMQE  306

Query  219  MIRKEVETYYSALVIKDGVRNAEVKRIGLGKTN  121
            MIRKEV +Y S +   + VRN  VKRIG+ K +
Sbjct  307  MIRKEVRSYMSGIEQGEAVRNVTVKRIGVSKID  339



>ref|XP_003611666.1| R2R3-MYB transcription factor [Medicago truncatula]
 gb|AES94624.1| myb transcription factor [Medicago truncatula]
Length=316

 Score =   218 bits (554),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 144/323 (45%), Positives = 179/323 (55%), Gaps = 52/323 (16%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++  +    P   
Sbjct  62   PEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDSESPP---  118

Query  600  RILKRADSADVTV------------TAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVR  457
              LKR+ SA   +              +P G  VS  S    +   +S+   P   R+V 
Sbjct  119  --LKRSVSAGAAIPVSTGLYINANSPGSPSGSDVSESSVPIVNTHVNSHVYRPVPTRTV-  175

Query  456  LALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDST-------  298
               PL  VE    S   NDP T L+LSLP  G +       R                  
Sbjct  176  --APLPLVETTSPS-NSNDPPTSLSLSLPGVGVDSSSEDSNRVTEPVNTAPPPPPPPPPS  232

Query  297  --------EAAAPAPVKsestl-------tlspellsLMQDMIRKEVETYYSAL------  181
                      A P P+             + S ELLS+MQ+MIR EV +Y + L      
Sbjct  233  AIPLMPVMTTAVPVPMAVPMQQSGSVMPFSFSAELLSVMQEMIRTEVRSYMAGLEQQNGM  292

Query  180  ---VIKDGVRNAEVKRIGLGKTN  121
                 +DG+RNA VKRIG+ + +
Sbjct  293  CFQKAEDGIRNALVKRIGISRID  315



>gb|AFK47194.1| unknown [Medicago truncatula]
Length=326

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 177/319 (55%), Gaps = 52/319 (16%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  12   DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  71

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++  +    P   
Sbjct  72   PEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDSESPP---  128

Query  600  RILKRADSADVTV------------TAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVR  457
              LKR+ SA   +              +P G  VS  S    +   +S+   P   R+V 
Sbjct  129  --LKRSVSAGAAIPVSTGLYINANSPGSPSGSDVSESSVPIVNTHVNSHVYRPVPTRTV-  185

Query  456  LALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDST-------  298
               PL  VE    S   NDP T L+LSLP  G +       R                  
Sbjct  186  --APLPLVETTSPS-NSNDPPTSLSLSLPGVGVDSSSEDSNRVTEPVNTASPPPPPPPPS  242

Query  297  --------EAAAPAPVKsestl-------tlspellsLMQDMIRKEVETYYSAL------  181
                      A P P+             + S ELLS+MQ+MIR EV +Y + L      
Sbjct  243  AIPLMPVMTTAVPVPMAVPMQQSGSVMPFSFSAELLSVMQEMIRTEVRSYMAGLEQQNGM  302

Query  180  ---VIKDGVRNAEVKRIGL  133
                 +DG+RNA VKRIG+
Sbjct  303  CFQKAEDGIRNALVKRIGI  321



>ref|XP_007227715.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
 gb|EMJ28914.1| hypothetical protein PRUPE_ppa008979mg [Prunus persica]
Length=312

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 144/309 (47%), Positives = 176/309 (57%), Gaps = 36/309 (12%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  8    ADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  67

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +P+ED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++   +E   P  
Sbjct  68   SPDEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM---SEDLTPDV  124

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                    SA V    A  GL ++  S S SD+S SS    P  V   ++  PL    P 
Sbjct  125  HSHPAHKRSASVGAVTAVSGLYLNPGSPSGSDMSDSSL---PGIVSPTQVFRPLVRTGPL  181

Query  423  LVSEKEN-----DPSTVLTLSLPAPGSNDGVSSLQR--------------DQPSYRRGDS  301
            +    E      DP T L+LSLP   S+DG + L                 QP       
Sbjct  182  IAPPMEASSSAVDPPTSLSLSLPGSDSSDGSNHLASGFGSNPGVSPTSMVQQPQEAAAAV  241

Query  300  TEAAAPAPVKsestltlspellsL-----MQDMIRKEVETYYSAL------VIKDGVRNA  154
              A  P      S +    +  S      MQ+MIRKEV  Y S +      +  + +RNA
Sbjct  242  AGAQLPRQSNQNSEMGYDQQFFSSEFLDVMQEMIRKEVRNYMSGVEQTGLCMHTEAIRNA  301

Query  153  EVKRIGLGK  127
             VKRIG+ K
Sbjct  302  VVKRIGISK  310



>ref|XP_006844027.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
 gb|ERN05702.1| hypothetical protein AMTR_s00006p00225600 [Amborella trichopoda]
Length=303

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 175/306 (57%), Gaps = 35/306 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEQLRKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EEDE I + HAQ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+   S E  E  P 
Sbjct  62   AEEDETIVRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSSSSSQEPNEQEPH  121

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
               KR  S+      +P G  +S    + +  ++      P A R+  +  P+Q      
Sbjct  122  HPAKRLSSSLSLSPGSPTGSEISDSGLALTSSAHVYR---PVA-RAGGIVPPVQI---ET  174

Query  420  VSEKENDPSTVLTLSLPAP-------GSNDGV--SSLQRDQPSYRRGDSTEAAAPAPVKs  268
             S   NDP T L+LSLP         GS +GV  S L+    S         +    +  
Sbjct  175  CSSPTNDPPTSLSLSLPGAQPLDSSDGSEEGVGGSHLRCQFVSPPPPPPPPPSFNGVMGF  234

Query  267  estltlspellsL------MQDMIRKEVETYYSAL------------VIKDG-VRNAEVK  145
            ++       L         MQ+MI KEV+ Y +AL            V+  G VRNA VK
Sbjct  235  QAVNNTEKTLGFSPEFISLMQEMIAKEVKNYMAALHQNGFCFQGEMGVLDSGAVRNAAVK  294

Query  144  RIGLGK  127
            R+G+GK
Sbjct  295  RVGVGK  300



>ref|XP_010092183.1| Transcription factor [Morus notabilis]
 gb|EXB50409.1| Transcription factor [Morus notabilis]
Length=310

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 140/316 (44%), Positives = 180/316 (57%), Gaps = 60/316 (19%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            D+VKGPWS EED+LL+ LV+++G RNWS+IS+SIPGRSGKSCRLRWCNQLSPEV+HRPF+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
             EED++I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ I         E 
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSAIDDGVMLLDAEL  127

Query  618  GEPRPGRILKRADSADVT--------------------VTAAP----PGLRVsrdsssds  511
               RP + L  A  A  +                    VT+ P    PG R         
Sbjct  128  SILRPRKRLASAPPASFSGLCYSSSSPSGSDASDSAAPVTSLPRVFWPGART--------  179

Query  510  disyssnDNGPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQR  331
                     G     S ++  P Q     +V++  ++PST+LTLS+P  GS   V    R
Sbjct  180  ---------GAILPPSTQVESPSQKDNKIIVNDSFSEPSTLLTLSMPGTGS---VECPNR  227

Query  330  DQPSYRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSALVIK------D  169
            D   +R   +T A      + ++ ++   E LSLMQ+MIRKEV  Y + +         +
Sbjct  228  DSDPHREVKTTSAQQ----EKKNAISFGLEFLSLMQEMIRKEVRDYMADIEKNLEVSRSE  283

Query  168  GVRNAEVKRIGLGKTN  121
            GVRN  VKRIG+ K +
Sbjct  284  GVRNVGVKRIGITKLD  299



>ref|XP_007156759.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
 gb|ESW28753.1| hypothetical protein PHAVU_002G015100g [Phaseolus vulgaris]
Length=300

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 178/308 (58%), Gaps = 38/308 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK ++ +  +    P P 
Sbjct  62   PEEDDTIVRAHARFGNKWATIARLLQGRTDNAIKNHWNSTLKRKCASTMMDD---HPPP-  117

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAA-----VRSV-RLALPLQ  439
              LKR+ SA   +  +  GL ++  +      S  S  + P A      R V R A  L 
Sbjct  118  --LKRSVSAGAAIPVS-TGLYINPPTPGSPSGSDVSESSAPVASPSHVFRPVPRTAAVLP  174

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAP------AP  277
             VE    S   NDP T L+LSLP   S++ VS+   +              P      AP
Sbjct  175  PVE--TTSSSSNDPPTSLSLSLPGVDSSE-VSNRVTEPAHPVPPPQPSNTIPLLPMMAAP  231

Query  276  VKsestlt--------lspellsLMQDMIRKEVETYYS--------ALVIKDGVRNAEVK  145
            V     L         LS E L +MQ+MIRKEV +Y              +DG RN  VK
Sbjct  232  VAMVPQLKPPGLGAFNLSAEFLVVMQEMIRKEVRSYMERQNPNGMCFQAAEDGFRNTSVK  291

Query  144  RIGLGKTN  121
            RIG+ + +
Sbjct  292  RIGISRVD  299



>emb|CAN75196.1| hypothetical protein VITISV_014739 [Vitis vinifera]
Length=301

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 137/299 (46%), Positives = 170/299 (57%), Gaps = 25/299 (8%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK SA+      G   
Sbjct  67   FTSEEDDTIMRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSAITEDGSFGGDY  126

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ---A  436
            P   LKR+ SA      +  GL +S  S   SD+S SS       V S  +  P+     
Sbjct  127  PPHPLKRSVSAGAAAPVS--GLYLSPSSPCGSDVSDSSL----PVVSSSHVYRPVARTGG  180

Query  435  VEPRLVSEKENDPSTVLTLSLP----------APGSNDGVSSLQRDQPSYRRGDSTEAAA  286
            + P   +   NDP T L+LSLP          AP  N           +Y    + ++ A
Sbjct  181  IIPPETTSSSNDPPTSLSLSLPGVDSCEVSNRAPEPNHAPPGKPYSDDTYDGSFAADSDA  240

Query  285  PAPVKsestltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGK  127
            P    S+            +  +  + +  Y + L      +  DG+RNA VKRIG+ K
Sbjct  241  PTQPASDGAGYSPLPGGETIYPLQLQSLRNYMAGLEQNGVCLQADGIRNAAVKRIGISK  299



>ref|XP_010096284.1| Transcription factor [Morus notabilis]
 gb|EXB63679.1| Transcription factor [Morus notabilis]
Length=299

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 179/312 (57%), Gaps = 52/312 (17%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            D+VKGPWS EED+LL+ LV+++G RNWS+IS+SIPGRSGKSCRLRWCNQLSPEV+HRPF+
Sbjct  8    DKVKGPWSHEEDELLQSLVQRYGPRNWSIISRSIPGRSGKSCRLRWCNQLSPEVQHRPFS  67

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
             EED++I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ I         E 
Sbjct  68   AEEDDIIVHAHAKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSAIDDGVMLLDAEL  127

Query  618  GEPRPGRILKRADSADVT--------------------VTAAPPGLRVsrdsssdsdisy  499
               RP + L  A  A  +                    VT+ P   R             
Sbjct  128  SILRPRKRLASAPPASFSGLCYSSSSPSGSDASDSAAPVTSLPRVFR-------------  174

Query  498  ssnDNGPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPS  319
                 G     S ++  P Q     +V++  ++PST+LTLS+P  GS   V    RD   
Sbjct  175  PVARTGAILPPSTQVESPSQKDNKIIVNDSFSEPSTLLTLSMPGTGS---VERPNRDSDP  231

Query  318  YRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSALVIK------DGVRN  157
            +R   +T A      + ++ ++  PE LSLMQ+MIRKEV  Y + +         +GVRN
Sbjct  232  HREVKTTSAQQ----EKKNAISFGPEFLSLMQEMIRKEVRDYMADIEKNLEVSRSEGVRN  287

Query  156  AEVKRIGLGKTN  121
              VKRIG+ K +
Sbjct  288  VGVKRIGITKLD  299



>ref|XP_010691674.1| PREDICTED: transcription factor MYB44-like [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score =   213 bits (542),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 167/257 (65%), Gaps = 36/257 (14%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+LL+KLV++HGARNWS+ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  14   ADRIKGPWSPEEDELLQKLVQKHGARNWSVISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  73

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE+I + HAQ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK+S+++  +E   P  
Sbjct  74   STEEDEIIVRAHAQHGNKWATISRLLNGRTDNAIKNHWNSTLKRKFSSIVAGDEIYRPE-  132

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                KR +     ++ +PP           S      +D+G   + +V        VE R
Sbjct  133  ----KRPE-----ISFSPP----------LSPSESDVSDSGVGYLPTV--------VEER  165

Query  423  LVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltlsp  244
                +ENDP T LTLSLP     +  S  +  Q   R+ D     +      + T++  P
Sbjct  166  --ENQENDPLTALTLSLPGI-IEEHPSKSESTQEETRKVDVVGCES-----VKETMSFGP  217

Query  243  ellsLMQDMIRKEVETY  193
            EL+++MQ+MI+KEV  Y
Sbjct  218  ELMAVMQEMIKKEVRNY  234



>ref|XP_008452606.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=269

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 135/289 (47%), Positives = 173/289 (60%), Gaps = 30/289 (10%)
 Frame = -3

Query  972  MADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEH  793
            MA +DR+KGPWS +ED+LL++LV  +G RNWSLISKSI GRSGKSCRLRWCNQLSPEVEH
Sbjct  1    MATTDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSISGRSGKSCRLRWCNQLSPEVEH  60

Query  792  RPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            RPFTP+ED+ I + H++ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+         
Sbjct  61   RPFTPDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSS-------SA  113

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV  433
            P     LKR+ S       APP        S       S +    + V      +PL + 
Sbjct  114  PEDDHPLKRSASV-----GAPPLYFNPSSPSGSDLSDSSLSGMSSSQVCKTFPPVPLISH  168

Query  432  EPRLVSEKEN-DPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestl  256
              +   E  + DP T LTLSL  PGS+ G      + P +    + ++   A ++     
Sbjct  169  SNQHPMETTSIDPPTSLTLSL--PGSDSG------EAPKHMSEGNHQSGKKAGIE---KQ  217

Query  255  tlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGK  127
              S E L +MQ+MIRKEV++Y S +      +  + + NA VKRIG+ K
Sbjct  218  FFSAEFLGVMQEMIRKEVQSYMSGMEQNGLCLQTEAITNAVVKRIGIRK  266



>gb|AFK46950.1| unknown [Medicago truncatula]
Length=316

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 178/323 (55%), Gaps = 52/323 (16%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+ G RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQKLVEKRGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++  +    P   
Sbjct  62   PEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDSESPP---  118

Query  600  RILKRADSADVTV------------TAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVR  457
              LKR+ SA   +              +P G  VS  S    +   +S+   P   R+V 
Sbjct  119  --LKRSVSAGAAIPVSTGLYINANSPGSPSGSDVSESSVPIVNTHVNSHVYRPVPTRTV-  175

Query  456  LALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDST-------  298
               PL  VE    S   NDP T L+LSLP  G +       R                  
Sbjct  176  --APLPLVETTSPS-NSNDPPTSLSLSLPGVGVDSSSEDSNRVTEPVNTAPPPPPPPPPS  232

Query  297  --------EAAAPAPVKsestl-------tlspellsLMQDMIRKEVETYYSAL------  181
                      A P P+             + S ELLS+MQ+MIR EV +Y + L      
Sbjct  233  AIPLMPVMTTAVPVPMAVPMQQSGSVMPFSFSAELLSVMQEMIRTEVRSYMAGLEQQNGM  292

Query  180  ---VIKDGVRNAEVKRIGLGKTN  121
                 +DG+RNA VKRIG+ + +
Sbjct  293  CFQKAEDGIRNALVKRIGISRID  315



>ref|XP_006425988.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
 gb|ABQ10816.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ESR39228.1| hypothetical protein CICLE_v10026107mg [Citrus clementina]
Length=317

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 180/289 (62%), Gaps = 28/289 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
            PEEDE+I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+++  N       G
Sbjct  69   PEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNG  128

Query  618  GEPRPGRI-------LKRADSADVTVTAA-----PPGLRVsrdsssdsdisyssnDN--G  481
             +   G         LKR+ SA  +V         PG     D S  S    SSN N   
Sbjct  129  YDADFGNSIQQQPLKLKRSVSAGSSVPVTTGLYMSPGSPSGSDVSDSSVPGLSSNYNIYK  188

Query  480  PAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDS  301
            P A RS  + + +  V     +   NDP T L+LSLP   S+  VS+   +     +  +
Sbjct  189  PVA-RSGGINVDVNVVPEPETTSSSNDPPTSLSLSLPGVDSSSEVSNKVSES---TQAVN  244

Query  300  TEAAAPAPVKsestlt----lspellsLMQDMIRKEVETYYSALVIKDG  166
             +A+ PAPV S+S        S E +++MQ+MI++EV TY +AL  + G
Sbjct  245  AKASVPAPVSSDSGSKGLVGFSKEFMAVMQEMIKQEVRTYMAALEQQRG  293



>ref|NP_001275856.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|ABQ10817.1| putative R2R3-Myb transcription factor [Citrus sinensis]
 gb|KDO79070.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=317

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 179/289 (62%), Gaps = 28/289 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
            PEEDE+I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+++  N       G
Sbjct  69   PEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNG  128

Query  618  GEPRPGRI-------LKRADSADVTVTAA-----PPGLRVsrdsssdsdisyssnDN--G  481
             +   G         LKR+ SA  +V         PG     D S  S    SSN N   
Sbjct  129  YDADFGNSIQQQPLKLKRSVSAGSSVPVTTGLYMSPGSPSGSDVSDSSVPGLSSNYNIYK  188

Query  480  PAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDS  301
            P A RS  + + +  V     +   NDP T L+LSLP   S+  VS+   +     +  +
Sbjct  189  PVA-RSGGINVDVNVVPEPETTSSSNDPPTSLSLSLPGVDSSSEVSNKVSES---TQAVN  244

Query  300  TEAAAPAPVKsestlt----lspellsLMQDMIRKEVETYYSALVIKDG  166
             +A+ PAPV S+S        S E + +MQ+MI++EV TY +AL  + G
Sbjct  245  AKASVPAPVSSDSGSKGLVGFSKEFMVVMQEMIKQEVRTYMAALEQQRG  293



>ref|NP_001275798.1| putative R2R3-MYB transcription factor [Citrus sinensis]
 gb|AEK32395.1| putative R2R3-MYB transcription factor [Citrus sinensis]
Length=302

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 147/305 (48%), Positives = 187/305 (61%), Gaps = 32/305 (10%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE--GGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++   ++     
Sbjct  67   FTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDESQVDAIN  126

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL---  442
            P P   LKRA+S   +   +  GL ++  S S SD S SS    P   +S  +  PL   
Sbjct  127  PLP---LKRANSVGPSNNIS--GLCLNPGSPSGSDSSDSSL---PGVAQSP-VCHPLFRT  177

Query  441  QAVEPRLVSEKENDPSTVLTLSLP----------APGSNDGVS-SLQRDQPSYRRGDSTE  295
             ++ P   S    DP T L+LSLP           PGS +G +  L  +Q +  R    +
Sbjct  178  GSLVPVETSSSTTDPPTSLSLSLPGSESCEVSNHGPGSENGSNLVLNPNQVASTRPLQVQ  237

Query  294  AAAPAPVKsestltlsp-ellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIG  136
            A A    +          E L++MQ+MIRKEV  Y S +      +  + +RNA VKRIG
Sbjct  238  AQAQNQGEFGYEKQFFNPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIG  297

Query  135  LGKTN  121
            + K +
Sbjct  298  INKAD  302



>ref|XP_008220277.1| PREDICTED: transcription factor MYB44-like [Prunus mume]
Length=312

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 176/309 (57%), Gaps = 36/309 (12%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  8    ADRIKGPWSPEEDEALQKLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  67

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +P+ED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++   +E   P  
Sbjct  68   SPDEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM---SEDLTPDV  124

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                    SA V    A  GL ++  S S SD+S SS    P  V   ++  PL    P 
Sbjct  125  HSHPAHKRSASVGAVTAVSGLYLNPGSPSGSDMSDSSL---PGIVSPTQVFRPLVRSGPL  181

Query  423  LVSEKEN-----DPSTVLTLSLPAPGSNDGVSSL-------------------QRDQPSY  316
            +    E      DP T L+LSLP   S+DG + L                   Q    + 
Sbjct  182  IAPPMEASSSAVDPPTSLSLSLPGSDSSDGSNHLTSGFGSNPGVSPTSMVQQPQEAAAAA  241

Query  315  RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNA  154
                 T  +             S E L +MQ+MIRKEV  Y S +      +  + +RNA
Sbjct  242  AGAQLTRQSNQNSEMGYDQQFFSSEFLDVMQEMIRKEVRNYMSGVEQTGLCMHTEAIRNA  301

Query  153  EVKRIGLGK  127
             VKRIG+ K
Sbjct  302  VVKRIGISK  310



>ref|XP_004141275.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN55237.1| hypothetical protein Csa_4G641690 [Cucumis sativus]
Length=263

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/295 (45%), Positives = 170/295 (58%), Gaps = 50/295 (17%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS +ED+LL++LV  +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  5    TDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  64

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            T +ED+ I + H++ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+         P  
Sbjct  65   TSDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSS-------SAPED  117

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
               LKR+ SA     +APP        +  S      +D+  + + S ++  P   V P 
Sbjct  118  DHPLKRSTSA-----SAPP-----LYFNPSSPSGSDLSDSSLSGMSSSQVCKPFPPVPP-  166

Query  423  LVSEKEN--------DPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKs  268
            L+S   +        DP T LTLSLP   S D    +       ++  S E         
Sbjct  167  LISHSNHPPMDTTSIDPPTSLTLSLPGSDSGDAPKHMSEANRIEKQFFSAEFLG------  220

Query  267  estltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGKTN  121
                        +MQ+MIRKEV++Y S +      +  + + NA VKRIG+ K +
Sbjct  221  ------------VMQEMIRKEVQSYMSGMEQNGLCLQTEAITNAVVKRIGIRKID  263



>gb|AHN50422.1| R2R3-type MYB transcription factor [Salicornia brachiata]
Length=269

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 159/260 (61%), Gaps = 32/260 (12%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EEDDLLKKLV++HGARNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHR F
Sbjct  15   ADRIKGPWSPEEDDLLKKLVDKHGARNWSEISKSIPGRSGKSCRLRWCNQLSPEVEHRAF  74

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
             PEEDE+I K HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK+S + G   GG    
Sbjct  75   LPEEDEIIVKAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKFSEIGG---GG----  127

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                     +DV           S  SS  S      + +G AA  S             
Sbjct  128  --------VSDVEFHRPEKRPEFSSISSPGSQSESDVSVSGVAASGSEERENKENENVNE  179

Query  423  LVSEKENDPSTVLTLSLPAPGSNDGVS-SLQRDQPSYRRGDSTEAAAPAPVKsestltls  247
             V++  NDP TVLTL L  PG  +G S + Q+++    R   T +  P  +         
Sbjct  180  NVTDN-NDPLTVLTLRL--PGVEEGRSETTQQEEEEVNRKKQTMSFGPELM---------  227

Query  246  pellsLMQDMIRKEVETYYS  187
                ++MQ+MI+KEV++Y +
Sbjct  228  ----AVMQEMIKKEVKSYMT  243



>ref|XP_004142878.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156374.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN62477.1| hypothetical protein Csa_2G355030 [Cucumis sativus]
Length=290

 Score =   212 bits (539),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 137/289 (47%), Positives = 176/289 (61%), Gaps = 16/289 (6%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ LK+LVE +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPF+
Sbjct  9    DRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK SA+   ++  +P   
Sbjct  69   AEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM--GDDFNDPDLH  126

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLA---LPLQAVE  430
               KR+ S   +      G  ++  S S SD+S SS        R +  +   +P    +
Sbjct  127  HPPKRSASLGPSPVTVASGFGLNPSSPSGSDLSDSSPPPPQPVYRPLARSSSIVPSNQQQ  186

Query  429  PRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltl  250
             ++V+    DP T L LSLP   S  G  S     P+ +   +T  A       + +   
Sbjct  187  QQIVNSY--DPPTSLCLSLPGSNSKSGYGSDSIPSPTRKMVQATPTAGGY---GKESELF  241

Query  249  spellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGKTN  121
            S E LS MQ+MI+ EV  Y S +      +  D +RNA VKR+G+ K +
Sbjct  242  SAEFLSAMQEMIKIEVRKYMSGIEHNGWHLHTDAIRNAVVKRMGISKID  290



>dbj|BAJ40867.1| transcriptional factor MYB-1 [Coptis japonica]
Length=312

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 149/312 (48%), Positives = 178/312 (57%), Gaps = 43/312 (14%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDDLL KLV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  10   DLDRIKGPWSPEEDDLLTKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  69

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            F+ EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S        GE  
Sbjct  70   FSSEEDDTIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKAS--------GEDI  121

Query  606  PGRILKRADSADVTVTAAPP---GLRVsrdsssdsdisyssnDNGPAA--VRSVRLALPL  442
                L R      +V A  P   GL +S  S   SD+S SS     +    R V     +
Sbjct  122  FIDGLTRPFKRSASVGAVAPYGSGLYLSPSSPCGSDVSDSSLPGSSSGHVYRPVARTGGI  181

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPG----SNDGVSSLQRDQ----------PSYRRGD  304
              +E    S   NDP T L+LSLP       SN  + +   DQ          P  ++  
Sbjct  182  LQIE---TSSSTNDPPTSLSLSLPGTDSCEVSNQAMKTQSVDQIPSALPMQQFPLLQQNS  238

Query  303  STEAAAPAPV----KsestltlspellsLMQDMIRKEVETYYSALVIK---------DGV  163
            S   ++   V    K   +   S E L++MQ+MI+KEV  Y SA+            DG+
Sbjct  239  SNMVSSDISVSPIEKPVVSKAFSAEFLAVMQEMIKKEVRNYMSAMEQNGGMCSSQAVDGI  298

Query  162  RNAEVKRIGLGK  127
            RNA VKRIG+ K
Sbjct  299  RNALVKRIGITK  310



>gb|KDO84060.1| hypothetical protein CISIN_1g022144mg [Citrus sinensis]
Length=302

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 146/305 (48%), Positives = 187/305 (61%), Gaps = 32/305 (10%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE--GGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++   ++     
Sbjct  67   FTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDESQVDAIN  126

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL---  442
            P P   LKRA+S   +   +  GL ++  S S SD S SS    P   +S  +  PL   
Sbjct  127  PLP---LKRANSVGPSNNIS--GLCLNPGSPSGSDSSDSSL---PGVAQSP-VCHPLFRT  177

Query  441  QAVEPRLVSEKENDPSTVLTLSLP----------APGSNDGVS-SLQRDQPSYRRGDSTE  295
             ++ P   S    DP T L+LSLP           PGS +G +  L  +Q +  +    +
Sbjct  178  GSLVPVETSSSTTDPPTSLSLSLPGSESCEVSNHGPGSENGSNLVLNPNQVASTQPLQVQ  237

Query  294  AAAPAPVKsestltlsp-ellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIG  136
            A A    +          E L++MQ+MIRKEV  Y S +      +  + +RNA VKRIG
Sbjct  238  AQAQNQGEFGYEKQFFSPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIG  297

Query  135  LGKTN  121
            + K +
Sbjct  298  INKAD  302



>ref|XP_006434697.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
 gb|ESR47937.1| hypothetical protein CICLE_v10001979mg [Citrus clementina]
Length=302

 Score =   212 bits (540),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 146/305 (48%), Positives = 187/305 (61%), Gaps = 32/305 (10%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE--GGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++   ++     
Sbjct  67   FTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDESQVDAIN  126

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL---  442
            P P   LKRA+S   +   +  GL ++  S S SD S SS    P   +S  +  PL   
Sbjct  127  PLP---LKRANSVGPSNNIS--GLCLNPGSPSGSDSSDSSL---PGVAQSP-VCHPLFRT  177

Query  441  QAVEPRLVSEKENDPSTVLTLSLP----------APGSNDGVS-SLQRDQPSYRRGDSTE  295
             ++ P   S    DP T L+LSLP           PGS +G +  L  +Q +  +    +
Sbjct  178  GSLVPVETSSSTTDPPTSLSLSLPGSESCEVSNHGPGSENGSNLVLNPNQVASTQPLQVQ  237

Query  294  AAAPAPVKsestltlsp-ellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIG  136
            A A    +          E L++MQ+MIRKEV  Y S +      +  + +RNA VKRIG
Sbjct  238  AQAQNQGEFGYEKQFFNPEFLAVMQEMIRKEVRNYMSGVERNGLCLPAEAIRNAVVKRIG  297

Query  135  LGKTN  121
            + K +
Sbjct  298  INKAD  302



>dbj|BAC53938.1| Myb-like protein [Nicotiana tabacum]
Length=329

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 177/324 (55%), Gaps = 49/324 (15%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            +SDR+KGPWS EED+LL+ LVE+HG RNWSLISKS+PGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    ESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++  S +     
Sbjct  69   FTSEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSM--SEDLSFET  126

Query  606  PGRILKRADSADVTVTAA----PPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ  439
            P + LKR+ S   +   +    P     S  S S       S    P         LP  
Sbjct  127  PQQPLKRSSSVGPSTNFSSGMNPGSPSGSDLSDSSLSGFPQSLVYRPVPRTGGIFPLP-P  185

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSY-------------------  316
             V+P   +    DP T L LSLP  G+ +  +S+Q  QP+                    
Sbjct  186  LVQPIETAPFIPDPPTSLCLSLPGSGTRE--TSIQTAQPTQLTQPPQSPPPPPLALPPVD  243

Query  315  ---------------RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL  181
                           +   S +   PA  KS      +PE L ++QDMIRKEV  Y S +
Sbjct  244  KPVPPPTAVFMSQLPQTKQSYDFCVPALPKSGEKQFFTPEFLGVLQDMIRKEVRNYMSGV  303

Query  180  ------VIKDGVRNAEVKRIGLGK  127
                  +  D +RNA VKRIG+ K
Sbjct  304  EHNGLCMQTDAIRNAVVKRIGISK  327



>ref|XP_009586849.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=329

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 177/324 (55%), Gaps = 49/324 (15%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            +SDR+KGPWS EED+LL+ LVE+HG RNWSLISKS+PGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    ESDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++  S +     
Sbjct  69   FTSEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSM--SEDLSFET  126

Query  606  PGRILKRADSADVTVTAA----PPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ  439
            P + LKR+ S   +   +    P     S  S S       S    P         LP  
Sbjct  127  PQQPLKRSSSVGPSTNFSSGMNPGSPSGSDLSDSSLSGFPQSLVYRPVPRTGGIFPLP-P  185

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSY-------------------  316
             V+P   +    DP T L LSLP  G+ +  +S+Q  QP+                    
Sbjct  186  LVQPIETAPFIPDPPTSLCLSLPGSGTRE--TSIQTAQPTQLTQPPQSPPPPPLALPPVD  243

Query  315  ---------------RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL  181
                           +   S +   PA  KS      +PE L ++QDMIRKEV  Y S +
Sbjct  244  KPVPPPTAVFMAQLPQTKQSYDFCVPALPKSGEKQFFTPEFLGVLQDMIRKEVRNYMSGV  303

Query  180  ------VIKDGVRNAEVKRIGLGK  127
                  +  D +RNA VKRIG+ K
Sbjct  304  EHNGLCMQTDAIRNAVVKRIGISK  327



>ref|XP_002285015.1| PREDICTED: transcription factor MYB44-like [Vitis vinifera]
Length=313

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 139/310 (45%), Positives = 176/310 (57%), Gaps = 35/310 (11%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN-EGGEP  610
            FTPEED  I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK S++       G  
Sbjct  67   FTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSSITEDMIADGHA  126

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV----RLALPL  442
            +P   LKR+ S     T +   L  S  S S+   S +         R V     + LP 
Sbjct  127  QPP--LKRSASVGAGTTVSGHNLSPSSPSGSEFSDSSAPGMASSLVYRPVPRTGPIVLPT  184

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVK---  271
            Q +E    +   NDP T L+LSLP   S +  + L        +    ++ A  PV+   
Sbjct  185  QKIE---AASSTNDPPTSLSLSLPGSDSCEVSNHLSGSDHVKIQNQILQSPAIPPVQLQQ  241

Query  270  ----------------sestltlspellsLMQDMIRKEVETYYSAL------VIKDGVRN  157
                                   +PE L++MQ+MIRKEV  Y S +      +  + + N
Sbjct  242  NPGSPRNIQNCELGLGMSEKPFFTPEFLAVMQEMIRKEVRNYMSGMEQNGLCLQTEAIWN  301

Query  156  AEVKRIGLGK  127
            A +KRIG+GK
Sbjct  302  AVMKRIGIGK  311



>ref|XP_007160886.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
 gb|ESW32880.1| hypothetical protein PHAVU_001G025200g [Phaseolus vulgaris]
Length=276

 Score =   211 bits (536),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/290 (48%), Positives = 171/290 (59%), Gaps = 30/290 (10%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G  D DRVKGPWS EED+ L++LV+  G RNW++ISKSIPGRSGKSCRLRWCNQLSPEVE
Sbjct  4    GSRDMDRVKGPWSPEEDEALQRLVQALGPRNWTVISKSIPGRSGKSCRLRWCNQLSPEVE  63

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            HRPF+PEED+ I + H + GNKWATIAR+LNGRTDNA+KNHWNSTLKRK SAV       
Sbjct  64   HRPFSPEEDDAIVRAHGRFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSAVSLDVTDR  123

Query  615  EPRPGRILKRADS--ADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL  442
             P     LKR+ S  A     ++P G  +S                 P+A    R  L  
Sbjct  124  PP-----LKRSASVGAGYLNPSSPSGSELSDPGQPALST--------PSASARCRPNLME  170

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKses  262
             A  P       +DP+T L+L LP  GS   + +  R   S     S     PA V+   
Sbjct  171  TASSP-------SDPATSLSLCLPGFGSEPSLVAAPRPA-SSPPPVSPPPPPPAAVEERG  222

Query  261  tltlspellsLMQDMIRKEVETYYSALVIKDGVR-------NAEVKRIGL  133
                + E L +MQ+MIRKEV +Y S + +K+G+R       NA VKR+G+
Sbjct  223  KQLFNAEFLRVMQEMIRKEVRSYMSGMELKNGLRIQTEAIGNAVVKRMGI  272



>ref|XP_009398678.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   214 bits (544),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 200/358 (56%), Gaps = 78/358 (22%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  12   DVDRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  71

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG---  616
            FTPEEDE I + H + GNKWATIAR+L+GRTDNA+KNHWNSTLKR+Y A   + +GG   
Sbjct  72   FTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAVKNHWNSTLKRRYCASSSAGDGGFRH  131

Query  615  ----EPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV-------  469
                +    R LKR  S    ++++  GL +S  S S S++S SS+ + P          
Sbjct  132  HPDDDVVAARPLKRTSSDGPAISSSGAGLCLSPGSPSASELSDSSHHSLPMTSPVSTASH  191

Query  468  ------RSVRLALPL------QAVEPRLV-----SEKENDPSTVLTLSLP----------  370
                  R+  + LP         +EP +V      +   DP T L+LSLP          
Sbjct  192  IYRPVPRTGGVVLPTPSALNPHQMEPSVVPTVAAPKNTEDPVTSLSLSLPGSETMDIPDH  251

Query  369  --APGSNDGVS-----------SLQ-RDQPSYRRGDSTEAAAPAPVKsestltl------  250
              + G ++G             +LQ R  P+  R   T  AA +P K + +         
Sbjct  252  HHSTGDDNGRHKQLDLAPSMPMTLQARPPPATARCADTAGAAVSPDKRKRSSAAEEEPRP  311

Query  249  ------spellsLMQDMIRKEVETYYSAL-----------VIKDGVRNAEVKRIGLGK  127
                  S ELL++MQ+MIRKEV +Y ++L              + VRNA +KRIG+ K
Sbjct  312  NAPFPFSAELLAVMQEMIRKEVRSYMTSLERSGAACTESRPPSESVRNAGIKRIGVAK  369



>gb|AFH03055.1| R2R3-MYB transcription factor MYB3 [Epimedium sagittatum]
Length=308

 Score =   211 bits (538),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 140/296 (47%), Positives = 175/296 (59%), Gaps = 27/296 (9%)
 Frame = -3

Query  954  VKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFTPE  775
            +KGPWS EEDDLL+KLV+ HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT E
Sbjct  22   IKGPWSPEEDDLLQKLVQTHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFTAE  81

Query  774  EDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN---EGGEPRP  604
            EDE I K H + GNKWATIAR+LNGRTDNAIKNHWNSTLKRK  +  GSN   +   PRP
Sbjct  82   EDETIIKAHEKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCCS-DGSNPQDQDQNPRP  140

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS---VRLALPLQAV  433
             +  +R+ S       +P G  VS  S S       S+ N   A  +     L+L L   
Sbjct  141  FK--QRSVSCVPFNENSPDGAAVSYSSRSSGSDVSDSSLNNVVASSNDPPTFLSLSLPGA  198

Query  432  EPRLVSEKENDPST----VLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKse  265
            EP  +S ++  P T     L+   P P +   + +    Q +    +  E       + +
Sbjct  199  EPLSLSAEKPKPPTPTAVPLSFQSPFPLNFQKIQTEPEIQINQVNENDKEK------EKQ  252

Query  264  stltlspellsLMQDMIRKEVETYYSALVIK--------DGVRNAEVKRIGLGKTN  121
              +  S E L++MQ+MIRKEV  Y S +           DG+RNA VKR+G+ K +
Sbjct  253  QYMPFSQEFLAVMQEMIRKEVRNYMSGMEQNGGLCFQNVDGIRNAVVKRMGISKID  308



>ref|XP_002310702.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
 gb|EEE91152.1| hypothetical protein POPTR_0007s10490g [Populus trichocarpa]
Length=330

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 183/324 (56%), Gaps = 56/324 (17%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLV++HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  9    DRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI-----------  634
            P+ED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK S++            
Sbjct  69   PDEDDTIIRAHARFGNKWATIARLLYGRTDNAIKNHWNSTLKRKCSSMAEDGNFCNREGY  128

Query  633  -GSNEGGEPRPGRILKRADSADVTV---------TAAPPGLRVsrdsssdsdisyssnDN  484
             G+ +G   +P   LKR+ SA   V           +P G  VS  S      SY+ N  
Sbjct  129  DGNLDGDNTQP---LKRSVSAGSGVPVSTGLYMSPGSPSGSDVSDSSLPGLSSSYNYNIY  185

Query  483  GPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSY----  316
             P A    R    +  VE    S+  NDP T L+LSL  PG++    S Q  +PS     
Sbjct  186  RPVA----RTGAVMPPVETTSSSDNNNDPPTSLSLSL--PGADSSEVSNQVGEPSQLPKS  239

Query  315  --------RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETY-----------  193
                     R    +  +PA      ++  + E +S+MQ+MIRKEV  Y           
Sbjct  240  NTVTPLLTGRNAPAQEVSPAVGGLSGSVGFNTEFMSVMQEMIRKEVRNYMMEHSGVGGGM  299

Query  192  -YSALVIKDGVRNAEV-KRIGLGK  127
             Y  +   +G RN  V  R+GL K
Sbjct  300  CYQGMS-GEGFRNVAVNNRVGLVK  322



>gb|AGL76985.1| MYB transcription factor [Cucumis melo]
Length=294

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/291 (48%), Positives = 174/291 (60%), Gaps = 16/291 (5%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ LK+LVE +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  9    DRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK SA+   ++  +P   
Sbjct  69   AEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM--GDDFNDPDLH  126

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV-----RSVRLALPLQA  436
               KR+ S   +      G  ++  S S SD+S SS    P  V     RS  + +P   
Sbjct  127  HPPKRSASVGPSPVTVASGFGLNPSSPSGSDLSDSSPPPPPQPVYRPLARSSSI-VPSNQ  185

Query  435  VEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestl  256
             + +       DP T L LSLP   S  G  S     P+     +T   A    K   + 
Sbjct  186  QQQQQQIVNSYDPPTSLCLSLPGSNSKSGYGSDSIPSPTRNMVQATTPTAGGHGK--ESE  243

Query  255  tlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGKTN  121
              S E LS MQ+MI+ EV  Y S +      +  D +RNA VKR+G+ K +
Sbjct  244  LFSAEFLSAMQEMIKIEVRKYMSGIEHNGWHLHTDAIRNAVVKRMGISKID  294



>ref|XP_004163238.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like 
[Cucumis sativus]
Length=262

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 169/295 (57%), Gaps = 51/295 (17%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS +ED+LL++LV  +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  5    TDRIKGPWSPDEDELLRRLVHNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  64

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            T +ED+ I + H++ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+         P  
Sbjct  65   TSDEDDTIIQAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSS-------SAPED  117

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
               LKR+ SA     +AP     S  S SD   S        + + S ++  P   V P 
Sbjct  118  DHPLKRSTSA-----SAPLCFNPSSPSGSDLSDSSL------SGMSSSQVCKPFPPVPP-  165

Query  423  LVSEKEN--------DPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKs  268
            L+S   +        DP T LTLSLP   S D    +       ++  S E         
Sbjct  166  LISHSNHPPMDTTSIDPPTSLTLSLPGSDSGDAPKHMSEANRIEKQFFSAEFLG------  219

Query  267  estltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGKTN  121
                        +MQ+MIRKEV++Y S +      +  + + NA VKRIG+ K +
Sbjct  220  ------------VMQEMIRKEVQSYMSGMEQNGLCLQTEAITNAVVKRIGIRKID  262



>ref|XP_011006987.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=330

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 148/324 (46%), Positives = 183/324 (56%), Gaps = 56/324 (17%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLV++HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  9    DRIKGPWSPEEDEALQKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI-----------  634
            P+ED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK S++            
Sbjct  69   PDEDDTIIRAHARFGNKWATIARLLYGRTDNAIKNHWNSTLKRKCSSMAEDGNFCNREGY  128

Query  633  -GSNEGGEPRPGRILKRADSADVTV---------TAAPPGLRVsrdsssdsdisyssnDN  484
             G+ +G   +P   LKR+ SA   V           +P G  VS  S      SY+ N  
Sbjct  129  DGNLDGDNTQP---LKRSVSAGSGVPVSTGLYMSPGSPSGSDVSDSSLPGLSSSYNYNIY  185

Query  483  GPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSY----  316
             P A    R    +  VE    S+  NDP T L+LSL  PG++    S Q  +PS     
Sbjct  186  RPVA----RTGAVMPPVETTSSSDNNNDPPTSLSLSL--PGADSSEVSNQVAEPSQLPKS  239

Query  315  --------RRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETY-----------  193
                     R    +  +PA      ++  S E +S+MQ+MIRKEV  Y           
Sbjct  240  NTVTPLLTGRNAPAQEVSPAVGGLSGSVGFSTEFMSVMQEMIRKEVRNYMMEHSGVGGGM  299

Query  192  -YSALVIKDGVRNAEV-KRIGLGK  127
             Y  +   +G RN  V  R+GL K
Sbjct  300  CYQGMS-GEGFRNVAVNNRVGLVK  322



>gb|EYU37627.1| hypothetical protein MIMGU_mgv1a026376mg [Erythranthe guttata]
Length=292

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 142/290 (49%), Positives = 178/290 (61%), Gaps = 19/290 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            SDR+KGPWS EED+LLKKLVE+HGARNWSLI +SIPGRSGKSCRLRWCNQLSPEV+HRPF
Sbjct  8    SDRIKGPWSAEEDELLKKLVERHGARNWSLICRSIPGRSGKSCRLRWCNQLSPEVQHRPF  67

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY--SAVIGSNEGGEP  610
            T EEDE I K H++ GNKWA+I+R+L GRTDNAIKNHWNSTLKRK+   A      G E 
Sbjct  68   TAEEDETILKAHSEFGNKWASISRLLVGRTDNAIKNHWNSTLKRKFAADAAACGGGGEEE  127

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrd--sssdsdisyssnDNGPAAVRSVRLALPLQA  436
            R  ++L+R+   D++  A   GL +     +S        +  N    V    LA P + 
Sbjct  128  RRTQVLRRSGCRDISA-AMRHGLNLISHESNSDSESSDSDNKANLYFPVTRSELAAPQRK  186

Query  435  VEPRLVS-EKENDPS-TVLTLSLPAPGSND-----GVSSLQRDQPSYRRGDSTEAAAPAP  277
              P +V  E  ND   T LTL LP   S+      GV   +R Q S   G+S+     A 
Sbjct  187  PPPTVVDVESINDTDLTALTLGLPGTRSDSSEKSIGVRESRRSQGS---GESSRFPITAE  243

Query  276  VKsestltlspellsLMQDMIRKEVETYYSALVIKDGVRNAEVKRIGLGK  127
             +     +L+PELL +MQ++IRKEV  Y S    + G  N  +KR G+ +
Sbjct  244  EEENKPPSLAPELLVVMQELIRKEVRNYLS----EHGEINPGIKRSGISR  289



>gb|ABQ10819.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 141/289 (49%), Positives = 179/289 (62%), Gaps = 28/289 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
            PEEDE+I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+++  N       G
Sbjct  69   PEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNG  128

Query  618  GEPRPGRI-------LKRADSADVTVTAA-----PPGLRVsrdsssdsdisyssnDN--G  481
             +   G         LKR+ SA  +V         PG     D S  S    SSN N   
Sbjct  129  YDADFGNSIQQQPLKLKRSVSAGSSVPVTTGLYMSPGSPSGSDVSDSSVPGLSSNYNIYK  188

Query  480  PAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDS  301
            P A RS  + + +  V     +   NDP T L+ SLP   S+  VS+   +     +  +
Sbjct  189  PVA-RSGGINVDVNVVPEPETTSSSNDPPTSLSPSLPGVDSSSEVSNKVSES---TQAVN  244

Query  300  TEAAAPAPVKsestlt----lspellsLMQDMIRKEVETYYSALVIKDG  166
             +A+ PAPV S+S        S E +++MQ+MI++EV TY +AL  + G
Sbjct  245  AKASVPAPVSSDSGSKGLVGFSKEFMAVMQEMIKQEVRTYMAALEQQRG  293



>ref|XP_007136715.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
 gb|ESW08709.1| hypothetical protein PHAVU_009G068000g [Phaseolus vulgaris]
Length=262

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 158/285 (55%), Gaps = 37/285 (13%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++ V+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  6    DMDRIKGPWSPEEDEALRRFVQIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  65

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT +EDE I K HA+ GNKWATIAR LNGRTDNAIKNHWNSTLKRK      S    +PR
Sbjct  66   FTAKEDETIVKAHARFGNKWATIARFLNGRTDNAIKNHWNSTLKRKC-----SEPPSDPR  120

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
            P + +     +      +  GL  +  +              P A  SV ++L    +  
Sbjct  121  PLKRVASGSDSPSGSDLSDSGLPATSPNPIYQ----------PLA-GSVSVSLVPSTLLA  169

Query  426  RLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltls  247
               S    D +T+L+LSLP   S +G S+     P     +   +     V         
Sbjct  170  ETASSSATDIATLLSLSLPGSNSCNGASNGPGPGPGTNGSEQLLSEELLKV---------  220

Query  246  pellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLG  130
                  MQDMIR EV  Y S L      +  D + NA +KR+G+G
Sbjct  221  ------MQDMIRVEVRNYMSGLERNGVFMQNDAIGNAVLKRMGIG  259



>ref|XP_004305954.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=270

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 135/273 (49%), Positives = 165/273 (60%), Gaps = 43/273 (16%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EEDDLL+KLV++HGARNW+LISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  12   DRVKGPWSPEEDDLLRKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  71

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV--------IGSN  625
             EEDE+IA  H++ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKYS++        +  N
Sbjct  72   AEEDEIIAAAHSKYGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSSMAEDGGGGGVEEN  131

Query  624  EGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPA-AVRSVRLAL  448
            +    RP    K++ +A V+     P           S      +D+G A AV S ++  
Sbjct  132  QYHILRPE---KKSATASVSGRGYSP----------TSPSGSDVSDSGVAPAVTSAQVFW  178

Query  447  PLQAVEPRLVS---EKENDPSTVLTLSLP-----APGSNDGVSSLQRDQPSYRRGDSTEA  292
            P+     R  S     E +PST+LTLSLP     A    +  +SL          + T +
Sbjct  179  PMARAVMRTESPPPRNEPEPSTLLTLSLPGGSEVATRREEKTTSLCLTTSLDENQNRTMS  238

Query  291  AAPAPVKsestltlspellsLMQDMIRKEVETY  193
              P             E +SLMQ+M+RKEV  Y
Sbjct  239  FGP-------------EFMSLMQEMVRKEVRNY  258



>emb|CBI19466.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 166/286 (58%), Gaps = 50/286 (17%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  18   DLDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  77

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED  I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK S    S  G E  
Sbjct  78   FTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSP--SSPSGSE--  133

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
                   +DS       + PG+       + S +       GP       + LP Q +E 
Sbjct  134  ------FSDS-------SAPGM-------ASSLVYRPVPRTGP-------IVLPTQKIE-  165

Query  426  RLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltls  247
               +   NDP T L+LSLP   S +  + L     +   G          +        +
Sbjct  166  --AASSTNDPPTSLSLSLPGSDSCEVSNHLSGSDHNCELG----------LGMSEKPFFT  213

Query  246  pellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGK  127
            PE L++MQ+MIRKEV  Y S +      +  + + NA +KRIG+GK
Sbjct  214  PEFLAVMQEMIRKEVRNYMSGMEQNGLCLQTEAIWNAVMKRIGIGK  259



>ref|XP_011017151.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=305

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 142/305 (47%), Positives = 183/305 (60%), Gaps = 33/305 (11%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            F+ EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++  S++  +  
Sbjct  67   FSAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM--SDDFNDDT  124

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
              + LKR+ S       A  GL ++  S S SD+S SS     ++     LA     V P
Sbjct  125  HQQPLKRSAS-----LGAGSGLYLNPSSPSGSDLSDSSAPGANSSPVYRPLARTASLVPP  179

Query  426  RL---VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKs----  268
             L   VS    DP T L LSLP   + +   S  R +P   +  +  A  PA V +    
Sbjct  180  SLSIDVSSPAADPPTSLCLSLPGSNTCETPGSGSRSRP-VNQTQTPVAPPPAAVTAQQQQ  238

Query  267  ------------estltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKR  142
                              S E L++MQ+MIR+EV +Y S +      +  + +R+A VKR
Sbjct  239  QIPTAQQNVKFGYEKQFFSSEFLAVMQEMIREEVRSYMSGIKQNGLCLGTEAIRSAVVKR  298

Query  141  IGLGK  127
            IG+ +
Sbjct  299  IGISR  303



>gb|ABQ10818.1| putative R2R3-Myb transcription factor [Citrus sinensis]
Length=317

 Score =   210 bits (534),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 140/291 (48%), Positives = 181/291 (62%), Gaps = 32/291 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN--------  625
            PEEDE+I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+++  N        
Sbjct  69   PEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNG  128

Query  624  ------EGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdi--------syssnD  487
                  +  + +P + LKR+ SA  +V     GL +S  S S SD         S + N 
Sbjct  129  YDADFGDSIQQQPLK-LKRSVSAGSSVPVT-TGLYMSPGSPSGSDDSDSSVPGLSSNYNI  186

Query  486  NGPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRG  307
              P A RS  + + +  V     +   NDP T L+LSLP   S+  VS+   +       
Sbjct  187  YKPVA-RSGGINVDVNVVPEPETTSSSNDPPTSLSLSLPGVDSSSEVSNKVSEST---HA  242

Query  306  DSTEAAAPAPVKsestlt----lspellsLMQDMIRKEVETYYSALVIKDG  166
             + +A+ PAP  S+S        S E + +MQ+MI++EV TY +AL  + G
Sbjct  243  VNAKASVPAPASSDSGSKGLVGFSKEFMVVMQEMIKQEVRTYMAALEQQRG  293



>ref|XP_002518677.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF43602.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=245

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED LLKKLV++HGARNW+LISKSIPGRSGKSCRLRWCNQLSPEVEHRPF 
Sbjct  8    DRVKGPWSPEEDLLLKKLVQRHGARNWTLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFA  67

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
            PEEDE+I   H++ GNKWA IAR+LNGRTDNAIKNHWNSTLKRKY A   +++G
Sbjct  68   PEEDEIIVDAHSRFGNKWAAIARLLNGRTDNAIKNHWNSTLKRKYGAAFNNDDG  121



>emb|CAN81361.1| hypothetical protein VITISV_028904 [Vitis vinifera]
Length=309

 Score =   209 bits (532),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 138/315 (44%), Positives = 173/315 (55%), Gaps = 41/315 (13%)
 Frame = -3

Query  972  MADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEH  793
            M    R+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEH
Sbjct  1    MMQIRRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEH  60

Query  792  RPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV----IGSN  625
            R FTPEED  I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK S++    I   
Sbjct  61   RAFTPEEDATIIRAHARFGNKWATIARLLVGRTDNAIKNHWNSTLKRKCSSITEDMIADG  120

Query  624  EGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV----R  457
                P     LKR+ S     T +   L  S  S S+   S +         R V     
Sbjct  121  HAQPP-----LKRSASVGAGTTVSGHNLSPSSXSGSEFSDSSAPGMXSSLVYRPVPRTGP  175

Query  456  LALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAP  277
            + LP Q +E        NDP T L+LSLP   S +  + L        +    ++ A  P
Sbjct  176  IVLPTQKIE---AXSSTNDPPTSLSLSLPGSDSCEVSNHLSGSDHVKIQNQILQSPAIPP  232

Query  276  VK-------------------sestltlspellsLMQDMIRKEVETYYSAL------VIK  172
            V+                          +PE L++MQ+MIRKEV  Y S +      +  
Sbjct  233  VQLQQNPGSPRNIQNCELGLGMSEKPFFTPEFLAVMQEMIRKEVRNYMSGMEQNGLCLQT  292

Query  171  DGVRNAEVKRIGLGK  127
            + + NA +KRIG+GK
Sbjct  293  EAIWNAVMKRIGIGK  307



>gb|KEH31491.1| myb transcription factor [Medicago truncatula]
Length=271

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 173/290 (60%), Gaps = 31/290 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L KLV+++G RNWSLIS++IPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  2    DRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAFS  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE-GGEPRP  604
            PEED +I + HAQ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ IGS++    P+P
Sbjct  62   PEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRDFNPQP  121

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV---  433
               LKR  SA V    +P G  +S                     R V + LP++     
Sbjct  122  ---LKR--SASVGAPGSPSGSDLSDSGVQQ------------TVFRPVPIRLPVETTSEP  164

Query  432  EPRLVSEK-ENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestl  256
            EP  V E  E D   + +LSL  PG +   + L    P      +  A   +       L
Sbjct  165  EPVTVPEAVEEDDGPLTSLSLSLPGVDAAAAVLVSPAPIT----AVTAVTVSEEAGIGAL  220

Query  255  tlspellsLMQDMIRKEVETYY---SALVIK--DGVRNAEVKRIGLGKTN  121
             LS E +++MQ+MI+ EV +Y    + +  +  D +RN   K IG+ + +
Sbjct  221  NLSGEFMAVMQEMIKNEVRSYMEERNGMCFQGVDRLRNVSAKPIGINRVD  270



>ref|XP_008444592.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=296

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 142/293 (48%), Positives = 176/293 (60%), Gaps = 18/293 (6%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ LK+LVE +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  9    DRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK SA+   ++  +P   
Sbjct  69   AEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM--GDDFNDPDLH  126

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV-----RSVRLALPLQA  436
               KR+ S   +      G  ++  S S SD+S SS    P  V     RS  + +P   
Sbjct  127  HPPKRSASVGPSPVTVASGFGLNPSSPSGSDLSDSSPPPPPQPVYRPLARSSSI-VPSNQ  185

Query  435  VEPRLVSEKEN--DPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKses  262
             + +   +  N  DP T L LSLP   S  G  S     P+     +T   A    K   
Sbjct  186  QQQQQQQQIVNSYDPPTSLCLSLPGSNSKSGYGSDSIPSPTRNMVQATTPTAGGHGK--E  243

Query  261  tltlspellsLMQDMIRKEVETYYSAL------VIKDGVRNAEVKRIGLGKTN  121
            +   S E LS MQ+MI+ EV  Y S +      +  D +RNA VKR+G+ K +
Sbjct  244  SELFSAEFLSAMQEMIKIEVRKYMSGIEHNGWHLHTDAIRNAVVKRMGISKID  296



>ref|XP_009392116.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=371

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 153/362 (42%), Positives = 188/362 (52%), Gaps = 74/362 (20%)
 Frame = -3

Query  990  SAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQL  811
            + V     D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  8    TTVVSRFNDVDRIKGPWSPEEDDALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQL  67

Query  810  SPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY--SAV  637
            SP+VEHRPFTPEEDE I + H + GNKWATIAR+L+GRTDNA+KNHWNSTLKR+Y  SA 
Sbjct  68   SPQVEHRPFTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAVKNHWNSTLKRRYSASAT  127

Query  636  IGSNEGG-------EPRPGRILKR---------ADSADVTVTAAPPGLRVsrdsssdsdi  505
              + +GG       EP P R LK+         +D A + ++   P      DSS  S  
Sbjct  128  AVAVDGGFVAAAELEPVPERRLKKTCSDGPLLSSDGAGLCLSPGSPSESDLSDSSYHSHP  187

Query  504  syssnDNGPAAVRSV----RLALPLQA-------VEPRLVS-------EKENDPSTVLTL  379
              S    G    R V     + LP  +        EP   +       E   DP T LTL
Sbjct  188  MISPVSTGSHIYRPVPRTGAVVLPSSSTPNHHHPTEPSAAAAATSCSPEIVEDPVTSLTL  247

Query  378  SLPA-----------PGSNDG-----------VSSLQRDQPSYRRGDSTEAAAPAPVKse  265
            SLP               NDG           V    + +PS  +  S EA    P   E
Sbjct  248  SLPGSDPMDTCNDRHSADNDGNGQKPLELLPSVPMPLQARPSSSKTRSAEATGATPCCKE  307

Query  264  st-----ltlspellsLMQDMIRKEVETYYSAL-----------VIKDGVRNAEVKRIGL  133
                        E L+ MQ++IRKEV +Y S+L           +  + V NA ++RIG+
Sbjct  308  EQGWHAPCPFGAEFLAAMQELIRKEVRSYMSSLEQSGMMCTRFPLPPESVLNAGIRRIGI  367

Query  132  GK  127
             K
Sbjct  368  TK  369



>ref|XP_010679545.1| PREDICTED: transcription factor MYB44 [Beta vulgaris subsp. vulgaris]
Length=313

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 183/325 (56%), Gaps = 45/325 (14%)
 Frame = -3

Query  1011  NLNRLCLSAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCR  832
             N N  C S+      + DR+KGPWS EED+ L +LV++HG RNWSLISKSIPGRSGKSCR
Sbjct  2     NRNNTCSSSDNNNRKEVDRIKGPWSPEEDEALTRLVQKHGPRNWSLISKSIPGRSGKSCR  61

Query  831   LRWCNQLSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKR  652
             LRWCNQLSP+VEHR FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKR
Sbjct  62    LRWCNQLSPQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKR  121

Query  651   KYSAVIGSNE----GGEPRPGRILKRA--DSADVTVTAAPPGLRVsrdsssdsdisyssn  490
             K SA++ S      G  P P   LKRA  D ADV +      +     ++++++ +  S 
Sbjct  122   KCSAMLSSPSDEFPGDYPPP---LKRAMSDGADVILK----NVSGLSLNNNNNNNNPGSP  174

Query  489   DNGPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAP-----GSNDGVSSLQRDQ  325
              +  A+     +  P+    P  +      P+T L+LSLP       GSN     +    
Sbjct  175   GSSDASDSGSHVFRPVAIPGPVNIGPA---PATDLSLSLPGSDCCCEGSNSDYEPVIAVS  231

Query  324   PSYRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSALVIK---------  172
             P       T  A  +P     T   S E +++MQ+MI+KEV TY   + +          
Sbjct  232   PI-----QTFPAMNSPAMISPTSAFSQEFVAMMQEMIKKEVRTYMEGIEMSNNNNGVGGF  286

Query  171   ----------DGVRNAEVKRIGLGK  127
                       DGV  A + RIG+GK
Sbjct  287   NYGGFCSQAADGVMRAAMSRIGIGK  311



>gb|ABR28330.1| MYB transcription factor MYB8 [Medicago truncatula]
Length=269

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/286 (47%), Positives = 171/286 (60%), Gaps = 31/286 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L KLV+++G RNWSLIS++IPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  2    DRIKGPWSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAFS  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE-GGEPRP  604
            PEED +I + HAQ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ IGS++    P+P
Sbjct  62   PEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRDFNPQP  121

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV---  433
               LKR  SA V    +P G  +S                     R V + LP++     
Sbjct  122  ---LKR--SASVGAPGSPSGSDLSDSGVQQ------------TVFRPVPIRLPVETTSEP  164

Query  432  EPRLVSEK-ENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestl  256
            EP  V E  E D   + +LSL  PG +   + L    P      +  A   +       L
Sbjct  165  EPVTVPEAVEEDDGPLTSLSLSLPGVDAAAAVLVSPAPIT----AVTAVTVSEEAGIGAL  220

Query  255  tlspellsLMQDMIRKEVETYY---SALVIK--DGVRNAEVKRIGL  133
             LS E +++MQ+MI+ EV +Y    + +  +  D +RN   K IGL
Sbjct  221  NLSGEFMAVMQEMIKNEVRSYMEERNGMCFQGVDRLRNVSAKPIGL  266



>gb|AHB59592.1| putative R2R3 MYB protein 4 [Arachis hypogaea]
Length=316

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 180/317 (57%), Gaps = 47/317 (15%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LVE+HG RNW+LISK IPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQRLVERHGPRNWTLISKYIPGRSGKSCRLRWCNQLSPQVEHRGFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP---  610
            P+EDE I + HA+ GNKWATIAR+L+GRTDNA+KNHWNSTLKRK S+++       P   
Sbjct  69   PDEDETIIRAHARFGNKWATIARLLSGRTDNAVKNHWNSTLKRKCSSMMIDEPATGPADF  128

Query  609  ------RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV---R  457
                  RP    KR+ SA  T+  +  GL +S  S      S +S+     +VR+V    
Sbjct  129  DGGYYLRPA---KRSASAGATMPLST-GLHMSPTSPGSPSGSDASD----CSVRAVSPSH  180

Query  456  LALPLQ--AVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDS------  301
            +  P+Q   V P   +    DP T L+LSLP  G +  V    R   S  R  S      
Sbjct  181  VLRPVQRTVVPPIETASSSEDPPTSLSLSLP--GVDVAVEVSNRVTESMSRAFSPAMVMA  238

Query  300  -------TEAAAPAPV-----KsestltlspellsLMQDMIRKEVETYYS-----ALVIK  172
                      A P P+     +  +    S EL+++MQ+MIRKEV +Y            
Sbjct  239  SAAPSTAVTTADPLPLPSPQHQVVAPFNFSAELMAVMQEMIRKEVRSYMEQRNGMCFQAA  298

Query  171  DGVRNAEVKRIGLGKTN  121
             G RN  V R+G+ K N
Sbjct  299  GGFRNVSVNRVGISKVN  315



>ref|NP_001235731.1| MYB transcription factor MYB178 [Glycine max]
 gb|ABH02834.1| MYB transcription factor MYB178 [Glycine max]
Length=178

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 9/143 (6%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  10   DRIKGPWSPEEDEALQKLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE----GGE  613
            PEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK ++ + ++E    G  
Sbjct  70   PEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMTADEAAAGGFS  129

Query  612  PRPGRILKRADSADVTVTAAPPG  544
            PRP   LKR+ SA   V   PPG
Sbjct  130  PRP---LKRSFSAGTAVP--PPG  147



>emb|CDP02540.1| unnamed protein product [Coffea canephora]
Length=365

 Score =   209 bits (533),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 129/250 (52%), Positives = 154/250 (62%), Gaps = 20/250 (8%)
 Frame = -3

Query  1005  NRLCLSAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLR  826
             N +  S       D+DR+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLR
Sbjct  6     NNISASTTITVRKDADRIKGPWSPEEDDLLQQLVQKHGPRNWSLISKSIPGRSGKSCRLR  65

Query  825   WCNQLSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
             WCNQLSP+VEHR FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK 
Sbjct  66    WCNQLSPQVEHRAFTPEEDDAIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKC  125

Query  645   SAVIGSNEGGEPRP----GRILKRADSADVTVTAAP-----PGLRVsrdsssdsdisyss  493
             S++  S+E     P     + LKR  S       +      PG     D SS S  + SS
Sbjct  126   SSITSSDEATNDFPLHHHHQPLKRTASTGSGGHVSGGLSLNPGSPSGSDVSSSSLPNTSS  185

Query  492   nDNGPAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYR  313
             +       R+  +  P Q VE    SE   DP T L+LSLP      GV S    + S R
Sbjct  186   SHVFKPVARAGPVLPPHQVVE--TTSENITDPPTSLSLSLP------GVDST---EASTR  234

Query  312   RGDSTEAAAP  283
               DST+   P
Sbjct  235   STDSTQPKVP  244



>gb|AHB59606.1| putative MYB-related protein 20 [Arachis hypogaea]
Length=352

 Score =   209 bits (532),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 143/211 (68%), Gaps = 7/211 (3%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  14   DMDRIKGPWSPEEDDALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  73

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  A +G  +  +P 
Sbjct  74   FTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRK-CASMGPID--DPH  130

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS-VRLALPLQA--  436
              + LKR+ SA   V  +  GL ++  +      S  S  + PAA  S V   +P     
Sbjct  131  FAQPLKRSVSAGAAVPVS-TGLYMNPPTPGSPSGSDVSESSVPAASTSHVFRPVPRAGGV  189

Query  435  VEPRLVSEKENDPSTVLTLSLPAPGSNDGVS  343
            V P   +    DP T L+LSLP   SN  VS
Sbjct  190  VPPVETTSSSYDPPTSLSLSLPGVDSNSEVS  220



>ref|XP_010556427.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=316

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 182/312 (58%), Gaps = 36/312 (12%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D+DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  11   DTDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI--GSNEGGE  613
            FT EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++   GS++   
Sbjct  71   FTAEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMADGGSSDADL  130

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV  433
             +P   LKR+ S     T     L ++  S + S++S SS   G  AV +  +  P  A 
Sbjct  131  EQP---LKRSASLGAG-TNLSTCLSLNPGSPAGSELSDSSLPGGCCAVSASPVYRP--AA  184

Query  432  EPRLVSEKENDPSTVLTLSLPAPG----------SNDGVSSLQRDQP----SYRR-----  310
                V     DP T L+LSLP  G          SN   S      P    S+ R     
Sbjct  185  RTGAVLPPATDPPTSLSLSLPGSGLSEPMSHGSDSNRVTSPPSHHHPLPKHSFARLPPAP  244

Query  309  ---GDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSALVIK------DGVRN  157
                  ++               S E L+++Q+MIR+EV +Y S +  K      + +RN
Sbjct  245  PPPPPPSQEVHGGGEMGLDEQFFSKEFLAVLQEMIRQEVRSYMSGIDQKGICFQTEAIRN  304

Query  156  AEVKRIGLGKTN  121
            A VKRIG+ K +
Sbjct  305  AVVKRIGISKID  316



>ref|XP_002302428.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
 gb|EEE81701.2| hypothetical protein POPTR_0002s12410g, partial [Populus trichocarpa]
Length=321

 Score =   207 bits (527),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 184/315 (58%), Gaps = 39/315 (12%)
 Frame = -3

Query  993  LSAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQ  814
            LS + R   D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQ
Sbjct  18   LSYILR--KDVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQ  75

Query  813  LSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI  634
            LSPEVEHRPF+ EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++ 
Sbjct  76   LSPEVEHRPFSAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMS  135

Query  633  GS-NEGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVR  457
               N+    +P   LKR+ S       A  GL ++  S S SD+S SS     ++     
Sbjct  136  DDLNDDAHQQP---LKRSAS-----LGAGSGLYLNPSSPSGSDLSDSSVPGVNSSPVYRP  187

Query  456  LALPLQAVEPRL---VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAA  286
            LA     V P L   VS    DP T L LSLP   + +   S  R   +  +  +  A  
Sbjct  188  LARTASLVPPSLSIDVSSPTADPPTSLCLSLPGSNTCETPGSGSR---AVSQTQTPVAPP  244

Query  285  PAPVKs----------------estltlspellsLMQDMIRKEVETYYSAL------VIK  172
            PA V                        S E L++MQ+MIRKEV +Y S +      +  
Sbjct  245  PAAVTVQQQQQIPAAQENVEFGYEKQFFSSEFLAVMQEMIRKEVRSYMSGIKQNGLCLGT  304

Query  171  DGVRNAEVKRIGLGK  127
            + +R+A VKRIG+ +
Sbjct  305  EAIRSAVVKRIGISR  319



>gb|EYU36318.1| hypothetical protein MIMGU_mgv1a022221mg, partial [Erythranthe 
guttata]
Length=288

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 135/315 (43%), Positives = 172/315 (55%), Gaps = 62/315 (20%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS +EDDLL++LVE+HG RNWSLISKSI GRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPDEDDLLQRLVEKHGPRNWSLISKSILGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK--------YSAVIGS  628
            TP+ED+ I + H + GNKWATIAR L+GRTDNAIKNHWNSTLKRK        +S+    
Sbjct  62   TPQEDDAIIEAHFKYGNKWATIARFLSGRTDNAIKNHWNSTLKRKCLSMSEEYFSSFDPE  121

Query  627  NEGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL  448
             +  +P     LKR+ S       +P G   S  +                  R V    
Sbjct  122  AQQQQPP----LKRSASVGPGSDISPSGSDTSDSTHHHL-------------YRPVARTC  164

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPAPGSN-----DGVSSLQRDQPSYRRGDSTEAAAP  283
            P+         E + D  T L+LSLP   +N     D    L+ +QP+   G       P
Sbjct  165  PI---------ELQTDLVTSLSLSLPGSDTNQKPEPDSNQKLRMEQPAL--GTGPTLLQP  213

Query  282  APV-------------KsestltlspellsLMQDMIRKEVETYYSA--------LVIKDG  166
            AP+             +  S    S E L++MQ+M+RKEV  Y +          V  + 
Sbjct  214  APIAHIAMPPPPPPAAQLPSQQFFSAEFLAVMQEMVRKEVREYMAGNGVDRNGLCVQSEV  273

Query  165  VRNAEVKRIGLGKTN  121
            +RNA VKR+G+ K N
Sbjct  274  IRNAVVKRMGISKIN  288



>ref|NP_001235142.1| MYB transcription factor MYB112 [Glycine max]
 gb|ABH02852.1| MYB transcription factor MYB112 [Glycine max]
Length=305

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 139/312 (45%), Positives = 177/312 (57%), Gaps = 41/312 (13%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDEALQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK ++ +  ++   P   
Sbjct  62   HEEDDTIIRAHARFGNKWATIARLLHGRTDNAIKNHWNSTLKRKCTSTMIDDDNTPP---  118

Query  600  RILKRADSADVTVTAAPPGLRVs-----rdsssdsdisyssnDNGPAAVRSV-RLALPLQ  439
              LKR+ SA   +  +  GL ++       S SD   S     +     R V R    L 
Sbjct  119  --LKRSLSAGAAIPVS-TGLYMNPPTPGSPSGSDVSESSVLVASSSHVFRPVPRTGAVLP  175

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKs---  268
             VE    +   NDP T L+LSL  PG +    S +  +P +          P P+ +   
Sbjct  176  PVE-TTTTLSSNDPPTSLSLSL--PGVDSSEVSNRTTEPIHAAPPPPPQPQPQPLNTIPL  232

Query  267  -------------estltlspellsLMQDMIRKEVETYYS----------ALVIKDGVRN  157
                          +    S E L++MQ+MIRKEV +Y               + DG RN
Sbjct  233  LPMMTVPSVSPTGMAPFNFSAEFLAVMQEMIRKEVRSYMELHNQKNGMCFQAAVNDGFRN  292

Query  156  AEVKRIGLGKTN  121
            A VKRIG+ + +
Sbjct  293  ASVKRIGISRVD  304



>ref|XP_007042527.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX98358.1| Myb domain protein 73, putative [Theobroma cacao]
Length=245

 Score =   203 bits (517),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 135/284 (48%), Positives = 160/284 (56%), Gaps = 52/284 (18%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED+LL+KLV + G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  4    DFDRVKGPWSPEEDELLRKLVLRLGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRA  63

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN--EGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S   G +  E G+
Sbjct  64   FTPEEDETIVRAHARYGNKWATIARLLNGRTDNAVKNHWNSTLKRKLSMEDGDSLQETGK  123

Query  612  PRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV  433
                R  K   SA      +P G  VS                         L L +   
Sbjct  124  ----RSAKSQRSASSNNMGSPSGSDVSD------------------------LGLNVAES  155

Query  432  EPRLVSEKENDPSTVLTLSLPAPGS---NDGVSSLQRDQPSYRRGDSTEAAAPAPVKses  262
            E   V       ST LTL   +  S   N+  SS ++   + +    T+ A   P     
Sbjct  156  ERSGV-------STELTLGRSSNESSELNNDNSSSEKVLLAQKHEMGTKTATVDP-----  203

Query  261  tltlspellsLMQDMIRKEVETYYSALVIK-DGVRNAEVKRIGL  133
                   L++ MQ+MIRKEV    +    + +GVRNA  KRIG+
Sbjct  204  ------NLMAAMQEMIRKEVRDCMAEFGFQSEGVRNAGFKRIGI  241



>ref|XP_009587267.1| PREDICTED: transcription factor MYB44-like [Nicotiana tomentosiformis]
Length=269

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 131/277 (47%), Positives = 159/277 (57%), Gaps = 30/277 (11%)
 Frame = -3

Query  981  FRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPE  802
               + ++ R+KGPWS EED+LL++LVE+HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+
Sbjct  1    MEAIKETGRIKGPWSPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQ  60

Query  801  VEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE  622
            VEHRPFT EEDE I K HA++GNKWATIAR L+GRTDNAIKNHWNSTLKRK  +   S++
Sbjct  61   VEHRPFTAEEDETILKAHAKLGNKWATIARFLSGRTDNAIKNHWNSTLKRKCPST--SDD  118

Query  621  GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL  442
                 P + LKR+ S      +  PG       S        S   G A     R A   
Sbjct  119  LSFETPQQPLKRSSSIGPGTISMNPG-------SPSGSDLSDSGFPGIAQSNVYRPAARP  171

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPA------  280
              V P  V     DP T L+LSLP  G N+      R  P     D   ++AP       
Sbjct  172  SGVLPPSVP----DPPTFLSLSLPGSGFNEATG---RVTPQVAEPDPAPSSAPGIMPQNL  224

Query  279  PV--------KsestltlspellsLMQDMIRKEVETY  193
            PV                SPE L+++Q+MI KEV+ Y
Sbjct  225  PVIENYSFGPSIMEKQLFSPEFLAVLQNMIHKEVKNY  261



>ref|XP_004141899.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004157164.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN48557.1| Sucrose responsive element binding protein [Cucumis sativus]
Length=301

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    DMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            F+PEEDE I + HA  GN+WATIAR+L GRTDNA+KNHWNSTLKRK S ++  NEG E  
Sbjct  67   FSPEEDETIIRAHANFGNRWATIARLLTGRTDNAVKNHWNSTLKRKCSLMM--NEGYEVD  124

Query  606  PG-RILKRADSADVTVTAA  553
            P  + +K++ SA   V A+
Sbjct  125  PNVQPMKKSVSAGAAVNAS  143



>ref|XP_009372447.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=316

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 143/311 (46%), Positives = 177/311 (57%), Gaps = 34/311 (11%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED++I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S   G +  G   
Sbjct  67   FTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDGGGVDLNGA-Y  125

Query  606  PGRI--------LKRADSADVTV---------TAAPPGLRVsrdsssdsdisyssnDNGP  478
             G +        LKR+ SA   V           +P G  VS  S+    +S       P
Sbjct  126  DGHVLHDHEQPPLKRSVSAGSGVPVSTGLYMSPGSPSGSDVSDSSAQVMSLSDCHVYR-P  184

Query  477  AAVRSVRLALPLQAV---EPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRG  307
             A R+  +  P +          + ++NDP T L+LSLP     +  + + R     +  
Sbjct  185  VA-RTGGVLPPAETTSSSNNNSSNSEKNDPPTSLSLSLPGVDPEEVSNQVARASWPTQAP  243

Query  306  DSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL-----------VIKDGVR  160
                A AP    S +   +  ELL++MQ MIRKEV  Y + L              +G R
Sbjct  244  APAPAPAPVSTTSVAVQNIPVELLAVMQGMIRKEVRNYMAGLEQSGVCFQQAAAGNEGFR  303

Query  159  NAEVKRIGLGK  127
            N  VKRIG  +
Sbjct  304  NVGVKRIGFSR  314



>ref|XP_006374871.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
 gb|ERP52668.1| hypothetical protein POPTR_0014s02260g [Populus trichocarpa]
Length=311

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 181/322 (56%), Gaps = 61/322 (19%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS-NEGGEP  610
            F+ EED+ I + HA++GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++    N+  + 
Sbjct  67   FSAEEDDTIIRAHARIGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMFDDLNDDAQQ  126

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAA------VRSVRLAL  448
            +P   LKR+ S       A  GL ++  S S SD+S SS     ++      V++  L  
Sbjct  127  QP---LKRSAS-----LGAGSGLHLNPSSPSGSDLSDSSIPGVNSSPVFRPPVKTASLVP  178

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPV--  274
            P  +++   VS    DP T L+LSLP         S+    P       +    P P+  
Sbjct  179  PSLSID---VSSPTVDPPTSLSLSLPG--------SITCQAPGSGSSSGSHVVNPTPMVQ  227

Query  273  ---------------------------KsestltlspellsLMQDMIRKEVETYYSAL--  181
                                               S E L++MQ+MIRKEV  Y S +  
Sbjct  228  TPAAPPQAAVAVQQQEQVSFLQQKNPGSRLENQFFSAEFLAVMQEMIRKEVRNYMSGIEQ  287

Query  180  ----VIKDGVRNAEVKRIGLGK  127
                +  + +RNA VKRIG+ +
Sbjct  288  NGLCLGTEAIRNAVVKRIGISR  309



>gb|KDP41681.1| hypothetical protein JCGZ_16088 [Jatropha curcas]
 gb|AIT52202.1| MYB family protein [Jatropha curcas]
Length=313

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 182/312 (58%), Gaps = 40/312 (13%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  8    DVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT +ED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++         +
Sbjct  68   FTADEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSDDLNDDVQQ  127

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAA------VRSVRLALP  445
            P   LKR  SA V       GL ++  S S SD+S SS     ++       R+  L  P
Sbjct  128  P---LKR--SASVGAGTNISGLHLNPSSPSGSDVSDSSLPGMASSPVYRPLARTGSLVPP  182

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSL--QRDQPSYRRGDS------TEAA  289
              +++    +    DP T L+LSLP   S +  + +        +  G S      T A 
Sbjct  183  GPSID---ATSSTTDPPTSLSLSLPGSDSCEASNQVSGSGSGSGFNHGLSPTHVVQTPAM  239

Query  288  APA--PVKsestltlsp----------ellsLMQDMIRKEVETYYSAL------VIKDGV  163
             PA  PV+    +  +           E L++MQ+MIRKEV  Y S +         + +
Sbjct  240  PPATLPVQQVPAVQQNCVGFEKQFFNPEFLAVMQEMIRKEVRNYMSGIEQNGMCFQTEAI  299

Query  162  RNAEVKRIGLGK  127
            RNA VKRIG+ +
Sbjct  300  RNAVVKRIGISR  311



>ref|XP_008440323.1| PREDICTED: transcription factor MYB44 [Cucumis melo]
Length=303

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 114/139 (82%), Gaps = 3/139 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  7    DMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            F+PEEDE I + HA  GN+WATIAR+L GRTDNA+KNHWNSTLKRK S ++  NEG E  
Sbjct  67   FSPEEDETIIRAHANFGNRWATIARLLTGRTDNAVKNHWNSTLKRKCSLMM--NEGYEVD  124

Query  606  PG-RILKRADSADVTVTAA  553
            P  + +K++ SA   V A+
Sbjct  125  PNVQPMKKSLSAGAAVNAS  143



>gb|ABL97967.1| R2R3-MYB transcription factor [Brassica rapa]
Length=266

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 131/204 (64%), Gaps = 18/204 (9%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S     N   E   
Sbjct  62   SPEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS---DGNPTAEEEQ  118

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                KR   +  +V     GL +              +   PA V S   A+P Q  +P 
Sbjct  119  DPAKKRRSMSSESVPPVDTGLYM--------------SPESPADVGSDSSAVPPQLFKP-  163

Query  423  LVSEKENDPSTVLTLSLPAPGSND  352
            + S  E DP+T L+LSL  P S +
Sbjct  164  MTSSAEEDPATTLSLSLSVPVSQE  187



>ref|XP_010531261.1| PREDICTED: transcription factor MYB44 [Tarenaya hassleriana]
Length=326

 Score =   204 bits (520),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 138/284 (49%), Positives = 165/284 (58%), Gaps = 24/284 (8%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            + +R+KGPWS EEDDLL+KLV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    EMERIKGPWSPEEDDLLQKLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG----  619
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK   ++   EG    
Sbjct  68   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCVTMVSGGEGQSYD  127

Query  618  --------GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS  463
                    G       LKR  S    V+    GL ++  S S SD+S  SN   P A   
Sbjct  128  FVSNGGYDGNLTAEHPLKRTASGGGVVST---GLYMNPGSPSGSDVSDQSNGPFPPASLV  184

Query  462  VRLALPLQAVEPRLVSEKENDPSTVLTLSLP--APGSNDGVSSLQRD--QPSYRRGDSTE  295
             +      AVE    S    DP T L+LSLP    G     + +     Q +  RG  T 
Sbjct  185  YKPTARAGAVE-VTSSSSAGDPPTYLSLSLPWAENGEKSAAAGVTESMIQKTRTRGGYTA  243

Query  294  AAAPAPVKsestltlsp----ellsLMQDMIRKEVETYYSALVI  175
               PA  + E    L      E ++++ DMIR EV +Y + L +
Sbjct  244  ELFPARREEERASGLMTGFNGEFMTVVHDMIRAEVRSYMTDLQL  287



>ref|XP_006411909.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
 gb|ESQ53362.1| hypothetical protein EUTSA_v10025742mg [Eutrema salsugineum]
Length=321

 Score =   204 bits (520),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 136/208 (65%), Gaps = 22/208 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV-----IGSNEG-  619
            PEEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK SAV      G N G 
Sbjct  70   PEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAVASDGDFGGNGGY  129

Query  618  ----GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVR-SVRL  454
                GE +P   LKR  S    V+    GL +    S         +  GP   + +VR 
Sbjct  130  DGNLGEEQP---LKRTASGGGGVST---GLYM-SPGSPSGSDVSEQSSGGPHVFKPTVRS  182

Query  453  ALPLQAVEPRLVSEKENDPSTVLTLSLP  370
                 A+     S    DP T L+LSLP
Sbjct  183  G----AMAEVTASSSGGDPPTYLSLSLP  206



>ref|XP_010057256.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW74299.1| hypothetical protein EUGRSUZ_E02958 [Eucalyptus grandis]
Length=296

 Score =   203 bits (517),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 104/111 (94%), Gaps = 0/111 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D+DRVKGPWS +EDDLL+KLV++HGARNWSLIS+SIPGRSGKSCRLRWCNQLSP VEHRP
Sbjct  13   DADRVKGPWSPDEDDLLRKLVQRHGARNWSLISRSIPGRSGKSCRLRWCNQLSPGVEHRP  72

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI  634
            FT EED++I + HA+ GN+WATIAR+L+GRTDNAIKNHWNSTLKRKY+A I
Sbjct  73   FTAEEDDLIVRAHAKYGNRWATIARLLSGRTDNAIKNHWNSTLKRKYAAAI  123



>ref|XP_011029247.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=311

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 178/322 (55%), Gaps = 61/322 (19%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  7    DVDRIKGPWSPEEDEALQRLVQTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS-NEGGEP  610
            F+ EED+ I + HA++GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++    N+  + 
Sbjct  67   FSAEEDDTIIRAHARIGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMFDDLNDDAQQ  126

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQA--  436
            +P   LKR+ S       A  GL ++  S S SD+S SS    P    S     P +   
Sbjct  127  QP---LKRSAS-----LGAGSGLHLNPSSPSGSDLSDSSI---PGVNSSPVFRPPAKTAS  175

Query  435  -VEPRL---VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPV--  274
             V P L   VS    DP T L+LSLP         S+    P       +    P P+  
Sbjct  176  LVPPSLSIDVSSPTVDPPTSLSLSLPG--------SITCQTPGSGSSSGSHVVNPTPMVQ  227

Query  273  ---------------------------KsestltlspellsLMQDMIRKEVETYYSAL--  181
                                               S E L++MQ+MIRKEV  Y S +  
Sbjct  228  TAAAPPQAAVAVQQQEQVSFLQQKNPGSRLENQFFSAEFLAVMQEMIRKEVRNYMSGIEQ  287

Query  180  ----VIKDGVRNAEVKRIGLGK  127
                +  + +RNA VKRIG+ +
Sbjct  288  NGLCLGTEAIRNAVVKRIGISR  309



>gb|KDP31997.1| hypothetical protein JCGZ_12458 [Jatropha curcas]
 gb|AIT52201.1| MYB family protein [Jatropha curcas]
Length=326

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 139/212 (66%), Gaps = 14/212 (7%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DVDRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVI--GSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++   G    G 
Sbjct  67   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMAEDGGAFDGN  126

Query  612  PRPGRILKRADSADVTVTAAP-----PGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL  448
             +P   LKR+ SA   +  +      PG     D S  S    SS+       R+  +  
Sbjct  127  CQP---LKRSVSAGSGMAVSTGLYMSPGSPSGSDVSDSSVPVLSSSHVYRPVARTGAVIP  183

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPAPGSND  352
            P++       S   NDP T L LSLP   S++
Sbjct  184  PVETTS----SSNNNDPPTSLCLSLPGVDSSE  211



>ref|XP_011074411.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=327

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/328 (40%), Positives = 169/328 (52%), Gaps = 55/328 (17%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EEDDLL++LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    ETDRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I K HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++       +P 
Sbjct  69   FTPEEDDTIIKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCLSMSEEFSNFDPE  128

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV--RLALPLQAV  433
                LKR+ S       +  G       S        S+ +G    R V     +  Q V
Sbjct  129  AHPPLKRSASVGPGTNISVSGF-CFNPGSPSESAMSDSSQSGQHVYRPVARTCGISPQDV  187

Query  432  EPRLVSEKENDPSTVLTLSLPAPGSNDGVS------------------------SLQRDQ  325
            +P        DP T L+LSLP    N   +                        S+Q + 
Sbjct  188  QP--------DPVTSLSLSLPGTEPNQKTATEPHFKPTSTPNPELTMEPTLKPESIQPNH  239

Query  324  P-----SYRRGDSTEAAAPAPVKsestltlspellsLM---------QDMIRKEVETYYS  187
            P     S+          P P +  +                     Q+M+RKEV  Y +
Sbjct  240  PTQIIQSHPPPPYVAMPPPLPTQHFNPAATQGVPEKQFFSAEFLAVMQEMVRKEVWNYMA  299

Query  186  AL------VIKDGVRNAEVKRIGLGKTN  121
             +      +  + +R+A VKRIG+ K +
Sbjct  300  GIEQNGFCMQSEAIRDAVVKRIGISKID  327



>ref|XP_009360105.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=315

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 174/312 (56%), Gaps = 41/312 (13%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEELQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV---IGSNEGGEP  610
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++   + S+    P
Sbjct  69   PEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMSEDLSSDVHAHP  128

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL------  448
               R      SA V   +   GL  +  S S SD+S SS   G +    V   L      
Sbjct  129  PHKR------SASVGAVSG-TGLYFNPGSPSGSDLSDSSLHGGVSPSSQVFTPLARPVPP  181

Query  447  -PLQAVEPRLVSEKENDPSTVLTLSLPAP----GSNDGVSSLQRD---QPSYRRGDSTEA  292
                       S    DP T L+LSLP      GSN   S    +    P+       E 
Sbjct  182  PIAPPPMEAATSAVAVDPPTSLSLSLPGSESCDGSNHTASGFGSNPIVSPTQMVEQPHEV  241

Query  291  AAPAPVK-----------sestltlspellsLMQDMIRKEVETYYSAL------VIKDGV  163
            AAP PV            +      S E L +M +MIRKEV  Y + +      +  + +
Sbjct  242  AAPLPVVGLLPPPRQSNLNNDQRFFSSEFLDVMHEMIRKEVRNYMTGIEQTGQCMHTEAI  301

Query  162  RNAEVKRIGLGK  127
            RNA +KRIG+ K
Sbjct  302  RNAVIKRIGISK  313



>ref|XP_006404809.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
 gb|ESQ46262.1| hypothetical protein EUTSA_v10000438mg [Eutrema salsugineum]
Length=296

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 125/271 (46%), Positives = 152/271 (56%), Gaps = 24/271 (9%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    ETDRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE--  613
            F+ EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S    S+EG    
Sbjct  68   FSAEEDDTILRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGWTSDEGQSCD  127

Query  612  --PRPGRILKRADSADVTVTAAPPGLRVsrdsssd----sdisyssnDNGPAAVRSVRLA  451
                 G      D   +  TA+  G  VS          S    S   +GP    S  + 
Sbjct  128  FGGNGGYDGNLTDEQPLKRTASGGGGAVSTGLFMSPGSPSGSDVSEQSSGPNLPSSSHVF  187

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQ-RDQPSYRRGDSTEAAAPAPV  274
             P       ++     DP+T L+LSLP     D V     R +    RG S  +     V
Sbjct  188  KPTARAGGVVIESTAKDPATSLSLSLPWSQQRDTVELFPVRKEEEKERGISGFSGDFMTV  247

Query  273  KsestltlspellsLMQDMIRKEVETYYSAL  181
                           +Q+MI+ EV +Y + L
Sbjct  248  ---------------VQEMIKTEVRSYMADL  263



>gb|AHN60131.1| MYB transcription factor 77 [Brassica napus]
Length=265

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 130/204 (64%), Gaps = 18/204 (9%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S     N   E   
Sbjct  62   SPEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS---DGNPTAEEDQ  118

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                KR   +  +V     GL +              +   P  V S   A+P Q  +P 
Sbjct  119  DPAKKRRSMSSESVPPVDTGLYM--------------SPESPTDVGSDSSAVPPQRFKP-  163

Query  423  LVSEKENDPSTVLTLSLPAPGSND  352
            + S  E DP+T L+LSL  P S +
Sbjct  164  MTSSSEEDPATTLSLSLSVPVSQE  187



>gb|AEO27498.1| MYB2 [Chrysanthemum x morifolium]
Length=315

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 114/143 (80%), Gaps = 4/143 (3%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS +ED++L  LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    DMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS--NEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++     NE   
Sbjct  68   FTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTNEEFNELQV  127

Query  612  PRPGRILKRADSADVTVTAAPPG  544
             +P  +LKR+ SA   V  + PG
Sbjct  128  QQP--MLKRSVSAGSGVPISSPG  148



>emb|CDY22442.1| BnaC03g61550D [Brassica napus]
Length=275

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 127/203 (63%), Gaps = 24/203 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EED+LL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE I + HA+ GNKWATI+R+L+GRTDNAIKNHWNSTLKRK SAV      G     
Sbjct  70   PEEDETIVRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCSAVTSDGYDGNIGEE  129

Query  600  RILKRADSADVTVTA------APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ  439
            + LKR  S     T       +P G  V              +  GP   RS        
Sbjct  130  QPLKRTASGGGVSTELYMSPRSPSGSDV-----------SEQSGGGPHVFRS-------G  171

Query  438  AVEPRLVSEKENDPSTVLTLSLP  370
            AV     S    DP T L+LSLP
Sbjct  172  AVNEMTASSSGADPPTYLSLSLP  194



>ref|XP_004291065.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 151/211 (72%), Gaps = 14/211 (7%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
            A +DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR
Sbjct  9    AAADRIKGPWSPEEDEALQRLVQSYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  68

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP  610
            PFTPEED+ I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK+S+ +  +   E 
Sbjct  69   PFTPEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKFSS-MSDDMSPEH  127

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssn----DNGPAAVRSVRLALPL  442
            +P   LKR+ S     T +  GL ++  S S SD+S SS      +  AA R V + +  
Sbjct  128  QP---LKRSASVGAGTTVS--GLYLNPGSPSGSDLSDSSLPGVIPHSQAAFRPVAMTV-A  181

Query  441  QAVEPRLVSEKENDPSTVLTLSLPAPGSNDG  349
              VEP  ++    DP T L+LSL  PGSN+G
Sbjct  182  PPVEPVALAVAV-DPPTSLSLSL--PGSNEG  209



>ref|XP_006339846.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=371

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED+LL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ + ++EG E
Sbjct  67   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-LSADEGNE  123



>ref|XP_009588514.1| PREDICTED: transcription factor MYB44 [Nicotiana tomentosiformis]
Length=361

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED+LL++LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  11   DMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ + ++EG E
Sbjct  71   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSS-LSADEGNE  127



>gb|AGN52056.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52166.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=257

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 126/289 (44%), Positives = 159/289 (55%), Gaps = 42/289 (15%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL++LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDDLLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I K HA+ GNKWATIAR L+GRTDNAIKNHWNSTLKRK  ++       +P   
Sbjct  62   AEEDDTIIKAHAKFGNKWATIARFLSGRTDNAIKNHWNSTLKRKCFSMSEELTDFDPEVH  121

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
              LKR      + +A PPG     +  S S    S +   P                 R 
Sbjct  122  HPLKR------SASAGPPGSAFCFNPGSPSGSDDSGHSAHPVY---------------RP  160

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltlspe  241
            V+     P  V +LSL  PG+    + +  D              P P  +      S E
Sbjct  161  VARPAPQPHIVTSLSLSLPGTEPAPAVMDPD------------PDPQPRWAAEKQFFSAE  208

Query  240  llsLMQDMIRKEVETYYSALVIKDG---------VRNAEVKRIGLGKTN  121
             L +MQ++IRKEV  Y   + ++           + N  +K++G+ K +
Sbjct  209  FLGVMQEIIRKEVRNYMVGMEMEHKGQCMQSDAMMINGVIKQMGMSKVD  257



>ref|XP_009418521.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=339

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 191/348 (55%), Gaps = 66/348 (19%)
 Frame = -3

Query  1017  FSNLNRLCLSAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKS  838
              S++ R  +    +GM   DR+KGPWS EED+ L++LVE+HG RNW+LIS+SIPGRSGKS
Sbjct  1     MSSMVRTSVVGRSKGM---DRIKGPWSIEEDEALRRLVERHGPRNWTLISRSIPGRSGKS  57

Query  837   CRLRWCNQLSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTL  658
             CRLRWCNQLSP+VEHRPFTPEEDE I + H + GNKWATIAR+L+GRTDNAIKNHWNSTL
Sbjct  58    CRLRWCNQLSPQVEHRPFTPEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTL  117

Query  657   KRKYSAVIGSN-------------EGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsss  517
             KRK S+                  +  E    R LKRA S      +A   L +S  S +
Sbjct  118   KRKCSSPTAFAAAADGAGGSALALDRDEEIAARPLKRASSVGPVPASASAQLCLSPGSPT  177

Query  516   dsdisyssnDNGPAAV---------RSVRLALPLQA-------------VEPRLV-----  418
              SD+S S++   PAA          R+  + +P  +             +E   V     
Sbjct  178   GSDLSDSTHHGHPAAAASCIYRPIPRTAGITVPPSSSPSTATFQEHDLQIEATGVSCTAS  237

Query  417   --SEKENDPSTVLTLSLPAPGSNDGVSSLQRDQ-PSYRRGDSTEAAAPAPVKsestltls  247
               S  ++DP T LTLSL  PG++  V+S Q  Q P  + GD      P           S
Sbjct  238   PSSYAKDDPLTSLTLSL--PGTDRTVTSNQIHQCPDAKTGDDRPPQRP--------FQFS  287

Query  246   pellsLMQDMIRKEVETYYSALVIKDGVR----------NAEVKRIGL  133
              ELL++MQ+M+R EV +Y S L      R          +A  KRIGL
Sbjct  288   AELLAVMQEMVRSEVRSYMSCLEQSGITRALQPPEAAICDAAPKRIGL  335



>ref|XP_010315996.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=372

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED+LL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  11   DMDRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ + ++EG E
Sbjct  71   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-LSADEGNE  127



>gb|AAG08960.1|AF122052_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=306

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 138/317 (44%), Positives = 170/317 (54%), Gaps = 53/317 (17%)
 Frame = -3

Query  957  RVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFTP  778
            R+KGPWS EED+LL+ LVE+HG RNW+LISKS+P RSGKSCRLRWCNQLSP+VEHR FTP
Sbjct  1    RIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPRRSGKSCRLRWCNQLSPQVEHRAFTP  60

Query  777  EEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPGR  598
            EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++        P+P  
Sbjct  61   EEDDTIIRAHAKYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMSEDLSFETPQPP-  119

Query  597  ILKRADSA------DVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQA  436
             LKR+ S          +    P      DSS             P       L  P++ 
Sbjct  120  -LKRSSSVGPCTNFSSVMNPGSPSGSDLSDSSLSGFPQPLVYRPVPRTGGIFPLPPPVKQ  178

Query  435  VEPRLVSEKENDPSTVLTLSLPAPGSNDG----------------------------VSS  340
            +E   +     DP T L LSLP  GS +                             +  
Sbjct  179  IE---IPPSVPDPPTSLCLSLPGSGSIEKPTQSPKSPPLPPPPLPVVDKPIPPSAAVMGH  235

Query  339  LQRDQPSYRRGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL------V  178
            L R   SY        AAP   KS      +PE LS++QDMIRKEV++Y S        +
Sbjct  236  LPRSNQSY-----DFCAAP---KSGEKQFFTPEFLSVLQDMIRKEVKSYMSGFEQNGICM  287

Query  177  IKDGVRNAEVKRIGLGK  127
              D +RNA +KRIG+ K
Sbjct  288  QTDAIRNAVIKRIGISK  304



>ref|XP_006660414.1| PREDICTED: transcription factor MYB44-like [Oryza brachyantha]
Length=312

 Score =   202 bits (514),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -3

Query  990  SAVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQL  811
            SA  RG  D DR+KGPWS EED+ L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQL
Sbjct  5    SASCRGGRDVDRIKGPWSPEEDEALQRLVARHGARNWSLISKSIPGRSGKSCRLRWCNQL  64

Query  810  SPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            SP+VEHRPFTP+ED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRKY
Sbjct  65   SPQVEHRPFTPDEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKY  119



>gb|ABV02031.1| sucrose responsive element binding factor 1 [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=282

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 136/296 (46%), Positives = 171/296 (58%), Gaps = 40/296 (14%)
 Frame = -3

Query  981  FRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPE  802
               + ++ R+KGPW+ EED+LL++LVE+HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+
Sbjct  1    MEAIKETGRIKGPWNPEEDELLQRLVEEHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQ  60

Query  801  VEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE  622
            VEHRPFT EEDE I K HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  +   S++
Sbjct  61   VEHRPFTAEEDETILKAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPST--SDD  118

Query  621  GGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV---RLA  451
                 P + LKR+ S      +  PG             S  S+   P  ++S     +A
Sbjct  119  LSFETPQQPLKRSSSIGPGTMSMNPG---------SPSGSDLSDSGFPGFLQSNVQRPVA  169

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSY-RRGDSTE---AAAP  283
             P   + P +      DP T L+LSLP  G N+   +  R  P    R  S E   +AAP
Sbjct  170  RPGGVLPPSVP-----DPPTSLSLSLPGSGFNE---TTGRVTPQVAERASSLEPAPSAAP  221

Query  282  A------PVKs--------estltlspellsLMQDMIRKEVETYYSALVIKDGVRN  157
            +      PV                SPE L+L+QDMI+KEV+ Y S    K    N
Sbjct  222  SLMPLIVPVTENYSFGPSIMEKQLFSPEFLALLQDMIQKEVKNYMSGFEDKGFTSN  277



>emb|CDY30608.1| BnaAnng03830D [Brassica napus]
Length=265

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 130/204 (64%), Gaps = 18/204 (9%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S     N   E   
Sbjct  62   SAEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS---DGNPTAEEEQ  118

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                KR   +  +V     GL +              +   PA V S   A+P Q  +P 
Sbjct  119  DPAKKRRSMSSESVPPVDTGLYM--------------SPESPADVGSDSSAVPPQRFKP-  163

Query  423  LVSEKENDPSTVLTLSLPAPGSND  352
            + S  E DP+T L+LSL  P S +
Sbjct  164  MTSSSEEDPATTLSLSLSVPVSQE  187



>ref|XP_009798591.1| PREDICTED: transcription factor MYB44 [Nicotiana sylvestris]
Length=357

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED+LL++LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  11   DMDRVKGPWSPEEDELLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ + ++EG E
Sbjct  71   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKSSS-LSADEGNE  127



>ref|NP_001237693.1| MYB transcription factor MYB70 [Glycine max]
 gb|ABH02833.1| MYB transcription factor MYB70 [Glycine max]
Length=268

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 127/286 (44%), Positives = 160/286 (56%), Gaps = 33/286 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED+ L++LV+ HG RNWS+ISKS+PGRSGKSCRLRWCNQLSP+V HRPF+
Sbjct  2    DRVKGPWSPEEDEALRRLVQAHGPRNWSVISKSVPGRSGKSCRLRWCNQLSPQVAHRPFS  61

Query  780  PEEDEVIAKVHAQVGNKWATIARML-NGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            P+EDE I + HA+ GNKWATIAR+L NGRTDNA+KNHWNSTLKRK  + +  +    P  
Sbjct  62   PDEDEAIVRAHARFGNKWATIARLLNNGRTDNAVKNHWNSTLKRKKCSAVSDDVTDRP--  119

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
               LKR      + +  P  L     S SD         + P+         P     P 
Sbjct  120  --PLKR------SASVGPAHLNPGSPSGSDLSDPSLPALSNPS---------PSAHYRPN  162

Query  423  LVSEKEN--DPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltl  250
            L+    +  DP+T L+LSLP  GS        R                   +       
Sbjct  163  LMETASSACDPATSLSLSLPGFGSGSNPVCAPRPVSVSPPSPXPAEPV----EQRGKQMF  218

Query  249  spellsLMQDMIRKEVETYYSALVIKDGVR-------NAEVKRIGL  133
            + E L +MQ+MIRKEV +Y S +  K+G R       NA VKR+G+
Sbjct  219  NAEFLRVMQEMIRKEVRSYMSGMEQKNGFRIPTEAIGNAVVKRMGI  264



>gb|AGN52088.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52198.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=305

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 124/266 (47%), Positives = 153/266 (58%), Gaps = 36/266 (14%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  5    DIDRIKGPWSPEEDDLLQQLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  64

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++   ++     
Sbjct  65   FTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSLTSDDD-----  119

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
                             APP L+ S  + S S      +   P+   S   + P      
Sbjct  120  -----------------APP-LKRSASAGSGSGAPMYLSPASPSGSDSSHTSFP------  155

Query  426  RLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRD----QPSYRRGDSTEAAAPAPVKsest  259
              V+    DP T L+LSLP   S +   S Q      Q         +  AP P+     
Sbjct  156  --VARAGADPPTSLSLSLPGVDSAESTESAQPQINPVQIQLLPPPPVQTQAPPPID-SRI  212

Query  258  ltlspellsLMQDMIRKEVETYYSAL  181
                 EL+ +MQ+MIR EV  Y   +
Sbjct  213  ALFGAELMEVMQEMIRAEVRNYMVGI  238



>ref|XP_011097391.1| PREDICTED: transcription factor MYB44 [Sesamum indicum]
Length=385

 Score =   204 bits (519),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 131/284 (46%), Positives = 165/284 (58%), Gaps = 27/284 (10%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDDLL++LV +HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  13   DVDRIKGPWSPEEDDLLQQLVHKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  72

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEEDE I + HA+ GNKWATIAR+L GRTDNA+KNHWNSTLKRK ++ + S+EG    
Sbjct  73   FTPEEDETIIRAHAKFGNKWATIARLLPGRTDNAVKNHWNSTLKRKCTS-LSSDEGNFDD  131

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
                L +++       +A  G+  S    S    S S   +   AV S        A   
Sbjct  132  KNEFLSQSERPLKRSVSAGSGVPGSGLCLSPGSPSGSDVSDSSLAVMSASHVYKPVARAG  191

Query  426  RLVSEKENDPSTVLTLSLPAPGSNDGVSS-LQRDQPS---------------------YR  313
             +V    +DP T L+LSLP   S +  +   +  QP+                       
Sbjct  192  GIVPSSADDPPTGLSLSLPGVESTESTNQRAESTQPTPNPIQLLQVLPTPPSSPPPPPPP  251

Query  312  RGDSTEAAAPAPVKsestltlspellsLMQDMIRKEVETYYSAL  181
            +  S ++AAP P +    +  S EL+++MQDMIR EV  Y   L
Sbjct  252  QSSSPKSAAPPPAQ----MPFSAELMAVMQDMIRAEVRNYMMGL  291



>ref|XP_008360495.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB44-like, 
partial [Malus domestica]
Length=199

 Score =   198 bits (504),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 2/119 (2%)
 Frame = -3

Query  987  AVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLS  808
            AV R   D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  2    AVIR--KDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  807  PEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG  631
            P+VEHR FTPEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S V G
Sbjct  60   PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGG  118



>ref|XP_003575562.1| PREDICTED: transcription factor MYB44-like [Brachypodium distachyon]
Length=336

 Score =   202 bits (514),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D+DR+KGPWS EED+ L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  19   DADRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  78

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FT +EDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRKYS++
Sbjct  79   FTADEDEAILRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKYSSM  128



>gb|AGN52031.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52141.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=317

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
            +++DR+KGPWS EED+LL+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  5    SEADRIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHR  64

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP  610
             FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++       +P
Sbjct  65   AFTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCVSMSEEFNDFDP  124

Query  609  RPGRILKRADS  577
               + LKR+ S
Sbjct  125  EARQPLKRSAS  135



>ref|XP_007047395.1| Myb domain protein 73, putative [Theobroma cacao]
 gb|EOX91552.1| Myb domain protein 73, putative [Theobroma cacao]
Length=312

 Score =   201 bits (511),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 132/272 (49%), Positives = 162/272 (60%), Gaps = 23/272 (8%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            + DR+KGPWS EEDDLL+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  11   EMDRIKGPWSPEEDDLLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV----------  637
            FTPEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK  +V          
Sbjct  71   FTPEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCLSVGEECNFITNG  130

Query  636  --IGSNEGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS  463
               G+  G E +P   LKR+ SA + ++   P      DSS     S       P +   
Sbjct  131  GYDGNLRGEEQQP---LKRSVSAGLYMSPGSPSGSDVSDSSVPVLSSSHVYKPIPRSGGV  187

Query  462  VRLALPLQAVEPRLV--SEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAA  289
                     V P  V  +   NDP T L+LSLP   S + VS+    + +  R ++    
Sbjct  188  NVDVNVDVNVMPAGVEAASSSNDPPTSLSLSLPGAESCE-VSTHPVSESTQMRNEAKNEE  246

Query  288  APAPVKsestltlspellsLMQDMIRKEVETY  193
                V     +  S E +++MQ+MIR EV  Y
Sbjct  247  RVGGV-----MGFSSEFMAVMQEMIRVEVRNY  273



>gb|AAG08959.1|AF122051_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=364

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 105/116 (91%), Gaps = 1/116 (1%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED+LL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            PEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ + ++EG E
Sbjct  62   PEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-LSADEGNE  116



>ref|XP_008799576.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=366

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L KLV++HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  11   DMDRIKGPWSPEEDEALHKLVQKHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FTPEED+ I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS+ 
Sbjct  71   FTPEEDDTIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSA  120



>ref|XP_010547980.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=319

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 3/119 (3%)
 Frame = -3

Query  972  MADS---DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPE  802
            MAD    DRVKGPWS EED LL++LV+QHGARNW+ ISKSIPGRSGKSCRLRWCNQLSPE
Sbjct  1    MADQKNLDRVKGPWSPEEDQLLRRLVQQHGARNWTGISKSIPGRSGKSCRLRWCNQLSPE  60

Query  801  VEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN  625
            VEHRPFT EEDE+I + H + GNKWATIAR LNGRTDNA+KNHWNSTLKR++SA+   N
Sbjct  61   VEHRPFTAEEDEIIVRAHVEHGNKWATIARRLNGRTDNAVKNHWNSTLKRRFSAMAMEN  119



>gb|KDO79069.1| hypothetical protein CISIN_1g021071mg [Citrus sinensis]
Length=278

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 122/227 (54%), Positives = 146/227 (64%), Gaps = 21/227 (9%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSN------EG  619
            PEEDE+I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+++  N       G
Sbjct  69   PEEDEMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSMLTENGIFLNCNG  128

Query  618  GEPRPGRI-------LKRADSADVTVTAA-----PPGLRVsrdsssdsdisyssnDN--G  481
             +   G         LKR+ SA  +V         PG     D S  S    SSN N   
Sbjct  129  YDADFGNSIQQQPLKLKRSVSAGSSVPVTTGLYMSPGSPSGSDVSDSSVPGLSSNYNIYK  188

Query  480  PAAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSS  340
            P A RS  + + +  V     +   NDP T L+LSLP   S+  VS+
Sbjct  189  PVA-RSGGINVDVNVVPEPETTSSSNDPPTSLSLSLPGVDSSSEVSN  234



>gb|ACJ85153.1| unknown [Medicago truncatula]
Length=199

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 5/133 (4%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLVE+HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  12   DRIKGPWSPEEDEALQKLVEKHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  71

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++  +    P   
Sbjct  72   PEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMIDDSESPP---  128

Query  600  RILKRADSADVTV  562
              LKR+ SA   +
Sbjct  129  --LKRSVSAGAAI  139



>ref|XP_010547530.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=315

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 145/212 (68%), Gaps = 17/212 (8%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EEDD L++LV+++G RNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDDQLRRLVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK--YSAVIGSNEGGE-  613
            T EEDE I + HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK  +S  +G   G   
Sbjct  62   TTEEDETIIRAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKSVFSRGVGGYNGNFV  121

Query  612  PRPGRILKRADSADVTVTA-APPGLRVsrdsssdsdisyssnD----NGPAAV-----RS  463
               G  LKR+ SA     A  P GL +S  S + SD+S SS      + PA V     R+
Sbjct  122  AEDGPPLKRSASAGSGGCAPVPTGLYMSPGSPTGSDVSDSSTVPDLLSAPAHVFKPVART  181

Query  462  VRLALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
              +ALPL+       +   +DP T L+LSLP 
Sbjct  182  GVVALPLEEKS----ASSGDDPPTSLSLSLPG  209



>ref|XP_008351390.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=255

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 2/119 (2%)
 Frame = -3

Query  987  AVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLS  808
            AV R   D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  2    AVIR--KDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  807  PEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG  631
            P+VEHR FTPEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S V G
Sbjct  60   PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGG  118



>gb|AFK48638.1| unknown [Medicago truncatula]
Length=253

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/262 (48%), Positives = 159/262 (61%), Gaps = 26/262 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGP S EED+ L KLV+++G RNWSLIS++IPGRSGKSCRLRWCNQLSP+VEHR F+
Sbjct  2    DRIKGPRSPEEDESLTKLVDRYGPRNWSLISRAIPGRSGKSCRLRWCNQLSPQVEHRAFS  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNE-GGEPRP  604
            PEED +I + HAQ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ IGS++    P+P
Sbjct  62   PEEDNIIIRAHAQFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSFIGSDDRDFNPQP  121

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAV---  433
               LKR  SA V    +P G  +S                     R V + LP++     
Sbjct  122  ---LKR--SASVGAPGSPSGSDLSDSGVQQ------------TVFRPVPIRLPVETTSEP  164

Query  432  EPRLVSEK-ENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestl  256
            EP  V E  E D   + +LSL  PG +   + L    P      +  A   +       L
Sbjct  165  EPVTVPEAVEEDDGPLTSLSLSLPGVDAAAAVLVSPAPIT----AVTAVTVSEEAGIGAL  220

Query  255  tlspellsLMQDMIRKEVETYY  190
             LS E +++MQ+MI+ EV +Y 
Sbjct  221  NLSGEFMAVMQEMIKNEVRSYM  242



>ref|XP_002313145.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
 gb|EEE87100.1| hypothetical protein POPTR_0009s09890g [Populus trichocarpa]
Length=245

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 155/268 (58%), Gaps = 36/268 (13%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D++RVKGPWS EEDDLLK LV +HG RNW++I++++PGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EEDE+I   HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY+ +I  N+G    
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTDNAIKNHWNSTLKRKYADLI-ENDGTVNE  120

Query  606  PG---RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQA  436
             G   +  K   S+ V   A+ P              S S   +    V S  LA     
Sbjct  121  DGVKEKSAKTGSSSSVHKRASTP--------------SGSDVSDAGLPVTSSMLASENMP  166

Query  435  VEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRR---GDSTEAAAPAPVKse  265
            V    +S  +   ST LTLS     S      L RD    +    GD  +    AP    
Sbjct  167  VVETGISNDDVGVSTELTLSTLGMES----GQLGRDGVGTKELLTGDVEKTMTFAP----  218

Query  264  stltlspellsLMQDMIRKEVETYYSAL  181
                   ELL++MQ+MIRKEV  Y   +
Sbjct  219  -------ELLAVMQEMIRKEVSIYMVGI  239



>ref|NP_001235688.1| MYB transcription factor MYB61 [Glycine max]
 gb|ABH02829.1| MYB transcription factor MYB61 [Glycine max]
Length=305

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/141 (68%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L KLVE+HG RNWSLIS+SIPGRSGKSC LRWCNQLSP+VEHR 
Sbjct  8    DMDRIKGPWSPEEDEALHKLVERHGPRNWSLISRSIPGRSGKSCMLRWCNQLSPQVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK ++ + + +     
Sbjct  68   FTPEEDETIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCASFMMAGDEAVAV  127

Query  606  PGRILKRADSADVTVTAAPPG  544
              R LKR+ SA   V   PPG
Sbjct  128  SPRPLKRSFSAGAAV--PPPG  146



>ref|XP_008391509.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=313

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 2/119 (2%)
 Frame = -3

Query  987  AVFRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLS  808
            AV R   D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLS
Sbjct  2    AVIR--KDMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLS  59

Query  807  PEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG  631
            P+VEHR FTPEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S V G
Sbjct  60   PQVEHRAFTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGG  118



>emb|CDY44045.1| BnaA08g15610D [Brassica napus]
Length=285

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 126/203 (62%), Gaps = 24/203 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EED+LL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE I + HA+ GNKWATI+R+L+GRTDNAIKNHWNSTLKRK + V      G     
Sbjct  70   PEEDETIIRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCNGVASDGYDGNIGEE  129

Query  600  RILKRADSADVTVTA------APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ  439
            + LKR  S     T       +P G  V              +  GP   RS        
Sbjct  130  QPLKRTASGGGVSTELYMSPRSPSGSDV-----------SEQSGGGPHVFRS-------G  171

Query  438  AVEPRLVSEKENDPSTVLTLSLP  370
            AV     S    DP T L+LSLP
Sbjct  172  AVNEMTASSSGEDPPTYLSLSLP  194



>ref|XP_009795719.1| PREDICTED: transcription factor MYB44-like [Nicotiana sylvestris]
Length=332

 Score =   200 bits (509),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 109/131 (83%), Gaps = 2/131 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            DSDR+KGPWS EED+LL+ LVE+HG RNWSLISKS+PGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    DSDRIKGPWSPEEDELLQSLVEKHGPRNWSLISKSVPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++  S +     
Sbjct  69   FTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCCSM--SEDLSFET  126

Query  606  PGRILKRADSA  574
            P + LKR+ S 
Sbjct  127  PQQPLKRSSSV  137



>ref|XP_011099313.1| PREDICTED: transcription factor MYB44-like [Sesamum indicum]
Length=360

 Score =   201 bits (511),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 104/116 (90%), Gaps = 1/116 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+LL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  14   DMDRIKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  73

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  A + S+EG
Sbjct  74   FTPEEDETIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRK-CASLSSDEG  128



>ref|XP_009109365.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=305

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/203 (54%), Positives = 126/203 (62%), Gaps = 24/203 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EED+LL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDELLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE I + HA+ GNKWATI+R+L+GRTDNAIKNHWNSTLKRK + V      G     
Sbjct  70   PEEDETIIRAHARFGNKWATISRLLSGRTDNAIKNHWNSTLKRKCNGVASDGYDGNIGEE  129

Query  600  RILKRADSADVTVTA------APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ  439
            + LKR  S     T       +P G  V              +  GP   RS        
Sbjct  130  QPLKRTASGGGVSTELYMSPRSPSGSDV-----------SEQSGGGPHVFRS-------G  171

Query  438  AVEPRLVSEKENDPSTVLTLSLP  370
            AV     S    DP T L+LSLP
Sbjct  172  AVNEMTASSSGEDPPTYLSLSLP  194



>ref|NP_001062562.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAF24476.1| Os09g0106700 [Oryza sativa Japonica Group]
 dbj|BAG89840.1| unnamed protein product [Oryza sativa Japonica Group]
Length=319

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G  D DR+KGPWS EED+ L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  9    GGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  68

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            HRPFTPEED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK+ + + +++  
Sbjct  69   HRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHSSLLADD--  126

Query  615  EPRPGRILKR--ADSADVTVTAAPPG  544
                 R LKR  +D      +AA PG
Sbjct  127  ----LRPLKRTTSDGHPTLSSAAAPG  148



>dbj|BAD34048.1| myb-related transcription factor-like [Oryza sativa Japonica 
Group]
 gb|EAZ43731.1| hypothetical protein OsJ_28356 [Oryza sativa Japonica Group]
Length=318

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G  D DR+KGPWS EED+ L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  8    GGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            HRPFTPEED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK+ + + +++  
Sbjct  68   HRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHSSLLADD--  125

Query  615  EPRPGRILKR--ADSADVTVTAAPPG  544
                 R LKR  +D      +AA PG
Sbjct  126  ----LRPLKRTTSDGHPTLSSAAAPG  147



>gb|EAZ08096.1| hypothetical protein OsI_30362 [Oryza sativa Indica Group]
Length=318

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 115/146 (79%), Gaps = 8/146 (5%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G  D DR+KGPWS EED+ L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VE
Sbjct  8    GGGDVDRIKGPWSPEEDEALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVE  67

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            HRPFTPEED+ I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK+ + + +++  
Sbjct  68   HRPFTPEEDDTILRAHARFGNKWATIARLLAGRTDNAIKNHWNSTLKRKHHSSLLADD--  125

Query  615  EPRPGRILKR--ADSADVTVTAAPPG  544
                 R LKR  +D      +AA PG
Sbjct  126  ----LRPLKRTTSDGHPTLSSAAAPG  147



>ref|XP_009103434.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=296

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 135/207 (65%), Gaps = 20/207 (10%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK      S E   P  
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGFYASTEDQRP--  119

Query  603  GRILKRADSADVTVTA--------APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL  448
               +KR+ S    + A        +P G  VS  S+     S       P A   V L L
Sbjct  120  ---VKRSVSDGYPLVANGLLMSPGSPTGSDVSDSSTLPVLTSVEVFKPVPRA-GGVMLPL  175

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPA  367
            P++       S   +DP+T L+LSLP 
Sbjct  176  PIE------TSTFCDDPATSLSLSLPG  196



>ref|XP_002462029.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
 gb|EER98550.1| hypothetical protein SORBIDRAFT_02g013010 [Sorghum bicolor]
Length=366

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
            AD DR+KGPWS EED+ L++LV +HGARNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHR
Sbjct  15   ADVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHR  74

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            PFTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY
Sbjct  75   PFTPEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKY  122



>gb|AHN19846.1| MYB6 [Malus hybrid cultivar]
Length=312

 Score =   199 bits (506),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FTPEED++I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  67   FTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  114



>gb|AHN19845.1| MYB6 [Malus hybrid cultivar]
Length=310

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FTPEED++I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  67   FTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  114



>dbj|BAJ86460.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=325

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L++LV +HGARNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  14   DVDRIKGPWSPEEDDALQRLVGRHGARNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  73

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            FTP+ED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY
Sbjct  74   FTPDEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKY  120



>ref|XP_008811216.1| PREDICTED: transcription factor MYB44-like [Phoenix dactylifera]
Length=372

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/109 (81%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLV++HGARNWSLISK+IPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  11   DMDRIKGPWSPEEDESLQKLVQKHGARNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
            FTPEED+ I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS+
Sbjct  71   FTPEEDDAIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSS  119



>ref|XP_010548433.1| PREDICTED: transcription factor MYB44 isoform X2 [Tarenaya hassleriana]
 ref|XP_010548434.1| PREDICTED: transcription factor MYB44 isoform X3 [Tarenaya hassleriana]
Length=328

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EED+LL+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   ERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
             EEDE I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK  A++   EG
Sbjct  70   SEEDETIIRAHARFGNKWATIARLLTGRTDNAIKNHWNSTLKRKCVAMVPGGEG  123



>ref|XP_010548432.1| PREDICTED: transcription factor MYB44 isoform X1 [Tarenaya hassleriana]
Length=328

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EED+LL+KLVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   ERIKGPWSPEEDELLQKLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
             EEDE I + HA+ GNKWATIAR+L GRTDNAIKNHWNSTLKRK  A++   EG
Sbjct  70   SEEDETIIRAHARFGNKWATIARLLTGRTDNAIKNHWNSTLKRKCVAMVPGGEG  123



>ref|XP_006294656.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
 gb|EOA27554.1| hypothetical protein CARUB_v10023692mg [Capsella rubella]
Length=308

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  9    ETDRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRG  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            FT EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S   G  E G+
Sbjct  69   FTAEEDDAIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGGGGGGEKGQ  126



>ref|XP_004511885.1| PREDICTED: transcription factor MYB44-like [Cicer arietinum]
Length=323

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 137/206 (67%), Gaps = 19/206 (9%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  11   DRIKGPWSPEEDEALQNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  70

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+++      E +P 
Sbjct  71   PEEDDTIVRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSIMID----ESQP-  125

Query  600  RILKRADSADVTVTAA--------PPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP  445
              LKR+ SA   +  +         PG     D S  S    SS+       R+V +  P
Sbjct  126  --LKRSVSAGAAIPVSTGLYMNPPTPGSPSGSDVSESSVPVVSSSHIYRPVPRTVTILPP  183

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPA  367
            ++       S K NDP T L+LSLP 
Sbjct  184  VETTS----SSKSNDPPTSLSLSLPG  205



>ref|XP_010943207.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=370

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  11   DMDRIKGPWSPEEDEALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FTPEED+ I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS+ 
Sbjct  71   FTPEEDDTIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSA  120



>ref|XP_002524926.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF37423.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=339

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDDALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            PEEDE I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  69   PEEDETIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  112



>ref|XP_004287994.1| PREDICTED: transcription factor MYB44-like [Fragaria vesca subsp. 
vesca]
Length=309

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/308 (43%), Positives = 167/308 (54%), Gaps = 34/308 (11%)
 Frame = -3

Query  972  MADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEH  793
            M   DR+KGPWS EEDD L+ LV++HG RNWSLISK+IPGRSGKSCRLRWCNQLSP+VEH
Sbjct  8    MDRMDRIKGPWSPEEDDALQSLVQKHGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEH  67

Query  792  RPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG-G  616
            R FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++     G G
Sbjct  68   RAFTPEEDDTIIRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMSDDGNGNG  127

Query  615  EPRPGRI-----LKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV-----R  466
                G       LKR+ SA   V  +          S       S     P+ V     R
Sbjct  128  VGYDGNFHEQPPLKRSVSAGSGVPVSTELFMNPGSPSGSDLSDSSVQVMSPSHVYRPVAR  187

Query  465  SVRLALPLQAV--EPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEA  292
            S  +  P++             +DP T L+LSLP      GV S +    ++R     E+
Sbjct  188  SGGVLPPVETTSSSNNNNINLNSDPPTSLSLSLP------GVDSCEVS--NHRVAAVVES  239

Query  291  AAPAPVKsestltlspellsLM----QDMIRKEVETYYSAL------VIK---DGVRNAE  151
                     +         + +    Q MI+KEV +Y   L      V++   DG RN  
Sbjct  240  TQNQAAAQPAAYDPMRSFPAELLELVQGMIKKEVRSYMEGLEQSGFGVMRQQSDGFRNVA  299

Query  150  VKRIGLGK  127
            VKRIG+ +
Sbjct  300  VKRIGISR  307



>ref|XP_007205522.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
 gb|EMJ06721.1| hypothetical protein PRUPE_ppa008450mg [Prunus persica]
Length=331

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDALQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FTPEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S +
Sbjct  67   FTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDI  116



>ref|XP_010550347.1| PREDICTED: transcription factor MYB44-like [Tarenaya hassleriana]
Length=305

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LVE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT
Sbjct  3    DRIKGPWSVEEDEQLRRLVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  62

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
             EEDE I + H Q GNKWATIAR+LNGRTDNA+KNHWNSTLKRK +   G     E RP
Sbjct  63   AEEDETIVRAHTQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCALSGGGQAAAEERP  121



>ref|XP_010101670.1| Transcription factor [Morus notabilis]
 gb|EXB89236.1| Transcription factor [Morus notabilis]
Length=303

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALRRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEED+ I + HA  GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S+ +  +  GEP   
Sbjct  69   PEEDDTIIRAHATYGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSS-LSEDFNGEPNDC  127

Query  600  RILKRADS  577
              LKR+ S
Sbjct  128  PPLKRSAS  135



>gb|ADL36764.1| MYB domain class transcription factor [Malus domestica]
Length=306

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  2    DRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG  631
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S V G
Sbjct  62   PEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSDVGG  111



>ref|XP_010437245.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=312

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 161/270 (60%), Gaps = 24/270 (9%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  70

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EED+ I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK S     N  GE +P 
Sbjct  71   QEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSGGYDGNL-GEEQP-  128

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
              LKR  S  V+      GL +S  S S SD+S  S+  G   V       P    E   
Sbjct  129  --LKRTASGGVST-----GLYMSPGSPSGSDVSEQSSGQGQQHV----FNKPTVRSEVTA  177

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSL-QRDQPSYRRGDSTEAAAPA---------PVK  271
             S  E DP T L+LSLP       V+   Q +Q +   G  T    P             
Sbjct  178  SSSGE-DPPTYLSLSLPWTEETVRVNEAPQLNQNTVMDGGYTAELFPVRKEEDVEVEEDP  236

Query  270  sestltlspellsLMQDMIRKEVETYYSAL  181
               +     E ++++QDMIR EV +Y + L
Sbjct  237  KGISGGFGGEFMTVVQDMIRTEVRSYMADL  266



>ref|XP_009367649.1| PREDICTED: transcription factor MYB44 [Pyrus x bretschneideri]
Length=323

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FTPEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  67   FTPEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  114



>emb|CDX75635.1| BnaA01g00670D [Brassica napus]
Length=299

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 131/216 (61%), Gaps = 36/216 (17%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV--------IGSN  625
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK SA          G N
Sbjct  70   AEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAFTSEGQSCDFGGN  129

Query  624  EG-----GEPRPGRILKRADSADVTVT------AAPPGLRVsrdsssdsdisyssnDNGP  478
             G     GE +P   LKR  S     T       +P G  VS  S     +   +  +G 
Sbjct  130  GGYDGNLGEEQP---LKRTASGGGVSTGLYMSPGSPSGSDVSEQSCGVPHVFKPTARSG-  185

Query  477  AAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLP  370
                         AV     S    DP T L+LSLP
Sbjct  186  -------------AVTEVTASTSGEDPPTYLSLSLP  208



>ref|XP_004238123.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=328

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 108/130 (83%), Gaps = 2/130 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            DSDR+KGPWS EED+LL+ LVE+HG RNW+LISKS+PGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    DSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++        P+
Sbjct  69   FTPEEDDTIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMSEDLSFETPQ  128

Query  606  PGRILKRADS  577
            P   LKR+ S
Sbjct  129  PP--LKRSSS  136



>ref|NP_001151336.1| sucrose responsive element binding protein [Zea mays]
 gb|ACG42418.1| sucrose responsive element binding protein [Zea mays]
 tpg|DAA60650.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=345

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G +D DR+KGPWS EED+ L++LV +HGARNWSLIS+SIPGRSGKSCRLRWCNQLSP+VE
Sbjct  13   GKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVE  72

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            HRPFT EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY
Sbjct  73   HRPFTAEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKY  122



>gb|AFH03065.1| R2R3-MYB transcription factor MYB13 [Epimedium sagittatum]
Length=350

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 143/203 (70%), Gaps = 8/203 (4%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    DMDRIKGPWSPEEDDSLTKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+   +++   P 
Sbjct  69   FTPEEDDTIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSSSMADDDDLP-  127

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP  427
                LKR+ SA   VT +  GL +S  S S SD+S SS     +++    +A     V P
Sbjct  128  ---PLKRSVSAGAAVTVS-GGLYLSPGSPSGSDVSDSSLPVMSSSLIYRPVARTGSMVPP  183

Query  426  RLVSEKENDPSTVLTLSLPAPGS  358
                  ++DP T L+LSLP  GS
Sbjct  184  PSF---QSDPPTSLSLSLPGAGS  203



>emb|CDP01282.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 140/207 (68%), Gaps = 8/207 (4%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            +SDR+KGPWS EED+LL++LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    ESDRIKGPWSPEEDELLQRLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT +EDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKR+ S++  S++     
Sbjct  69   FTADEDEKIIRAHAKFGNKWATIARLLSGRTDNAIKNHWNSTLKRRCSSM--SDDFNFEV  126

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRL----ALPLQ  439
            P + LKR+ S       +   +  S  S SD   S  S        R + L    + P+Q
Sbjct  127  PQQPLKRSASVGPGTNVSAIYVNPSSPSGSDLSDSSLSGFGSGHVFRPLALTGGISPPVQ  186

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGS  358
             +E   +S    DP T LTLSLP   S
Sbjct  187  QIE--TLSAAAPDPPTSLTLSLPGSSS  211



>gb|ADX60118.1| MYB-RELATED transcription factor [Zea mays]
Length=347

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -3

Query  975  GMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVE  796
            G +D DR+KGPWS EED+ L++LV +HGARNWSLIS+SIPGRSGKSCRLRWCNQLSP+VE
Sbjct  13   GKSDVDRIKGPWSPEEDEALQRLVARHGARNWSLISRSIPGRSGKSCRLRWCNQLSPQVE  72

Query  795  HRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            HRPFT EED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY
Sbjct  73   HRPFTAEEDDTILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKY  122



>ref|XP_010928389.1| PREDICTED: transcription factor MYB44-like [Elaeis guineensis]
Length=372

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  11   DMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FT EEDE I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS+ 
Sbjct  71   FTAEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSA  120



>emb|CDX69287.1| BnaC01g01660D [Brassica napus]
Length=306

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 129/210 (61%), Gaps = 24/210 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV--------IGSN  625
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK S           G N
Sbjct  70   AEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSGFTSEGQSCDFGGN  129

Query  624  EG-----GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV  460
             G     GE +P   LKR        TA+  G+      S  S      ++    A    
Sbjct  130  GGYDGNLGEEQP---LKR--------TASGGGVSTGLYMSPGSPSGSDVSEQSSGAPHVF  178

Query  459  RLALPLQAVEPRLVSEKENDPSTVLTLSLP  370
            +      AV     S    DP T L+LSLP
Sbjct  179  KPTARSGAVTEVTASTSGEDPPTYLSLSLP  208



>gb|AFS65096.1| sucrose responsive element-binding protein [Elaeis guineensis]
Length=372

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  11   DMDRIKGPWSPEEDEALQKLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            FT EEDE I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS+ 
Sbjct  71   FTAEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYSSA  120



>ref|XP_006367421.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=320

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 2/131 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            DSDR+KGPWS EED+LL+ LVE+HG RNW+LISKS+PGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  9    DSDRIKGPWSPEEDELLQTLVEKHGPRNWTLISKSVPGRSGKSCRLRWCNQLSPQVEHRA  68

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FTPEED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK  ++        P+
Sbjct  69   FTPEEDDTIIRAHAKYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCPSMSEDLSFETPQ  128

Query  606  PGRILKRADSA  574
            P   LKR+ S 
Sbjct  129  PP--LKRSSSV  137



>ref|XP_011001142.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=243

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D++RVKGPWS EEDDLLK LV +HG RNW++I++++PGRSGKSCRLRWCNQLSPEVEHR 
Sbjct  2    DNNRVKGPWSPEEDDLLKHLVIKHGPRNWTMIARAVPGRSGKSCRLRWCNQLSPEVEHRA  61

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
            FT EEDE+I   HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY+ +I  N+G
Sbjct  62   FTREEDEIIINAHAKYGNKWATIARLLDGRTDNAIKNHWNSTLKRKYADLI-ENDG  116



>ref|XP_008462845.1| PREDICTED: transcription factor MYB44-like [Cucumis melo]
Length=301

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 167/306 (55%), Gaps = 43/306 (14%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDD L++LV ++G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  6    DRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  65

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE I    A  GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ +    GG     
Sbjct  66   PEEDETIINAQALYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSS-MADESGGCDATS  124

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
              LKR+ SA + +   PP    + D S        S+ +    V      LP     P  
Sbjct  125  PPLKRSLSAGLYM---PPNSPSASDVSDSGFFPAVSSSHVYRPVARTGAVLP-----PGE  176

Query  420  VSEKENDPSTVLTLSLPAPGSND----GVSSLQRDQPSYRRGDSTEAAAPAPVKsestlt  253
                 NDP T L+LSLP   S++      S+      S RR  ST  A  A +  E  ++
Sbjct  177  TVSSSNDPPTSLSLSLPGADSSEVNFVANSAQGMGGVSERR--STGLACSAAMNGEERIS  234

Query  252  lspellsL-------------MQDMIRKEVETYYSALVIKD---------------GVRN  157
               E  +              MQ+MIRKEV  Y + L+ ++               G RN
Sbjct  235  GEKEESNSNGFGIFGSDLMTVMQEMIRKEVRNYMAGLMEQNVGGGGGVCYQQAAAGGFRN  294

Query  156  AEVKRI  139
              ++RI
Sbjct  295  VVIQRI  300



>ref|XP_010417080.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL+ LVE+HG RNWSLI+KS+PGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   DRIKGPWSPEEDDLLQTLVEKHGPRNWSLITKSVPGRSGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S   G  +G
Sbjct  70   AEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSGQRGGYDG  123



>ref|XP_002877726.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53985.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=285

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/211 (53%), Positives = 134/211 (64%), Gaps = 22/211 (10%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA--------VIGS  628
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S          +  
Sbjct  62   SPEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAAVTAMTVTE  121

Query  627  NEGGEPRPGRILKRADSADVTV----TAAPPGLRVsrdsssdsdisyssnDNGPAAVRSV  460
             +  E RP +  +R+ S D       T +P G  VS  S+  S  S  +    P  +   
Sbjct  122  TDEEEDRPKK--RRSVSFDSAFAPVDTESPNGFDVSDSSTIPSPSSPVAQLFKPMPISGG  179

Query  459  RLALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
             L        P  +S    DP+T L+LSLP 
Sbjct  180  PL--------PVEMSSSSEDPTTSLSLSLPG  202



>gb|AAZ20429.1| MYB6 [Malus domestica]
 gb|ADL36770.1| MYB domain class transcription factor [Malus domestica]
Length=312

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FTPEED++I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  67   FTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  114



>ref|XP_002510155.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF52342.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=295

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP
Sbjct  11   DVDRIKGPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  70

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            FTPEEDE I + H++ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  71   FTPEEDETIMRAHSRFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  116



>gb|ADN33728.1| MYB transcription factor [Cucumis melo subsp. melo]
Length=211

 Score =   194 bits (492),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ LK+LVE +G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  9    DRIKGPWSPEEDESLKRLVESYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRPFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK SA+
Sbjct  69   AEEDDAIIRAHAKFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSAM  116



>gb|AHN60125.1| MYB transcription factor 44 [Brassica napus]
Length=300

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 134/207 (65%), Gaps = 20/207 (10%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK      S E   P  
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGFYASAEDQRP--  119

Query  603  GRILKRADSADVTVTA--------APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL  448
               +KR+ S      A        +P G  VS  S+     S       P A   V L L
Sbjct  120  ---VKRSVSDGYPPVANGLLMSPGSPTGSDVSDSSTLPVLTSVEVFKPVPRA-GGVMLPL  175

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPA  367
            P++       S   +DP+T L+LSLP 
Sbjct  176  PIE------TSTFCDDPATSLSLSLPG  196



>ref|XP_009137661.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
 gb|AHN60130.1| MYB transcription factor 73 [Brassica napus]
Length=328

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 131/216 (61%), Gaps = 36/216 (17%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   ERIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV--------IGSN  625
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK SA          G N
Sbjct  70   AEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSAFTSEGQSCDFGGN  129

Query  624  EG-----GEPRPGRILKRADSADVTVT------AAPPGLRVsrdsssdsdisyssnDNGP  478
             G     GE +P   LKR  S     T       +P G  VS  S     +   +  +G 
Sbjct  130  GGYDGNLGEEQP---LKRTASGGGVSTGLYMSPGSPSGSDVSEQSCGVPHVFKPTARSG-  185

Query  477  AAVRSVRLALPLQAVEPRLVSEKENDPSTVLTLSLP  370
                         AV     S    DP T L+LSLP
Sbjct  186  -------------AVTEVTASTSGEDPPTCLSLSLP  208



>gb|AIK01747.1| MYB [Chrysanthemum indicum var. aromaticum]
Length=315

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 4/133 (3%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS +ED++L  LVE+HG RNWSLISKSIPGRSGKSCRLRWCN+LSP+VEHR 
Sbjct  8    DMDRIKGPWSPDEDEMLTNLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNRLSPDVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS--NEGGE  613
            FTPEEDE I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S++     NE   
Sbjct  68   FTPEEDETILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSSMTNEEFNELQV  127

Query  612  PRPGRILKRADSA  574
             +P  +LKR+ SA
Sbjct  128  QQP--MLKRSVSA  138



>ref|XP_004501595.1| PREDICTED: transcriptional activator Myb-like [Cicer arietinum]
Length=237

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 97/155 (63%), Positives = 110/155 (71%), Gaps = 16/155 (10%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED +L +LVEQHG RNWSLIS+ I GRSGKSCRLRWCNQLSP VEHRPF+
Sbjct  32   DRIKGPWSAEEDRILTRLVEQHGPRNWSLISRYIKGRSGKSCRLRWCNQLSPTVEHRPFS  91

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG----------  631
            P+EDE I   HAQ GN+WATIAR+L GRTDNA+KNHWNSTLKRK S + G          
Sbjct  92   PQEDETIIAAHAQYGNRWATIARLLPGRTDNAVKNHWNSTLKRKASGLGGDCSVVVAGNV  151

Query  630  --SNEGGEPRPGRILKRA----DSADVTVTAAPPG  544
              SNEGG    GR ++      D     +T APPG
Sbjct  152  TASNEGGSFSSGRGVRSCLPVEDDPLTALTLAPPG  186



>emb|CDY01420.1| BnaA07g11930D [Brassica napus]
Length=263

 Score =   195 bits (495),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK      S E   P  
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGFYASAEDQRPVK  121

Query  603  GRILK  589
              + K
Sbjct  122  RSVFK  126



>ref|XP_008338349.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=312

 Score =   196 bits (499),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS EEDD L+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  7    DMDRIKGPWSPEEDDSLQXLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRA  66

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FTPEED++I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  67   FTPEEDDMIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  114



>ref|XP_009418325.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=365

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D  R+KGPWS EED+ L+KLV+++G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  10   DLGRIKGPWSPEEDEALRKLVQRNGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRP  69

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            FTPEEDE I + H + GN+WATIAR+L+GRTDNA+KNHWNSTLKR+YSA   + +GG
Sbjct  70   FTPEEDETIIRAHRRFGNRWATIARLLSGRTDNAVKNHWNSTLKRRYSASATAVDGG  126



>emb|CDX72621.1| BnaC07g46430D [Brassica napus]
Length=265

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 150/261 (57%), Gaps = 40/261 (15%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+KLVE+HG +NWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDDLLQKLVEKHGPKNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
            PEEDE+I + HA+ GNKWAT++R+L+GRTDNA+KNHWNSTLKRK +        GE +P 
Sbjct  70   PEEDEMIVRAHARYGNKWATVSRLLSGRTDNAVKNHWNSTLKRKCTPEGHDGNLGEEQPS  129

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
               KRA S  V       GL +S                            P       +
Sbjct  130  ---KRAASGGVCT-----GLYMS----------------------------PGSPAGSDV  153

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPV-Ksestltlsp  244
             +    DP T L+LSLP    N+G  +           D    A   PV K E    +  
Sbjct  154  SASDGGDPPTYLSLSLPW---NNGCDTETVGINGDTVIDGGYTAELFPVRKEEERGIVGG  210

Query  243  ellsLMQDMIRKEVETYYSAL  181
            E ++ +Q+M+R EV +Y + L
Sbjct  211  EFMTAVQEMVRTEVRSYMAEL  231



>ref|XP_009396271.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=325

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 137/305 (45%), Positives = 167/305 (55%), Gaps = 39/305 (13%)
 Frame = -3

Query  957  RVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFTP  778
            RV GPW  EED+ L +LVE+HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP VEHRPFT 
Sbjct  26   RVTGPWRAEEDEALLRLVERHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPRVEHRPFTA  85

Query  777  EEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK-----------YSAVIG  631
            EEDE I + H ++GNKWATIAR+L+GRTDNAIKNHW STLKRK           ++  + 
Sbjct  86   EEDEAIVRAHRRLGNKWATIARLLSGRTDNAIKNHWYSTLKRKSSPPPVDDAEGFAMAVD  145

Query  630  SNEGGEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAV---RSV  460
              +    RP    KRA       T+A     V    S    +S   + N PA     R V
Sbjct  146  LKDAPAERP---FKRASCVGAAYTSAD---LVICLRSGSPSMSDVRDCNHPAVCLVNRPV  199

Query  459  RLALPLQAVEPRLVSEKEN--DPSTVLTLSLPAPGSNDGVSSLQRDQ---PSYRRGDST-  298
                 + A  P L S   N  DPST LTLSLP    +D V +  R Q    S+    S  
Sbjct  200  LRTGGVAASPPHLASSAANAVDPSTSLTLSLPG---SDHVGTFNRHQGRSSSHNHNHSQH  256

Query  297  EAAAPAPVKsestltlspellsLMQDMIRKEVETYYS----ALVIK------DGVRNAEV  148
            E  A           LS E L++MQ+MIR EV +Y S    + V++        +R A +
Sbjct  257  ETTASGHSTRHLPFRLSGEHLAVMQEMIRSEVRSYLSGPDHSNVMRTQPPPGTAIRGAAI  316

Query  147  KRIGL  133
            K +G 
Sbjct  317  KGVGF  321



>ref|XP_002306488.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
 gb|EEE93484.2| hypothetical protein POPTR_0005s18620g [Populus trichocarpa]
Length=351

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ LKKLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALKKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++
Sbjct  69   PEEDDRIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM  116



>ref|NP_190575.1| myb domain protein 77 [Arabidopsis thaliana]
 gb|AAL11582.1|AF424588_1 AT3g50060/F3A4_140 [Arabidopsis thaliana]
 emb|CAB62114.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
 gb|AAM70537.1| AT3g50060/F3A4_140 [Arabidopsis thaliana]
 gb|AAS10068.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE78622.1| myb domain protein 77 [Arabidopsis thaliana]
Length=301

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 131/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA-----VIGSNEG  619
            +PEEDE I    AQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S       +   E 
Sbjct  62   SPEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEE  121

Query  618  GEPRPGR--------ILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS  463
             + RP +             D+       +P G+ VS  S+  S  S  +    P  +  
Sbjct  122  DQDRPKKRRSVSFDSAFAPVDTGLYMSPESPNGIDVSDSSTIPSPSSPVAQLFKPMPISG  181

Query  462  VRLALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
                +P     P  +S    DP T L+LSLP 
Sbjct  182  GFTVVPQPL--PVEMSSSSEDPPTSLSLSLPG  211



>ref|XP_006286095.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
 gb|EOA18993.1| hypothetical protein CARUB_v10007638mg [Capsella rubella]
Length=319

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 133/279 (48%), Positives = 162/279 (58%), Gaps = 32/279 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  70

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK-----YSAVIGSNEG-  619
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK      S   G N G 
Sbjct  71   QEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGY  130

Query  618  ----GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLA  451
                GE +P   LKR  S     T    GL +S  S S SD+S  S+  G   V    + 
Sbjct  131  DGNLGEEQP---LKRTASGGGVST----GLYMSPGSPSGSDVSEQSSGQGQQHVFKPTVR  183

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPA---  280
              + A      S    DP T L+LSLP   +     + Q +Q +   G  T    P    
Sbjct  184  SDVTA------SSSAEDPPTYLSLSLPWTETARVNEAPQPNQDTVMDGGYTAELFPVRKE  237

Query  279  ------PVKsestltlspellsLMQDMIRKEVETYYSAL  181
                        +     E L+++Q+MIR EV +Y + L
Sbjct  238  EEVEVEDEAKGISGGFGGEFLTVVQEMIRTEVRSYMADL  276



>ref|XP_010432074.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=322

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 138/207 (67%), Gaps = 23/207 (11%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  70

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK-----YSAVIGSNEG-  619
             EED+ I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK      S   G N G 
Sbjct  71   QEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGY  130

Query  618  ----GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLA  451
                GE +P   LKR  S  V+      GL +S +S S SD+S  S+  G   V      
Sbjct  131  DGNLGEEQP---LKRTASGGVST-----GLYMSPESPSGSDVSEQSSGQGQQHV----FN  178

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLP  370
             P    E    S  E DP T L+LSLP
Sbjct  179  KPTVRSEVTASSSGE-DPPTYLSLSLP  204



>emb|CAA74604.1| R2R3-MYB transcription factor [Arabidopsis thaliana]
Length=304

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 131/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA-----VIGSNEG  619
            +PEEDE I    AQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S       +   E 
Sbjct  62   SPEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEE  121

Query  618  GEPRPGR--------ILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS  463
             + RP +             D+       +P G+ VS  S+  S  S  +    P  +  
Sbjct  122  DQDRPKKRRSVSFDSAFAPVDTGLYMSPESPNGIDVSDSSTIPSPSSPVAQLFKPMPISG  181

Query  462  VRLALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
                +P     P  +S    DP T L+LSLP 
Sbjct  182  GFTVVPQPL--PVEMSSSSEDPPTSLSLSLPG  211



>emb|CAA90810.1| MYB-related protein [Arabidopsis thaliana]
Length=304

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 131/212 (62%), Gaps = 15/212 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA-----VIGSNEG  619
            +PEEDE I    AQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S       +   E 
Sbjct  62   SPEEDETIVTARAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCSGGVAVTTVTETEE  121

Query  618  GEPRPGR--------ILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRS  463
             + RP +             D+       +P G+ VS  S+  S  S  +    P  +  
Sbjct  122  DQDRPKKRRSVSFDPAFAPVDTGLYMSPESPNGIDVSDSSTIPSPSSPVAQLFKPMPISG  181

Query  462  VRLALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
                +P     P  +S    DP T L+LSLP 
Sbjct  182  GFTVVPQPL--PVEMSSSSEDPPTSLSLSLPG  211



>ref|NP_195443.1| myb domain protein 73 [Arabidopsis thaliana]
 emb|CAB16756.1| myb-related protein [Arabidopsis thaliana]
 emb|CAB80392.1| myb-related protein [Arabidopsis thaliana]
 gb|AAL36268.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAM14206.1| putative myb-related protein [Arabidopsis thaliana]
 gb|AAS10083.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEE86774.1| myb domain protein 73 [Arabidopsis thaliana]
Length=320

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 132/281 (47%), Positives = 163/281 (58%), Gaps = 35/281 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK-----YSAVIGSNEG-  619
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK      S   G N G 
Sbjct  70   QEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGY  129

Query  618  ----GEPRPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLA  451
                GE +P   LKR  S    V+    GL +S  S S SD+S  S+        +VR  
Sbjct  130  DGNLGEEQP---LKRTASGGGGVST---GLYMSPGSPSGSDVSEQSSGGAHVFKPTVRSE  183

Query  450  LPLQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSS-LQRDQPSYRRGDSTEAAAPA--  280
            +          S    DP T L+LSLP       V+  +Q +Q +   G  T    P   
Sbjct  184  V--------TASSSGEDPPTYLSLSLPWTDETVRVNEPVQLNQNTVMDGGYTAELFPVRK  235

Query  279  --------PVKsestltlspellsLMQDMIRKEVETYYSAL  181
                          +     E ++++Q+MIR EV +Y + L
Sbjct  236  EEQVEVEEEEAKGISGGFGGEFMTVVQEMIRTEVRSYMADL  276



>ref|XP_006404067.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
 gb|ESQ45520.1| hypothetical protein EUTSA_v10010581mg [Eutrema salsugineum]
Length=300

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 147/219 (67%), Gaps = 22/219 (10%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+K+VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRKMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS--------AVIGS  628
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK          A   +
Sbjct  62   SPEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGGGGDVSFATATT  121

Query  627  NEGGEPRPGRILKRADSADVTVTAAPP---GLRVsrdsssdsdisyssnDNGPAAVRSVR  457
             E  + RP +  +R+    V+  +APP   GL +S +S +  D+S SS    P +  + +
Sbjct  122  TEEDQDRPKK--RRS----VSSESAPPVDTGLYMSPESPAGIDVSDSSTIPSPRSPVAAQ  175

Query  456  LALPLQ-----AVEPRLVSEKENDPSTVLTLSLPAPGSN  355
            L  P+       V P  +S    DP+T L+LSL  PGS+
Sbjct  176  LFKPMPVTGGFTVSPVEMSSSSEDPATSLSLSLSLPGSD  214



>emb|CDY12830.1| BnaC07g16030D [Brassica napus]
Length=253

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L+KLV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRKLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK        E   P  
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGFYAPAEDQRPVK  121

Query  603  GRILK  589
              + K
Sbjct  122  RSVFK  126



>gb|AFV73403.1| R2R3-MYB transcription factor [Jatropha curcas]
Length=313

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 138/307 (45%), Positives = 177/307 (58%), Gaps = 40/307 (13%)
 Frame = -3

Query  951  KGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFTPEE  772
            K PWS EED+ L++LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT +E
Sbjct  13   KVPWSPEEDEALQRLVQNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFTADE  72

Query  771  DEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPGRIL  592
            D+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++         +P   L
Sbjct  73   DDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSLSDDLNDDVQQP---L  129

Query  591  KRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAA------VRSVRLALPLQAVE  430
            KR  SA V       GL ++  S S SD+S SS     ++       R+  L  P  +++
Sbjct  130  KR--SASVGAGTNISGLHLNPSSPSGSDVSDSSLPGMASSPVYRPLARTGSLVPPGPSID  187

Query  429  PRLVSEKENDPSTVLTLSLPAPGSNDGVSSL--QRDQPSYRRGDS------TEAAAPA--  280
                +    DP T L+LSLP   S +  + +        +  G S      T A  PA  
Sbjct  188  ---ATSSTTDPPTSLSLSLPGSDSCEASNQVSGSGSGSGFNHGLSPTHVVQTPAMPPATL  244

Query  279  PVKsestltlsp----------ellsLMQDMIRKEVETYYSAL------VIKDGVRNAEV  148
            PV+    +  +           E L++MQ+MIRKEV  Y S +         + +RNA V
Sbjct  245  PVQQVPAVQQNCVGFEKQFFNPEFLAVMQEMIRKEVRNYMSGIEQNGMCFQTEAIRNAVV  304

Query  147  KRIGLGK  127
            KRIG+ +
Sbjct  305  KRIGISR  311



>ref|NP_001237709.1| MYB transcription factor MYB81 [Glycine max]
 gb|ABH02837.1| MYB transcription factor MYB81 [Glycine max]
Length=273

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 156/284 (55%), Gaps = 34/284 (12%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED+ L+ LV+ HG RNWS+ISKSIPGR  KSCRLRWCNQLSP+V HRPF+
Sbjct  12   DRVKGPWSPEEDEALRALVQAHGPRNWSVISKSIPGRFRKSCRLRWCNQLSPQVAHRPFS  71

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EEDE I   HA+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK SAV   +     +P 
Sbjct  72   QEEDEAIIMAHAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKSSAVSDDDVVTHRQP-  130

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
              LKR++S        P  L  +  S SD         + P+         P     P L
Sbjct  131  --LKRSNS------VGPAHLNPASPSVSDLSDPGLPALSNPS---------PSAHYMPNL  173

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPVKsestltlspe  241
            +    + P    +LSL  PG            P     ++ E               + E
Sbjct  174  METASSAPDPATSLSLSLPGFTVPQPVSPPPPPLPLPAETVEERG--------KQMFNAE  225

Query  240  llsLMQDMIRKEVETYYSAL-VIKDGVR-------NAEVKRIGL  133
             L +MQ+MI+KEV +Y S +   K+G R       NA VKR+G+
Sbjct  226  FLRVMQEMIKKEVRSYMSGMEEQKNGFRMQTEAIGNAVVKRMGI  269



>ref|XP_010558924.1| PREDICTED: transcription factor MYB44-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558931.1| PREDICTED: transcription factor MYB44-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010558937.1| PREDICTED: transcription factor MYB44-like isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010558944.1| PREDICTED: transcription factor MYB44-like isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010558950.1| PREDICTED: transcription factor MYB44-like isoform X5 [Tarenaya 
hassleriana]
Length=311

 Score =   194 bits (494),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EEDD L++LV ++G RNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDDQLRRLVVKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            TPEED+ I + HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   TPEEDDTILRAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>ref|XP_011010210.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=335

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 99/108 (92%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+KLV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  9    DRIKGPWSPEEDEALQKLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++
Sbjct  69   PEEDDKIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM  116



>ref|NP_001183628.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|ACR37800.1| unknown [Zea mays]
 tpg|DAA39569.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
 gb|AIB04986.1| MYB transcription factor, partial [Zea mays]
Length=285

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 109/144 (76%), Gaps = 8/144 (6%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
            A  DR+KGPWS EED+ L++LV +HGARNWSLIS+S+PGRSGKSCRLRWCNQLSP VEHR
Sbjct  15   AGVDRIKGPWSPEEDEALQRLVRRHGARNWSLISRSVPGRSGKSCRLRWCNQLSPRVEHR  74

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP  610
            PFTP+ED+ I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKR+            P
Sbjct  75   PFTPDEDDAILRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRERERKREYYADARP  134

Query  609  RPG--RILKRADSADVTVTAAPPG  544
             PG  R LKR      T +  PPG
Sbjct  135  GPGDQRSLKR------TSSDGPPG  152



>gb|ABN11121.1| MYB transcription factor [Capsicum annuum]
Length=345

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 1/116 (1%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED+LL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQ SP+VEHRP T
Sbjct  2    DRVKGPWSPEEDELLQQLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQSSPQVEHRPLT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGE  613
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK  + + ++EG E
Sbjct  62   PEEDDTIIRPHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCCS-LSADEGRE  116



>ref|XP_002880492.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56751.1| hypothetical protein ARALYDRAFT_481200 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   DRIKGPWSPEEDDLLQTLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
             EED+ I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  70   AEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  115



>gb|AAM65553.1| putative MYB family transcription factor [Arabidopsis thaliana]
Length=309

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   DRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
             EED+ I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  70   AEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  115



>gb|AHB59591.1| putative R2R3 MYB protein 3 [Arachis hypogaea]
Length=253

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/104 (81%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DRVKGPWS EED+ L++LV  HG RNW++ISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  2    DRVKGPWSPEEDETLRRLVGAHGPRNWTIISKSIPGRSGKSCRLRWCNQLSPEVEHRAFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            PEED++I + HA+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   PEEDDIIVRAHAEFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  105



>ref|XP_010464243.1| PREDICTED: transcription factor MYB44 [Camelina sativa]
Length=309

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/209 (53%), Positives = 139/209 (67%), Gaps = 17/209 (8%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG--SNEGGEP  610
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK        S +G E 
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSED  121

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQ---  439
            +  R +KR+ SA      +PP +     S      S  S+ +    + SV L  P+    
Sbjct  122  Q--RPVKRSVSA-----GSPPVVTGLYMSPGSPTGSDVSDSSTIPILPSVELFKPVPRPG  174

Query  438  --AVEPRL---VSEKENDPSTVLTLSLPA  367
               + P+L    S    DP T+L+LSLP 
Sbjct  175  AVVLPPQLPIETSSSSEDPPTLLSLSLPG  203



>ref|XP_010472329.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+ LVE+HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   NRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  70   AEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  113



>ref|XP_010429274.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=306

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL+ LVE+HG RNWSLISKSIPGR GKSCRLRWCNQLSPEVEHR FT
Sbjct  10   DRIKGPWSPEEDDLLQTLVEKHGPRNWSLISKSIPGRPGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
             EED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  70   AEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  113



>gb|KFK28404.1| hypothetical protein AALP_AA8G510400 [Arabis alpina]
Length=309

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 134/207 (65%), Gaps = 14/207 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S   G +   + RP
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS---GYDHREDHRP  118

Query  603  GRILKR--ADSADVTVT------AAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLAL  448
               +KR  +D +   VT       +P G  VS  S+     S       P A   V    
Sbjct  119  ---MKRSASDGSPPVVTGLYMSPGSPTGSDVSDSSTIPVLPSVELFKPVPRAGAVVLPPP  175

Query  447  PLQAVEPRLVSEKENDPSTVLTLSLPA  367
            P+        S    DP T L+LSLP 
Sbjct  176  PMTTATVIETSSSSVDPPTSLSLSLPG  202



>ref|NP_179910.1| myb domain protein 70 [Arabidopsis thaliana]
 gb|AAB87103.1| MYB family transcription factor [Arabidopsis thaliana]
 dbj|BAC41938.1| putative MYB family transcription factor [Arabidopsis thaliana]
 gb|AAP37702.1| At2g23280 [Arabidopsis thaliana]
 gb|AAS10044.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AEC07437.1| myb domain protein 70 [Arabidopsis thaliana]
Length=309

 Score =   193 bits (491),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EEDDLL+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR FT
Sbjct  10   DRIKGPWSPEEDDLLQSLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRGFT  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
             EED+ I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S
Sbjct  70   AEEDDTIILAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCS  115



>ref|XP_010070607.1| PREDICTED: transcription factor MYB44-like [Eucalyptus grandis]
 gb|KCW59483.1| hypothetical protein EUGRSUZ_H02226 [Eucalyptus grandis]
Length=339

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR FT
Sbjct  8    DRIKGPWSPEEDEALRLLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAFT  67

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            PEED++I + HA+ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S
Sbjct  68   PEEDDIIVRAHARFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCS  113



>ref|XP_010268609.1| PREDICTED: transcriptional activator Myb-like [Nelumbo nucifera]
Length=221

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/147 (63%), Positives = 109/147 (74%), Gaps = 10/147 (7%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+R+KGPWSTEED +L +LV +HGARNWSLIS+ IPGRSGKSCRLRWCNQLSP VEHRPF
Sbjct  36   SERIKGPWSTEEDKILTRLVNRHGARNWSLISRYIPGRSGKSCRLRWCNQLSPNVEHRPF  95

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +P EDE I   HA  GN+WATIAR+L GRTDNA+KNHWNSTLKR+       +  G    
Sbjct  96   SPAEDETILAAHASYGNRWATIARLLPGRTDNAVKNHWNSTLKRRQREQPVEDNNG----  151

Query  603  GRILKRADSAD------VTVTAAPPGL  541
            GR L+   S++       T+T APPG+
Sbjct  152  GRSLESGSSSETKPDPPTTLTLAPPGV  178



>gb|ADL36765.1| MYB domain class transcription factor [Malus domestica]
Length=317

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++
Sbjct  69   PEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM  116



>gb|KFK34266.1| hypothetical protein AALP_AA5G122700 [Arabis alpina]
Length=311

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 136/216 (63%), Gaps = 23/216 (11%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++V+++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVDKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA-------VIGSN  625
            +PEEDE I     + GNKWATIAR+LNGRTDNA+KNHWNSTLKRK          V    
Sbjct  62   SPEEDETIISARGKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGGGGGGGDVPAVT  121

Query  624  EGGEPRPGRILKRADSADVTVTAAPP---GLRVsrdsssdsdisyssnDNGPAAVRSVR-  457
            E  + RP +  +R+ S D    +APP   GL +S +       +  S  + P AV+  + 
Sbjct  122  EEEQDRPKK--RRSVSLDSNGVSAPPVDTGLYMSPEIDVSDSSTIPSPPSPPVAVQLFKP  179

Query  456  ------LALPLQAVEPRLVSEKENDPSTVLTLSLPA  367
                    LP     P  +S    DP T L+LSLP 
Sbjct  180  MPFSGGFVLPA----PVEISSSTEDPETSLSLSLPG  211



>ref|NP_001287808.1| transcription factor MYB44-like [Malus domestica]
 gb|ADL36769.1| MYB domain class transcription factor [Malus domestica]
Length=319

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALQNLVKNYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  69   PEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  112



>ref|XP_009115687.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=266

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 130/204 (64%), Gaps = 18/204 (9%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +PEEDE I    A+ GNKWATIAR+LNGRT+NA+KNHWNSTLKRK    +  N   E   
Sbjct  62   SPEEDETIVSARAKFGNKWATIARLLNGRTNNAVKNHWNSTLKRK---CLDGNPTAEEEQ  118

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPR  424
                KR   +  +V     GL +              +   P  V S   A+P Q  +P 
Sbjct  119  DPAKKRRSMSSESVPPVDTGLYM--------------SPESPTDVGSDSSAVPPQLFKP-  163

Query  423  LVSEKENDPSTVLTLSLPAPGSND  352
            + S  E DP+T L+LSL  P S +
Sbjct  164  MTSSSEEDPATTLSLSLSLPVSQE  187



>emb|CDY23023.1| BnaC07g31640D [Brassica napus]
Length=290

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            +PEEDE I    A+ GN+WATIAR+LNGRTDNA+KNHWNSTLKRK+
Sbjct  62   SPEEDETILSARAKFGNRWATIARLLNGRTDNAVKNHWNSTLKRKF  107



>ref|XP_009354151.1| PREDICTED: transcription factor MYB44-like [Pyrus x bretschneideri]
Length=319

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALQNLVKTYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            PEED+ I + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  69   PEEDDTIIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  112



>emb|CDY57355.1| BnaC08g48630D [Brassica napus]
Length=278

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 131/217 (60%), Gaps = 30/217 (14%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRLMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK    +  N   E   
Sbjct  62   SPEEDETIVSARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRK---CLDGNPTTEEDQ  118

Query  603  GRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEP-  427
             R  KR   +  +V     GL +              +   P  V S   A+P Q  +P 
Sbjct  119  DRAKKRRSMSSESVPPVDTGLYM--------------SPESPTHVASDSSAVPPQLFKPM  164

Query  426  ------------RLVSEKENDPSTVLTLSLPAPGSND  352
                         + S  E DP+T L+LSL  P S +
Sbjct  165  PVSGGFTVPSPVEMTSSSEEDPATTLSLSLSLPVSQE  201



>ref|XP_009395856.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=364

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS  ED+ L++LV++HG RNWS+ISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  15   EADRIKGPWSPAEDEALQRLVQRHGPRNWSIISKSIPGRSGKSCRLRWCNQLSPQVEHRP  74

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEG  619
            FT EEDE+I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRK+S      +G
Sbjct  75   FTDEEDEIIVRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKHSRPCAGEDG  130



>ref|XP_008351984.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            PEED+   + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++
Sbjct  69   PEEDDTJIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM  116



>ref|XP_010444669.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=310

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 137/214 (64%), Gaps = 26/214 (12%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG--SNEGGEP  610
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK        S +G E 
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSED  121

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVE  430
               R +KR+ SA      +PP +     S      S  S+ +    + SV L  P+    
Sbjct  122  H--RPVKRSVSA-----GSPPVVTGLYMSPGSPTGSDVSDSSTIPILPSVELFKPV----  170

Query  429  PRL-------------VSEKENDPSTVLTLSLPA  367
            PRL              S    DP T+L+LSLP 
Sbjct  171  PRLGAVVLPPPPLPIETSSSSEDPPTLLSLSLPG  204



>ref|XP_010446682.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=319

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 109/145 (75%), Gaps = 13/145 (9%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL++LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  11   ERIKGPWSPEEDDLLQRLVQKHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRAFS  70

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK-----YSAVIGSNEG-  619
             EED+ I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK      S   G N G 
Sbjct  71   QEEDDTIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSVEGQSCDFGGNGGY  130

Query  618  ----GEPRPGRILKRADSADVTVTA  556
                GE +P   LKR  S     T 
Sbjct  131  DGNLGEEQP---LKRTASGGGVSTG  152



>emb|CDY02098.1| BnaA03g40690D [Brassica napus]
Length=293

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            +PEEDE I    A+ GN+WATIAR+LNGRTDNA+KNHWNSTLKRK+
Sbjct  62   SPEEDETILSARAKFGNRWATIARLLNGRTDNAVKNHWNSTLKRKF  107



>ref|XP_009138487.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
 emb|CDY29542.1| BnaA03g53870D [Brassica napus]
Length=265

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 147/261 (56%), Gaps = 40/261 (15%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+K+VE+HG RNWSLISKSIP RSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDDLLQKVVEEHGPRNWSLISKSIPARSGKSCRLRWCNQLSPEVEHRGFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRPG  601
             EEDE I + HA+ GNKWATI+R+L+GRTDNA+KNHWNSTLKRK +        GE +P 
Sbjct  70   AEEDETIVRAHARYGNKWATISRLLSGRTDNAVKNHWNSTLKRKCTPEGYDGNLGEGQPS  129

Query  600  RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQAVEPRL  421
               KRA S  V       GL +S                            P       +
Sbjct  130  ---KRAASGGVCT-----GLYIS----------------------------PGSPAGSDV  153

Query  420  VSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRRGDSTEAAAPAPV-Ksestltlsp  244
             +    DP T L+LSLP    N+G  +           D    A   PV K E    +  
Sbjct  154  SASDGGDPPTYLSLSLPW---NNGCDTETVGINGDTVIDGGYTAELFPVRKEEERGIVGG  210

Query  243  ellsLMQDMIRKEVETYYSAL  181
            E ++ +Q+MIR EV +Y + L
Sbjct  211  EFMTAVQEMIRTEVRSYMAEL  231



>ref|XP_010426549.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=311

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 96/107 (90%), Gaps = 0/107 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK S
Sbjct  62   SPEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCS  108



>ref|XP_008367655.1| PREDICTED: transcription factor MYB44-like [Malus domestica]
Length=317

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 98/108 (91%), Gaps = 0/108 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED+ L+ LV+ +G RNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF+
Sbjct  9    DRIKGPWSPEEDEALQNLVKIYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFS  68

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAV  637
            PEED+ + + HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S++
Sbjct  69   PEEDDTLIRAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSSM  116



>emb|CDY38933.1| BnaA04g13540D [Brassica napus]
Length=292

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EED LL+ LV++HG RNWSLISK I GRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    ETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
            F+PEEDE+I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S 
Sbjct  68   FSPEEDEMILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSG  116



>ref|XP_009396365.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=375

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 1/118 (1%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++ R+KGPWS EED  L++LV++HG RNWSLIS+SIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  12   EAARIKGPWSPEEDTSLQRLVQRHGPRNWSLISRSIPGRSGKSCRLRWCNQLSPQVEHRP  71

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS-AVIGSNEGG  616
            FT EEDE+I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKY+    GS +GG
Sbjct  72   FTAEEDEIIIRAHRRFGNKWATIARILSGRTDNAIKNHWNSTLKRKYTPPCAGSGDGG  129



>ref|XP_006393928.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
 gb|ESQ31214.1| hypothetical protein EUTSA_v10004676mg [Eutrema salsugineum]
Length=301

 Score =   191 bits (486),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SSEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>ref|XP_009140453.1| PREDICTED: transcription factor MYB44 [Brassica rapa]
Length=292

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/109 (79%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EED LL+ LV++HG RNWSLISK I GRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    ETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
            F+PEEDE+I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK S 
Sbjct  68   FSPEEDEMILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRKCSG  116



>ref|XP_006279745.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
 gb|EOA12643.1| hypothetical protein CARUB_v10027659mg [Capsella rubella]
Length=300

 Score =   191 bits (485),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>ref|XP_003603000.1| Myb transcription factor [Medicago truncatula]
 gb|AES73251.1| myb transcription factor [Medicago truncatula]
 gb|AFK37953.1| unknown [Medicago truncatula]
Length=226

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 105/145 (72%), Gaps = 10/145 (7%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED +L +LVEQHGARNWSLIS+ I GRSGKSCRLRWCNQLSP VEHRPF+
Sbjct  34   DRIKGPWSAEEDRILTRLVEQHGARNWSLISRYIKGRSGKSCRLRWCNQLSPTVEHRPFS  93

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK------YSAVIGSNEG  619
             +EDE I   HAQ GN+WATIAR+L GRTDNA+KNHWNSTLKR+       +   G NEG
Sbjct  94   SQEDETIIAAHAQYGNRWATIARLLPGRTDNAVKNHWNSTLKRRAGCGGSVTVAGGGNEG  153

Query  618  GEPRPGRILKRADSADVTVTAAPPG  544
            G+          D     +T APPG
Sbjct  154  GQ----FTFPLEDDPLTALTLAPPG  174



>ref|XP_004151866.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 ref|XP_004156766.1| PREDICTED: transcription factor MYB44-like [Cucumis sativus]
 gb|KGN63306.1| hypothetical protein Csa_2G427310 [Cucumis sativus]
Length=301

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 129/315 (41%), Positives = 166/315 (53%), Gaps = 59/315 (19%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EEDD L++LV ++G RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  5    TDRIKGPWSPEEDDALQRLVHKYGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRAF  64

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPRP  604
            TP+EDE I    A  GNKWATIAR+L+GRTDNAIKNHWNSTLKRK S+ +  + GG    
Sbjct  65   TPDEDEAIINAQALYGNKWATIARLLSGRTDNAIKNHWNSTLKRKCSS-MPDDTGGCHAT  123

Query  603  GRILKRADSADVTVTA-APPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPL----Q  439
                K++ SA + +   +P G  +S                   AV S  +  P+     
Sbjct  124  SPPFKKSVSAGLYMPPNSPSGSDLSDSGFF-------------PAVSSSHVFRPVPRTGA  170

Query  438  AVEPRLVSEKENDPSTVLTLSLPAPGSND---------GVSSLQRDQPSYRRGDSTEAAA  286
             + P       +DP T L+LSLP   S++         GV  +     S RR      +A
Sbjct  171  VLPPGETVSSSDDPPTSLSLSLPGADSSEVNFVANSVQGVGGV-----SERRSTGLACSA  225

Query  285  PAPVKsestltlspell-----------sLMQDMIRKEVETYYSALVIK-----------  172
             A  +   +                   ++MQ+MIRKEV  Y + L+ +           
Sbjct  226  TANGEERISGEKEESNSNGFGIFSSDLMAVMQEMIRKEVRNYMAGLMEQKVGGGGGVCYQ  285

Query  171  ----DGVRNAEVKRI  139
                 G RN  V+RI
Sbjct  286  QAAAGGFRNVVVQRI  300



>ref|XP_009415461.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+ GPWS EED+ L+ LV++HG RNWSLISKSIPGRSGKSCRLRWCNQLSP+VEHR 
Sbjct  6    DVDRITGPWSQEEDEALQSLVQRHGPRNWSLISKSIPGRSGKSCRLRWCNQLSPQVEHRH  65

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYS  643
            FT EEDE+I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRKYS
Sbjct  66   FTAEEDEIIVRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKYS  113



>ref|XP_002866710.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42969.1| AtMYB44/AtMYBr1 [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>emb|CAA90809.1| MYB-related protein [Arabidopsis thaliana]
Length=305

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>gb|AAM64847.1| myb-related protein, 33.3K [Arabidopsis thaliana]
Length=305

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>emb|CDX89554.1| BnaC04g35730D [Brassica napus]
Length=293

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 94/106 (89%), Gaps = 0/106 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            ++DR+KGPWS EED LL+ LV++HG RNWSLISK I GRSGKSCRLRWCNQLSPEVEHR 
Sbjct  8    ETDRIKGPWSPEEDQLLQTLVQKHGPRNWSLISKPISGRSGKSCRLRWCNQLSPEVEHRA  67

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            F+PEEDE I   HA+ GNKWATIAR+LNGRTDNAIKNHWNSTLKRK
Sbjct  68   FSPEEDETILLAHARFGNKWATIARLLNGRTDNAIKNHWNSTLKRK  113



>ref|XP_010515371.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=304

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+ +VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRMMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            +PEEDE I    A+ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SPEEDETIVTARAKFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>ref|NP_201531.1| transcription factor MYB44 [Arabidopsis thaliana]
 sp|Q9FDW1.1|MYB44_ARATH RecName: Full=Transcription factor MYB44; AltName: Full=Myb-related 
protein 44; Short=AtMYB44; AltName: Full=Myb-related 
protein R1; Short=AtMYBR1 [Arabidopsis thaliana]
 gb|AAG41459.1|AF326877_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAK00380.1|AF339698_1 putative myb-related protein, 33.3K [Arabidopsis thaliana]
 dbj|BAB09015.1| myb-related protein, 33.3K [Arabidopsis thaliana]
 gb|AAS10118.1| MYB transcription factor [Arabidopsis thaliana]
 gb|AED98326.1| transcription factor MYB44 [Arabidopsis thaliana]
 dbj|BAP16463.1| myb-related protein, 33.3K [Cloning vector pTACAtg1]
Length=305

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>gb|AAK96490.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
 gb|AAL31250.1| AT5g67300/K8K14_2 [Arabidopsis thaliana]
Length=305

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>ref|XP_006293134.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
 gb|EOA26032.1| hypothetical protein CARUB_v10019440mg [Capsella rubella]
Length=309

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            +PEEDE I    ++ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SPEEDETIVTARSKFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



>gb|EYU34554.1| hypothetical protein MIMGU_mgv1a011398mg [Erythranthe guttata]
Length=283

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 134/278 (48%), Positives = 167/278 (60%), Gaps = 32/278 (12%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
             + DR+KGPWS EEDDLL+ LV++HG RNW+LIS+SIPGRSGKSCRLRWCNQL P VEHR
Sbjct  3    GNMDRIKGPWSPEEDDLLQSLVQRHGPRNWTLISRSIPGRSGKSCRLRWCNQLCPHVEHR  62

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP  610
            PFTPEED+ I + H++ GNKWATIAR+L+GRTDNAIKNHWNSTLKRK +++  S++GG  
Sbjct  63   PFTPEEDDAIIRAHSRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKSASLSFSSDGGGG  122

Query  609  RPG--RILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALPLQA  436
              G  R LKR+ SA         GL VS    S    S S   N             LQ 
Sbjct  123  GVGSERPLKRSVSAGS-------GLPVSGLYLSPGSPSISDGCNSS-----------LQV  164

Query  435  VEPRLVSEKENDPSTVLTLSLPAPGSNDGVSS--LQRDQPSYR-RGDSTEAAAPAPVKse  265
            V P +     +DP T L+LSLP   S +  +S   +  QP       +       P    
Sbjct  165  VVPPI-----DDPPTGLSLSLPGVESTESTTSHRTESTQPKMNPVQLTLPLLTTPPPPPP  219

Query  264  stltlspellsLMQDMIRKEVETYYSALVIKDGVRNAE  151
              L LS EL+++MQ+MIR EV +Y    +I  GV   +
Sbjct  220  PQLGLSSELMAVMQEMIRAEVRSY----MIMGGVEQQQ  253



>ref|XP_010484518.1| PREDICTED: transcription factor MYB44-like [Camelina sativa]
Length=309

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/217 (53%), Positives = 140/217 (65%), Gaps = 19/217 (9%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DR+KGPWS EED+ L++LV ++G RNW++ISKSIPGRSGKSCRLRWCNQLSP+VEHR F
Sbjct  2    ADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRSF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIG--SNEGGEP  610
            + EEDE IA+ HAQ GNKWATIAR+LNGRTDNA+KNHWNSTLKRK        S +G E 
Sbjct  62   STEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRRSFDGSED  121

Query  609  RPGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP-----  445
            +  R +KR+ SA      +PP +     S      S  S+ +    + SV L  P     
Sbjct  122  Q--RPVKRSVSA-----GSPPVVTGLYMSPGSPTGSDVSDSSTIPILPSVELFKPVPRPG  174

Query  444  ---LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVS  343
               L    P   S    DP T+L+LSL  PG+ D VS
Sbjct  175  AVVLPPPLPIETSSSSEDPPTLLSLSL--PGAADVVS  209



>ref|XP_009136534.1| PREDICTED: transcription factor MYB44-like [Brassica rapa]
Length=293

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 95/106 (90%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE++G RNWS ISKSIPGRSGKSCRLRWCNQLSPEVEHRPF
Sbjct  2    ADRVKGPWSEEEDEQLRRMVEKYGPRNWSAISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            + EEDE I    A+ GN+WATIAR+LNGRTDNA+KNHWNSTLKRK+
Sbjct  62   SAEEDETILSARAKFGNRWATIARLLNGRTDNAVKNHWNSTLKRKF  107



>gb|EPS70032.1| myb-like protein, partial [Genlisea aurea]
Length=147

 Score =   184 bits (466),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 96/119 (81%), Gaps = 5/119 (4%)
 Frame = -3

Query  981  FRGMA-----DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCN  817
            F GMA      S+R KGPWS EED LL++LVE+ G RNWSLISKSIPGRSGKSCRLRWCN
Sbjct  1    FSGMAARKEESSERAKGPWSPEEDGLLRRLVEKQGPRNWSLISKSIPGRSGKSCRLRWCN  60

Query  816  QLSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
            QLSP VEHR FT EED  I + H ++GNKWA IAR+L+GRTDNAIKNHWNSTLKRK  A
Sbjct  61   QLSPAVEHRAFTAEEDATIIRAHGELGNKWAAIARLLSGRTDNAIKNHWNSTLKRKCGA  119



>gb|KFK30351.1| hypothetical protein AALP_AA7G250300 [Arabis alpina]
Length=309

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            +R+KGPWS EEDDLL+ LV +HG RNWSLISKSI GRSGKSCRLRWCNQLSPEVEHR F+
Sbjct  10   ERIKGPWSPEEDDLLQSLVSKHGPRNWSLISKSISGRSGKSCRLRWCNQLSPEVEHRAFS  69

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
             EEDE I + HA+ GNKWATI+R+LNGRTDNAIKNHWNSTLKRK S+
Sbjct  70   TEEDETIIRAHARFGNKWATISRLLNGRTDNAIKNHWNSTLKRKCSS  116



>ref|XP_010268711.1| PREDICTED: transcription factor MYB44-like [Nelumbo nucifera]
Length=242

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -3

Query  978  RGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEV  799
            R ++ S+R+KGPWSTEED +L +LV+++GARNWSLIS+ IPGRSGKSCRLRWCNQLSP V
Sbjct  30   RAISKSERIKGPWSTEEDKILTRLVDRYGARNWSLISRYIPGRSGKSCRLRWCNQLSPNV  89

Query  798  EHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            EHRPF+P EDE I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+
Sbjct  90   EHRPFSPAEDETILAAHARYGNRWATIARILPGRTDNAVKNHWNSTLKRR  139



>ref|XP_009385523.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=363

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 2/117 (2%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DR+KGPWS +ED  L++LV++HG RNWS ISKSIPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  21   DVDRIKGPWSPDEDAALQRLVQRHGPRNWSPISKSIPGRSGKSCRLRWCNQLSPQVEHRP  80

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGG  616
            FT EEDE+I + H + GNKWATIAR+L+GRTDNAIKNHWNSTLKRK + + G  +GG
Sbjct  81   FTAEEDEIIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLKRKCTPLFG--DGG  135



>ref|XP_011030579.1| PREDICTED: transcription factor MYB44-like [Populus euphratica]
Length=247

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 109/166 (66%), Gaps = 22/166 (13%)
 Frame = -3

Query  978  RGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEV  799
            R    S+R+KGPWS EED +L +LVEQHG RNWSLIS+ I GRSGKSCRLRWCNQLSP V
Sbjct  28   RSANKSERIKGPWSAEEDRILTRLVEQHGPRNWSLISRYIKGRSGKSCRLRWCNQLSPNV  87

Query  798  EHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK----------  649
            EHRPF+P EDE I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+          
Sbjct  88   EHRPFSPVEDETILAAHARFGNRWATIARLLPGRTDNAVKNHWNSTLKRRARERQSQMNL  147

Query  648  ----YSAVIGSNEGGE--------PRPGRILKRADSADVTVTAAPP  547
                YS     NEG            P  I++  + A  T+T APP
Sbjct  148  EGNLYSNYGNHNEGNAIDINVASGSMPDTIMREEEDALTTLTLAPP  193



>ref|XP_009394543.1| PREDICTED: transcription factor MYB44-like [Musa acuminata subsp. 
malaccensis]
Length=309

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR KG WSTEED+ L++LVE+HG RNW+LI +SIPGRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  2    DRTKGSWSTEEDEALRRLVERHGPRNWTLIGRSIPGRSGKSCRLRWCNQLSPQVEHRPFT  61

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            PEEDE I + H + GNKWATIAR+L+GRTDNAIKNHWNSTL+R+
Sbjct  62   PEEDETIIRAHRRFGNKWATIARLLSGRTDNAIKNHWNSTLRRR  105



>emb|CDP07617.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  978  RGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEV  799
            R  + S+R+KGPWS EED +L +LVE++GARNWSLIS  I GRSGKSCRLRWCNQLSP V
Sbjct  30   RDASRSERIKGPWSAEEDKILTRLVEKYGARNWSLISNYIKGRSGKSCRLRWCNQLSPSV  89

Query  798  EHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            EHRPF+PEED+ I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+Y
Sbjct  90   EHRPFSPEEDDTILAAHAKYGNRWATIARLLPGRTDNAVKNHWNSTLKRRY  140



>ref|XP_004238184.1| PREDICTED: transcription factor MYB44-like [Solanum lycopersicum]
Length=252

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+R+KGPWS EED +L KLVE++GARNWSLISK I GRSGKSCRLRWCNQLSP VEHRPF
Sbjct  31   SERIKGPWSAEEDKILTKLVERYGARNWSLISKYIKGRSGKSCRLRWCNQLSPNVEHRPF  90

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            +P EDE I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+Y
Sbjct  91   SPAEDEAILAAHAKYGNRWATIARLLPGRTDNAVKNHWNSTLKRRY  136



>ref|NP_001147631.1| LOC100281240 [Zea mays]
 gb|ACF83396.1| unknown [Zea mays]
 gb|ACG28163.1| MYB transcription factor TaMYB1 [Zea mays]
 gb|ADX60113.1| MYB transcription factor [Zea mays]
 gb|AFW70526.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=304

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = -3

Query  969  ADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHR  790
            ++ DR+KGPWS EED+ L++LVE+HGARNW+ I + IPGRSGKSCRLRWCNQLSP+VE R
Sbjct  5    SECDRIKGPWSPEEDEALRRLVERHGARNWTAIGRGIPGRSGKSCRLRWCNQLSPQVERR  64

Query  789  PFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEP  610
            PFTPEED  I   HA++GN+WA IAR+L GRTDNA+KNHWNS+LKRK +    ++ G + 
Sbjct  65   PFTPEEDAAILAAHARLGNRWAAIARLLPGRTDNAVKNHWNSSLKRKLATATATSSGSDA  124

Query  609  RPGRILKRADSADVTVTAA  553
               R  KRA     + TA+
Sbjct  125  E--RACKRASPGPGSPTAS  141



>ref|XP_006354921.1| PREDICTED: transcription factor MYB44-like [Solanum tuberosum]
Length=251

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+R+KGPWS EED +L KLVE++GARNWSLISK I GRSGKSCRLRWCNQLSP VEHRPF
Sbjct  31   SERIKGPWSAEEDKILTKLVERYGARNWSLISKYIKGRSGKSCRLRWCNQLSPNVEHRPF  90

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            +P EDE I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+Y
Sbjct  91   SPAEDEAILAAHAKYGNRWATIARLLPGRTDNAVKNHWNSTLKRRY  136



>gb|AAG08961.1|AF122053_1 tuber-specific and sucrose-responsive element binding factor 
[Solanum tuberosum]
Length=255

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            S+R+KGPWS EED +L KLVE++GARNWSLISK I GRSGKSCRLRWCNQLSP VEHRPF
Sbjct  31   SERIKGPWSAEEDKILTKLVERYGARNWSLISKYIKGRSGKSCRLRWCNQLSPNVEHRPF  90

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKY  646
            +P EDE I   HA+ GN+WATIAR+L GRTDNA+KNHWNSTLKR+Y
Sbjct  91   SPAEDEAILAAHAKYGNRWATIARLLPGRTDNAVKNHWNSTLKRRY  136



>gb|ABD60291.2| R2R3-MYB transcription factor MYB6 [Picea glauca]
Length=252

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            + DR+KGPWS EED  L+  V++ G RNWSLISK+IPGRSGKSCRLRWCNQLSP+VEHRP
Sbjct  2    EPDRIKGPWSPEEDAALQHFVQKCGPRNWSLISKAIPGRSGKSCRLRWCNQLSPQVEHRP  61

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            FTPEED  I + HAQ GNKWATIAR+L+GRTDNAIKNHWNSTL+R+
Sbjct  62   FTPEEDATIIRAHAQHGNKWATIARVLSGRTDNAIKNHWNSTLRRR  107



>ref|XP_002975777.1| hypothetical protein SELMODRAFT_103999, partial [Selaginella 
moellendorffii]
 gb|EFJ23406.1| hypothetical protein SELMODRAFT_103999, partial [Selaginella 
moellendorffii]
Length=125

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 92/107 (86%), Gaps = 0/107 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED  L+KLV+++GARNWSLISK I GRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  19   DRIKGPWSPEEDAALQKLVDKYGARNWSLISKGIAGRSGKSCRLRWCNQLSPQVEHRPFT  78

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSA  640
              ED  I K H+Q GNKWATIAR+L GRTDNAIKNHWNSTL+R+  A
Sbjct  79   AAEDATIIKAHSQHGNKWATIARLLPGRTDNAIKNHWNSTLRRRCCA  125



>emb|CDX68566.1| BnaC01g26440D [Brassica napus]
Length=314

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 97/126 (77%), Gaps = 2/126 (2%)
 Frame = -3

Query  1017  FSNLNRLCLSAVFRGMADS--DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSG  844
             F  +N L    V   + DS  DR KGPWS EED+ L+++VE +G RNW  +SKS+PGRSG
Sbjct  22    FLYINDLSFFLVSTILLDSMADRAKGPWSQEEDEQLRRMVEHYGPRNWLEVSKSVPGRSG  81

Query  843   KSCRLRWCNQLSPEVEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNS  664
             KSCRLRWCNQLSP VEHRPF+ EED+ I    A  GNKWATIAR+LNGRTDNA+KNHWNS
Sbjct  82    KSCRLRWCNQLSPVVEHRPFSSEEDKTIVSARATFGNKWATIARLLNGRTDNAVKNHWNS  141

Query  663   TLKRKY  646
             TLKRKY
Sbjct  142   TLKRKY  147



>ref|XP_002298748.1| hypothetical protein POPTR_0001s30750g [Populus trichocarpa]
 gb|EEE83553.1| hypothetical protein POPTR_0001s30750g [Populus trichocarpa]
Length=244

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 148/277 (53%), Gaps = 44/277 (16%)
 Frame = -3

Query  966  DSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRP  787
            D DRVKGPWS EED LLK LV +HG R+W++I++++PGRSGKSCRLRWCNQLSP VEHR 
Sbjct  2    DCDRVKGPWSPEEDALLKHLVIKHGPRSWTMIARAVPGRSGKSCRLRWCNQLSPVVEHRA  61

Query  786  FTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGSNEGGEPR  607
            FT EED +I   H + GNKWA IAR+L+GRTDNAIKNHWNS LKRKY+  I    GG   
Sbjct  62   FTREEDVIIINAHIKYGNKWAAIARLLDGRTDNAIKNHWNSKLKRKYADFI--VHGGMVN  119

Query  606  PGRILKRADSADVTVTAAPPGLRVsrdsssdsdisyssnDNGPAAVRSVRLALP------  445
               +    D +  TV+++    R                 N P+        LP      
Sbjct  120  EDGV---KDKSAKTVSSSSVLERA----------------NTPSGSEVSDAGLPGTSSLL  160

Query  444  LQAVEPRLVSEKENDPSTVLTLSLPAPGSNDGVSSLQRDQPSYRR----GDSTEAAAPAP  277
            +Q   P + S   N+      L+L  PG   G   L RD     +    GD+ +     P
Sbjct  161  VQENVPVVESGISNNADVSTELTLSVPGMKSG--QLGRDHGVGNKGLLTGDAEKTMTFGP  218

Query  276  VKsestltlspellsLMQDMIRKEVETYYSALVIKDG  166
                       +LL++MQ+MIRKEV  Y   +  K G
Sbjct  219  -----------KLLAVMQEMIRKEVRDYMVGIGGKSG  244



>ref|XP_002973727.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
 gb|EFJ25387.1| hypothetical protein SELMODRAFT_99462, partial [Selaginella moellendorffii]
Length=122

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 91/104 (88%), Gaps = 0/104 (0%)
 Frame = -3

Query  960  DRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPFT  781
            DR+KGPWS EED  L+KLV+++GARNWSLISK I GRSGKSCRLRWCNQLSP+VEHRPFT
Sbjct  19   DRIKGPWSPEEDAALQKLVDKYGARNWSLISKGIAGRSGKSCRLRWCNQLSPQVEHRPFT  78

Query  780  PEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
              ED  I K H+Q GNKWATIAR+L GRTDNAIKNHWNSTL+R+
Sbjct  79   AAEDATIIKAHSQHGNKWATIARLLPGRTDNAIKNHWNSTLRRR  122



>gb|KDP44734.1| hypothetical protein JCGZ_01234 [Jatropha curcas]
 gb|AIT52205.1| MYB family protein [Jatropha curcas]
Length=260

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = -3

Query  981  FRGMADSDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPE  802
            F G   +DR+KG WS +ED  L KLVEQHG RNWSLIS  IPGRSGKSCRLRWCNQLSPE
Sbjct  4    FSGCG-ADRIKGSWSPQEDANLIKLVEQHGPRNWSLISTGIPGRSGKSCRLRWCNQLSPE  62

Query  801  VEHRPFTPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRKYSAVIGS  628
            V+HRPF+P ED +I + HA  GNKWATIAR+L GRTDNAIKNHWNSTL+RK +A + S
Sbjct  63   VQHRPFSPAEDAIIVQAHAIHGNKWATIARLLPGRTDNAIKNHWNSTLRRKRAAELSS  120



>emb|CDX83109.1| BnaA01g21090D [Brassica napus]
Length=162

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  963  SDRVKGPWSTEEDDLLKKLVEQHGARNWSLISKSIPGRSGKSCRLRWCNQLSPEVEHRPF  784
            +DRVKGPWS EED+ L+++VE +G RNWS +SKS+PGRSGKSCRLRWCNQLSP+VEHRPF
Sbjct  2    ADRVKGPWSQEEDEQLRRMVEHYGPRNWSEVSKSVPGRSGKSCRLRWCNQLSPDVEHRPF  61

Query  783  TPEEDEVIAKVHAQVGNKWATIARMLNGRTDNAIKNHWNSTLKRK  649
            + +ED+ I    A  GNKWATIAR+LNGRTDNA+KNHWNSTLKRK
Sbjct  62   SSDEDKTIVSARATFGNKWATIARLLNGRTDNAVKNHWNSTLKRK  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2592761898720