BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c81052_g1_i1 len=640 path=[1:0-639]

Length=640
                                                                      Score     E

ref|XP_010320431.1|  PREDICTED: uncharacterized protein LOC101263408  53.5    4e-06   
ref|XP_006342053.1|  PREDICTED: uncharacterized protein LOC102598340  52.4    1e-05   
ref|XP_009595693.1|  PREDICTED: uncharacterized protein LOC104091951  51.2    4e-05   
ref|XP_009758324.1|  PREDICTED: uncharacterized protein LOC104211028  50.1    7e-05   



>ref|XP_010320431.1| PREDICTED: uncharacterized protein LOC101263408 [Solanum lycopersicum]
Length=133

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 11/141 (8%)
 Frame = -2

Query  534  MGWFARESRGLSLQGPVGGSISPPPLGLMVFLGSVLFWMYMGSDSE---SDKKQQAKTNF  364
            MGWF  E RG+S +     SIS PPL L+V  G V+F M M + SE   + +K +A    
Sbjct  1    MGWFIGERRGVSWRDQTLESISAPPLALIVLFGLVIFLMSMSTYSEYKATVEKSKASMK-  59

Query  363  ILRFLLPLFAIFLVHFLMVSNRWFSPAPTGHYSRPFYQSMttadnddtttttplrlalll  184
            ++ FLLP   I LV+ ++ SNRWF   P G  +RP    +           +P  +ALLL
Sbjct  60   LMSFLLPFLIILLVYIMIDSNRWF--YPYGGVTRPVVYHL-----ASQEGGSPWGIALLL  112

Query  183  lillvLINYQPSVQSGWFKLL  121
            ++LLV+++YQ S QS WF++L
Sbjct  113  VLLLVMVHYQDSFQSTWFRIL  133



>ref|XP_006342053.1| PREDICTED: uncharacterized protein LOC102598340 [Solanum tuberosum]
Length=133

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 81/141 (57%), Gaps = 11/141 (8%)
 Frame = -2

Query  534  MGWFARESRGLSLQGPVGGSISPPPLGLMVFLGSVLFWMYMGSDSE---SDKKQQAKTNF  364
            MGWF  E RG+S +     S+S PPL L+V  G V+F M M + SE   + +K +A    
Sbjct  1    MGWFIGERRGVSWRDQTLESLSAPPLALIVLFGLVIFLMSMSTYSEYKATVEKSKASMK-  59

Query  363  ILRFLLPLFAIFLVHFLMVSNRWFSPAPTGHYSRPFYQSMttadnddtttttplrlalll  184
            ++ FLLP   I LV+ ++ SNRWF   P G  +RP    +           +P  +ALLL
Sbjct  60   LMSFLLPFLIILLVYIMIDSNRWF--YPYGGVTRPVVYHL-----ASQEGGSPWGIALLL  112

Query  183  lillvLINYQPSVQSGWFKLL  121
            ++LLV+++YQ S QS WF++L
Sbjct  113  VLLLVMVHYQDSFQSTWFRML  133



>ref|XP_009595693.1| PREDICTED: uncharacterized protein LOC104091951 [Nicotiana tomentosiformis]
Length=137

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -2

Query  534  MGWFARESRGLSLQGPVGGSISPPPLGLMVFLGSVLFWMYMGSDSESDKKQQAKTNFI--  361
            MGWF  E RG+S +     S S PP  L++F G V+  MY    S+   ++Q   N +  
Sbjct  1    MGWFTSERRGISWRDQTVESASAPPFPLILFFGLVILLMYFAGYSDYKAQEQRLENSMRL  60

Query  360  LRFLLPLFAIFLVHFLMVSNRWFSP  286
            L FLLP+  + +V+ ++V+NRWFSP
Sbjct  61   LLFLLPMLVVLMVYAMVVNNRWFSP  85



>ref|XP_009758324.1| PREDICTED: uncharacterized protein LOC104211028, partial [Nicotiana 
sylvestris]
Length=122

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = -2

Query  534  MGWFARESRGLSLQGPVGGSISPPPLGLMVFLGSVLFWMYMGSDSESDKKQQAKTNFI--  361
            MGWF  E RG+S +     S S PP  L++F G V+  MY    S+   ++Q   N +  
Sbjct  1    MGWFTSERRGISWRDQTVESASAPPFPLILFFGLVILLMYFAGYSDYKAQEQRSKNSMRL  60

Query  360  LRFLLPLFAIFLVHFLMVSNRWFSP  286
            L FLLP+  + +V+ ++V+NR FSP
Sbjct  61   LLFLLPMLVVIMVYAMVVNNRCFSP  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889286245264