BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c80989_g1_i1 len=1790 path=[1768:0-1789]

Length=1790
                                                                      Score     E

ref|XP_009589328.1|  PREDICTED: cytochrome P450 94C1-like               726   0.0      
ref|XP_009766870.1|  PREDICTED: cytochrome P450 94C1-like               716   0.0      
ref|XP_010322431.1|  PREDICTED: cytochrome P450 94C1                    696   0.0      
ref|XP_006347236.1|  PREDICTED: cytochrome P450 94A1-like               695   0.0      
emb|CDP06950.1|  unnamed protein product                                682   0.0      
ref|XP_002264897.1|  PREDICTED: cytochrome P450 94C1                    682   0.0      Vitis vinifera
ref|XP_007015870.1|  Cytochrome P450 94A1                               678   0.0      
ref|XP_010034212.1|  PREDICTED: cytochrome P450 94C1-like               675   0.0      
ref|XP_006424280.1|  hypothetical protein CICLE_v10028253mg             671   0.0      
gb|KDO51311.1|  hypothetical protein CISIN_1g040199mg                   670   0.0      
ref|XP_002529058.1|  cytochrome P450, putative                          670   0.0      Ricinus communis
ref|XP_006471355.1|  PREDICTED: cytochrome P450 94A1-like               669   0.0      
ref|XP_011044868.1|  PREDICTED: cytochrome P450 94C1-like               666   0.0      
ref|XP_010271731.1|  PREDICTED: cytochrome P450 94C1-like               665   0.0      
ref|XP_006471356.1|  PREDICTED: cytochrome P450 94A1-like               662   0.0      
ref|XP_006424281.1|  hypothetical protein CICLE_v10028254mg             662   0.0      
ref|XP_002312905.2|  cytochrome P450 family protein                     661   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006592314.1|  PREDICTED: cytochrome P450 94A1-like               659   0.0      
ref|XP_010244250.1|  PREDICTED: cytochrome P450 94C1                    657   0.0      
ref|XP_009618179.1|  PREDICTED: cytochrome P450 94C1-like               655   0.0      
gb|AJD25221.1|  cytochrome P450 CYP94C54                                654   0.0      
ref|XP_010089862.1|  Cytochrome P450 94A1                               653   0.0      
ref|XP_011046266.1|  PREDICTED: cytochrome P450 94C1-like               653   0.0      
ref|XP_011088865.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    652   0.0      
ref|XP_009588047.1|  PREDICTED: cytochrome P450 94C1-like               651   0.0      
ref|XP_006384629.1|  cytochrome P450 family protein                     650   0.0      
ref|XP_009789882.1|  PREDICTED: cytochrome P450 94C1-like               650   0.0      
ref|XP_010658738.1|  PREDICTED: cytochrome P450 94C1-like               649   0.0      
ref|XP_008228870.1|  PREDICTED: cytochrome P450 94C1                    649   0.0      
ref|XP_007205046.1|  hypothetical protein PRUPE_ppa004592mg             647   0.0      
ref|XP_004291623.1|  PREDICTED: cytochrome P450 94A1-like               647   0.0      
emb|CDP15392.1|  unnamed protein product                                645   0.0      
ref|XP_009774133.1|  PREDICTED: cytochrome P450 94C1-like               644   0.0      
emb|CAN66874.1|  hypothetical protein VITISV_021428                     650   0.0      Vitis vinifera
ref|XP_003606223.1|  Cytochrome P450 94A1                               644   0.0      
gb|AED99869.1|  cytochrome P450                                         642   0.0      
ref|XP_002277129.2|  PREDICTED: cytochrome P450 94C1                    640   0.0      Vitis vinifera
ref|XP_006430255.1|  hypothetical protein CICLE_v10013425mg             638   0.0      
ref|XP_006481811.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    639   0.0      
ref|XP_008376983.1|  PREDICTED: cytochrome P450 94C1-like               640   0.0      
ref|XP_006430254.1|  hypothetical protein CICLE_v10013407mg             637   0.0      
ref|XP_006481880.1|  PREDICTED: cytochrome P450 94A1-like               638   0.0      
emb|CAN67559.1|  hypothetical protein VITISV_002257                     638   0.0      Vitis vinifera
ref|XP_003538134.1|  PREDICTED: cytochrome P450 94A2-like               637   0.0      
ref|XP_009348573.1|  PREDICTED: cytochrome P450 94C1-like               638   0.0      
ref|XP_004305353.1|  PREDICTED: cytochrome P450 94A1-like               636   0.0      
ref|XP_007132406.1|  hypothetical protein PHAVU_011G092100g             636   0.0      
ref|XP_007027680.1|  Cytochrome P450 94A1                               637   0.0      
ref|XP_004249445.1|  PREDICTED: cytochrome P450 94C1-like               635   0.0      
ref|XP_004506151.1|  PREDICTED: cytochrome P450 94A1-like               635   0.0      
ref|XP_006341239.1|  PREDICTED: cytochrome P450 94A1-like               638   0.0      
ref|XP_009338687.1|  PREDICTED: cytochrome P450 94C1-like               635   0.0      
ref|XP_002533544.1|  cytochrome P450, putative                          632   0.0      Ricinus communis
gb|KDP42721.1|  hypothetical protein JCGZ_23661                         630   0.0      
ref|XP_011094380.1|  PREDICTED: cytochrome P450 94C1-like               630   0.0      
ref|XP_007010240.1|  Cytochrome P450                                    629   0.0      
ref|XP_010912256.1|  PREDICTED: cytochrome P450 94C1-like               628   0.0      
gb|EYU36964.1|  hypothetical protein MIMGU_mgv1a023150mg                626   0.0      
ref|XP_006341238.1|  PREDICTED: cytochrome P450 94A1-like               624   0.0      
ref|XP_010097640.1|  Cytochrome P450 94A1                               624   0.0      
ref|XP_002319770.2|  hypothetical protein POPTR_0013s07310g             624   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011077931.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    624   0.0      
ref|XP_008371286.1|  PREDICTED: cytochrome P450 94C1-like               623   0.0      
ref|XP_010932013.1|  PREDICTED: cytochrome P450 94C1-like               622   0.0      
ref|XP_010067149.1|  PREDICTED: cytochrome P450 94C1-like               622   0.0      
ref|XP_008241266.1|  PREDICTED: cytochrome P450 94C1-like               621   0.0      
gb|KCW87400.1|  hypothetical protein EUGRSUZ_B03878                     620   0.0      
ref|XP_007203184.1|  hypothetical protein PRUPE_ppa025166mg             620   0.0      
ref|XP_010049665.1|  PREDICTED: cytochrome P450 94C1-like               620   0.0      
ref|XP_009366644.1|  PREDICTED: cytochrome P450 94C1-like               620   0.0      
ref|XP_008784226.1|  PREDICTED: cytochrome P450 94C1-like               620   0.0      
ref|XP_009338906.1|  PREDICTED: cytochrome P450 94C1-like               619   0.0      
ref|XP_010045242.1|  PREDICTED: cytochrome P450 94C1-like               619   0.0      
ref|XP_008391766.1|  PREDICTED: cytochrome P450 94C1-like               619   0.0      
ref|XP_008790927.1|  PREDICTED: cytochrome P450 94C1-like               618   0.0      
ref|XP_010907146.1|  PREDICTED: cytochrome P450 94C1-like               618   0.0      
ref|XP_010541286.1|  PREDICTED: cytochrome P450 94C1-like               617   0.0      
ref|XP_011005435.1|  PREDICTED: cytochrome P450 94C1-like               617   0.0      
ref|XP_009374745.1|  PREDICTED: cytochrome P450 94C1-like               617   0.0      
ref|XP_011024239.1|  PREDICTED: cytochrome P450 94C1-like               617   0.0      
gb|KEH42061.1|  cytochrome P450 family 94 protein                       615   0.0      
ref|XP_009364325.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    619   0.0      
ref|XP_006577067.1|  PREDICTED: cytochrome P450 94A1-like               614   0.0      
ref|XP_008443586.1|  PREDICTED: cytochrome P450 94C1-like               612   0.0      
ref|XP_007162882.1|  hypothetical protein PHAVU_001G188500g             613   0.0      
gb|KGN59117.1|  hypothetical protein Csa_3G775300                       612   0.0      
ref|XP_004149216.1|  PREDICTED: cytochrome P450 94A1-like               611   0.0      
ref|XP_009414947.1|  PREDICTED: cytochrome P450 94C1-like               609   0.0      
ref|XP_009800093.1|  PREDICTED: cytochrome P450 94C1-like               610   0.0      
ref|XP_002315447.2|  hypothetical protein POPTR_0010s24310g             608   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009401100.1|  PREDICTED: cytochrome P450 94C1-like               607   0.0      
ref|XP_009403729.1|  PREDICTED: cytochrome P450 94C1-like               606   0.0      
ref|XP_007145327.1|  hypothetical protein PHAVU_007G229700g             607   0.0      
ref|XP_004139575.1|  PREDICTED: cytochrome P450 94A1-like               605   0.0      
ref|XP_009411963.1|  PREDICTED: cytochrome P450 94C1-like               605   0.0      
ref|XP_003596778.1|  Cytochrome P450                                    605   0.0      
gb|KGN64915.1|  hypothetical protein Csa_1G154090                       606   0.0      
ref|XP_010557399.1|  PREDICTED: cytochrome P450 94C1-like               603   0.0      
ref|XP_010521668.1|  PREDICTED: cytochrome P450 94C1-like               598   0.0      
ref|XP_009388367.1|  PREDICTED: cytochrome P450 94C1-like               598   0.0      
ref|XP_008461642.1|  PREDICTED: cytochrome P450 94C1                    598   0.0      
ref|XP_009414555.1|  PREDICTED: cytochrome P450 94C1-like               598   0.0      
ref|XP_008801229.1|  PREDICTED: cytochrome P450 94C1                    597   0.0      
ref|XP_009393377.1|  PREDICTED: cytochrome P450 94C1-like               597   0.0      
emb|CBI30267.3|  unnamed protein product                                595   0.0      
gb|KHN18751.1|  Cytochrome P450 94A1                                    597   0.0      
ref|XP_004516191.1|  PREDICTED: cytochrome P450 94A1-like               593   0.0      
ref|XP_006294094.1|  hypothetical protein CARUB_v10023087mg             592   0.0      
ref|XP_009103613.1|  PREDICTED: cytochrome P450 94C1                    590   0.0      
ref|NP_180337.1|  cytochrome P450, family 94, subfamily C, polype...    590   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY04506.1|  BnaA07g13320D                                          590   0.0      
ref|XP_008776666.1|  PREDICTED: cytochrome P450 94C1-like               588   0.0      
ref|XP_004487513.1|  PREDICTED: cytochrome P450 94A1-like               587   0.0      
ref|XP_010232583.1|  PREDICTED: cytochrome P450 94C1                    585   0.0      
ref|XP_002458797.1|  hypothetical protein SORBIDRAFT_03g040440          585   0.0      Sorghum bicolor [broomcorn]
dbj|BAK08034.1|  predicted protein                                      584   0.0      
ref|XP_010510742.1|  PREDICTED: cytochrome P450 94C1-like               583   0.0      
gb|AFW78139.1|  putative cytochrome P450 superfamily protein            583   0.0      
gb|EAY76557.1|  hypothetical protein OsI_04502                          583   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_002880978.1|  CYP94C1                                            582   0.0      
gb|KHN48177.1|  Cytochrome P450 94A1                                    581   0.0      
ref|NP_001172660.1|  Os01g0858350                                       582   0.0      
ref|XP_009421132.1|  PREDICTED: cytochrome P450 94C1-like               580   0.0      
ref|XP_003541451.1|  PREDICTED: cytochrome P450 94A1-like               581   0.0      
ref|XP_006409751.1|  hypothetical protein EUTSA_v10016556mg             578   0.0      
ref|XP_006361448.1|  PREDICTED: cytochrome P450 94A1-like               577   0.0      
gb|EAY98229.1|  hypothetical protein OsI_20140                          577   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010473161.1|  PREDICTED: cytochrome P450 94C1                    576   0.0      
ref|XP_004970645.1|  PREDICTED: cytochrome P450 94A1-like               577   0.0      
emb|CDX71432.1|  BnaC04g16670D                                          576   0.0      
gb|EYU35153.1|  hypothetical protein MIMGU_mgv1a026773mg                576   0.0      
ref|NP_001055681.1|  Os05g0445100                                       576   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645049.1|  PREDICTED: cytochrome P450 94A1-like               575   0.0      
emb|CBX25407.1|  hypothetical_protein                                   574   0.0      
emb|CDM80095.1|  unnamed protein product                                575   0.0      
dbj|BAJ99856.1|  predicted protein                                      572   0.0      
ref|XP_008657035.1|  PREDICTED: cytochrome P450 94C1-like               573   0.0      
ref|XP_006654479.1|  PREDICTED: cytochrome P450 94A2-like               572   0.0      
dbj|BAJ85532.1|  predicted protein                                      568   0.0      
ref|XP_003577893.2|  PREDICTED: cytochrome P450 94C1-like               567   0.0      
dbj|BAJ94069.1|  predicted protein                                      566   0.0      
ref|XP_002439880.1|  hypothetical protein SORBIDRAFT_09g021890          564   0.0      Sorghum bicolor [broomcorn]
gb|AJD25222.1|  cytochrome P450 CYP94C55                                562   0.0      
ref|XP_006436643.1|  hypothetical protein CICLE_v10033768mg             559   0.0      
ref|NP_001066166.2|  Os12g0150200                                       559   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABA95812.1|  Cytochrome P450 family protein, expressed               558   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008662461.1|  PREDICTED: cytochrome P450 94C1-like               557   0.0      
ref|XP_002862559.1|  CYP94C1                                            555   0.0      
ref|XP_008662467.1|  PREDICTED: cytochrome P450 94C1-like               553   0.0      
ref|XP_004961922.1|  PREDICTED: cytochrome P450 94A2-like               553   0.0      
ref|XP_003566202.1|  PREDICTED: cytochrome P450 94C1-like               554   0.0      
emb|CBI40252.3|  unnamed protein product                                551   0.0      
ref|XP_004977561.1|  PREDICTED: cytochrome P450 94A1-like               551   0.0      
ref|XP_002450277.1|  hypothetical protein SORBIDRAFT_05g003100          551   0.0      Sorghum bicolor [broomcorn]
ref|XP_003578905.1|  PREDICTED: cytochrome P450 94C1-like               550   0.0      
emb|CBX25324.1|  hypothetical_protein                                   548   0.0      
ref|NP_001065766.1|  Os11g0151400                                       549   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ88829.1|  predicted protein                                      548   0.0      
ref|XP_006481812.1|  PREDICTED: cytochrome P450 94A1-like isoform X2    543   0.0      
ref|XP_006662735.1|  PREDICTED: cytochrome P450 94A1-like               545   0.0      
ref|XP_006851517.1|  hypothetical protein AMTR_s00040p00166370          543   0.0      
ref|XP_010686047.1|  PREDICTED: cytochrome P450 94C1                    541   0.0      
ref|NP_001183398.1|  putative cytochrome P450 superfamily protein       540   0.0      
ref|XP_004978691.1|  PREDICTED: cytochrome P450 94A1-like               535   0.0      
ref|XP_002442803.1|  hypothetical protein SORBIDRAFT_08g003110          529   3e-179   Sorghum bicolor [broomcorn]
ref|XP_008664407.1|  PREDICTED: cytochrome P450 94C1-like               525   1e-177   
gb|EAZ17458.1|  hypothetical protein OsJ_32985                          512   1e-172   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010683845.1|  PREDICTED: cytochrome P450 94C1-like               509   3e-171   
emb|CBX24475.1|  hypothetical_protein                                   491   5e-165   
gb|EAZ19658.1|  hypothetical protein OsJ_35235                          492   9e-165   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007037964.1|  Cytochrome P450 94A2                               462   5e-153   
ref|XP_002278009.1|  PREDICTED: cytochrome P450 94A1                    447   2e-147   Vitis vinifera
ref|XP_002511196.1|  cytochrome P450, putative                          445   1e-146   Ricinus communis
ref|XP_010250749.1|  PREDICTED: cytochrome P450 94B3-like               444   4e-146   
ref|XP_009150186.1|  PREDICTED: cytochrome P450 94B3                    439   6e-144   
ref|XP_010111213.1|  Cytochrome P450 94A1                               439   6e-144   
emb|CDP15011.1|  unnamed protein product                                436   6e-143   
ref|XP_007210176.1|  hypothetical protein PRUPE_ppa017252mg             435   1e-142   
ref|XP_011041380.1|  PREDICTED: cytochrome P450 94A1-like               434   2e-142   
ref|XP_002279981.1|  PREDICTED: cytochrome P450 94B3-like               435   2e-142   Vitis vinifera
ref|XP_002322606.2|  hypothetical protein POPTR_0016s03160g             434   3e-142   Populus trichocarpa [western balsam poplar]
ref|XP_006477025.1|  PREDICTED: cytochrome P450 94A1-like               434   4e-142   
ref|XP_010677888.1|  PREDICTED: cytochrome P450 94B3                    435   4e-142   
ref|XP_008239459.1|  PREDICTED: cytochrome P450 94B3                    434   4e-142   
ref|XP_010247227.1|  PREDICTED: cytochrome P450 94B3                    434   4e-142   
ref|XP_002318721.2|  hypothetical protein POPTR_0012s09880g             437   1e-141   Populus trichocarpa [western balsam poplar]
gb|KDO52651.1|  hypothetical protein CISIN_1g036030mg                   432   2e-141   
ref|XP_004236332.1|  PREDICTED: cytochrome P450 94B3-like               431   3e-141   
gb|KFK34160.1|  hypothetical protein AALP_AA5G108200                    431   5e-141   
ref|XP_004236553.1|  PREDICTED: cytochrome P450 94B3-like               430   9e-141   
gb|ADE75655.1|  unknown                                                 432   1e-140   
ref|XP_011044159.1|  PREDICTED: cytochrome P450 94B3-like               430   1e-140   
gb|KGN63489.1|  hypothetical protein Csa_1G002090                       430   2e-140   
ref|XP_006440103.1|  hypothetical protein CICLE_v10019793mg             429   3e-140   
ref|XP_002282477.2|  PREDICTED: cytochrome P450 94A1-like               430   1e-139   Vitis vinifera
ref|XP_006351474.1|  PREDICTED: cytochrome P450 94A1-like               427   1e-139   
ref|XP_009610819.1|  PREDICTED: cytochrome P450 94A1-like               427   1e-139   
ref|XP_011083758.1|  PREDICTED: cytochrome P450 94B3-like               428   2e-139   
ref|XP_006351473.1|  PREDICTED: cytochrome P450 94A1-like               426   2e-139   
ref|XP_004236333.1|  PREDICTED: cytochrome P450 94B3-like               427   2e-139   
ref|XP_010250748.1|  PREDICTED: cytochrome P450 94B3-like               427   2e-139   
ref|XP_002282468.1|  PREDICTED: cytochrome P450 94A1                    426   3e-139   Vitis vinifera
ref|XP_010045498.1|  PREDICTED: cytochrome P450 94B3-like               427   3e-139   
ref|XP_008788895.1|  PREDICTED: cytochrome P450 94B3-like               426   4e-139   
ref|XP_010045499.1|  PREDICTED: cytochrome P450 94B3-like               426   7e-139   
ref|XP_010026539.1|  PREDICTED: cytochrome P450 94B3-like               426   7e-139   
emb|CAN75729.1|  hypothetical protein VITISV_031409                     426   8e-139   Vitis vinifera
ref|XP_006482029.1|  PREDICTED: cytochrome P450 94A1-like               425   8e-139   
ref|XP_002979339.1|  medium chain fatty acid hydroxylase                424   9e-139   
ref|XP_009359442.1|  PREDICTED: cytochrome P450 94B3-like               425   1e-138   
ref|XP_002988642.1|  medium chain fatty acid hydroxylase                424   1e-138   
emb|CDP06233.1|  unnamed protein product                                425   1e-138   
ref|XP_009763713.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    425   2e-138   
ref|XP_008443231.1|  PREDICTED: cytochrome P450 94A1-like               425   2e-138   
gb|KCW83159.1|  hypothetical protein EUGRSUZ_B00114                     424   2e-138   
gb|ADO24345.1|  cytochrome P450 A                                       424   2e-138   
ref|XP_009149812.1|  PREDICTED: cytochrome P450 94B3                    424   2e-138   
emb|CDY59153.1|  BnaC08g48490D                                          424   2e-138   
ref|XP_002964775.1|  medium chain fatty acid hydroxylase                424   3e-138   
gb|EPS62279.1|  hypothetical protein M569_12509                         424   3e-138   
ref|XP_002961706.1|  hypothetical protein SELMODRAFT_76541              423   3e-138   
ref|XP_006373690.1|  cytochrome P450 family protein                     423   4e-138   
ref|XP_010929779.1|  PREDICTED: cytochrome P450 94B3-like               424   4e-138   
ref|XP_010679201.1|  PREDICTED: cytochrome P450 94A1-like               424   5e-138   
ref|XP_006364779.1|  PREDICTED: cytochrome P450 94A2-like               423   6e-138   
ref|XP_006351475.1|  PREDICTED: cytochrome P450 94A1-like               422   8e-138   
gb|KCW83161.1|  hypothetical protein EUGRSUZ_B00116                     423   9e-138   
gb|EYU43048.1|  hypothetical protein MIMGU_mgv1a026913mg                421   1e-137   
ref|XP_006430501.1|  hypothetical protein CICLE_v10011533mg             422   1e-137   
ref|XP_008346695.1|  PREDICTED: cytochrome P450 94B3-like               422   1e-137   
ref|XP_007134770.1|  hypothetical protein PHAVU_010G074400g             422   2e-137   
ref|XP_011084785.1|  PREDICTED: cytochrome P450 94B3-like               421   2e-137   
ref|XP_011070085.1|  PREDICTED: cytochrome P450 94A1                    422   2e-137   
ref|XP_010026558.1|  PREDICTED: cytochrome P450 94B3-like               422   2e-137   
ref|XP_009368544.1|  PREDICTED: cytochrome P450 94B3-like               422   3e-137   
gb|AAL54884.1|AF092913_1  cytochrome P450-dependent fatty acid hy...    421   3e-137   Nicotiana tabacum [American tobacco]
ref|XP_004136768.1|  PREDICTED: cytochrome P450 94A1-like               421   4e-137   
ref|XP_006482030.1|  PREDICTED: cytochrome P450 94A1-like               421   4e-137   
ref|XP_009604998.1|  PREDICTED: cytochrome P450 94B3-like               420   9e-137   
ref|XP_010045501.1|  PREDICTED: cytochrome P450 94B3-like               420   1e-136   
ref|XP_008368443.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    420   1e-136   
ref|XP_002979336.1|  hypothetical protein SELMODRAFT_110688             419   2e-136   
ref|XP_004249121.2|  PREDICTED: cytochrome P450 94A2 isoform X2         419   2e-136   
gb|AJD25220.1|  cytochrome P450 CYP94B50                                419   2e-136   
gb|AAZ39645.1|  cytochrome P450 monooxygenase                           419   5e-136   Petunia x hybrida [garden petunia]
ref|XP_008341677.1|  PREDICTED: cytochrome P450 94B3-like               418   6e-136   
ref|XP_004249120.1|  PREDICTED: cytochrome P450 94A2 isoform X1         417   7e-136   
ref|XP_010679200.1|  PREDICTED: cytochrome P450 94A1-like               418   8e-136   
ref|XP_004167155.1|  PREDICTED: cytochrome P450 94A1-like               418   8e-136   
ref|XP_010247229.1|  PREDICTED: cytochrome P450 94B3-like               417   1e-135   
ref|XP_006838838.1|  hypothetical protein AMTR_s00002p00263780          417   1e-135   
gb|KCW83158.1|  hypothetical protein EUGRSUZ_B00113                     417   1e-135   
ref|XP_009766464.1|  PREDICTED: cytochrome P450 94B3-like               417   1e-135   
ref|XP_003601427.1|  Cytochrome P450 94A1                               418   2e-135   
ref|XP_010906406.1|  PREDICTED: cytochrome P450 94B3-like               416   2e-135   
gb|EPS70135.1|  hypothetical protein M569_04626                         416   3e-135   
ref|XP_009415113.1|  PREDICTED: cytochrome P450 94B3-like               417   3e-135   
gb|KCW83162.1|  hypothetical protein EUGRSUZ_B00117                     416   4e-135   
ref|XP_003521105.1|  PREDICTED: cytochrome P450 94A1                    415   5e-135   
gb|AJD25223.1|  cytochrome P450 CYP94D47                                415   7e-135   
ref|XP_009607568.1|  PREDICTED: cytochrome P450 94B3-like               415   8e-135   
ref|XP_008464443.1|  PREDICTED: cytochrome P450 94B3                    415   9e-135   
ref|XP_007050381.1|  Cytochrome P450 94A1                               415   1e-134   
gb|KFK28056.1|  hypothetical protein AALP_AA8G465900                    414   1e-134   
ref|XP_002300789.2|  cytochrome P450 CYP94A1 family protein             415   2e-134   Populus trichocarpa [western balsam poplar]
gb|KDP46287.1|  hypothetical protein JCGZ_10127                         414   2e-134   
ref|XP_009784521.1|  PREDICTED: cytochrome P450 94B3-like               414   3e-134   
ref|XP_002979685.1|  medium chain fatty acid hydroxylase                414   3e-134   
ref|XP_008788555.1|  PREDICTED: cytochrome P450 94A2-like               413   3e-134   
ref|XP_003516338.1|  PREDICTED: cytochrome P450 94A2-like               413   4e-134   
gb|EPS72518.1|  hypothetical protein M569_02237                         413   4e-134   
ref|XP_009620147.1|  PREDICTED: cytochrome P450 94A2-like               413   5e-134   
gb|AJD25218.1|  cytochrome P450 CYP94A48                                413   6e-134   
ref|XP_004502138.1|  PREDICTED: cytochrome P450 94A2-like               413   6e-134   
ref|XP_009790300.1|  PREDICTED: cytochrome P450 94A2                    412   7e-134   
ref|XP_009610631.1|  PREDICTED: cytochrome P450 94A2                    412   9e-134   
ref|XP_010055620.1|  PREDICTED: cytochrome P450 94A2-like               412   1e-133   
ref|XP_010045497.1|  PREDICTED: cytochrome P450 94B3-like               413   1e-133   
ref|XP_002985393.1|  hypothetical protein SELMODRAFT_122098             412   1e-133   
ref|XP_009620348.1|  PREDICTED: cytochrome P450 94B3                    412   1e-133   
ref|XP_010111205.1|  Cytochrome P450 94A2                               412   2e-133   
ref|XP_002519477.1|  cytochrome P450, putative                          411   3e-133   
ref|XP_007209920.1|  hypothetical protein PRUPE_ppa004467mg             411   3e-133   
gb|KHN12182.1|  Cytochrome P450 94A1                                    410   5e-133   
ref|XP_006383696.1|  cytochrome P450 CYP94A1 family protein             410   9e-133   
ref|XP_008244020.1|  PREDICTED: cytochrome P450 94A1-like               410   1e-132   
ref|XP_006447077.1|  hypothetical protein CICLE_v10017920mg             409   1e-132   
ref|XP_003522151.1|  PREDICTED: cytochrome P450 94A2-like               410   1e-132   
ref|XP_007162039.1|  hypothetical protein PHAVU_001G118600g             410   1e-132   
ref|XP_003624855.1|  Cytochrome P450                                    409   1e-132   
ref|XP_006470124.1|  PREDICTED: cytochrome P450 94A2-like               409   1e-132   
ref|XP_010247228.1|  PREDICTED: cytochrome P450 94B3-like               410   1e-132   
ref|XP_006290939.1|  hypothetical protein CARUB_v10017052mg             409   2e-132   
ref|XP_010525434.1|  PREDICTED: cytochrome P450 94B3                    409   2e-132   
ref|XP_010055610.1|  PREDICTED: cytochrome P450 94A2                    409   2e-132   
ref|XP_002521002.1|  cytochrome P450, putative                          409   2e-132   
ref|XP_009394066.1|  PREDICTED: cytochrome P450 94B3-like               409   2e-132   
ref|XP_006383694.1|  cytochrome P450 CYP94A1 family protein             409   2e-132   
ref|XP_011028759.1|  PREDICTED: cytochrome P450 94A1-like               409   3e-132   
ref|XP_009601037.1|  PREDICTED: cytochrome P450 94B3-like               408   3e-132   
ref|XP_010111207.1|  Cytochrome P450 94A1                               414   3e-132   
ref|XP_002893825.1|  CYP94D1                                            408   4e-132   
ref|XP_008235727.1|  PREDICTED: cytochrome P450 94A1-like               408   5e-132   
ref|XP_006338805.1|  PREDICTED: cytochrome P450 94A1-like               408   6e-132   
ref|XP_010515172.1|  PREDICTED: cytochrome P450 94B3-like               408   6e-132   
ref|XP_007199792.1|  hypothetical protein PRUPE_ppa004444mg             407   1e-131   
gb|EMS54048.1|  Cytochrome P450 94A1                                    403   1e-131   
gb|KEH22037.1|  cytochrome P450 family protein                          407   1e-131   
ref|XP_007010545.1|  Cytochrome P450, putative                          406   2e-131   
ref|XP_004247227.1|  PREDICTED: cytochrome P450 94A1-like               406   2e-131   
ref|XP_006351638.1|  PREDICTED: cytochrome P450 94A2-like               406   2e-131   
ref|XP_010938845.1|  PREDICTED: cytochrome P450 94B3-like               407   2e-131   
ref|NP_191222.1|  cytochrome P450, family 94, subfamily D, polype...    405   3e-131   
ref|XP_006848391.1|  hypothetical protein AMTR_s00013p00215200          405   4e-131   
ref|XP_004299232.1|  PREDICTED: cytochrome P450 94A1-like               405   4e-131   
ref|XP_009130252.1|  PREDICTED: cytochrome P450 94B1-like               405   5e-131   
ref|NP_190421.1|  cytochrome P450, family 94, subfamily B, polype...    405   6e-131   
ref|XP_010246280.1|  PREDICTED: cytochrome P450 94A2-like               405   8e-131   
ref|XP_010247156.1|  PREDICTED: cytochrome P450 94B3-like               405   8e-131   
ref|XP_010906405.1|  PREDICTED: cytochrome P450 94A1                    405   8e-131   
dbj|BAC43161.1|  putative cytochrome P450                               405   9e-131   
ref|NP_201150.1|  cytochrome P450, family 94, subfamily B, polype...    405   1e-130   
ref|XP_009393106.1|  PREDICTED: cytochrome P450 94A1-like               405   1e-130   
gb|EPS65724.1|  hypothetical protein M569_09053                         403   1e-130   
gb|AAM60854.1|  cytochrome P450-like protein                            404   1e-130   
ref|XP_002866555.1|  hypothetical protein ARALYDRAFT_496532             404   1e-130   
emb|CDP03714.1|  unnamed protein product                                404   3e-130   
ref|XP_010503490.1|  PREDICTED: cytochrome P450 94B3-like               404   3e-130   
ref|XP_011026019.1|  PREDICTED: cytochrome P450 94A1-like               404   3e-130   
ref|XP_010426348.1|  PREDICTED: cytochrome P450 94B3                    403   3e-130   
ref|XP_010104028.1|  Cytochrome P450 94A1                               402   4e-130   
gb|ABR16897.1|  unknown                                                 401   4e-130   
ref|XP_008788557.1|  PREDICTED: cytochrome P450 94A1                    403   5e-130   
ref|XP_002877615.1|  CYP94B3                                            402   6e-130   
ref|XP_010444242.1|  PREDICTED: cytochrome P450 94B1                    402   1e-129   
ref|XP_010484081.1|  PREDICTED: cytochrome P450 94B1-like               401   2e-129   
ref|XP_002307954.2|  putative cytochrome P450 family protein            400   3e-129   
ref|XP_009781600.1|  PREDICTED: cytochrome P450 94A2-like               401   3e-129   
ref|XP_006394276.1|  hypothetical protein EUTSA_v10005707mg             400   4e-129   
ref|XP_009407042.1|  PREDICTED: cytochrome P450 94B3-like               400   5e-129   
ref|XP_003520587.1|  PREDICTED: cytochrome P450 94A1-like               400   5e-129   
ref|XP_004289914.1|  PREDICTED: cytochrome P450 94A1-like               400   5e-129   
ref|XP_008393292.1|  PREDICTED: cytochrome P450 94A2-like               400   6e-129   
ref|XP_010550730.1|  PREDICTED: cytochrome P450 94B3                    400   6e-129   
ref|XP_010460278.1|  PREDICTED: cytochrome P450 94B1-like               399   1e-128   
ref|XP_009337343.1|  PREDICTED: cytochrome P450 94A2-like               399   2e-128   
emb|CDX67652.1|  BnaA07g16920D                                          399   2e-128   
ref|XP_009615866.1|  PREDICTED: cytochrome P450 94A2-like               399   2e-128   
ref|XP_002876375.1|  CYP94D2                                            398   2e-128   
ref|XP_006282257.1|  hypothetical protein CARUB_v10028534mg             399   2e-128   
ref|XP_006366194.1|  PREDICTED: cytochrome P450 94A1-like               399   2e-128   
ref|XP_010033411.1|  PREDICTED: cytochrome P450 94B3-like               399   2e-128   
ref|XP_004250943.1|  PREDICTED: cytochrome P450 94A2-like               399   2e-128   
ref|XP_010651498.1|  PREDICTED: cytochrome P450 94A1-like               399   3e-128   
gb|ABK28430.1|  unknown                                                 398   3e-128   
ref|XP_010545953.1|  PREDICTED: cytochrome P450 94B3-like               398   4e-128   
ref|XP_008374734.1|  PREDICTED: cytochrome P450 94A2-like               398   4e-128   
ref|XP_006361761.1|  PREDICTED: cytochrome P450 94A2-like               397   4e-128   
ref|NP_174713.1|  cytochrome P450, family 94, subfamily D, polype...    397   4e-128   
emb|CDY56777.1|  BnaAnng14430D                                          397   5e-128   
gb|AAL54886.1|AF092915_1  cytochrome P450-dependent fatty acid hy...    398   5e-128   
ref|XP_009412188.1|  PREDICTED: cytochrome P450 94A1-like               398   5e-128   
emb|CDP03713.1|  unnamed protein product                                397   6e-128   
ref|XP_011028760.1|  PREDICTED: cytochrome P450 94A2-like               397   6e-128   
ref|XP_010679199.1|  PREDICTED: cytochrome P450 94A2-like               398   6e-128   
ref|XP_008360918.1|  PREDICTED: cytochrome P450 94A2-like               398   7e-128   
ref|XP_009371650.1|  PREDICTED: cytochrome P450 94B3-like               397   7e-128   
ref|XP_008393293.1|  PREDICTED: cytochrome P450 94A2-like               398   8e-128   
ref|XP_007215034.1|  hypothetical protein PRUPE_ppa004311mg             397   1e-127   
ref|XP_007200096.1|  hypothetical protein PRUPE_ppa019319mg             397   1e-127   
ref|XP_008235725.1|  PREDICTED: cytochrome P450 94A1-like               397   1e-127   
ref|XP_009346889.1|  PREDICTED: cytochrome P450 94A2-like               397   1e-127   
ref|XP_011040725.1|  PREDICTED: cytochrome P450 94A1                    396   1e-127   
ref|XP_009354911.1|  PREDICTED: cytochrome P450 94A1-like               397   1e-127   
ref|XP_008790365.1|  PREDICTED: cytochrome P450 94A1-like               396   2e-127   
ref|XP_009337118.1|  PREDICTED: cytochrome P450 94A2-like               397   2e-127   
gb|KDP21346.1|  hypothetical protein JCGZ_21817                         396   2e-127   
ref|XP_009377719.1|  PREDICTED: cytochrome P450 94A1-like isoform X1    395   3e-127   
ref|XP_010246279.1|  PREDICTED: cytochrome P450 94A2-like               395   3e-127   
ref|XP_009104013.1|  PREDICTED: cytochrome P450 94B3-like               395   5e-127   
ref|XP_011087220.1|  PREDICTED: cytochrome P450 94A2-like               395   7e-127   
emb|CDX67653.1|  BnaA07g16930D                                          394   8e-127   
ref|XP_004233587.1|  PREDICTED: cytochrome P450 94B3                    395   8e-127   
ref|XP_008341306.1|  PREDICTED: cytochrome P450 94B3-like               394   9e-127   
dbj|BAJ97414.1|  predicted protein                                      395   1e-126   
ref|XP_008447772.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    394   1e-126   
gb|AAL54885.1|AF092914_1  cytochrome P450-dependent fatty acid hy...    394   1e-126   
ref|XP_010673087.1|  PREDICTED: cytochrome P450 94A2-like               394   1e-126   
ref|XP_009386731.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    394   1e-126   
ref|XP_009377718.1|  PREDICTED: cytochrome P450 94A1-like               394   2e-126   
dbj|BAO45862.1|  cytochrome P450 94A1                                   394   2e-126   
emb|CDY32023.1|  BnaC06g16010D                                          394   2e-126   
ref|XP_008810187.1|  PREDICTED: cytochrome P450 94A1-like               394   2e-126   
ref|XP_004170788.1|  PREDICTED: cytochrome P450 94A2-like               394   2e-126   
emb|CDX72120.1|  BnaC08g27540D                                          393   2e-126   
ref|XP_010673085.1|  PREDICTED: cytochrome P450 94A1-like               394   2e-126   
gb|EMT07846.1|  Cytochrome P450 94A1                                    389   2e-126   
ref|XP_008231126.1|  PREDICTED: cytochrome P450 94B3                    394   2e-126   
ref|XP_007200970.1|  hypothetical protein PRUPE_ppa004449mg             393   3e-126   
ref|XP_002521004.1|  cytochrome P450, putative                          393   4e-126   
gb|KFK35660.1|  cytochrome p450                                         392   4e-126   
ref|XP_006404244.1|  hypothetical protein EUTSA_v10011125mg             392   4e-126   
gb|KDP21345.1|  hypothetical protein JCGZ_21816                         392   5e-126   
ref|XP_009112079.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    392   5e-126   
ref|XP_002273811.3|  PREDICTED: cytochrome P450 94B3                    393   6e-126   
ref|XP_008364314.1|  PREDICTED: cytochrome P450 94A1-like               392   7e-126   
ref|XP_003553253.2|  PREDICTED: cytochrome P450 94A1-like               392   8e-126   
ref|XP_009116365.1|  PREDICTED: cytochrome P450 94B3                    391   9e-126   
ref|XP_010112360.1|  Cytochrome P450 94A1                               392   9e-126   
ref|XP_010278943.1|  PREDICTED: cytochrome P450 94A2-like               392   1e-125   
ref|XP_010038019.1|  PREDICTED: cytochrome P450 94A1-like               392   1e-125   
ref|XP_003553484.1|  PREDICTED: cytochrome P450 94A1-like               392   1e-125   
emb|CDY32022.1|  BnaC06g16000D                                          391   2e-125   
ref|XP_009762653.1|  PREDICTED: cytochrome P450 94B3-like               390   2e-125   
ref|XP_002300103.1|  cytochrome P450 family protein                     391   2e-125   
ref|XP_009104014.1|  PREDICTED: cytochrome P450 94B3-like               390   3e-125   
ref|XP_007162510.1|  hypothetical protein PHAVU_001G157900g             390   4e-125   
gb|KHN10718.1|  Cytochrome P450 94A1                                    387   5e-125   
ref|XP_006402968.1|  hypothetical protein EUTSA_v10005910mg             390   5e-125   
ref|XP_002509524.1|  cytochrome P450, putative                          390   5e-125   
ref|XP_008351912.1|  PREDICTED: cytochrome P450 94A2-like               390   7e-125   
ref|XP_011003922.1|  PREDICTED: cytochrome P450 94B3                    391   8e-125   
ref|XP_009377720.1|  PREDICTED: cytochrome P450 94A1-like isoform X2    389   9e-125   
ref|XP_001763206.1|  predicted protein                                  390   9e-125   
ref|XP_009367721.1|  PREDICTED: cytochrome P450 94A1-like               389   9e-125   
sp|O81117.2|C94A1_VICSA  RecName: Full=Cytochrome P450 94A1; AltN...    389   1e-124   
ref|XP_004242690.1|  PREDICTED: cytochrome P450 94A1-like               388   2e-124   
gb|AJD25219.1|  cytochrome P450 CYP94A49                                388   3e-124   
ref|XP_010935094.1|  PREDICTED: cytochrome P450 94A1-like               387   4e-124   
ref|XP_009594945.1|  PREDICTED: cytochrome P450 94A2-like               388   4e-124   
ref|XP_010516270.1|  PREDICTED: cytochrome P450 94B3-like               387   8e-124   
emb|CDP08469.1|  unnamed protein product                                387   9e-124   
ref|XP_011080016.1|  PREDICTED: cytochrome P450 94A2-like               386   1e-123   
gb|KEH23874.1|  cytochrome P450 family 94 protein                       386   1e-123   
ref|XP_004301073.1|  PREDICTED: cytochrome P450 94A1-like               386   1e-123   
ref|XP_007161734.1|  hypothetical protein PHAVU_001G094200g             385   2e-123   
ref|XP_004493756.1|  PREDICTED: cytochrome P450 94A1-like               386   2e-123   
ref|XP_006577700.1|  PREDICTED: cytochrome P450 94A1-like               388   2e-123   
ref|XP_010504571.1|  PREDICTED: cytochrome P450 94B3-like               384   7e-123   
ref|XP_002300790.2|  hypothetical protein POPTR_0002s04340g             381   8e-123   
gb|KHN10717.1|  Cytochrome P450 94A1                                    381   1e-122   
ref|XP_010039240.1|  PREDICTED: cytochrome P450 94A1-like               384   1e-122   
emb|CDY37921.1|  BnaA06g18960D                                          382   1e-122   
ref|XP_004495122.1|  PREDICTED: cytochrome P450 94A2-like               384   1e-122   
ref|XP_010673086.1|  PREDICTED: cytochrome P450 94A1-like               383   2e-122   
emb|CDP03715.1|  unnamed protein product                                383   3e-122   
ref|XP_006290956.1|  hypothetical protein CARUB_v10017072mg             382   4e-122   
ref|XP_003548522.2|  PREDICTED: cytochrome P450 94A1-like               382   4e-122   
gb|EPS66548.1|  hypothetical protein M569_08223                         380   5e-122   
ref|XP_006482377.1|  PREDICTED: cytochrome P450 94A1-like               384   6e-122   
ref|XP_010910194.1|  PREDICTED: cytochrome P450 94C1-like               376   7e-122   
ref|XP_008808400.1|  PREDICTED: cytochrome P450 94A1-like               381   8e-122   
ref|XP_008382925.1|  PREDICTED: cytochrome P450 94A1-like               383   1e-121   
ref|XP_010039015.1|  PREDICTED: cytochrome P450 94A2-like               381   1e-121   
gb|KHN38650.1|  Cytochrome P450 94A1                                    374   2e-121   
gb|KFK37646.1|  hypothetical protein AALP_AA3G010200                    380   3e-121   
ref|XP_008450098.1|  PREDICTED: cytochrome P450 94B3 isoform X1         380   3e-121   
ref|XP_010100076.1|  Cytochrome P450 94A1                               402   3e-121   
ref|XP_010552073.1|  PREDICTED: cytochrome P450 94B1                    379   5e-121   
ref|XP_010106592.1|  Cytochrome P450 94A1                               380   5e-121   
gb|KCW84705.1|  hypothetical protein EUGRSUZ_B01524                     377   1e-120   
gb|ABC59092.1|  cytochrome P450 monooxygenase CYP94A14                  378   2e-120   
ref|XP_010029004.1|  PREDICTED: cytochrome P450 94B3-like               378   2e-120   
ref|XP_011024949.1|  PREDICTED: cytochrome P450 94A1-like               378   3e-120   
ref|XP_001781706.1|  predicted protein                                  377   4e-120   
dbj|BAB92258.1|  putative cytochrome P450-dependent fatty acid hy...    377   4e-120   
ref|NP_566155.1|  cytochrome P450, family 94, subfamily B, polype...    377   5e-120   
ref|NP_001067905.2|  Os11g0483000                                       379   5e-120   
ref|XP_004970286.1|  PREDICTED: cytochrome P450 94A1-like               377   6e-120   
ref|NP_001168221.1|  uncharacterized protein LOC100381980 precursor     376   1e-119   
gb|EAY80935.1|  hypothetical protein OsI_36114                          378   1e-119   
ref|XP_004513634.1|  PREDICTED: cytochrome P450 94A1-like               376   2e-119   
ref|XP_009414953.1|  PREDICTED: cytochrome P450 94A2-like               376   2e-119   
gb|EYU45403.1|  hypothetical protein MIMGU_mgv1a006399mg                373   2e-119   
ref|XP_009409972.1|  PREDICTED: cytochrome P450 94A1-like               375   3e-119   
tpg|DAA38877.1|  TPA: putative cytochrome P450 superfamily protein      376   3e-119   
tpg|DAA44138.1|  TPA: putative cytochrome P450 superfamily protein      375   4e-119   
gb|KEH23872.1|  cytochrome P450 family 94 protein                       374   5e-119   
ref|NP_001146262.1|  uncharacterized protein LOC100279836               372   7e-119   
ref|XP_003577576.1|  PREDICTED: cytochrome P450 94B3                    374   9e-119   
ref|XP_008808414.1|  PREDICTED: uncharacterized protein LOC103720476    391   9e-119   
tpg|DAA38876.1|  TPA: putative cytochrome P450 superfamily protein      376   1e-118   
ref|XP_004303976.1|  PREDICTED: cytochrome P450 94A1-like               374   1e-118   
ref|XP_003577084.2|  PREDICTED: cytochrome P450 94B3-like               374   1e-118   
gb|AAN05337.1|  Putative cytochrome P450                                374   1e-118   
ref|NP_001049423.1|  Os03g0223100                                       374   2e-118   
ref|XP_002439815.1|  hypothetical protein SORBIDRAFT_09g020650          373   2e-118   
emb|CDY71281.1|  BnaA06g38770D                                          371   3e-118   
emb|CAN75428.1|  hypothetical protein VITISV_003302                     374   4e-118   
gb|EAY76187.1|  hypothetical protein OsI_04120                          372   4e-118   
ref|XP_002277006.1|  PREDICTED: cytochrome P450 86B1                    373   4e-118   
ref|XP_006644863.1|  PREDICTED: cytochrome P450 94A1-like               372   5e-118   
gb|ACG47870.1|  cytochrome P450 CYP94D27                                372   6e-118   
ref|XP_010688690.1|  PREDICTED: cytochrome P450 86B1                    374   6e-118   
ref|XP_008678135.1|  PREDICTED: cytochrome P450 94B3                    373   7e-118   
ref|XP_002527038.1|  cytochrome P450, putative                          372   8e-118   
ref|XP_009794142.1|  PREDICTED: cytochrome P450 94A2-like               371   1e-117   
gb|EAZ13864.1|  hypothetical protein OsJ_03787                          371   1e-117   
ref|XP_008790364.1|  PREDICTED: cytochrome P450 94A1-like               370   1e-117   
gb|EAY76183.1|  hypothetical protein OsI_04116                          370   2e-117   



>ref|XP_009589328.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=499

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/469 (75%), Positives = 398/469 (85%), Gaps = 5/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +SK+KP C+CEICK YL++SWT++  NLCDWY+ LL KSPTGTIHVHVLGNVITANP NV
Sbjct  23    LSKIKPCCECEICKGYLSTSWTLQFKNLCDWYAHLLKKSPTGTIHVHVLGNVITANPKNV  82

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML TKFENFPKG+QFA+ILGDLLGRGIFAVDG+LWK QRKMAS E GSVSIRSYAF+I
Sbjct  83    EYMLKTKFENFPKGRQFATILGDLLGRGIFAVDGELWKLQRKMASLELGSVSIRSYAFDI  142

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V  E+R RL PLLE   ++  VLD QDV RRFSFD+ICKFSFGMDPGCL LSLPVS    
Sbjct  143   VRDEIRNRLIPLLE-SNQSGTVLDLQDVFRRFSFDSICKFSFGMDPGCLKLSLPVSDLQV  201

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSAERA+TASP VWK+KR LNIGSEKKL EAI +++ LAEEMI  KRK  G  
Sbjct  202   AFDLASKLSAERAMTASPLVWKIKRALNIGSEKKLKEAIKMVDILAEEMISHKRK-NGFS  260

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q+DLLSRFM  I+DDKLLRDIVISFLLAGRDT+ASALT+FFWLLS+HPEVTD IRAES 
Sbjct  261   SQNDLLSRFMRNINDDKLLRDIVISFLLAGRDTVASALTTFFWLLSQHPEVTDEIRAESS  320

Query  665   RIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             R+M     + LA++++IR M+YLTAA+HESMRLFPP+QFDSKFC  DDTLPDGTFV KGT
Sbjct  321   RVMGKTEKEKLASFEEIRKMHYLTAALHESMRLFPPIQFDSKFCQEDDTLPDGTFVAKGT  380

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+SIWG DC EFKPERWL+DGVFK +  +KYPVFQ G RVCLGKD+A+V
Sbjct  381   RVTYHPYAMGRMESIWGQDCLEFKPERWLQDGVFKPQCPFKYPVFQGGLRVCLGKDLAIV  440

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             EMKSVA+ALIR FD +VV +  Q PR+ PGLTATVRGGL V + +RR Q
Sbjct  441   EMKSVALALIRQFDFQVVAKE-QTPRFMPGLTATVRGGLPVMVQERRQQ  488



>ref|XP_009766870.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=488

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/469 (74%), Positives = 393/469 (84%), Gaps = 5/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + K+KP C+CEICK YL++SWT+E  NLCDWYS L  KSPTGTIHVHVLGNVITANP NV
Sbjct  23    LCKIKPCCECEICKGYLSTSWTLEFKNLCDWYSHLFKKSPTGTIHVHVLGNVITANPKNV  82

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML TKFENFPKG+QFA+ILGDLLGRGIFAVDG+LWK QRKMAS E GSVSIRSYAF+ 
Sbjct  83    EYMLKTKFENFPKGRQFATILGDLLGRGIFAVDGELWKLQRKMASLELGSVSIRSYAFDT  142

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V  E+R RL PLLE    N  VLD QDV RRFSFD+ICKFSFGMDPGCL LSLPVS F  
Sbjct  143   VGGEIRNRLIPLLE-SNNNDTVLDLQDVFRRFSFDSICKFSFGMDPGCLKLSLPVSDFQV  201

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSAERA+TASP VWK+KR LNIGSEKKL EAI +++ L+EEMI  KRK     
Sbjct  202   AFDLASKLSAERAMTASPLVWKIKRALNIGSEKKLKEAIKMVDILSEEMISHKRK-NDFS  260

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q+DLLSRFM  I+DDKLLRDIVISFLLAGRDT+ASALT+FFWLLS+HPEV D IRAES 
Sbjct  261   SQNDLLSRFMRNINDDKLLRDIVISFLLAGRDTVASALTTFFWLLSQHPEVKDEIRAEST  320

Query  665   RIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             R+M     + LA++++IR M+YLTAA+HES+RLFPPVQFDSKFC  DDTLPDGTFV KGT
Sbjct  321   RVMGKTEKEKLASFEEIRKMHYLTAALHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGT  380

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+SIWG DC EF+PERWL+DGVFK +  +KYPVFQ G RVCLGKD+A+V
Sbjct  381   RVTYHPYAMGRMESIWGQDCLEFRPERWLQDGVFKPQCPFKYPVFQGGLRVCLGKDLAIV  440

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             EMKSVA+ALIR FD +VV +  Q PR+ PGLTATVRGGL V + +R+ Q
Sbjct  441   EMKSVALALIRQFDFQVVAKE-QTPRFMPGLTATVRGGLPVVVQERQQQ  488



>ref|XP_010322431.1| PREDICTED: cytochrome P450 94C1 [Solanum lycopersicum]
Length=485

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/469 (71%), Positives = 388/469 (83%), Gaps = 5/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S+LKP C+CEICK+YL S+W++E  NLCDWYS LL KSPTGTIHVHVLGNVIT+NP NV
Sbjct  20    LSRLKPYCECEICKSYLNSTWSLEFKNLCDWYSYLLKKSPTGTIHVHVLGNVITSNPNNV  79

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T F+NFPKGKQF++ILGDLLGRGIFAVDG++WKFQRKMAS E G VSIRSYAF+I
Sbjct  80    EYMLKTNFDNFPKGKQFSTILGDLLGRGIFAVDGEMWKFQRKMASLELGRVSIRSYAFDI  139

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V+ E+R RL PLLE       VLD QDVLRRFSFD+ICKFSFGMDPGCL LSLP S    
Sbjct  140   VSDEIRNRLIPLLE--SNIHTVLDLQDVLRRFSFDSICKFSFGMDPGCLKLSLPDSDLQE  197

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             +FDLASKLSAERA+T SP VWK+KR LNIGSEKKL EAI  ++ LAEE+I QKRK     
Sbjct  198   SFDLASKLSAERAMTVSPLVWKIKRSLNIGSEKKLKEAIEKVDVLAEEVIIQKRK-NDFS  256

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q+D+LSRFM  IDDDKLLRDI++SFLLAGRDT+AS LT+FFWLL++HP V + IRAES 
Sbjct  257   SQNDVLSRFMRNIDDDKLLRDIIVSFLLAGRDTVASGLTTFFWLLAQHPHVINEIRAESN  316

Query  665   RIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             R+M    +  LAT++ IR+M++LTAAIHES+RLFPPVQFDSKFC  DDTLPDGTFV KGT
Sbjct  317   RVMGKTVNGTLATFEGIREMHFLTAAIHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGT  376

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+ IWG DC EFKPERWLEDGVFK++  +KYPVFQ G RVCLGKD+++V
Sbjct  377   RVTYHPYAMGRMEGIWGKDCLEFKPERWLEDGVFKAQCPFKYPVFQGGVRVCLGKDLSIV  436

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             EMKSVA+ALIR FD +V     Q P++ PGLTATVRGGL + +  RR Q
Sbjct  437   EMKSVALALIRQFDFQVHLAKDQAPKFMPGLTATVRGGLPIMVQKRREQ  485



>ref|XP_006347236.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=489

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/470 (71%), Positives = 391/470 (83%), Gaps = 6/470 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S+LKP C+CEICK YL S+W++E  NLCDWYS LL KSP+GTIHVHVLGNVITANP NV
Sbjct  23    LSRLKPYCECEICKGYLNSTWSLEFKNLCDWYSYLLKKSPSGTIHVHVLGNVITANPNNV  82

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T F+NFPKGKQF++ILGDLLGRGIFAVDG++WKFQRKMAS E GSVSIRSYAF+I
Sbjct  83    EYMLKTNFDNFPKGKQFSTILGDLLGRGIFAVDGEMWKFQRKMASLELGSVSIRSYAFDI  142

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V+ E+R RL PLL+       VLD QDVLRRFSFD+ICKFSFGMDPGCL LSLP S    
Sbjct  143   VSDEIRNRLIPLLK--SNIHTVLDLQDVLRRFSFDSICKFSFGMDPGCLKLSLPDSNLQE  200

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             +FDLASKLSAERA+T SP VWK+KR LNIGSEKKL EAI  ++ LAEE+I QKRK     
Sbjct  201   SFDLASKLSAERAMTVSPLVWKIKRGLNIGSEKKLKEAIKKVDILAEEVIIQKRK-NDFS  259

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q+DLL+RFM  ++DDKLLRDI++SFLLAGRDT+AS LT+FFWLL++HP V D IRAES 
Sbjct  260   SQNDLLARFMRNMNDDKLLRDIIVSFLLAGRDTVASGLTTFFWLLAQHPRVIDEIRAESS  319

Query  665   RIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             R+M     + LA++++IR+M+YLTAAIHES+RLFPPVQFDSKFC  DDTLPDGTFV KGT
Sbjct  320   RVMVRREKETLASFEEIREMHYLTAAIHESIRLFPPVQFDSKFCQEDDTLPDGTFVAKGT  379

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+ IWG DC EFKPERWLE+G+FK++  +KYPVFQ G RVCLGKD+++V
Sbjct  380   RVTYHPYAMGRMEGIWGKDCLEFKPERWLEEGLFKAQCPFKYPVFQGGVRVCLGKDLSIV  439

Query  311   EMKSVAVALIRAFDIEV-VCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             EMKSVA+ALIR FD +V V    Q P++ PGLTATVRGGL + + +RR Q
Sbjct  440   EMKSVALALIRQFDFQVHVATKEQAPKFMPGLTATVRGGLPIMVQERREQ  489



>emb|CDP06950.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/469 (69%), Positives = 386/469 (82%), Gaps = 5/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +LKP C C+ C++YLTSSW+ E +NLCDWYS LL KSPTGTIHVHVL N+ITANP NV
Sbjct  37    ILRLKPWCSCDSCRSYLTSSWSHEFNNLCDWYSHLLQKSPTGTIHVHVLSNIITANPKNV  96

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EY++ T+FENFPKGK F+++LGDLLGRGIF VDG+ WKFQRKMAS E GSVS RSYAF++
Sbjct  97    EYIIKTRFENFPKGKPFSALLGDLLGRGIFNVDGESWKFQRKMASLELGSVSTRSYAFQV  156

Query  1205  VAAEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             VA E+RTRL PLL    G+  +VLD QDVLRRFSFD ICKFSFGMDP CL+LSLPVS+ A
Sbjct  157   VANEIRTRLVPLLSSVAGKEGKVLDLQDVLRRFSFDTICKFSFGMDPSCLELSLPVSELA  216

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFDLA++LSA RA++ASP +WK+KR LN GSEKKL EA+ L+N LAE +I+QKR  G +
Sbjct  217   NAFDLATQLSAARAISASPLIWKLKRFLNTGSEKKLKEALKLVNSLAEGVIKQKRNMGFS  276

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
               Q DLLSRFMG I+DDK LRDI++SFLLAGRDT+ASALT FFWLL++HPEV   I  ES
Sbjct  277   -SQQDLLSRFMGSIEDDKYLRDIIVSFLLAGRDTVASALTCFFWLLAKHPEVKQAILDES  335

Query  668   GRIMEPD---QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRK  498
               IM  +    +LA+++Q++ M+YL AAI+ESMRL+PPVQFDSK+C  DD LPDGTFV+K
Sbjct  336   NHIMGENISADNLASFEQMQKMHYLQAAIYESMRLYPPVQFDSKYCQEDDVLPDGTFVKK  395

Query  497   GTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             GT+VTYHPYAMGRM SIWG DC EFKPERWL+DG FK E+ +KYPVFQ G RVCLGKDMA
Sbjct  396   GTKVTYHPYAMGRMQSIWGPDCLEFKPERWLQDGRFKPESPFKYPVFQGGLRVCLGKDMA  455

Query  317   LVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             LVEMKS+A++LIR FDI+V   +   PR+ PGLTA+VRGGL V+I +RR
Sbjct  456   LVEMKSIALSLIRQFDIQVNAPTSDTPRFMPGLTASVRGGLQVQIQERR  504



>ref|XP_002264897.1| PREDICTED: cytochrome P450 94C1 [Vitis vinifera]
 emb|CAN76753.1| hypothetical protein VITISV_011074 [Vitis vinifera]
Length=504

 Score =   682 bits (1761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/469 (68%), Positives = 391/469 (83%), Gaps = 3/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C++C++YL+ SW ME  NL DWY+ LL KSP+ TIHVHVLGN+ITANP NV
Sbjct  38    ILRLRPCCDCDVCRSYLSGSWKMEFDNLSDWYTHLLRKSPSRTIHVHVLGNIITANPENV  97

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+F+N+PKGK F++ILGDLLGRGIF VDGD WKFQRKMAS E GSVSIR++AFEI
Sbjct  98    EYMLKTRFDNYPKGKPFSAILGDLLGRGIFNVDGDSWKFQRKMASLELGSVSIRTFAFEI  157

Query  1205  VAAEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V +E++ RL PL+    G +  +LD QDVLRRFSFDNIC+FSFG+DPGCL LSLP+S+FA
Sbjct  158   VTSEIKNRLIPLMSSIAGRSEAILDLQDVLRRFSFDNICRFSFGLDPGCLQLSLPMSEFA  217

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFDLASKLSAERA+TASP +WK+KRLLNIGSE+KL EAI +++ELA E+I+Q+R  G +
Sbjct  218   EAFDLASKLSAERAMTASPLIWKMKRLLNIGSERKLKEAIKMVDELAHELIKQRRTAGFS  277

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
               Q DLLSRFM  + DD+ LRDIVISFLLAGRDT+ASALTSFFWLLS+HPEV   IR ES
Sbjct  278   -TQRDLLSRFMCSVSDDQYLRDIVISFLLAGRDTVASALTSFFWLLSQHPEVVSAIREES  336

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
              RIM   ++ A+++Q+R+M+YL A+++ESMRLFPP+QFDSKF L +D LPDGTFVRKGTR
Sbjct  337   DRIMGQTEEQASFEQMREMHYLQASVYESMRLFPPIQFDSKFSLQEDVLPDGTFVRKGTR  396

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VT+HPYAMGRM+  WG DC EFKPERWL++G F +EN +KYPVFQAGPRVCLGK+MA+V+
Sbjct  397   VTFHPYAMGRMEKAWGPDCLEFKPERWLKNGEFMAENPFKYPVFQAGPRVCLGKEMAVVQ  456

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQR  162
             MKSVA+AL+R FDI+    SR   R+APGLTATVRGG  VR+ +RR  +
Sbjct  457   MKSVALALVRRFDIQDAVPSRAQ-RFAPGLTATVRGGFQVRVHERRQHQ  504



>ref|XP_007015870.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOY33489.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=516

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/464 (67%), Positives = 385/464 (83%), Gaps = 1/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LK  C CEIC+AYLTSSWT E  NLCDWY+ LL KSPTGTIH+HVLGN ITA+PANV
Sbjct  36    VLRLKLWCNCEICQAYLTSSWTKEFDNLCDWYTHLLKKSPTGTIHIHVLGNTITASPANV  95

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L T+FEN+PKGKQF+++LGDLLG+GIF VDG+ W+FQRKMAS E GS+SIR +AF+I
Sbjct  96    EHILKTRFENYPKGKQFSALLGDLLGKGIFNVDGESWRFQRKMASLELGSISIRMHAFDI  155

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V +E++TRL PLL       +VLD QDVLRRFSFDNICKFSFG+DPGCL LSLP+S+FA 
Sbjct  156   VNSEIQTRLIPLLSSVSSEEQVLDLQDVLRRFSFDNICKFSFGLDPGCLMLSLPISEFAE  215

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSA+R + +SP++WKVKRLLN+G+EK+L EAI +++E A+EMI Q+R+  G  
Sbjct  216   AFDLASKLSAQRGLASSPSIWKVKRLLNLGTEKQLKEAIKMVDEFAQEMINQRRE-KGFS  274

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             D +DLLSRFMG + DDK LRDIVISFLLAGRDT+AS LTSFFWLLS+HPEV   IR E  
Sbjct  275   DSNDLLSRFMGTVSDDKYLRDIVISFLLAGRDTVASGLTSFFWLLSQHPEVESAIRDELE  334

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             R+M   Q  A++ Q+R+M+YL AA++ES+RLFPPVQFDSKF   DD LPDGTFVRKGTRV
Sbjct  335   RVMGSSQQFASFDQMREMHYLHAALYESLRLFPPVQFDSKFAQEDDILPDGTFVRKGTRV  394

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYHPYAMGRM+ +WG+DC E+KP+RWL++G++  EN YKYPVFQAG RVCLGK+++LVEM
Sbjct  395   TYHPYAMGRMERVWGSDCLEYKPDRWLKNGIYNPENPYKYPVFQAGQRVCLGKEISLVEM  454

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K V +A+I  F+I V  +  Q PR+APGLTATVRGGL + + +R
Sbjct  455   KCVVLAVISRFNIRVATDLNQAPRFAPGLTATVRGGLPILVQER  498



>ref|XP_010034212.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW50816.1| hypothetical protein EUGRSUZ_J00477 [Eucalyptus grandis]
Length=509

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/467 (69%), Positives = 390/467 (84%), Gaps = 4/467 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +LKPLC CE+C AYL+SSWT E  NLCDWY+ LL KSPTGTIHVHVLGNV+TANPANV
Sbjct  38    IFRLKPLCDCEVCTAYLSSSWTKEFDNLCDWYTHLLRKSPTGTIHVHVLGNVVTANPANV  97

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML T+F+N+PKGK F++ILGDLLGRGIF VDG+ WKFQRKMAS E GSVSIR+YAFE+
Sbjct  98    EHMLRTRFDNYPKGKPFSAILGDLLGRGIFNVDGESWKFQRKMASLELGSVSIRAYAFEV  157

Query  1205  VAAEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             VA+E+ +RLFPLL    G++  VLD QDV RRFSFD+ICKFSFG+DPGCL LSLPVS+FA
Sbjct  158   VASEIESRLFPLLSSVCGKDDRVLDLQDVFRRFSFDSICKFSFGLDPGCLKLSLPVSEFA  217

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD AS+LSAERA++ SP VW++KRLLNIG E++LGEAI ++N LA+E+I+QKR+ G +
Sbjct  218   EAFDAASRLSAERAMSPSPLVWRIKRLLNIGGERRLGEAIKMVNALADEVIKQKREMGPS  277

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
                +DLLSRFM  IDDD+ LRDIV+SFLLAGRDT+ASALTSFFWLLS++PEV D IR ES
Sbjct  278   EGHNDLLSRFMINIDDDRYLRDIVVSFLLAGRDTVASALTSFFWLLSQNPEVRDAIREES  337

Query  668   GRIMEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
              R+M P  D LA+++Q+R M YL AA++E MRL+PPVQFDSKF  +DD LPDG  V+KGT
Sbjct  338   DRVMGPTADGLASFEQMRKMPYLQAALYECMRLYPPVQFDSKFAQDDDVLPDGKKVKKGT  397

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             RVTYHPYAMGRM+ +WG D  +F+P RWL  DGVF  EN YKYPVFQAG RVCLGK+MAL
Sbjct  398   RVTYHPYAMGRMERLWGPDGLKFRPSRWLTRDGVFSPENPYKYPVFQAGVRVCLGKEMAL  457

Query  314   VEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VEMKSVA+AL+R FD+  V +  + PR+APGLTAT+RGGL V I +R
Sbjct  458   VEMKSVALALVRRFDVR-VADGHRGPRFAPGLTATIRGGLPVEIEER  503



>ref|XP_006424280.1| hypothetical protein CICLE_v10028253mg [Citrus clementina]
 gb|ESR37520.1| hypothetical protein CICLE_v10028253mg [Citrus clementina]
Length=502

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/463 (68%), Positives = 383/463 (83%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LKP C+C+ C++YLT SW  + +NLCDWY+ LL KSPTGTIH+HVLGN IT+NP NVEY
Sbjct  40    RLKPWCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+F+N+PKGK F+ ILGDLLGRGIF VDGD W+FQRKMA  E GS +I+ YA E+V 
Sbjct  100   ILKTRFDNYPKGKPFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVT  159

Query  1199  AEVRTRLFPLLEFYG-ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             AE+R+RL PLL     ++  +LD QDV RRFSFD+ICKFSFG+DP CL L+LPVSKFA A
Sbjct  160   AEIRSRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+  SP VWK+KRLLNIGSEK+L  AI L+NELAE MI Q+++ G ++ 
Sbjct  220   FDLASKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSK-  278

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             ++DLLSRFM  IDDDK LRDIV+SFLLAGRDT+AS LTSFFWLLS+HPEV   IR ES +
Sbjct  279   KNDLLSRFMASIDDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDK  338

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             IM+P+QDL +++Q+R+++YL AA++ESMRLFPPVQFDSKF   DD LPDGTFVRKGTRVT
Sbjct  339   IMKPNQDLVSFEQLRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVT  398

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+ IWG DC EFKP+RWL +G F  EN +KYPVFQAG RVCLGKD+ALVEMK
Sbjct  399   YHPYAMGRMERIWGPDCLEFKPQRWLRNGRFVPENPFKYPVFQAGHRVCLGKDIALVEMK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA+A++R F+I  V +  Q PR+APGLTATVRGGL V + +R
Sbjct  459   SVALAVVRKFNIR-VSDPNQAPRFAPGLTATVRGGLPVMVQER  500



>gb|KDO51311.1| hypothetical protein CISIN_1g040199mg [Citrus sinensis]
Length=502

 Score =   670 bits (1729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/463 (68%), Positives = 383/463 (83%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LKP C+C+ C++YLT SW  + +NLCDWY+ LL KSPTGTIH+HVLGN IT+NP NVEY
Sbjct  40    RLKPWCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+F+N+PKGK F+ ILGDLLGRGIF VDGD W+FQRKMA  E GS +I+ YA E+V 
Sbjct  100   ILKTRFDNYPKGKPFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVT  159

Query  1199  AEVRTRLFPLLEFYG-ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             AE+R+RL PLL     ++  +LD QDV RRFSFD+ICKFSFG+DP CL L+LPVSKFA A
Sbjct  160   AEIRSRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+  SP VWK+KRLLNIGSEK+L  AI L+NELAE MI Q+++ G ++ 
Sbjct  220   FDLASKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSK-  278

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             ++DLLSRFM  IDDDK LRDIV+SFLLAGRDT+AS LTSFFWLLS+HPEV   IR ES +
Sbjct  279   KNDLLSRFMASIDDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDK  338

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             IM+P+QDL +++Q+R+++YL AA++ESMRLFPPVQFDSKF   DD LPDGTFVRKGTRVT
Sbjct  339   IMKPNQDLVSFEQLRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVT  398

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+ IWG DC EFKP+RWL +G F  EN +KYPVFQAG RVCLGKD+ALVEMK
Sbjct  399   YHPYAMGRMERIWGPDCLEFKPQRWLRNGRFVPENPFKYPVFQAGHRVCLGKDIALVEMK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA+A++R F+I  V +  Q PR+APGLTATVRGGL V + +R
Sbjct  459   SVALAVVRKFNIR-VSDPNQAPRFAPGLTATVRGGLPVMVQER  500



>ref|XP_002529058.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF33302.1| cytochrome P450, putative [Ricinus communis]
Length=499

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/462 (68%), Positives = 381/462 (82%), Gaps = 4/462 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             KP C C+ICK+Y+T+SW  E  NLCDWY+ LL KSPTGTIH+HVLGN+IT+NP NVEY+L
Sbjct  38    KPWCNCDICKSYITASWAKEFVNLCDWYTHLLKKSPTGTIHIHVLGNIITSNPENVEYIL  97

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T FEN+PKGK F+++LGDLLGRGIF VDGD W+FQRKMAS E GSVSIR YAFE++ +E
Sbjct  98    KTNFENYPKGKPFSALLGDLLGRGIFNVDGDSWRFQRKMASLELGSVSIRMYAFELIMSE  157

Query  1193  VRTRLFPLLEFYG--ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             +++RL PLL      ++++ +D QDV RRFSFDNICKFSFG+DPGCL LSLP+S+FA AF
Sbjct  158   IKSRLIPLLSSISCDKDQQGIDLQDVFRRFSFDNICKFSFGLDPGCLKLSLPISEFALAF  217

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D ASKLSAERA+ AS  +WK+KR LNIGSEKKL EAI ++NELAE +I  +RK  G  D 
Sbjct  218   DTASKLSAERALAASSMIWKMKRFLNIGSEKKLKEAIQMVNELAEGVINHRRK-EGCMDN  276

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLSRFMG I+DDK LRDIVISFLLAGRDT+AS LTSFFWLLS+HP+V   IR ES R+
Sbjct  277   KDLLSRFMGSINDDKYLRDIVISFLLAGRDTVASGLTSFFWLLSKHPQVESAIREESDRV  336

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             M   ++L +Y+Q+R+++YL AA++ESMRLFPPVQFDSKF   DD LPDGTF+RKGTRVTY
Sbjct  337   MGSSEELTSYEQLRELHYLNAAVYESMRLFPPVQFDSKFSQEDDILPDGTFIRKGTRVTY  396

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             H YAMGRM+ IWG DC EFKPERWL++GVF  E+  KYPVF AG RVCLGK+MALVEMKS
Sbjct  397   HQYAMGRMERIWGQDCLEFKPERWLKNGVFVPESSSKYPVFHAGFRVCLGKEMALVEMKS  456

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VA+ +IRAF++ VV +  Q+PR++PGLTAT+RGGL V I +R
Sbjct  457   VALTMIRAFNVRVV-DPNQVPRFSPGLTATMRGGLPVVIQER  497



>ref|XP_006471355.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=502

 Score =   669 bits (1725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/463 (68%), Positives = 383/463 (83%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LKP C+C+ C++YLT SW  + +NLCDWY+ LL KSPTGTIH+HVLGN IT+NP NVEY
Sbjct  40    RLKPWCQCDACRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHVLGNTITSNPGNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+F+N+PKGK F+ ILGDLLGRGIF VDGD W+FQRKMA  E GS +I+ YA E+V 
Sbjct  100   ILKTRFDNYPKGKAFSVILGDLLGRGIFNVDGDSWEFQRKMACFELGSFNIKMYALELVT  159

Query  1199  AEVRTRLFPLLEFYG-ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             AE+R+RL PLL     ++  +LD QDV RRFSFD+ICKFSFG+DP CL L+LPVSKFA A
Sbjct  160   AEIRSRLIPLLSSAANKDNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFATA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+  SP VWK+KRLLNIGSEK+L  AI L+NELAE MI Q+++ G ++ 
Sbjct  220   FDLASKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAINLVNELAETMIHQRQQMGFSK-  278

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             ++DLLSRFM  IDDDK LRDIV+SFLLAGRDT+AS LTSFFWLLS+HPEV   IR ES +
Sbjct  279   KNDLLSRFMASIDDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESYK  338

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             IM+P+QDL +++Q+R+++YL AA++ESMRLFPPVQFDSKF   DD LPDGTFVRKGTRVT
Sbjct  339   IMKPNQDLVSFEQLRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTRVT  398

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+ IWG DC EFKPERWL +G F  EN +KYPVFQAG RVCLGKD+ALVEMK
Sbjct  399   YHPYAMGRMERIWGPDCLEFKPERWLRNGRFVLENPFKYPVFQAGHRVCLGKDIALVEMK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA+A++R F+I  V +  Q P++APGLTATVRGGL V + +R
Sbjct  459   SVALAVVRKFNIR-VSDPNQAPQFAPGLTATVRGGLPVMVQER  500



>ref|XP_011044868.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=490

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/464 (68%), Positives = 383/464 (83%), Gaps = 2/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C C++CK YL+SSWT + +NLCDWY+ LL KS TGTIHVHVLGN+ITANP NV
Sbjct  27    VLRLKPWCNCDVCKTYLSSSWTNDFANLCDWYTHLLRKSKTGTIHVHVLGNIITANPENV  86

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML TKFEN+PKGK F+S+LGDLLGRGIF VDGD WKFQRKMAS E GSVSIR +AF++
Sbjct  87    EHMLKTKFENYPKGKPFSSLLGDLLGRGIFNVDGDHWKFQRKMASLELGSVSIRIHAFDL  146

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             + +E+R+RL PLL    + + VLD QDV RRFSFDNICKFSFG+DPGCL+LSLP  KFAA
Sbjct  147   IMSEIRSRLLPLLSSVADEQRVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPACKFAA  206

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD ASKLSAERA+  SP VWK+KRLL+IGSEK+L EAI  +N+LAE MI ++RK G ++
Sbjct  207   AFDTASKLSAERALAPSPIVWKIKRLLSIGSEKELKEAIKKVNDLAEGMINERRKAGFSK  266

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             + +DLLSRFM  I D+K LRDIVISFLLAGRDT+AS LTSFFWLLS+ PEV   IRAE+ 
Sbjct  267   N-NDLLSRFMMSITDEKYLRDIVISFLLAGRDTVASGLTSFFWLLSQRPEVVSAIRAETE  325

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             ++M  +QDL ++Q++R+M+ L AA+HES+RL+PPVQFDSKF   DD LP+GTFV KGTRV
Sbjct  326   KVMGLNQDLPSFQEMREMHCLNAAVHESLRLYPPVQFDSKFSQEDDILPNGTFVPKGTRV  385

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYH YAMGRM+ IWG DC EFKPERWL++GVF   N +KY VF AG R+CLGK+MALVEM
Sbjct  386   TYHQYAMGRMEQIWGPDCLEFKPERWLKNGVFVPANPFKYTVFHAGVRICLGKEMALVEM  445

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+VA+A+IR FD  VV +  Q+PR++PGLTATVRGGL V I +R
Sbjct  446   KAVALAIIRGFDTRVV-DPNQVPRFSPGLTATVRGGLPVVIQER  488



>ref|XP_010271731.1| PREDICTED: cytochrome P450 94C1-like [Nelumbo nucifera]
Length=503

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/450 (69%), Positives = 378/450 (84%), Gaps = 2/450 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C++C++YLT+SW++E  NLCDWY+ LL KSP+ TIHVHVL N ITANP NVEYML T+
Sbjct  43    CNCDVCRSYLTASWSIEFDNLCDWYTHLLKKSPSKTIHVHVLRNTITANPDNVEYMLKTR  102

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F+ ILGDLLGRGIF VDGD WKFQRK+AS E GSVSIRS+AFEIV  E++ 
Sbjct  103   FENYPKGKPFSVILGDLLGRGIFNVDGDTWKFQRKLASLELGSVSIRSFAFEIVTTEIKR  162

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL        VLD QDV RRF+FDNIC+FSFG+DPGCL+LSLP+S+FA AFDLAS+
Sbjct  163   RLVPLLSSAAGEGRVLDLQDVFRRFTFDNICRFSFGLDPGCLELSLPISEFAMAFDLASR  222

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA+RA++ SP +WK+KRLLN+GSEKKL +AI LIN LA+E+I Q+RK G +  Q DLLS
Sbjct  223   LSAQRALSLSPLIWKIKRLLNLGSEKKLKKAIRLINVLAKEVIRQRRKMGFSASQ-DLLS  281

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFMG I+DDK LRDIVISFLLAGRDT+ASALTSFFWLL++HPEV   I  ES R+M P Q
Sbjct  282   RFMGTINDDKYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEVAATILNESDRVMGPTQ  341

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
             +LA+++QIR+M+YL +A++ES+RL+PPVQFDSKF   DD LPDGT V++GTRVTYHPYAM
Sbjct  342   ELASFEQIREMHYLHSAVYESLRLYPPVQFDSKFSQEDDVLPDGTAVKRGTRVTYHPYAM  401

Query  464   GRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVAL  285
             GRM+ +WG DC EFKPERWL++G+F  EN +KYPVFQAG RVCLGK+M+LVE+KSV +A+
Sbjct  402   GRMEELWGPDCLEFKPERWLKNGIFSPENPFKYPVFQAGLRVCLGKEMSLVEIKSVVLAV  461

Query  284   IRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             +R+F+I+VV E    PR+APGLTATV GGL
Sbjct  462   VRSFEIQVV-EDNDSPRFAPGLTATVSGGL  490



>ref|XP_006471356.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=502

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/463 (68%), Positives = 378/463 (82%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LKP C+C++C++YLT SW  + +NLCDWY+ LL KSPTGTIH+H LGN +T+NP NVEY
Sbjct  40    RLKPWCQCDVCRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHALGNTVTSNPVNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+F+N+PKGK F+ ILGDLLGRGIF VDG+ WKFQRK+AS E GS +I+ Y+FE+V 
Sbjct  100   ILQTRFDNYPKGKPFSVILGDLLGRGIFNVDGNSWKFQRKIASVELGSFNIKMYSFELVT  159

Query  1199  AEVRTRLFPLLEFYG-ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             AE+R+RL PLL     ++  +LD QDV RRFSFDNIC+FSFG+DP CL L+LP+S FA A
Sbjct  160   AEIRSRLIPLLSSAANKDNNILDLQDVFRRFSFDNICRFSFGLDPECLKLNLPISTFATA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+  SP VWK+KRLLNIGSEK+L  AI L+NELAE MI Q+R+ G +  
Sbjct  220   FDLASKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAIKLVNELAETMIHQRRQMGFS-S  278

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             ++DLLSRFM  IDDDK LRDIV+SFLLAGRDT+AS LTSFFWLLS+HPEV   IR ES +
Sbjct  279   KNDLLSRFMASIDDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHPEVESAIRNESDK  338

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             IM+P+Q L + +Q+R+MNYL AA++ESMRLFPPVQFDSKF   DD LPDGTFV +GTRVT
Sbjct  339   IMKPNQVLISLEQLREMNYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVGRGTRVT  398

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+ IWG DC EFKPERWL +G F  EN +KYPVFQAG RVCLGKDMALVEMK
Sbjct  399   YHPYAMGRMERIWGPDCLEFKPERWLRNGRFVPENPFKYPVFQAGHRVCLGKDMALVEMK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             S A+A++R F+I  V +  Q PR+APGLTATV GGL V + +R
Sbjct  459   SAALAVVRKFNIR-VSDPNQAPRFAPGLTATVSGGLPVMVRER  500



>ref|XP_006424281.1| hypothetical protein CICLE_v10028254mg [Citrus clementina]
 gb|ESR37521.1| hypothetical protein CICLE_v10028254mg [Citrus clementina]
 gb|KDO51312.1| hypothetical protein CISIN_1g010737mg [Citrus sinensis]
Length=502

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/465 (67%), Positives = 378/465 (81%), Gaps = 3/465 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C+C++C++YLT SW  + +NLCDWY+ LL KSPTGTIH+H LGN +T+NP NV
Sbjct  38    VLRLKPWCQCDVCRSYLTFSWLKDFNNLCDWYTHLLAKSPTGTIHLHALGNTVTSNPENV  97

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EY+L T+F+N+PKGK F+ ILGDLLG GIF VDG+ WKFQRK+AS E GS + + YAFE+
Sbjct  98    EYILKTRFDNYPKGKPFSVILGDLLGGGIFNVDGNSWKFQRKIASVELGSFNFKMYAFEL  157

Query  1205  VAAEVRTRLFPLLEFYGEN-REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V AE+R RL PLL         +LD QDV RRFSFD+ICKFSFG+DP CL L+LPVSKFA
Sbjct  158   VTAEIRFRLIPLLSSAANKVNNILDLQDVFRRFSFDSICKFSFGLDPECLMLNLPVSKFA  217

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFDLASKLSAERA+  SP VWK+KRLLNIGSEK+L  AI L+NELAE MI Q+++ G +
Sbjct  218   TAFDLASKLSAERALAPSPIVWKIKRLLNIGSEKQLKGAIKLVNELAETMIHQRQQMGFS  277

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
             + ++DLLSRFM  IDDDK LRDIV+SFLLAGRDT+AS LTSFFWLLS+H EV   IR ES
Sbjct  278   K-KNDLLSRFMASIDDDKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQHSEVESAIRNES  336

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
              +IM+P+QDL +++Q+R+++YL AA++ESMRLFPPVQFDSKF   DD LPDGTFVRKGTR
Sbjct  337   DKIMKPNQDLVSFEQLRELHYLNAAVYESMRLFPPVQFDSKFAQEDDILPDGTFVRKGTR  396

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYHPYAMGRM+ IWG DC EFKPERWL +G F  +N +KYPVFQAG RVCLGKDMALVE
Sbjct  397   VTYHPYAMGRMERIWGPDCSEFKPERWLRNGTFVPQNPFKYPVFQAGHRVCLGKDMALVE  456

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             MKS A+A++R F+I  V +  Q PR+APGLTATV GGL V + +R
Sbjct  457   MKSAALAVVRKFNIR-VSDPNQAPRFAPGLTATVSGGLPVMVQER  500



>ref|XP_002312905.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE86860.2| cytochrome P450 family protein [Populus trichocarpa]
Length=490

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/464 (67%), Positives = 382/464 (82%), Gaps = 2/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C C++CK YL+SSWT + +NLCDWY+ LL KS TGTIHVHVLGN+ITANP NV
Sbjct  27    VLRLKPWCNCDVCKTYLSSSWTKDFANLCDWYTHLLRKSKTGTIHVHVLGNIITANPENV  86

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML TKFEN+PKGK F+++LGDLLGRGIF VDG+ WKFQRKMAS E GSVSIR +AF++
Sbjct  87    EHMLKTKFENYPKGKPFSALLGDLLGRGIFNVDGNHWKFQRKMASLELGSVSIRMHAFDL  146

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             + +E+R+RL PLL    + + VLD QDV RRFSFDNICKFSFG+DPGCL+LSLP  KFAA
Sbjct  147   IMSEIRSRLLPLLSSVADEQRVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPACKFAA  206

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD ASKLSAERA+  SP VWK+KRLL+IGSEK+L EAI  +NELAE +I ++RK G ++
Sbjct  207   AFDTASKLSAERALAPSPIVWKIKRLLSIGSEKELKEAIKKVNELAEGVINERRKAGFSK  266

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             + +DLLSRFM  I D+K LRDIV+SFLLAGRDT+AS LTSFFWLLS+ PEV   IRAE+ 
Sbjct  267   N-NDLLSRFMTSITDEKYLRDIVVSFLLAGRDTVASGLTSFFWLLSQRPEVESAIRAETE  325

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             ++M  +QDL ++Q++R+M+ L AA+HES+RL+PPVQFDSKF   DD LPDGTFV KGTRV
Sbjct  326   KVMGLNQDLPSFQEMREMHCLNAAVHESLRLYPPVQFDSKFSQEDDILPDGTFVPKGTRV  385

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYH YAMGRM+ IWG DC EFKPERWL++ VF   N +KY VF AG R+CLGK+MALVEM
Sbjct  386   TYHQYAMGRMEQIWGPDCLEFKPERWLKNAVFVPANPFKYTVFHAGVRICLGKEMALVEM  445

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+VA+A+IR F+  VV +  Q+PR++PGLTATVRGGL V I +R
Sbjct  446   KAVALAIIRGFNTRVV-DPNQVPRFSPGLTATVRGGLPVVIQER  488



>ref|XP_006592314.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=502

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/469 (67%), Positives = 380/469 (81%), Gaps = 6/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S++KP C C++CK+YLT SW  +  NLCDWY+ LL KSPTGTIHVHVLGN IT+NP NV
Sbjct  36    ISRMKPWCNCDLCKSYLTVSWLKKFPNLCDWYTHLLRKSPTGTIHVHVLGNTITSNPHNV  95

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L T F+N+PKGK F++ILGDLLGRGIF VDG+ WKFQRKMAS E GSV+IR+YA E+
Sbjct  96    EHILKTNFQNYPKGKPFSTILGDLLGRGIFNVDGESWKFQRKMASLELGSVAIRTYAMEL  155

Query  1205  VAAEVRTRLFPLLEFYGENRE----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V  E+  RL P++E           VLD QD+LRRFSFDNICKFSFG+DPGCL  +LPVS
Sbjct  156   VNEEIHARLIPIMESTARGELNSVCVLDLQDILRRFSFDNICKFSFGLDPGCLLPNLPVS  215

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
               A AFDLASKLSAERA+ ASP +WK+KRLLNIGSEKKL E I ++N++A+EMI+Q+R+ 
Sbjct  216   DLAVAFDLASKLSAERAMNASPFIWKLKRLLNIGSEKKLRETINVVNDVAKEMIKQRREM  275

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G  + ++DLLSRFMG IDDD  LRDIV+SFLLAGRDTIA+ LT FF LLS+ PEV + IR
Sbjct  276   G-FKTRNDLLSRFMGSIDDDVYLRDIVVSFLLAGRDTIAAGLTGFFMLLSKSPEVEELIR  334

Query  677   AESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRK  498
              E GR+M P Q+  +++QIR+M+YL AAIH+SMRLFPP+QFDSKF   DD LPDGTFVRK
Sbjct  335   EEVGRVMGPGQEFPSFEQIREMHYLNAAIHDSMRLFPPIQFDSKFATEDDVLPDGTFVRK  394

Query  497   GTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             G+RVTYHPYAMGRM++IWG DC +F+PERWL DGVF  E  +KYPVFQAG RVCLGKD+A
Sbjct  395   GSRVTYHPYAMGRMENIWGPDCLDFRPERWLRDGVFVPECPFKYPVFQAGVRVCLGKDLA  454

Query  317   LVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             L+EMKSV VAL+R FDI V  +  Q PR+APGLTAT+RGG  VR+ +R+
Sbjct  455   LMEMKSVVVALVRRFDIRVA-QPDQEPRFAPGLTATLRGGFPVRVCERK  502



>ref|XP_010244250.1| PREDICTED: cytochrome P450 94C1 [Nelumbo nucifera]
Length=503

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/465 (67%), Positives = 379/465 (82%), Gaps = 4/465 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  CKC++C+ Y+TSSW+ E  NLCDWY+ LL  SP+ TIH+HVLGN ITANP NVEY
Sbjct  38    RLKAWCKCDVCRGYVTSSWSTEFDNLCDWYTHLLKNSPSRTIHIHVLGNTITANPDNVEY  97

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+N+PKGK F++ILGDLLGRGIF VDGD WKFQRKMAS E GSVSIRS+AFEIV 
Sbjct  98    MLKTRFDNYPKGKPFSAILGDLLGRGIFNVDGDTWKFQRKMASLELGSVSIRSFAFEIVT  157

Query  1199  AEVRTRLFPLLEFYG--ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +E++ RL P L      E   VLD QDV +RF+FDNIC+FSFG+DPGCL+LSLP+S+FA 
Sbjct  158   SEIKHRLLPFLSSTASDEQDRVLDLQDVFQRFTFDNICRFSFGLDPGCLELSLPMSEFAM  217

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLAS+L A+RA++ SP VWK KRLLN+GSEKKL +AI LIN LA+E+I+Q+RK G + 
Sbjct  218   AFDLASRLCAKRALSLSPLVWKAKRLLNLGSEKKLKKAIRLINILADEVIKQRRKLGFS-  276

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
                DLLSRFMG ++DD  LRDIV+SFLLAGRDT+A+ALTS FWL+++HPEVT  I  ES 
Sbjct  277   THLDLLSRFMGTVNDDAYLRDIVVSFLLAGRDTVAAALTSIFWLMAKHPEVTTAILEESD  336

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             R+M P Q+LAT+QQ+RDM+YL A ++ESMRL+PPVQFDSKF   DD LPDGT V++GTRV
Sbjct  337   RVMGPTQELATFQQLRDMHYLQATVYESMRLYPPVQFDSKFPQEDDVLPDGTVVKRGTRV  396

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYHPYAMGRM+ +WG DC EFKPERWL+ G+F  E+ +KYPVFQAG RVCLGKD+ALVE+
Sbjct  397   TYHPYAMGRMEEVWGPDCLEFKPERWLKKGIFWPESPFKYPVFQAGFRVCLGKDLALVEI  456

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             KSV +A+IR F+IE V E    PR+APGLTATV GGL V +  RR
Sbjct  457   KSVMLAVIRGFEIE-VDEPDNSPRFAPGLTATVSGGLPVLVRQRR  500



>ref|XP_009618179.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=498

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 382/468 (82%), Gaps = 8/468 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + KLK  C CEIC AY+T+SW+ + +NLCDWY+ LL  SPT TIH+HVLGN ITANP NV
Sbjct  32    IVKLKLWCNCEICHAYVTTSWSSQFTNLCDWYTHLLQNSPTRTIHIHVLGNTITANPENV  91

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+F+N+PKGK F++ILGD LGRGIF VDGDLW+FQR+M+S E G VSIRSYAFE+
Sbjct  92    EYMLKTRFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQRRMSSLELGKVSIRSYAFEV  151

Query  1205  VAAEVRTRLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKF  1032
             V  E++ RL PLL     N+E  VLDFQDV RRFSFDNIC+FSFG+DP CL+ SLP+S+F
Sbjct  152   VHNEIQKRLLPLLA----NKEGVVLDFQDVFRRFSFDNICRFSFGLDPKCLESSLPISEF  207

Query  1031  AAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGG  852
             A +FDLASKLSAERA+T SP VWK+KR LNIGSE+KL +AI LIN LA+E+I QKRK G 
Sbjct  208   AVSFDLASKLSAERAMTTSPIVWKIKRFLNIGSERKLKKAIKLINILAQEVIRQKRKLGF  267

Query  851   ARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             + +  DLLSRFMG I D+  LRDIVISFLLAGRDTIASAL SFF++++ HP+V   IR E
Sbjct  268   S-NHRDLLSRFMGTISDETYLRDIVISFLLAGRDTIASALISFFYVIANHPQVAKSIREE  326

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             + R++ P++DL + +Q+ +++YL A+I+ESMRL+PP+QFDSKFCL DD LPDGTFV+KGT
Sbjct  327   ADRVLGPNKDLKSCEQMSELHYLQASIYESMRLYPPIQFDSKFCLEDDILPDGTFVKKGT  386

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+ +WG D  EFKPERWL+DG+F  EN +KYPVFQAG RVCLGK+MALV
Sbjct  387   RVTYHPYAMGRMEELWGCDSLEFKPERWLKDGIFFQENPFKYPVFQAGLRVCLGKEMALV  446

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRP  168
             E+KSVA++L+R F++E + +    PR++PGLTA+ RGGL V + +  P
Sbjct  447   EIKSVALSLLRRFNVE-LAQPYHTPRFSPGLTASFRGGLMVSVREISP  493



>gb|AJD25221.1| cytochrome P450 CYP94C54 [Salvia miltiorrhiza]
Length=491

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/465 (68%), Positives = 377/465 (81%), Gaps = 8/465 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C CE C+ +LTS W +E++NLCDWYS LL KSPTGTIHVHVLGNVITANP NV
Sbjct  30    VVRLKPSCGCETCQTFLTSRWALEYNNLCDWYSHLLAKSPTGTIHVHVLGNVITANPENV  89

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML TKFEN+PKGKQF++ILGDLLGRGIF VDGDLW+FQRKMA  E GSVS+RS+AF+I
Sbjct  90    EHMLKTKFENYPKGKQFSAILGDLLGRGIFNVDGDLWRFQRKMACLELGSVSVRSHAFDI  149

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V +E+ +RL PLL    +     D QD+ RRFSFD+IC+FSFG+DPGCL  SLP  +FAA
Sbjct  150   VTSEIESRLVPLLRSSSD----FDLQDIFRRFSFDSICRFSFGLDPGCLAPSLPACEFAA  205

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSAERA+  SP VWKVKR LN+GSE++L +AI  ++ELAE +I  KR+ GGA 
Sbjct  206   AFDLASKLSAERAIATSPLVWKVKRFLNLGSERRLKQAIRSVHELAEGVIRHKREHGGA-  264

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
                DLLSRFMG  DDD  LRDIVISFLLAGRDT+ASALTSFFWLLSR+P V D IR ES 
Sbjct  265   -HGDLLSRFMGTTDDDVFLRDIVISFLLAGRDTVASALTSFFWLLSRNPAVVDAIREESD  323

Query  665   RIMEPD-QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             R++  D ++  T+ Q+R+M++L AA+HESMRLFPPVQFDSKFC NDD L DGTFV +GTR
Sbjct  324   RVIGGDREETVTFAQLREMHHLQAAVHESMRLFPPVQFDSKFCENDDVLADGTFVSRGTR  383

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYHPYAMGRM+ IWG    +F PERWLE+GVFK ++ +KYPVFQ G RVCLGK+MALVE
Sbjct  384   VTYHPYAMGRMERIWGEAPLQFAPERWLENGVFKHKDPFKYPVFQGGIRVCLGKEMALVE  443

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             MK+VA+++IR FDIEV+  S Q P++ PGLTA++RGGL   +T R
Sbjct  444   MKAVALSIIRRFDIEVI-GSGQAPKFMPGLTASIRGGLPAIVTVR  487



>ref|XP_010089862.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXB38478.1| Cytochrome P450 94A1 [Morus notabilis]
Length=492

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/469 (67%), Positives = 377/469 (80%), Gaps = 7/469 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C CE+C+++LTSSWT E  NLCDWY+ LL KSPTGTIHVHVLGN ITANP NV
Sbjct  25    VLRLKPWCNCEVCRSFLTSSWTSEFGNLCDWYTHLLRKSPTGTIHVHVLGNTITANPENV  84

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+FEN+PKGK F+ ILGDLLGRGIF VDGD W+FQRK AS E GS S+RSYAFEI
Sbjct  85    EYMLKTRFENYPKGKPFSMILGDLLGRGIFNVDGDSWRFQRKTASLELGSTSVRSYAFEI  144

Query  1205  VAAEVRTRLFPLLEFYGENRE----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             +  E+++RL PLL      +E    VLD QDVLRRFSFDNICKFSFG+DPG L LSLP+S
Sbjct  145   IKTEIKSRLIPLLASVSGKKEQEGGVLDLQDVLRRFSFDNICKFSFGLDPGGLRLSLPMS  204

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
             +FAAAFDLASKLSAERA +ASP +WKVKRLL IGSE+KL E++ +++ LA EMI  +R+ 
Sbjct  205   EFAAAFDLASKLSAERATSASPLIWKVKRLLGIGSERKLRESVKMVDNLAAEMIRSRREK  264

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G + D+ DLLSRFM  +DDD+ LRDIV+SFLLAGRDT++SALTSFF+L+S+HPEV  +IR
Sbjct  265   GFS-DRQDLLSRFMASVDDDRYLRDIVVSFLLAGRDTVSSALTSFFYLISQHPEVEQKIR  323

Query  677   AESGRIMEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
              ES R+M    D +  + ++ +M+YL AAIHESMRL+PPVQFDSKFC  DD LPDG  VR
Sbjct  324   EESDRVMGSGSDEVPDFGEMGEMHYLHAAIHESMRLYPPVQFDSKFCQEDDVLPDGALVR  383

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDM  321
             KGTRVT+HPYAMGRM+ IWG DC EFKPERW ++GVF    L+KYPVFQAG R+CLG++M
Sbjct  384   KGTRVTFHPYAMGRMEQIWGPDCLEFKPERWFKNGVFAPVCLFKYPVFQAGRRICLGREM  443

Query  320   ALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             A++EMKSVA  LI+ F+I V     Q PR+A GLTATVRGGL VRI +R
Sbjct  444   AVMEMKSVAHTLIKRFNIRVFG-PHQEPRFAAGLTATVRGGLPVRIQER  491



>ref|XP_011046266.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=490

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/464 (67%), Positives = 373/464 (80%), Gaps = 2/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C C++C+AYL++SWT + +NLCDWY+ LL  S TGTIH+HVLGN+ITANP NV
Sbjct  27    VWRLKPWCNCDVCEAYLSASWTKDFTNLCDWYTHLLRNSKTGTIHLHVLGNIITANPENV  86

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+M+ TKF+N+PKGK F+ +LGDLLGRGIF VDGD WKFQRKMAS E GSVSIR YAF++
Sbjct  87    EHMIKTKFDNYPKGKPFSDLLGDLLGRGIFNVDGDSWKFQRKMASFELGSVSIRMYAFDL  146

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +  E+R RL PLL      +EVLD QDV RRFSFDNICKFSFG+DPGCL+LSLPV +FA 
Sbjct  147   ITTEIRKRLIPLLSSAAAKQEVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPVCEFAL  206

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD+ASKLSAERA+ ASP VWK+KRLLNIGSE++L EAI  ++ELAE MI QKRK  G  
Sbjct  207   AFDVASKLSAERAIVASPMVWKIKRLLNIGSERELKEAIKKVDELAERMINQKRK-EGFS  265

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             + SDLLSRFM  I DD+ LRDIVISFLLAGRDT+AS LTSFFW+LS+HPEV   IR E  
Sbjct  266   NISDLLSRFMTSISDDRYLRDIVISFLLAGRDTVASGLTSFFWILSQHPEVVSAIREEIE  325

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             ++  P+Q+L  +Q++  M+YL AAI+ES+RL+PPVQFDSKF   DD LPDGTFV KGTR 
Sbjct  326   KVTGPNQELPNFQEMLQMHYLNAAIYESLRLYPPVQFDSKFAQEDDILPDGTFVPKGTRA  385

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYH YAMGRM+ IWG DC  FKPERWL+ GVF + N +KY VF AG R+C+GK++ALVEM
Sbjct  386   TYHQYAMGRMEQIWGPDCLAFKPERWLKKGVFVAANPFKYTVFHAGHRICIGKELALVEM  445

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+VA+A+IR F+  VV +  Q+PR+ PG TATVRGGL V I +R
Sbjct  446   KTVALAIIRGFNT-VVEDPNQIPRFIPGFTATVRGGLPVLIQER  488



>ref|XP_011088865.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1 [Sesamum 
indicum]
Length=505

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/472 (66%), Positives = 381/472 (81%), Gaps = 13/472 (3%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLKP C CEIC+++LTSSWT+E++NLCDWYS LL+KSPTGTIHVHVLGNVITANP NVE+
Sbjct  37    KLKPCCSCEICQSFLTSSWTLEYNNLCDWYSHLLSKSPTGTIHVHVLGNVITANPENVEH  96

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+N+PKGK F++ILGDLLGRGIF  DGDLW+FQRKMAS E GSVS+RSYAF IV 
Sbjct  97    MLKTRFDNYPKGKPFSAILGDLLGRGIFNADGDLWRFQRKMASLELGSVSVRSYAFNIVT  156

Query  1199  AEVRTRLFPLL-----EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSK  1035
              E+ +RL PLL     +   ++   LD QD+LRRFSFD+IC+FSFG+DPGCL LSLP+S+
Sbjct  157   TEIESRLIPLLSSVADKCNNDSSGSLDLQDILRRFSFDSICRFSFGLDPGCLRLSLPISE  216

Query  1034  FAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCG  855
             FAAAFDLASKLSAERA+T SP +WK+KR  N+GSEK+L +AI  ++ELAEE+I  KR   
Sbjct  217   FAAAFDLASKLSAERAITTSPMIWKLKRFFNLGSEKQLKQAIKSVHELAEEVIRHKR--N  274

Query  854   GARDQS---DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDR  684
              AR  S   DLLS F+   DDD  LRDIV+SFLLAGRDT+ASALTSFFW+LS++  V ++
Sbjct  275   NARPDSSHDDLLSHFICTTDDDIFLRDIVVSFLLAGRDTVASALTSFFWILSKNTHVVEK  334

Query  683   IRAESGRIM-EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
             IR ES R+M +  + +  + Q+R+M+YL AA+HESMRLFPPVQFDSKFC  DD L DGTF
Sbjct  335   IREESNRVMGQETEKMVEFAQLREMHYLQAAVHESMRLFPPVQFDSKFCEEDDVLADGTF  394

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             V +GTRVTYHPYAMGRM+ IWG DC EFKP+RWL  GVFK  + +KYPVFQAG RVCLGK
Sbjct  395   VTRGTRVTYHPYAMGRMERIWGPDCLEFKPDRWLRGGVFKQADPFKYPVFQAGRRVCLGK  454

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +MA+VEMK+VA++LIR FDI+V     + P + PGLTAT+RGGL + + +R+
Sbjct  455   EMAIVEMKTVALSLIRRFDIQVAMA--RAPTFMPGLTATLRGGLPIVVRERK  504



>ref|XP_009588047.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana tomentosiformis]
Length=501

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/458 (65%), Positives = 378/458 (83%), Gaps = 2/458 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             CKCEIC +Y+++SW+ + +NLCDWY+ LL +SPT TIH+HVLGN ITANP N+EYML T+
Sbjct  33    CKCEICNSYISASWSSKFTNLCDWYTHLLKESPTRTIHIHVLGNTITANPENIEYMLKTR  92

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FENFPKGK F++ILGD LGRGIF VDGDLWKFQRKMAS E G  SIRSYAFE++  E++ 
Sbjct  93    FENFPKGKTFSTILGDFLGRGIFNVDGDLWKFQRKMASLELGRNSIRSYAFEVIHNEIQQ  152

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL    E  E LD QDV RRFSFD+IC+FSFG+DP CL+LSLP+S+FA +FDLAS+
Sbjct  153   RLLPLLACVAEKDESLDLQDVFRRFSFDSICRFSFGLDPKCLELSLPISEFAISFDLASQ  212

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSAERA+  SP +WK+KR LNIGSEKKL +AI +IN LA+E+I Q+RK G + +  DLLS
Sbjct  213   LSAERAMNVSPIIWKIKRFLNIGSEKKLKKAIKMINILAQEVIRQRRKLGFS-NHKDLLS  271

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFMG I ++  LRDIVISFLLAGRDT+ASALTSFFWL++RHP+V ++IR E+ +++  + 
Sbjct  272   RFMGTIANETYLRDIVISFLLAGRDTVASALTSFFWLIARHPQVVEKIRNEADKVIGKNH  331

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
             ++   +Q+R+++YL A I+ESMRLFPP+QFDSKFCL DD LPDGTF++KGTR+TYHPYAM
Sbjct  332   EITNCEQMRELHYLQATIYESMRLFPPIQFDSKFCLEDDFLPDGTFIKKGTRITYHPYAM  391

Query  464   GRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVA  288
             GRM+++WG+D  EFKPERW+ +DGVF  EN +KYPVFQAG RVCLGK+MALVE+KSVA++
Sbjct  392   GRMEALWGSDSLEFKPERWINKDGVFFQENPFKYPVFQAGVRVCLGKEMALVEIKSVALS  451

Query  287   LIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              ++ F +E+V  S   PR++PGLTA+ RGGL V + ++
Sbjct  452   FLQRFHVELVHPSHHTPRFSPGLTASFRGGLPVFVREK  489



>ref|XP_006384629.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP62426.1| cytochrome P450 family protein [Populus trichocarpa]
Length=490

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/464 (66%), Positives = 371/464 (80%), Gaps = 2/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V +LKP C C++CKAYL++SWT + +NLCDWY+ LL  S TGTIH+HVLGN+ITANP NV
Sbjct  27    VWRLKPWCNCDVCKAYLSASWTKDFTNLCDWYTHLLRNSKTGTIHLHVLGNIITANPENV  86

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+M+ TKF+N+PKGK F+ +LGDLLGRGIF VDGD WKFQRKMAS E GSVSIR YAF++
Sbjct  87    EHMVKTKFDNYPKGKPFSDLLGDLLGRGIFNVDGDSWKFQRKMASLELGSVSIRMYAFDL  146

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +  E+R RL PLL      +EVLD QDV RRFSFDNICKFSFG+DPGCL+LSLPV +FA 
Sbjct  147   IITEIRKRLLPLLSSAAAKQEVLDLQDVFRRFSFDNICKFSFGLDPGCLELSLPVCEFAL  206

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD ASKLSAERA+ ASP VWK+KRLLNIGSE++L EAI  ++ELAE MI QKRK  G  
Sbjct  207   AFDAASKLSAERAIAASPMVWKIKRLLNIGSERELKEAIKKVDELAERMINQKRK-EGFS  265

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             +  DLLSRFM  I DD+ LRDIVISFLLAGRDT+AS LTSFFW+LS+HPEV   IR E  
Sbjct  266   NIGDLLSRFMTSISDDRYLRDIVISFLLAGRDTVASGLTSFFWILSQHPEVVSAIREEIE  325

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             ++  P+Q+L  +Q++  M+YL AAI+ES+RL+PPVQFDSKF   DD LPDGTF+ KGTR 
Sbjct  326   KVTGPNQELPNFQEMLQMHYLNAAIYESLRLYPPVQFDSKFAQEDDILPDGTFMPKGTRA  385

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYH YAMGRM+ IWG DC  FKPERWL+ GVF+  N +KY VF AG R+C+GK++ALVEM
Sbjct  386   TYHQYAMGRMEQIWGPDCLAFKPERWLKKGVFEPANPFKYTVFHAGHRICIGKELALVEM  445

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+VA+A+IR F+  VV +  Q+PR+ PG TATVRGGL V I +R
Sbjct  446   KTVALAIIRGFNT-VVEDPNQVPRFIPGFTATVRGGLPVLIQER  488



>ref|XP_009789882.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=493

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/468 (65%), Positives = 380/468 (81%), Gaps = 8/468 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + KLK  C CEIC AY+T+SW+ + +NLCDWY+ LL  SPT TIH+HVLGN ITANP NV
Sbjct  32    IVKLKLWCNCEICHAYVTTSWSSQFTNLCDWYTHLLQNSPTRTIHIHVLGNTITANPENV  91

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML  +F+N+PKGK F++ILGD LGRGIF VDGDLW+FQR+M+S E G VSIRSYAFE+
Sbjct  92    EYMLKARFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQRRMSSLELGKVSIRSYAFEV  151

Query  1205  VAAEVRTRLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKF  1032
             V  E++ RL PLL     N+E  VLDFQDV RRFSFDNIC+FSFG+DP CL+ SLP+S+F
Sbjct  152   VHTEIQKRLLPLLA----NKEGAVLDFQDVFRRFSFDNICRFSFGLDPKCLESSLPISEF  207

Query  1031  AAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGG  852
             A +FDLASKLSAERA+T SP  WK+KR LNIGSE+KL +AI LIN LA+E+I QKRK G 
Sbjct  208   AISFDLASKLSAERAMTTSPIAWKIKRFLNIGSERKLKKAIKLINILAQEVIRQKRKLGF  267

Query  851   ARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             + +  DLLSRFMG I D+  LRDIVISFLLAGRDTIASALTSFF++++ +P+V   IR E
Sbjct  268   S-NHRDLLSRFMGTISDETYLRDIVISFLLAGRDTIASALTSFFYVIANNPKVAKSIRDE  326

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
               R++ P++DL   +Q+ +++YL A+I+ESMRL+PP+QFDSKFCL DD LPDGTFV+KGT
Sbjct  327   VDRVLGPNKDLTCCEQMNELHYLQASIYESMRLYPPIQFDSKFCLEDDILPDGTFVKKGT  386

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+ +WG D  EFKPERWL+DG+F  EN +KYPVFQAG RVCLGK+MALV
Sbjct  387   RVTYHPYAMGRMEELWGCDSLEFKPERWLKDGIFFQENPFKYPVFQAGLRVCLGKEMALV  446

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRP  168
             E+KSVA++L+R F++E+  +   MPR++PGLTA+ RGGL V + +  P
Sbjct  447   EIKSVALSLLRRFNVELA-QPYHMPRFSPGLTASFRGGLMVSVREISP  493



>ref|XP_010658738.1| PREDICTED: cytochrome P450 94C1-like [Vitis vinifera]
Length=506

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/466 (66%), Positives = 376/466 (81%), Gaps = 3/466 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C C+IC  YLTSSW ME  NLCDWY+ LL KSPT TIH+HVLGN ITANP NVEYML
Sbjct  41    KVWCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYML  100

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+N+PKGK F++ILGDLLG+GIF VDGD W FQRKMAS E GSVSIRS+AFE+V AE
Sbjct  101   KTRFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAE  160

Query  1193  VRTRLFPLLEFYGE-NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             ++ RL PLL  Y E +  VLD QDV RRF+FDNICKFSFG+DPGCL+L+LP+S+FA +FD
Sbjct  161   IKHRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDPGCLELALPISQFAESFD  220

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
             LA+KLSAERA+ ASP +WK+KRLLN+GSE++L EAI  +N LA+E+I QKRK G +  Q 
Sbjct  221   LATKLSAERAMVASPLIWKIKRLLNLGSERRLKEAIKKVNVLAKELIIQKRKLGFSTHQ-  279

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  I DD  LRDIVISF+LAGRDT+ASALT+FFWL++ HPEV  +IR E+ RIM
Sbjct  280   DLLSRFMACIKDDDYLRDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  339

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
              P+Q+  +++ IR+M+YL AA+HES+RL+PPVQFDSKF   DD L DGTFV KGTRVTYH
Sbjct  340   HPNQEFPSFELIREMHYLHAAVHESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTYH  399

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR+++IWG DC EF+P+RWL +G F  ++ +K+PVFQAG RVCLGK+MA+V MKSV
Sbjct  400   PYAMGRIEAIWGPDCMEFRPQRWLNNGTFFPQSPFKFPVFQAGIRVCLGKEMAVVAMKSV  459

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             A A++R F+I VV  +   PR+  GLTATVRGGL V + +RR   Q
Sbjct  460   AAAVLRPFNIHVV-HANVAPRFDSGLTATVRGGLPVVVRERRATDQ  504



>ref|XP_008228870.1| PREDICTED: cytochrome P450 94C1 [Prunus mume]
Length=501

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/471 (65%), Positives = 380/471 (81%), Gaps = 7/471 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C +C+++LTSSW+ +  NLCDWY+ LL KSPTGTIH+HVLGNVI A+P NV
Sbjct  31    IIRLRPWCNCHVCRSFLTSSWSKDFDNLCDWYTHLLRKSPTGTIHLHVLGNVIIADPENV  90

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L TKF N+PKGK F +ILGDLLGRGIF VDG+ W FQRKMAS E GSVS+RSYA EI
Sbjct  91    EHILKTKFHNYPKGKPFTTILGDLLGRGIFNVDGNAWLFQRKMASLELGSVSVRSYALEI  150

Query  1205  VAAEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V++E+++RL PLL  + E++   +D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S FA
Sbjct  151   VSSEIQSRLIPLLASFAEDQNSAVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISGFA  210

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD ASKLSAERA+T+SP VWK+KR  NIGSE++L +A+ +++ LA+ MIEQ+R+ G  
Sbjct  211   VAFDTASKLSAERAMTSSPIVWKIKRFFNIGSERQLRDAVKMVDSLAKSMIEQRREMGNF  270

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
               Q DLLSRFM  IDDD+ LRDIV+SFLLAGRDTIAS LTS F+LLS+HPEV   I  ES
Sbjct  271   STQKDLLSRFMANIDDDQYLRDIVVSFLLAGRDTIASGLTSLFYLLSQHPEVKRAILEES  330

Query  668   GRIMEPDQD-----LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFV  504
              RIM          +A+++Q+R+M YL A I+E+MRL+PP+QFDSK+C  DD LPDGTFV
Sbjct  331   DRIMGRSGSGSRSWVASFEQMREMPYLHAVIYETMRLYPPIQFDSKYCQEDDVLPDGTFV  390

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKD  324
             + GTRVTYH YAMGRM+ +WG+DC EFKPERWL++G+F  E+ +KYPVFQ G RVCLGK+
Sbjct  391   QSGTRVTYHQYAMGRMERVWGSDCLEFKPERWLKNGLFTPESPFKYPVFQGGERVCLGKE  450

Query  323   MALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +AL+EMKSVAVAL+R FDI+ V E  + PR+APGLTATVRGGL VRI +R+
Sbjct  451   LALLEMKSVAVALVRRFDIQ-VSEPDRTPRFAPGLTATVRGGLPVRIQERK  500



>ref|XP_007205046.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica]
 gb|EMJ06245.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica]
Length=501

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/471 (65%), Positives = 378/471 (80%), Gaps = 7/471 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C +C+++LTSSW+ +  NLCDWY+ LL KSPTGTIH+HVLGN+ITA+P NV
Sbjct  31    IIRLRPWCNCHVCRSFLTSSWSKDFDNLCDWYTHLLRKSPTGTIHLHVLGNIITADPENV  90

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L TKF N+PKGK F +ILGDLLGRGIF VDG+ W FQRKMAS E GSVS+RSYA EI
Sbjct  91    EHILKTKFHNYPKGKPFTTILGDLLGRGIFNVDGNAWLFQRKMASLELGSVSVRSYALEI  150

Query  1205  VAAEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V++E+++RL PLL    E+R   +D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S FA
Sbjct  151   VSSEIQSRLIPLLASLAEDRNSAVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDFA  210

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD ASKLSAERA+T+SP VWK+KR  NIGSE++L +A+ +++ LA+ MIEQ+R+ G  
Sbjct  211   VAFDTASKLSAERAMTSSPIVWKIKRFFNIGSERQLRDAVKMVDSLAKSMIEQRREMGNF  270

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
               Q DLLSRFM  IDDDK LRDIV+SFLLAGRDTIAS LTS F+LLS+HPEV   I  E 
Sbjct  271   STQKDLLSRFMANIDDDKYLRDIVVSFLLAGRDTIASGLTSLFYLLSQHPEVKRAILEEL  330

Query  668   GRIM-----EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFV  504
              R+M     E     A+++Q+R+M+YL A I+E+MRL+PP+QFDSK+C  DD LPDGTFV
Sbjct  331   DRVMGRSGSESRSWAASFEQMREMHYLHAVIYETMRLYPPIQFDSKYCQEDDVLPDGTFV  390

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKD  324
               GTRVTYH YAMGRM+ +WG+DC EFKPERWL++G+F  E  +KYPVFQ G RVCLGK+
Sbjct  391   PSGTRVTYHQYAMGRMERVWGSDCLEFKPERWLKNGLFTPECPFKYPVFQGGERVCLGKE  450

Query  323   MALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +AL+EMKSVAVAL+R FDI+ V E  + PR+APGLTATVRGGL VRI +R+
Sbjct  451   LALLEMKSVAVALVRRFDIQ-VSEPDRTPRFAPGLTATVRGGLPVRIQERK  500



>ref|XP_004291623.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/464 (65%), Positives = 378/464 (81%), Gaps = 6/464 (1%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+++LTSSWT + +N CDWY+ LL KSPTGTIH+HVLGN++T+NP NVEYML 
Sbjct  47    PWCNCHVCRSFLTSSWTKDFANFCDWYAHLLRKSPTGTIHIHVLGNIVTSNPENVEYMLK  106

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+N+PKGK F  +LGDLLGRGIF VDGD+W+FQRKMAS E GSV++RS+A E+VAAE+
Sbjct  107   TRFDNYPKGKPFTVLLGDLLGRGIFNVDGDMWRFQRKMASLELGSVTVRSHALEVVAAEI  166

Query  1190  RTRLFPLLEFYGENRE---VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             ++RL PL+     N     VLD QD+ RRFSFDNICKFSFG+DPGCL+ SLPVSKFA AF
Sbjct  167   QSRLIPLMASVSGNDSDAGVLDLQDLFRRFSFDNICKFSFGLDPGCLEPSLPVSKFADAF  226

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+T+SP  WK+KR  N+GSEK+L EA+ +I++ A+EMI+Q+RK G    +
Sbjct  227   DLASKLSAERAMTSSPVFWKIKRFFNVGSEKRLKEAVRIIDDQAKEMIKQRRKMGYVA-K  285

Query  839   SDLLSRFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             +DLLSRFM I+ DDD+ LRDIV+SFLLAGRDTI+S LTS F+LLS+HPEVT  IR ES +
Sbjct  286   NDLLSRFMAIVNDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLSQHPEVTRAIREESDQ  345

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             +M     + +++Q+R+M+YL A ++E+MRLFPPVQFDSK+C  DD LPDGTFV+ GTRVT
Sbjct  346   VMGRAGAIPSFEQMREMHYLHAVLYETMRLFPPVQFDSKYCQEDDVLPDGTFVKSGTRVT  405

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+SIWG DC +FKPERWL++GV+   + YKYPVFQ G RVCLGK++ALVEMK
Sbjct  406   YHPYAMGRMESIWGPDCLDFKPERWLKNGVYSPVSPYKYPVFQGGDRVCLGKELALVEMK  465

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
               A AL+  FDI  V +  Q PR+APGLTATVRGGL VR+ +RR
Sbjct  466   CAAAALVGRFDIR-VSQPGQAPRFAPGLTATVRGGLPVRVEERR  508



>emb|CDP15392.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/460 (66%), Positives = 374/460 (81%), Gaps = 4/460 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             CKC IC+AY++SSW+++  NLCDWY+ LL  SP+ TIHVHVLGN+ITANP NVEY+L T+
Sbjct  7     CKCVICQAYVSSSWSVKFKNLCDWYTYLLQDSPSQTIHVHVLGNIITANPENVEYILKTR  66

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F++ILGD LGRGIF VDGDLWKFQRKMAS E   +S+RSYAF++V  E+  
Sbjct  67    FENYPKGKPFSTILGDFLGRGIFNVDGDLWKFQRKMASLELCRISMRSYAFDVVQHEIEN  126

Query  1184  RLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL  +   +E  VLDFQDV RRFSFD IC+ SFG+DP CL++SLP+S+FA  FDLA
Sbjct  127   RLIPLLSSFAAGKEDRVLDFQDVFRRFSFDCICRVSFGLDPRCLEISLPLSEFAVCFDLA  186

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSAERA+TA+P  WKVKR+LNIGSEK+L +AI +IN LA+E+I Q+RK G + +  DL
Sbjct  187   SRLSAERAMTAAPVTWKVKRMLNIGSEKELRKAIQMINLLAKEVIRQRRKLGFS-EHKDL  245

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG + D+  LRDI+ISFLLAGRDT+AS LTSFFWL++ HPEV   I+ E+ R++ P
Sbjct  246   LSRFMGSVTDETYLRDIIISFLLAGRDTVASTLTSFFWLVANHPEVEAAIQREADRVVGP  305

Query  650   DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
              + L + +Q+R++ YL AAI ESMRL+PPVQFDSKFCL DD  PDGT V+KGTRVTYHPY
Sbjct  306   KEKLTSLEQLRELQYLHAAIFESMRLYPPVQFDSKFCLEDDIFPDGTAVKKGTRVTYHPY  365

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGRM++IWG+DC EFKPERWL DGVF  EN +KYPVFQAG RVCLGKDMALVE+KSVA+
Sbjct  366   AMGRMENIWGSDCLEFKPERWLRDGVFFQENPFKYPVFQAGQRVCLGKDMALVELKSVAI  425

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +L+R F I V+ E+ Q PR++PGLTAT  GGL V +  ++
Sbjct  426   SLLRNFHI-VLAEAHQSPRFSPGLTATFHGGLPVLVRGKK  464



>ref|XP_009774133.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=501

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/464 (64%), Positives = 378/464 (81%), Gaps = 2/464 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +LK  CKCEIC +Y+++SW+ + +NLCDWY+ LL +SPT TIH+HVLGN ITANP NV
Sbjct  26    ILRLKFWCKCEICNSYISASWSSKFTNLCDWYTLLLKESPTRTIHIHVLGNTITANPENV  85

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+FENFPKGK F++ILGD LGRGIF VDGDLWKFQRKMAS E G  SIRSYAFE+
Sbjct  86    EYMLKTRFENFPKGKTFSTILGDFLGRGIFNVDGDLWKFQRKMASLELGRSSIRSYAFEV  145

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +  E++ RL PLL       E+LD QDV RRFSFD+IC+FSFG+DP  L+LSLP+S+FA 
Sbjct  146   IHNEIQQRLLPLLACVANKDEILDLQDVFRRFSFDSICRFSFGLDPKSLELSLPISEFAL  205

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             +FDLAS+LSAERA+  SP +WK+KRLLNIGSEKKL +AI  IN LA+E+I Q+RK G + 
Sbjct  206   SFDLASQLSAERAMHMSPIIWKIKRLLNIGSEKKLKKAIKTINILAQEVIRQRRKLGFS-  264

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             +  DLLSRFMG I ++  LRDIVISFLLAGRDT+ASALTSFFWL++RHP+V ++IR E+ 
Sbjct  265   NHKDLLSRFMGTIANETYLRDIVISFLLAGRDTVASALTSFFWLVARHPQVVEKIRDEAD  324

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             +++  + ++   +Q+R+++YL A ++ESMRLFPP+QFDSKFCL DD LPDGTF++KGTRV
Sbjct  325   KVIGKNHEITDCEQMRELHYLQATVYESMRLFPPIQFDSKFCLEDDFLPDGTFIKKGTRV  384

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             TY+PYAMGRM+ +WG+D  EFKPERW+ +DGVF  EN +KYPVFQAG RVCLGK+MALVE
Sbjct  385   TYYPYAMGRMEELWGSDSLEFKPERWINKDGVFFQENPFKYPVFQAGLRVCLGKEMALVE  444

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +KSV ++ +R F +E+V  S   PR++PGLTA+ RGGL V + +
Sbjct  445   IKSVVLSFLRRFHVELVHPSHHTPRFSPGLTASFRGGLPVFVRE  488



>emb|CAN66874.1| hypothetical protein VITISV_021428 [Vitis vinifera]
Length=671

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/466 (66%), Positives = 375/466 (80%), Gaps = 3/466 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C C+IC  YLTSSW ME  NLCDWY+ LL KSPT TIH+HVLGN ITANP NVEYML
Sbjct  206   KVWCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYML  265

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+N+PKGK F++ILGDLLG+GIF VDGD W FQRKMAS E GSVSIRS+AFE+V AE
Sbjct  266   KTRFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAE  325

Query  1193  VRTRLFPLLEFYGE-NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             ++ RL PLL  Y E +  VLD QDV RRF+FDNICKFSFG+DPGCL+L+LP+S+FA +FD
Sbjct  326   IKHRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDPGCLELALPISQFAESFD  385

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
             LA+KLSAERA+ ASP +WK+ RLLN+GSE++L EAI  +N LA+E+I QKRK G +  Q 
Sbjct  386   LATKLSAERAMVASPLIWKINRLLNLGSERRLKEAIKKVNVLAKEVIIQKRKLGFSTHQ-  444

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  I DD  L+DIVISF+LAGRDT+ASALT+FFWL++ HPEV  +IR E+ RIM
Sbjct  445   DLLSRFMACIKDDNYLKDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  504

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
              P+Q+  +++QIR+M+YL AA++ES+RL+PPVQFDSKF   DD L DGTFV KGTRVTYH
Sbjct  505   HPNQEFPSFEQIREMHYLHAAVYESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTYH  564

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR+++IWG DC EFKP+RWL +G F  ++ +KYPVFQAG RVCLGK+MA+V MKSV
Sbjct  565   PYAMGRIEAIWGPDCMEFKPQRWLNNGTFFPQSPFKYPVFQAGIRVCLGKEMAVVAMKSV  624

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             A A++R FDI VV  +   PR+  GLTAT RGGL V + +RR   Q
Sbjct  625   AAAVLRPFDIHVV-HANVAPRFDSGLTATXRGGLPVVVRERRATNQ  669



>ref|XP_003606223.1| Cytochrome P450 94A1 [Medicago truncatula]
 gb|ABC59093.1| cytochrome P450 monooxygenase CYP94C9 [Medicago truncatula]
 gb|AES88420.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=517

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/478 (64%), Positives = 377/478 (79%), Gaps = 15/478 (3%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S++KP C C  CK +LT SW+ +  NL D+Y+ LL +SPTGTIHVHVLGN IT+NP NV
Sbjct  40    ISRIKPWCNCNTCKTFLTMSWSNKFVNLVDYYTHLLQESPTGTIHVHVLGNTITSNPENV  99

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EY+L T F N+PKGKQF++ILGDLLGRGIF VDG  WKFQRKMAS E GSV IRSYA E+
Sbjct  100   EYILKTNFNNYPKGKQFSTILGDLLGRGIFNVDGHSWKFQRKMASLELGSVVIRSYAMEL  159

Query  1205  VAAEVRTRLFPLLEFYGENRE-----------VLDFQDVLRRFSFDNICKFSFGMDPGCL  1059
             V  E++TRL PL+    E +            +LD QD+LRRFSFDNICKFSFG+DP CL
Sbjct  160   VIEEIKTRLLPLIASVAEKKTASKADNTSEDVLLDMQDILRRFSFDNICKFSFGLDPCCL  219

Query  1058  DLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEM  879
               SLPVS  A AFDL+S LSA+RA+TASP +WK+KR  NIGSEKKL EAI ++N+LA EM
Sbjct  220   VPSLPVSNLANAFDLSSTLSAQRALTASPLIWKMKRFFNIGSEKKLKEAIKIVNDLANEM  279

Query  878   IEQKRKC-GGARDQSDLLSRFMGIID--DDKLLRDIVISFLLAGRDTIASALTSFFWLLS  708
             I+Q+R+   G   + DLLSRFMG ++  DD+ LRDIV+SFLLAGRDT+ASALT FF LLS
Sbjct  280   IKQRREIENGVESRKDLLSRFMGALNSHDDEYLRDIVVSFLLAGRDTVASALTGFFILLS  339

Query  707   RHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDD  528
             ++P+V ++IR E  R+M P+Q+ AT++Q R+M+YL  AIHESMRLFPPVQFDSKF L DD
Sbjct  340   KNPKVEEKIRVELDRVMNPNQECATFEQTREMHYLNGAIHESMRLFPPVQFDSKFALEDD  399

Query  527   TLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAG  348
              LPDGTF++KG+RVTYHPYAMGRM++IWG DC EFKPERWL+DGVF  +  +KYPVFQAG
Sbjct  400   VLPDGTFIKKGSRVTYHPYAMGRMENIWGPDCLEFKPERWLKDGVFVPKCPFKYPVFQAG  459

Query  347   PRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              RVCLGK++A+VEMKSV  +L++ FD+ VV  + Q P++APGLTA+ RGGL V+I +R
Sbjct  460   SRVCLGKELAIVEMKSVVASLVKRFDVRVVGPN-QEPQFAPGLTASFRGGLPVKIYER  516



>gb|AED99869.1| cytochrome P450 [Panax notoginseng]
Length=489

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/466 (67%), Positives = 373/466 (80%), Gaps = 6/466 (1%)
 Frame = -1

Query  1556  LKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYM  1377
             LK  C CE  + +L++ W ++++NLCDWY+ LL +SPTGTIHVHVL N+IT+NP NVEYM
Sbjct  25    LKQYCGCETSRTFLSAGWNLKYNNLCDWYTHLLQESPTGTIHVHVLDNIITSNPENVEYM  84

Query  1376  LTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAA  1197
             L T F+N+PKGK F++ILGDLLG+GIF VDG+ WKFQRKMAS E GS+SIRSYAFE V  
Sbjct  85    LKTNFDNYPKGKPFSTILGDLLGKGIFNVDGEKWKFQRKMASLELGSLSIRSYAFETVTW  144

Query  1196  EVRTRLFPLLEFYG---ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             E+  RL PLL       +   V+D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S+FA 
Sbjct  145   EINNRLIPLLSSSAVGCKKSGVVDLQDIFRRFSFDNICKFSFGVDPGCLKLSLPLSEFAE  204

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSA+RA+TASP VWKVKRLLN+GSEKKL +AI  ++ LAEE+I QKR  G + 
Sbjct  205   AFDLASKLSAQRALTASPVVWKVKRLLNLGSEKKLRKAIKKVDVLAEEVIRQKRLMGFST  264

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE-S  669
             +  DLLSRFMG I+DDK LRDIVISFLLAGRDT+ASALTSFFWLL +HP V   IR E S
Sbjct  265   N-DDLLSRFMGSINDDKYLRDIVISFLLAGRDTVASALTSFFWLLDQHPGVVTSIRDELS  323

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
                      LA   Q+R+ +YL AA++ESMRL+PPVQFDSKFC  DD LPDGTFVRKGTR
Sbjct  324   SPSGGQQHKLAGVDQLREFHYLQAALYESMRLYPPVQFDSKFCQQDDVLPDGTFVRKGTR  383

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             +TYHPYAMGRM+SIWG+DC +FKP+RWLE+GVF+ E+ YKYPVFQAG RVCLGK+MAL+E
Sbjct  384   LTYHPYAMGRMESIWGSDCLQFKPQRWLENGVFQPESPYKYPVFQAGLRVCLGKEMALME  443

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             MKSVAVALI+ FDI+ V  S  M  +APGLTAT+RGG  V I +RR
Sbjct  444   MKSVAVALIQRFDIQXVAPSSTM-LFAPGLTATMRGGFPVTIRERR  488



>ref|XP_002277129.2| PREDICTED: cytochrome P450 94C1 [Vitis vinifera]
Length=509

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/463 (66%), Positives = 375/463 (81%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  C CEIC +Y+T SW+ +  NLCDWY+ LL  SPT TIHVHVLGN ITAN  NVEY
Sbjct  46    RLKLWCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVEY  105

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+FEN+PKGK F++ILGD LGRGIF VDG+LW+FQRKMAS E G  SIRSYAFEIV 
Sbjct  106   MLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIVN  165

Query  1199  AEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E+  RL PLL     N + VLD QDV RRFSFD+IC+FSFG+DPGCL+LSLP+S+FA A
Sbjct  166   YEIERRLLPLLWSVAGNEDGVLDLQDVFRRFSFDSICRFSFGLDPGCLELSLPISEFADA  225

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSA RA+ ASP VW++KR+LN+G+EKKL +AI LIN LA+E+I+QKRK G +  
Sbjct  226   FDLASKLSAARAMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFSAH  285

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             + DLLS FM  ++DD  LRDIVISFLLAGRDT+ASALTSFFWLLS HP+V   IR+E+ +
Sbjct  286   K-DLLSLFMRNLNDDTYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRSEADK  344

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+ PDQ++ +++Q+++++YL AA+HESMRL+PP+QFDSKFC  DD LPDGTFV++GTRVT
Sbjct  345   IIGPDQEVTSFEQMQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQRGTRVT  404

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR++ IWG DC EFKPERWL+DGVF  EN +KYPVFQAG RVCLGK+MAL+E K
Sbjct  405   YHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMALMEFK  464

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA++L+R F IE+      +PR++PGLTAT   GL V +  R
Sbjct  465   SVALSLVRRFHIELATPC-PIPRFSPGLTATFGSGLPVLVRGR  506



>ref|XP_006430255.1| hypothetical protein CICLE_v10013425mg [Citrus clementina]
 gb|ESR43495.1| hypothetical protein CICLE_v10013425mg [Citrus clementina]
Length=463

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/463 (65%), Positives = 369/463 (80%), Gaps = 2/463 (0%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLK  C CEIC  YLT SW+ +  NLCDWY+ LL+KSPT TIH+HVLGN ITANP NVEY
Sbjct  2     KLKLWCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVEY  61

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGD W+FQ++MAS E    SIRSYA EIV 
Sbjct  62    MLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIVN  121

Query  1199  AEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++TRL PLL    G+   VLD QDV +RFSFD++CKFSFG+DP CL+LSLP+S FA A
Sbjct  122   QEIKTRLIPLLSSVAGKEDGVLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFAVA  181

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+T SP VWK+KR+LN+GSEK+L EAI +I+ LA E+I+Q+RK G +  
Sbjct  182   FDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS-T  240

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFM  ++DD  LRDIVISFLLAGRDT+ASALTSF WLL ++P V   IRAE+ R
Sbjct  241   HKDLLSRFMSSVNDDTYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEADR  300

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+  +Q+L ++ Q+R+++YL AA++ES RL+PP+QFDSKFC  DD LPDGT+V+KGTRVT
Sbjct  301   ILGQNQELTSFDQLRELHYLQAAVYESTRLYPPIQFDSKFCEEDDVLPDGTYVKKGTRVT  360

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM  IWG +C EFKPERWL++G+F  EN YKYPVFQAG RVCLGK+MALVE+K
Sbjct  361   YHPYAMGRMREIWGQNCLEFKPERWLKNGLFLPENPYKYPVFQAGFRVCLGKEMALVEIK  420

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              VA++L+R F I +V   R  PR++PGLTAT  GGL V +  R
Sbjct  421   IVALSLVRQFQIHLVSPYRATPRFSPGLTATFSGGLPVLLQQR  463



>ref|XP_006481811.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Citrus sinensis]
Length=504

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/463 (65%), Positives = 370/463 (80%), Gaps = 2/463 (0%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLK  C CEIC  YLT SW+ +  NLCDWY+ LL+KSPT TIH+HVLGN ITANP NVEY
Sbjct  43    KLKLWCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVEY  102

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGD W+FQ++MAS E    SIRSYA EIV 
Sbjct  103   MLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIVN  162

Query  1199  AEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++TRL PLL    G+   VLD QDV +RFSFD++CKFSFG+DP CL+LSLP+S FA A
Sbjct  163   QEIKTRLIPLLSSVAGKEDGVLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFAVA  222

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+T SP VWK+KR+LN+GSEK+L EAI +I+ LA E+I+Q+RK G +  
Sbjct  223   FDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS-T  281

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFM  ++DD  LRDIVISFLLAGRDT+ASALTSF WLL ++P V   IRAE+ R
Sbjct  282   HKDLLSRFMSSVNDDTYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEADR  341

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+  +Q+L ++ Q+R+++YL AA+ ES RL+PP+QFDSKFC  DD LPDGT+V+KGTRVT
Sbjct  342   ILGQNQELTSFDQLRELHYLQAAVSESTRLYPPIQFDSKFCEEDDVLPDGTYVKKGTRVT  401

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM  IWG +C EF PERWL++GVF  EN YKYPVFQAG RVCLGK+MALVE+K
Sbjct  402   YHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMALVEIK  461

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA++L+R F I+++   R +PR++PGLTAT  GGL V +  R
Sbjct  462   SVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPVLLQQR  504



>ref|XP_008376983.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
 ref|XP_008343326.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=533

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/471 (64%), Positives = 375/471 (80%), Gaps = 9/471 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C +C+++LTSSW     NLCDWY+ LL KSPTGTI VHVLGN+ITANP NV
Sbjct  63    IIRLRPWCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIQVHVLGNIITANPENV  122

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++ T F N+PKGK F +ILGDLLGRGIF VDGD W+FQRKMAS E GSVS+RSYA EI
Sbjct  123   EHIIKTNFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEI  182

Query  1205  VAAEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V+ E+++RL PL        GEN  V D QD+ RRFSFDNICKFSFG+DP CL LSLP+S
Sbjct  183   VSTEIQSRLIPLFASVAGSEGEN-GVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPIS  241

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
              FA AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ MIEQ+R+ 
Sbjct  242   DFAVAFDLASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVNMVDNLAKTMIEQRREM  301

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    Q DLLSRFM  IDDD+ LRDIV+SFLLAGRDTI+S LTS F+LL++HPEV   IR
Sbjct  302   GTFLTQKDLLSRFMANIDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIR  361

Query  677   AESGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
              E   +M P ++    A++ Q+R+++YL A ++E+MRL+PPVQFDSKFC  DD LPDGTF
Sbjct  362   EELDHVMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTF  421

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             VR+GTRVTYH YAMGRM+SIWG+DC +FKP+RW++ GVF  E+ YKYP+FQ G RVCLGK
Sbjct  422   VRRGTRVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGVFSPESPYKYPIFQGGERVCLGK  481

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++AL+EMK VAVAL+R FDI+V+   R+ P++ PGLTATVRGGL +RI +R
Sbjct  482   ELALMEMKCVAVALVRRFDIQVLDPERR-PQFVPGLTATVRGGLPIRIKER  531



>ref|XP_006430254.1| hypothetical protein CICLE_v10013407mg [Citrus clementina]
 gb|ESR43494.1| hypothetical protein CICLE_v10013407mg [Citrus clementina]
Length=463

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/460 (65%), Positives = 369/460 (80%), Gaps = 2/460 (0%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLK  C CEIC  YLT SW+ +  NLCDWY+ LL+KSPT TIH+HVLGN ITANP NVEY
Sbjct  2     KLKLWCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVEY  61

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGD W+FQ++MAS E    SIRSYA EIV 
Sbjct  62    MLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIVN  121

Query  1199  AEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++TRL PLL    G+   VLD QDV +RFSFD++CKFSFG+DP CL+LSLP+S FA A
Sbjct  122   QEIKTRLIPLLSSVAGKEDGVLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFAVA  181

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+T SP VWK+KR+LN+G+EK+L EAI +I+ LA E+I+Q+RK G +  
Sbjct  182   FDLASKLSAERAMTVSPLVWKIKRMLNLGNEKQLKEAIKMIDLLALEVIKQRRKMGFS-T  240

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFM  ++DD  LRDIV+SFLLAGRDT+ASALTSF WLL ++P V   IRAE+ R
Sbjct  241   HKDLLSRFMSSVNDDTYLRDIVVSFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEADR  300

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+  +Q+L ++ Q+R+++YL AA+ ESMRL+PP+QFDSKFC  DD LPDGT+V+KGTRVT
Sbjct  301   ILGQNQELTSFDQLRELHYLQAAVSESMRLYPPIQFDSKFCEEDDVLPDGTYVKKGTRVT  360

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM  IWG +C EF PERWL++GVF  EN YKYPVFQAG RVCLGK+MALVE+K
Sbjct  361   YHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMALVEIK  420

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             SVA++L+R F I+++   R +PR++PGLTAT  GGL   +
Sbjct  421   SVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPAMV  460



>ref|XP_006481880.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/460 (65%), Positives = 369/460 (80%), Gaps = 2/460 (0%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLK  C CEIC  YLT SW+ +  NLCDWY+ LL+KSPT TIH+HVLGN ITANP NVEY
Sbjct  43    KLKLWCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVEY  102

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGD W+FQ++MAS E    SIRSYA EIV 
Sbjct  103   MLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIVN  162

Query  1199  AEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++TRL PLL    G+   VLD QDV +RFSFD++CKFSFG+DP CL+LSLP+S FA A
Sbjct  163   QEIKTRLIPLLSSVAGKEDGVLDLQDVFKRFSFDSMCKFSFGLDPRCLELSLPMSDFAVA  222

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+T SP VWK+KR+LN+GSEK+L EAI +I+ LA E+I+Q+RK G +  
Sbjct  223   FDLASKLSAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS-T  281

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFM  ++DD  LRDIV+SFLLAGRDT+ASALTSF WLL ++P V   IRAE+ R
Sbjct  282   HKDLLSRFMSSVNDDTYLRDIVVSFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEADR  341

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+  +Q+L ++ Q+R+++YL AA+ ESMRL+PP+QFDSKFC  DD LPDGT+V+KGTRVT
Sbjct  342   ILGQNQELTSFDQLRELHYLQAAVSESMRLYPPIQFDSKFCEEDDVLPDGTYVKKGTRVT  401

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM  IWG +C EF PERWL++GVF  EN YKYPVFQAG RVCLGK+MALVE+K
Sbjct  402   YHPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMALVEIK  461

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             SVA++L+R F I+++   R +PR++PGLTAT  GGL   +
Sbjct  462   SVALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPAMV  501



>emb|CAN67559.1| hypothetical protein VITISV_002257 [Vitis vinifera]
Length=527

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/458 (67%), Positives = 373/458 (81%), Gaps = 3/458 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  C CEIC +Y+T SW+ +  NLCDWY+ LL  SPT TIHVHVLGN ITAN  NVEY
Sbjct  40    RLKLWCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+FEN+PKGK F++ILGD LGRGIF VDG+LW+FQRKMAS E G  SIRSYAFEIV 
Sbjct  100   MLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIVN  159

Query  1199  AEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E+  RL PLL     N + VLD QDV RRFSFD+IC+FSFG+DPGCL+LSLP+S+FA A
Sbjct  160   YEIERRLLPLLWSVAGNEDGVLDLQDVFRRFSFDSICRFSFGLDPGCLELSLPISEFADA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSA RA+ ASP VW++KR+LN+G+EKKL +AI LIN LA+E+I+QKRK G +  
Sbjct  220   FDLASKLSAARAMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFSAH  279

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             + DLLS FM  ++DD  LRDIVISFLLAGRDT+ASALTSFFWLLS HP+V   IR+E+ +
Sbjct  280   K-DLLSLFMRNLNDDTYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRSEADK  338

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+ PDQ++ +++Q+++++YL AA+HESMRL+PP+QFDSKFC  DD LPDGTFV++GTRVT
Sbjct  339   IIGPDQEVTSFEQMQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQRGTRVT  398

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR++ IWG DC EFKPERWL+DGVF  EN +KYPVFQAG RVCLGK+MAL+E K
Sbjct  399   YHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMALMEFK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSV  189
             SVA++L+R F IE+      +PR++PGLTAT   GL V
Sbjct  459   SVALSLVRRFHIELATPC-PIPRFSPGLTATFGSGLPV  495



>ref|XP_003538134.1| PREDICTED: cytochrome P450 94A2-like [Glycine max]
Length=506

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/465 (66%), Positives = 370/465 (80%), Gaps = 8/465 (2%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             ++KP C C++CK+YLT SW  +  NLCDWY+ LL KSPTGTIHVHVL N IT+NP NVEY
Sbjct  38    RMKPWCNCDVCKSYLTVSWLNKFPNLCDWYTHLLRKSPTGTIHVHVLENTITSNPVNVEY  97

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T F+N+PKGK F+ ILGDLLGRGIF VDG+ WK QRKMAS E GSV+IR+ A E+V 
Sbjct  98    ILKTNFQNYPKGKPFSVILGDLLGRGIFNVDGESWKLQRKMASLELGSVAIRTNAMELVN  157

Query  1199  AEVRTRLFPLLEFYGENRE------VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
              E+  RL P +     + E      VLD QD+LRRFSFDNICKFSFG+DPGCL  +LPVS
Sbjct  158   EEIHARLIPFIMGSVTHDELNDSVCVLDLQDILRRFSFDNICKFSFGLDPGCLLPNLPVS  217

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
               A AFDLASKLSAERA+ ASP +WK+KRLLN+GSE+KL EAI ++N++A EMI+Q+ + 
Sbjct  218   NLADAFDLASKLSAERAMNASPFIWKLKRLLNVGSERKLREAINVVNDVANEMIKQRIEM  277

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    ++DLLSRF G I+DD  LRDIV+SFLLAGRDTIAS LT FF LLS+ PEV + IR
Sbjct  278   G-FNTRNDLLSRFTGSINDDVYLRDIVVSFLLAGRDTIASGLTGFFMLLSKSPEVEELIR  336

Query  677   AESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRK  498
              E+GR++ P Q+  +++QIR+M+YL AAIHESMRLFPP+QFDSKF   DD LPDGTFVRK
Sbjct  337   EEAGRVVGPGQEFPSFEQIREMHYLNAAIHESMRLFPPIQFDSKFATEDDVLPDGTFVRK  396

Query  497   GTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             G+RVTYHPYAMGRM++IWG DC EF+PERWL DGVF     +KYPVFQAG RVCLGKD+A
Sbjct  397   GSRVTYHPYAMGRMENIWGPDCLEFRPERWLRDGVFVPACPFKYPVFQAGVRVCLGKDLA  456

Query  317   LVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             L+EMKSV +AL+R FDI VV +S Q PR+ PGLTAT+RGGL VR+
Sbjct  457   LMEMKSVVLALVRRFDIRVV-QSGQEPRFEPGLTATLRGGLPVRV  500



>ref|XP_009348573.1| PREDICTED: cytochrome P450 94C1-like, partial [Pyrus x bretschneideri]
Length=533

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 372/471 (79%), Gaps = 9/471 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C +C+++LTSSW     NLCDWY+ LL KSPTGTIHVHVLGN+ITANP NV
Sbjct  62    IIRLRPWCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIHVHVLGNIITANPENV  121

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++ T F N+PKGK F +ILGDLLGRGIF VDGD W+FQRKMAS E GSVS+RSYA EI
Sbjct  122   EHIIKTNFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEI  181

Query  1205  VAAEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V+ E+++RL PL        GEN  V D QD+ RRFSFDNICKFSFG+DP CL LSLP+S
Sbjct  182   VSTEIQSRLIPLFASVAGSEGEN-GVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPIS  240

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
              FA AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ MIEQ+R+ 
Sbjct  241   DFAVAFDLASKLSAERAITSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIEQRREM  300

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    Q DLLSRFM  IDDD+ LRDIV+SFLLAGRDTI+S LTS F+LL++HPEV   IR
Sbjct  301   GTFLTQKDLLSRFMANIDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIR  360

Query  677   AESGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
              E   +M P ++    A++ Q+R+++YL A ++E+MRL+PPVQFDSKFC  DD LPDGTF
Sbjct  361   EELDHVMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTF  420

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             VR GTRVTYH YAMGRM+SIWG+DC +FKP+RW++ G F  E+ YKYP+FQ G RVCLGK
Sbjct  421   VRSGTRVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGAFSPESPYKYPIFQGGERVCLGK  480

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++A++EMK VAVAL+R FDI+V+   R+ P++ PG TATV GGL VRI +R
Sbjct  481   ELAVMEMKCVAVALVRKFDIQVLDPERR-PQFVPGFTATVSGGLPVRIKER  530



>ref|XP_004305353.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca]
Length=495

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/458 (65%), Positives = 368/458 (80%), Gaps = 2/458 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC  YLTSSW+++  NLCDWY+ LL +SPT TIH+HVL N ITANP NV YML T 
Sbjct  35    CNCEICNTYLTSSWSLKFHNLCDWYAHLLRESPTKTIHIHVLRNTITANPENVRYMLKTN  94

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FENFPKGK F++ILGD LG+GIF VDG  W+FQRKMAS E    S+RSY+FEIV  E+  
Sbjct  95    FENFPKGKPFSTILGDFLGQGIFNVDGHPWRFQRKMASLELDKQSVRSYSFEIVNHEIEH  154

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             R  PLL    E ++VLD QDV +RFSFD+ICKFSFG+DP CLDLSLP+S+FA +FDLAS+
Sbjct  155   RFIPLLSSSSEKKDVLDLQDVFKRFSFDSICKFSFGLDPMCLDLSLPLSEFAVSFDLASR  214

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSAERA+TASP VWK+KR+LN+GSEK+L EAI +I+ LA E+I  KR+ G A  Q DLLS
Sbjct  215   LSAERAMTASPIVWKIKRMLNLGSEKQLKEAINMIDVLAREVIVTKRQMGFA-TQKDLLS  273

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFM  +DD+  LRDIVISFLLAGRDT+ASALTSFFWL++ H  V   IRAE+ +++ P  
Sbjct  274   RFMRSVDDETYLRDIVISFLLAGRDTVASALTSFFWLMTTHKLVESAIRAEADKVLGPSV  333

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
              L +++Q+++++YL AAI+ESMRL+PPVQFDSKFC  DD LPDGTFV+KGTRVTYHPYAM
Sbjct  334   GLNSFEQLQELHYLQAAIYESMRLYPPVQFDSKFCDQDDVLPDGTFVKKGTRVTYHPYAM  393

Query  464   GRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVAL  285
             GR++  WG DC EFKPERWL++GVF +EN +KYPVFQ G RVCLGK+MAL+E+K VA++L
Sbjct  394   GRIEENWGPDCMEFKPERWLKEGVFFTENQFKYPVFQPGLRVCLGKEMALMELKVVALSL  453

Query  284   IRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +R F+IE   +   +PR++PGLTAT RGGL VR+ +R+
Sbjct  454   LRNFEIETTAQF-NVPRFSPGLTATFRGGLPVRVRERK  490



>ref|XP_007132406.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris]
 gb|ESW04400.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris]
Length=499

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 374/468 (80%), Gaps = 10/468 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             ++++KP C C +CK+YLT SW  + +NLCDWY+ LL KSP+GTIH+HVLGN IT+NP NV
Sbjct  36    ITRMKPWCNCLLCKSYLTLSWARKFTNLCDWYTHLLRKSPSGTIHMHVLGNTITSNPDNV  95

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EY+L T F N+PKGK F++ILGDLLG+GIF VDGD W+FQRKMAS E GSV+IRSYA E+
Sbjct  96    EYILKTNFHNYPKGKPFSAILGDLLGKGIFNVDGDSWRFQRKMASLELGSVAIRSYAMEL  155

Query  1205  VAAEVRTRLFPLL--EFYGE-NRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V  E+ +RL P+      GE N+E VLD QD+LRRFSFDNICK SFG+DPGCL  SLPVS
Sbjct  156   VNEEIHSRLLPIAVSTARGEMNKEKVLDLQDILRRFSFDNICKISFGLDPGCLLPSLPVS  215

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
               A AFDLASKLSAERA+T+SP VW+ KRLL IGSEK+L EAI ++N++A+ MI+Q+R+ 
Sbjct  216   DLADAFDLASKLSAERAMTSSPCVWQAKRLLGIGSEKRLKEAIKVVNDVADGMIKQRREM  275

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    ++DLLSRFMG +DDD  LRDIV+SFLLAGRDTIASALT FF LLS+ PEV  RIR
Sbjct  276   G-FNSRNDLLSRFMGSVDDDAYLRDIVVSFLLAGRDTIASALTGFFSLLSKSPEVEARIR  334

Query  677   AESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRK  498
              E G   EP     T++QIR+M+YL  A+HESMRLFPP+QFDSKF   DD LPDGTFVRK
Sbjct  335   EEVGPGPEP----PTFEQIREMHYLNGAVHESMRLFPPIQFDSKFAKEDDVLPDGTFVRK  390

Query  497   GTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             G+RVTYHPYAMGRM++IWG DC +F+PERWL DGVF     +KYPVFQAG RVCLGKD+A
Sbjct  391   GSRVTYHPYAMGRMENIWGPDCLQFRPERWLRDGVFVPPCPFKYPVFQAGVRVCLGKDLA  450

Query  317   LVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             L EMKSV VALIR FDI VV E  Q  R+APGLTAT+RGGL VR+ +R
Sbjct  451   LTEMKSVVVALIRRFDIRVV-EPDQELRFAPGLTATLRGGLPVRVFER  497



>ref|XP_007027680.1| Cytochrome P450 94A1 [Theobroma cacao]
 gb|EOY08182.1| Cytochrome P450 94A1 [Theobroma cacao]
Length=538

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/461 (65%), Positives = 372/461 (81%), Gaps = 5/461 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C CEIC AYL SSW+ +  NLCDWY+ LL  SP  TIH+HVLGN ITANP NVEYML
Sbjct  39    KLWCNCEICSAYLASSWSRQFENLCDWYTHLLKNSPGKTIHIHVLGNTITANPDNVEYML  98

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              + F+NFPKGK F+ ILGD LGRGIF VDGD W+FQ+KMAS E G  SIRSYAFEI+  E
Sbjct  99    KSNFDNFPKGKPFSMILGDFLGRGIFNVDGDSWRFQKKMASLELGKQSIRSYAFEIINCE  158

Query  1193  VRTRLFPLLEFY--GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             +  RL PLL     G+ + VLD QDV RRFSFD+IC+FSFG+DP CL+LSLP+SKFA AF
Sbjct  159   IIDRLIPLLSSVATGKEQRVLDLQDVFRRFSFDSICRFSFGLDPRCLELSLPMSKFATAF  218

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+TASP VWK+KR+LNIGSEK+L +A+ +IN LA+E+I Q+RK G     
Sbjct  219   DLASKLSAERAMTASPLVWKIKRMLNIGSEKQLKKAVKIINILAKEVIRQRRKMGFL-TH  277

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM  ++D+  LRDIVISFLLAGRDT+AS LTS FWLL++HP+V   IR E+ R+
Sbjct  278   NDLLSRFMCTVNDETYLRDIVISFLLAGRDTVASGLTSLFWLLAKHPKVGSAIRQEADRV  337

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             +  +Q++ +++Q+++++YL AA++ESMRL+PP+QFDSKFC  DDTLPDG+F+++GTRVTY
Sbjct  338   IGQNQEMTSFEQMKELHYLQAAVYESMRLYPPIQFDSKFCQEDDTLPDGSFLKRGTRVTY  397

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGR++ IWG DC EFKPERWL +GVF  EN +KYPVFQAG RVCLGK+MALVE+KS
Sbjct  398   HPYAMGRIEEIWGPDCLEFKPERWLRNGVFSPENPFKYPVFQAGFRVCLGKEMALVELKS  457

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             VA++L+R F IE+V   R  PR++PGLTAT  GGL V +TD
Sbjct  458   VALSLVRRFQIELVAPHR-TPRFSPGLTATFSGGLPV-LTD  496



>ref|XP_004249445.1| PREDICTED: cytochrome P450 94C1-like [Solanum lycopersicum]
Length=497

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/459 (64%), Positives = 371/459 (81%), Gaps = 1/459 (0%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             ++K  C CEIC AY+T+SW+ +  NLCDWY+ LL +SPT TIH+HVLGN+IT+N  NVEY
Sbjct  35    RVKLWCNCEICHAYITTSWSSQFINLCDWYTHLLKESPTRTIHIHVLGNIITSNTQNVEY  94

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+N+PKGK F++ILGD LGRGIF VDGDLW+FQ++M+S E G VSIRSYAFE+V 
Sbjct  95    MLKTRFDNYPKGKTFSTILGDFLGRGIFNVDGDLWRFQKRMSSLELGKVSIRSYAFEVVK  154

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+  RL PLL  Y +   VLDFQDV RRFSFD IC+FSFG+DP CL+ SLP+S+FA +F
Sbjct  155   NEIDKRLVPLLHEYKQGGGVLDFQDVFRRFSFDCICRFSFGLDPKCLESSLPMSQFALSF  214

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSA+RA+T SP VWK+KR  NIGSEK+L EAI +IN LA+E+I QKRK   + + 
Sbjct  215   DLASKLSAKRAMTTSPIVWKIKRFFNIGSEKELREAIKVINILAQEVIRQKRKLAFS-NH  273

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLSRFMG I D+  LRDIVISFLLAGRDTIASALTSFF+++  +P+V   IR E+ R+
Sbjct  274   RDLLSRFMGSISDETYLRDIVISFLLAGRDTIASALTSFFYVIGNNPQVAKAIREEANRV  333

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + P++DL +Y+Q+ +++YL A ++ESMRL+PP+QFDSKFCL DD L DGTFV+KGTRVTY
Sbjct  334   LGPNEDLTSYEQMSELHYLQACVYESMRLYPPIQFDSKFCLEDDFLLDGTFVKKGTRVTY  393

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM+ +WG D  EFKP+RWL+DGVF  EN +KYPVFQAG RVCLGK+MALVE+KS
Sbjct  394   HPYAMGRMEELWGCDALEFKPQRWLKDGVFVQENPFKYPVFQAGLRVCLGKEMALVEVKS  453

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             VA++L+R F +E+       PR++PGLTA+ +GGL V +
Sbjct  454   VALSLLRRFHVELAQPYHHNPRFSPGLTASFKGGLLVSV  492



>ref|XP_004506151.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=505

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/467 (64%), Positives = 374/467 (80%), Gaps = 5/467 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S++KP C C  CK+YLT +W+   +NLCD+Y+ LL  S TGTIH+HVL N IT+NP NV
Sbjct  35    ISRIKPWCNCNTCKSYLTMNWSKNFTNLCDYYTHLLQNSRTGTIHIHVLANTITSNPQNV  94

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L T F N+PKGK F++ILGDLLGRGIF  DGD WKFQRKMAS E GSV+IRSYA E+
Sbjct  95    EHILKTNFNNYPKGKPFSAILGDLLGRGIFNADGDSWKFQRKMASLELGSVAIRSYAMEL  154

Query  1205  VAAEVRTRLFPLLEFYGENREV-LDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V  E++TRL P++    EN E  LD QD+LRRFSFDNICKFSFG+DP CL  SLPVS  A
Sbjct  155   VTEEIKTRLIPIIATNIENNETCLDLQDILRRFSFDNICKFSFGLDPCCLVPSLPVSNLA  214

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFDLASKLSAERA+TASP +WK+KR  N+GSEKKL E+I ++N+L  EMI+Q+R+ G  
Sbjct  215   NAFDLASKLSAERAMTASPLIWKMKRFFNVGSEKKLRESIKVVNDLTNEMIKQRREIG-F  273

Query  848   RDQSDLLSRFMGI--IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
               ++DLLSRFMG   ++DD+ LRDIV+SFLLAGRDTIASALT FF LLS++P V  +IR 
Sbjct  274   DSRNDLLSRFMGSLNVNDDEYLRDIVVSFLLAGRDTIASALTGFFILLSKNPNVEAKIRV  333

Query  674   ESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
             E  R+M+P  + AT++Q R+M+Y+TAAI+ESMRLFPP+QFDSK+ + DD LPDGT VRKG
Sbjct  334   ELDRVMDPVHECATFEQTREMHYVTAAIYESMRLFPPIQFDSKYAIEDDVLPDGTLVRKG  393

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             +RVTYHPYAMGRM+ IWG DC EFKPERWL+DGVF  +  +KYPVFQAG RVCLGK++A+
Sbjct  394   SRVTYHPYAMGRMEKIWGPDCLEFKPERWLKDGVFVPKCPFKYPVFQAGLRVCLGKELAI  453

Query  314   VEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VEMKSV  AL+R FD+ VV  +R + R+APGLTAT RGGL +++ +R
Sbjct  454   VEMKSVVAALVRRFDVRVVEPNRDI-RFAPGLTATFRGGLPIKVYER  499



>ref|XP_006341239.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=615

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/464 (65%), Positives = 377/464 (81%), Gaps = 4/464 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK LCKCEIC+ Y+TSSW  + +NLCDWY+ LL KSPT TIH+HVLGN ITANP NVEY
Sbjct  148   RLKFLCKCEICQCYITSSWYPQFTNLCDWYTHLLQKSPTRTIHIHVLGNTITANPRNVEY  207

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+FENFPKGK F++ILGD LGRGIF VDGDLW+FQRKMAS E    SIRS+AF+++ 
Sbjct  208   MLKTRFENFPKGKNFSTILGDFLGRGIFNVDGDLWRFQRKMASLELRRNSIRSFAFDVMN  267

Query  1199  AEVRTRLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++ RL PLL     N+ E+LD QDV RRFSFD IC+FSFG+DP CL+LSLP+S+FA +
Sbjct  268   TEIQNRLIPLLACVANNKDEILDLQDVFRRFSFDCICRFSFGLDPKCLELSLPISQFAIS  327

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLAS+LSA+RA+  S  VWK+KR  NIGSE+KL +AI LIN LA+E+I Q+RK G + +
Sbjct  328   FDLASQLSAKRAMHVSSIVWKIKRFFNIGSERKLKKAIKLINILAQEVIRQRRKLGFS-N  386

Query  842   QSDLLSRFM-GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
               DLLSRFM G I ++  LRDIVISFLLAGRDT+ASA TS FWLL+ +P V +RIR E+ 
Sbjct  387   HKDLLSRFMQGDIVNETYLRDIVISFLLAGRDTVASASTSLFWLLAENPRVAERIRDEAN  446

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
              ++  +Q+L + +Q+RD++YL A ++ESMRL+PP+QFDSKFCL DD LPDGTFV+KGTRV
Sbjct  447   EVLGLNQELTSCEQLRDLHYLQACVYESMRLYPPIQFDSKFCLEDDFLPDGTFVKKGTRV  506

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             TYHPYAMGRM+ +WG DC EFKPERW+ +DGVF  EN YKYPVFQAG RVCLGK+MALVE
Sbjct  507   TYHPYAMGRMEELWGVDCLEFKPERWINKDGVFFQENPYKYPVFQAGVRVCLGKEMALVE  566

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +KS+A++ +R F++E+   S Q+PR++PGLTA++RGGL V + +
Sbjct  567   LKSMALSFLRRFNVELAHPSHQIPRFSPGLTASLRGGLPVFVRE  610



>ref|XP_009338687.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=581

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/471 (63%), Positives = 372/471 (79%), Gaps = 9/471 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C +C+++LTSSW     NLCDWY+ LL KSPTGTIHVHVLGN+ITANP NV
Sbjct  110   IIRLRPWCNCHVCRSFLTSSWLGSFDNLCDWYTHLLRKSPTGTIHVHVLGNIITANPENV  169

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++ T F N+PKGK F +ILGDLLGRGIF VDGD W+FQRKMAS E GSVS+RSYA EI
Sbjct  170   EHIIKTNFHNYPKGKLFTTILGDLLGRGIFNVDGDAWRFQRKMASLELGSVSVRSYAHEI  229

Query  1205  VAAEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V+ E+++RL PL        GEN  V D QD+ RRFSFDNICKFSFG+DP CL LSLP+S
Sbjct  230   VSTEIQSRLIPLFASVAGSEGEN-GVFDLQDLFRRFSFDNICKFSFGLDPECLQLSLPIS  288

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
              FA AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ MIEQ+R+ 
Sbjct  289   DFAVAFDLASKLSAERAITSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIEQRREM  348

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    Q DLLSRFM  IDDD+ LRDIV+SFLLAGRDTI+S LTS F+LL++HPEV   IR
Sbjct  349   GTFLTQKDLLSRFMANIDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIR  408

Query  677   AESGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
              E   +M P ++    A++ Q+R+++YL A ++E+MRL+PPVQFDSKFC  DD LPDGTF
Sbjct  409   EELDHVMGPTREGLATASFDQMRELHYLHAVLYETMRLYPPVQFDSKFCQEDDVLPDGTF  468

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             VR GTRVTYH YAMGRM+SIWG+DC +FKP+RW++ G F  E+ YKYP+FQ G RVCLGK
Sbjct  469   VRSGTRVTYHQYAMGRMESIWGSDCLDFKPDRWMKKGAFSPESPYKYPIFQGGERVCLGK  528

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++A++EMK VAVAL+R FDI+V+   R+ P++ PG TATV GGL VRI +R
Sbjct  529   ELAVMEMKCVAVALVRKFDIQVLDPERR-PQFVPGFTATVSGGLPVRIKER  578



>ref|XP_002533544.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF28834.1| cytochrome P450, putative [Ricinus communis]
Length=501

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/460 (65%), Positives = 365/460 (79%), Gaps = 3/460 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  C CEIC+AYLT SWT + +NLCDWY+ LL  SPT TIH+HVLGN ITANP NVEY
Sbjct  37    RLKLRCNCEICEAYLTLSWTKQFNNLCDWYAHLLKSSPTKTIHIHVLGNTITANPENVEY  96

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+N+PKGK F++ILG+ LGRGIF VDGD W+FQ+KMAS E    SIR YAFEIV 
Sbjct  97    MLKTRFDNYPKGKPFSTILGNFLGRGIFNVDGDSWRFQKKMASLELDRFSIRMYAFEIVL  156

Query  1199  AEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E+  RL PLL    G    VLD QDV RRFSFD+IC+FSFG+DP CL+ +LP+S+FA A
Sbjct  157   YEIEHRLVPLLSSVSGNEGGVLDLQDVFRRFSFDSICRFSFGLDPRCLEPTLPISEFAVA  216

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLASKLSAERA+  SP VWK+KR LN+GSEKK+ EA+ +IN LA+E+I QKR   G   
Sbjct  217   FDLASKLSAERAMVVSPLVWKIKRKLNLGSEKKMKEAMTVINILAQEVIRQKR-IMGFLS  275

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFM  ++D+  LRDIVISFLLAGRDT+ASALTS FWLL+ HPEV+  I  E+ R
Sbjct  276   HKDLLSRFMQTVNDETYLRDIVISFLLAGRDTVASALTSLFWLLANHPEVSSAILLEADR  335

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             ++ P+Q+L +Y+Q++D++YL A ++ESMRL+PP+QFDSKFC  DDTLPDGTFV +GTRVT
Sbjct  336   VLGPNQELTSYEQMKDLHYLQATVYESMRLYPPIQFDSKFCQEDDTLPDGTFVNRGTRVT  395

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+ +WG DC EFKPERWL +G F +EN +KYPVFQAG RVCLGK+MAL+E+K
Sbjct  396   YHPYAMGRMEDLWGQDCLEFKPERWLRNGTFFNENPFKYPVFQAGLRVCLGKEMALLELK  455

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             SVA++L+R F IE+    R  PR++PGLTAT  GGL V +
Sbjct  456   SVAISLLRKFHIELETSYRT-PRFSPGLTATFSGGLPVVV  494



>gb|KDP42721.1| hypothetical protein JCGZ_23661 [Jatropha curcas]
Length=515

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/464 (64%), Positives = 373/464 (80%), Gaps = 5/464 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  C CE+C AYLT SWT +  NLCDWY+ LL  SP+ TIH+HVLGN+ITANP NVEY
Sbjct  38    RLKLWCNCEVCDAYLTLSWTKQFVNLCDWYAHLLKNSPSKTIHIHVLGNIITANPENVEY  97

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+FEN+PKGK F++ILGD LG+GIF VDGDLW+FQRKMAS E    SIRSYAF+I+ 
Sbjct  98    ILKTRFENYPKGKPFSTILGDFLGQGIFNVDGDLWRFQRKMASLELDRFSIRSYAFDIIR  157

Query  1199  AEVRTRLFPLLEFYG--ENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
              E+  RL PLL+     E+R V+D QDV RRFSFD+IC+FSFG+DP CL+++LP+S FA 
Sbjct  158   FEIEDRLIPLLKSISIKEDR-VIDLQDVFRRFSFDSICRFSFGIDPRCLEITLPISDFAV  216

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLASKLSAERA+T SP +WK+KR+ N+G+EKK+ EAI LIN LA+E+I Q+RK G   
Sbjct  217   AFDLASKLSAERAMTVSPLIWKIKRMFNLGTEKKMKEAIKLINILAQEVIRQRRKMGFL-  275

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q DLLSRFM  ++DD  LRDIVISFLLAGRDT+ASALTSFFWLL+ +P+V   I  E+ 
Sbjct  276   SQKDLLSRFMHTVNDDTYLRDIVISFLLAGRDTVASALTSFFWLLANYPQVRLAILDEAD  335

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             +++  +Q+L ++QQ+RD++YL AA++ESMRL+PP+QFDSKFC  DD LPDGTFV+KGTRV
Sbjct  336   KVLGLNQELKSFQQLRDLHYLQAAVYESMRLYPPIQFDSKFCEEDDFLPDGTFVKKGTRV  395

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             TYHPYAMGR++ IWG DC EFKPERWL +DG+F  EN +KYPVFQAG RVCLGK+MAL+E
Sbjct  396   TYHPYAMGRIEEIWGQDCLEFKPERWLRDDGIFFPENPFKYPVFQAGLRVCLGKEMALLE  455

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +K VA++L+R F  +++  +   PR++PGLTAT  GGL V + +
Sbjct  456   LKCVAISLLRRFHFDLITTTYHTPRFSPGLTATFSGGLPVLVRE  499



>ref|XP_011094380.1| PREDICTED: cytochrome P450 94C1-like [Sesamum indicum]
Length=507

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/463 (64%), Positives = 370/463 (80%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +++  C CEIC+ Y+ S WT +  NLCDWY+ LL  SPT TIH+HVL N ITANP NVEY
Sbjct  40    RVRVWCNCEICQTYIESRWTTQFGNLCDWYAHLLKNSPTRTIHIHVLNNTITANPDNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGDLW+FQRKMAS E G  SIR+Y+F +V 
Sbjct  100   MLKTRFDNFPKGKPFSAILGDFLGRGIFNVDGDLWRFQRKMASLELGRTSIRAYSFRVVN  159

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+  RL PLLE      +VLD QDV RRFSFD+IC+FSFG+DP CL+LSLP+SKFA +F
Sbjct  160   QEIDQRLLPLLESVSAGNQVLDLQDVFRRFSFDSICRFSFGLDPKCLELSLPLSKFAVSF  219

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+ ASP VWK+KRLLNIGSEK+L +AI +++ LA E+I Q+RK   + DQ
Sbjct  220   DLASKLSAERAMIASPIVWKIKRLLNIGSEKQLRQAIKIVHLLAREVIRQRRKFSFS-DQ  278

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM  I D+  LRDI+ISFLLAGRD++ASALTSF WL++ H ++   I  E+ +I
Sbjct  279   NDLLSRFMSSISDETYLRDIIISFLLAGRDSMASALTSFIWLVACHQDIEAAILIEAEKI  338

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + P+QDL +Y+Q+R+++YL AAI+ESMRL+PP+QFDSKFCL DD LPDG+FV++GTRVTY
Sbjct  339   IGPNQDLTSYEQLRELHYLHAAIYESMRLYPPIQFDSKFCLEDDLLPDGSFVKRGTRVTY  398

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGV-FKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             HPYAMGRM+ IWG+DC EFKPERWL +GV F  EN +KYPVFQAG RVCLGK+MALVE+K
Sbjct  399   HPYAMGRMEEIWGSDCLEFKPERWLRNGVFFPHENPFKYPVFQAGIRVCLGKEMALVELK  458

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +VA++L+R F +E+  +    PR++PGLTAT   GL V +  R
Sbjct  459   TVAISLLRQFHVELA-QPECTPRFSPGLTATFADGLRVLVRPR  500



>ref|XP_007010240.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY19050.1| Cytochrome P450 [Theobroma cacao]
Length=502

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/462 (65%), Positives = 363/462 (79%), Gaps = 3/462 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C C+IC AYL+S+W+ E +NLCDWY+ LL KSP+ TIH+HVL N ITANP NVEYML
Sbjct  38    KIWCSCDICHAYLSSNWSKEFNNLCDWYTYLLQKSPSQTIHIHVLNNTITANPENVEYML  97

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F ++PKGK FA ILGDLLG+GIF VDGDLW FQRKMAS E  + +IR+YAFEIVA E
Sbjct  98    KTRFNDYPKGKSFAMILGDLLGKGIFNVDGDLWMFQRKMASLELANFAIRAYAFEIVATE  157

Query  1193  VRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             ++ RL PLL  F G++  VLD Q+V RRFSFDNICKFSFG+DPGCL+ SLP+S FA AFD
Sbjct  158   IKYRLLPLLSSFSGKDGSVLDLQEVFRRFSFDNICKFSFGLDPGCLESSLPISHFADAFD  217

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
             LASKLSAER +   P +WK+KR+ NIGSEKKL +AI  +N LA E+I QKRK G +    
Sbjct  218   LASKLSAERGMAPVPLLWKIKRIFNIGSEKKLKKAIEAVNGLAMEVIMQKRKLGFS-THK  276

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  I+DD  LRDIVISF+LAGRDT+ASALT+ FWLL+ HP     IR ES +  
Sbjct  277   DLLSRFMACINDDSYLRDIVISFILAGRDTMASALTTLFWLLANHPLAISEIRKESDQFR  336

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
             E +Q+ A+Y QIR M+YL A ++ES+RL+PPVQFDSKF   DD LPDGTFV+KGTRVTYH
Sbjct  337   ESNQEFASYDQIRKMHYLHATVYESLRLYPPVQFDSKFACKDDILPDGTFVQKGTRVTYH  396

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGRM+++WG+DC +FKPERWL+DG F  +  +KYPVFQAG RVCLGK++ALVEMK V
Sbjct  397   PYAMGRMENVWGSDCIKFKPERWLKDGTFCPQCPFKYPVFQAGVRVCLGKELALVEMKVV  456

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
              ++++R FDIE+V   +  P++ PGLTA VRGGL V I  RR
Sbjct  457   VLSVLRQFDIELVA-PKVAPQFDPGLTAMVRGGLQVVIRKRR  497



>ref|XP_010912256.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=508

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/461 (65%), Positives = 371/461 (80%), Gaps = 6/461 (1%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +CKAYL+SSWT E +NLCDWY+ LL +SPTGTI +HVLGN IT NP NVEYML 
Sbjct  40    PWCNCHVCKAYLSSSWTAEFANLCDWYTHLLRESPTGTIDIHVLGNTITTNPDNVEYMLK  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK F+S+LGD LGRGIF VDG+ W+FQRKMAS E GSV  RS+AF+IV+ EV
Sbjct  100   TRFDNFPKGKPFSSLLGDFLGRGIFNVDGESWQFQRKMASLELGSVYARSFAFDIVSTEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             R RL PL     E   V+D QD+ RRF+FDNICK SFG+DPGCL++SLP+S+FAAAFD A
Sbjct  160   RRRLLPLFTTVSE--RVIDLQDMFRRFAFDNICKISFGLDPGCLEVSLPMSEFAAAFDTA  217

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA RA   +PAVWK+KRLLN+GSE++L  AI ++N LA E+I Q+RK G A +  DL
Sbjct  218   SRLSAGRATAVAPAVWKLKRLLNVGSERELRRAIRMVNVLANEVIRQRRKLGFASNL-DL  276

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM--  657
             LSRFM  +DDD+ LRDIVISFLLAGRDT+AS LTSFF LLS+HPEVT  IR E   +M  
Sbjct  277   LSRFMSSVDDDRYLRDIVISFLLAGRDTVASGLTSFFLLLSKHPEVTAAIRDEIANVMRG  336

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
               D ++A+  Q+++M+Y+ AA++ESMRL+PP+QFDSKFC+ D  LPDGTFVRKGTRVTYH
Sbjct  337   SGDDEVASLNQLKEMHYVHAAMYESMRLYPPIQFDSKFCIEDAVLPDGTFVRKGTRVTYH  396

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGRM+SIWG DC +FKPERWL D  F  ++ +KY VFQAG RVCLGK+MAL+EMK+V
Sbjct  397   PYAMGRMESIWGPDCEKFKPERWLHDRKFVPQSPFKYSVFQAGLRVCLGKEMALMEMKTV  456

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V+++R+FD++V+ +  Q P++APGLTA++RGGLS R+  R
Sbjct  457   IVSVVRSFDVQVL-DGDQPPKFAPGLTASIRGGLSARVRRR  496



>gb|EYU36964.1| hypothetical protein MIMGU_mgv1a023150mg, partial [Erythranthe 
guttata]
Length=476

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/471 (64%), Positives = 367/471 (78%), Gaps = 15/471 (3%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             ++ LKP C C+ C+++LTSSW++ ++NLCDWY+ LL++SPTGTIHVHVL N+IT+NP NV
Sbjct  6     ITALKPYCSCDTCQSFLTSSWSLRYNNLCDWYTHLLSQSPTGTIHVHVLNNIITSNPKNV  65

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L T+F+N+PKGK F+++LGDLLGRGIF VDGDLWK QRKMA  E GS+SIRSYAF I
Sbjct  66    EHVLKTRFDNYPKGKPFSTLLGDLLGRGIFNVDGDLWKLQRKMAILELGSISIRSYAFGI  125

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V++E+ +RL PLL  +      +D QD+ RRFSFD+IC+FSFGMDPGCL+LSLPVS+FA 
Sbjct  126   VSSEIESRLTPLLTSFSGTDTAVDLQDIFRRFSFDSICRFSFGMDPGCLNLSLPVSEFAY  185

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK-----  861
             AFDLASKLSAERA+T  P VWK+KR  N+GSEK+L EAI  I+ELA+ +I  KR      
Sbjct  186   AFDLASKLSAERAITTPPLVWKLKRFFNVGSEKQLREAIKSIHELADGVIRHKRNQVIAA  245

Query  860   -------CGGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRH  702
                            DLLSRFMG I+DD  LRDIVISFLLAGRDT+AS+LT FF LL+ +
Sbjct  246   TAATAAAADDNFSHEDLLSRFMGTINDDVFLRDIVISFLLAGRDTVASSLTGFFLLLAEN  305

Query  701   PEVTDRIRAESGRIM-EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDT  525
             P   + IR ES R+M   +++  T+ Q+R+M YL AA+HESMRL PPVQFDSKFC  DD 
Sbjct  306   PGAVESIREESDRVMGRENKEPVTFSQLREMQYLQAAVHESMRLLPPVQFDSKFCDEDDY  365

Query  524   LPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAG  348
             L DGTFV KGTRVTYHPYAMGRM+ IWG DC EFKPERWL E+G+FK EN +KYPVFQAG
Sbjct  366   LADGTFVAKGTRVTYHPYAMGRMEKIWGGDCLEFKPERWLNENGLFKQENPFKYPVFQAG  425

Query  347   PRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             PRVCLG +MA+VEMK+VA++LIR FD  V    R  P++ PGLTATVRGGL
Sbjct  426   PRVCLGMEMAVVEMKTVALSLIRRFDFRVADPGRA-PKFVPGLTATVRGGL  475



>ref|XP_006341238.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=496

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/464 (63%), Positives = 371/464 (80%), Gaps = 4/464 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK LCKCEIC+ Y+TSSW  + +NLCDWY+ LL KSPT TIH+HVLGN ITANP NVEY
Sbjct  29    RLKFLCKCEICQCYMTSSWYPQFTNLCDWYTHLLQKSPTRTIHIHVLGNTITANPKNVEY  88

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGDLW+FQRKMAS E    SIRS+AF+++ 
Sbjct  89    MLKTRFDNFPKGKNFSTILGDFLGRGIFNVDGDLWQFQRKMASLELRRNSIRSFAFDVMN  148

Query  1199  AEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E++ RL PLL     N++ +LD QDV RRFSFD IC+FSFG+DP CL+LSLP+S+FA +
Sbjct  149   NEIQNRLIPLLACVANNKDKILDLQDVFRRFSFDCICRFSFGLDPKCLELSLPISQFAIS  208

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLAS+LSA+RA+  S  VWK+KR  NIGSE+KL +AI LIN LA+E+I Q+RK G + +
Sbjct  209   FDLASQLSAKRAMHVSSIVWKIKRFFNIGSERKLKKAIKLINILAQEVIRQRRKLGFS-N  267

Query  842   QSDLLSRFM-GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
               DLLSRFM G I ++  LRDIVISFLLAGRDT+AS  TS FWLL+ +P V +RIR E+ 
Sbjct  268   HKDLLSRFMQGDIVNETYLRDIVISFLLAGRDTVASTSTSLFWLLAENPRVAERIREEAN  327

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
              ++  +Q+L + +Q+RD++YL A ++ESMRL+PP+QFDSKFCL DD LPDGTFV+KGTRV
Sbjct  328   EVLGLNQELTSCEQLRDLHYLQACVYESMRLYPPIQFDSKFCLEDDFLPDGTFVKKGTRV  387

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             TYHPYAMGRM+ +WG DC EFKPERW+ +DGVF  EN YKYPVFQAG RVCLGK+MALVE
Sbjct  388   TYHPYAMGRMEELWGVDCLEFKPERWINKDGVFFQENPYKYPVFQAGVRVCLGKEMALVE  447

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +KS+ ++ +R F +E+   S  +PR++PGLTA+  GGL V + +
Sbjct  448   LKSMTLSFLRRFHVELAHPSHHIPRFSPGLTASFCGGLPVFVRE  491



>ref|XP_010097640.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC43583.1| Cytochrome P450 94A1 [Morus notabilis]
Length=508

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/462 (64%), Positives = 369/462 (80%), Gaps = 14/462 (3%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC  YLTSSWT + +NLCDWYS LL+KSPT TIH+HVLGN++TANP NVEYML T+
Sbjct  36    CNCEICHVYLTSSWTKQFANLCDWYSHLLSKSPTKTIHIHVLGNIVTANPNNVEYMLKTR  95

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+NFPKGK F++ILGD LG GIF VDGD W+FQRKMA  E    SIRS+AFEIV  E+ +
Sbjct  96    FDNFPKGKPFSAILGDFLGHGIFNVDGDSWRFQRKMARLELDRYSIRSFAFEIVNNEIES  155

Query  1184  RLFPLLEFYGE---------NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKF  1032
             RL PLL  +           N  VLD QDV RRFSFD+IC+FSFG+DP CL++S+P+S+F
Sbjct  156   RLIPLLSSFSAGKSVSGFDGNGGVLDLQDVFRRFSFDSICRFSFGLDPMCLEMSVPLSEF  215

Query  1031  AAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGG  852
             A +FDLAS+LSAERA+TASP VWKVKRLLN+GSEK+L  AI ++N LA+E+I QKRK G 
Sbjct  216   AVSFDLASRLSAERAMTASPLVWKVKRLLNLGSEKQLKVAINVVNMLAKEVIRQKRKMGF  275

Query  851   ARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             + +  DLLSRFM  ++D+  LRDIV+SFLLAGRDTIASALTSFFWL+  HP+V   I AE
Sbjct  276   S-NHMDLLSRFMRTVNDESYLRDIVVSFLLAGRDTIASALTSFFWLVVNHPDVEAAICAE  334

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             + R++ P+++L  ++Q++ ++YL AAI+ESMRL+PP+QFDSKFCL DD LPDGT V++GT
Sbjct  335   ADRVIGPNRNLKNFEQVQKLHYLKAAIYESMRLYPPIQFDSKFCLYDDVLPDGTVVKRGT  394

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             RVTYHPYAMGR++ IWG+D  EFKPERWL  DGVF+ EN +KYPVFQAG RVCLGK+MA+
Sbjct  395   RVTYHPYAMGRLEEIWGSDFMEFKPERWLRNDGVFRQENPFKYPVFQAGLRVCLGKEMAM  454

Query  314   VEMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGG  198
             VE+KSVA+AL+R F+I++     Q    PR++PGLTAT  GG
Sbjct  455   VELKSVALALLRRFEIKLATPPSQRHTQPRFSPGLTATFSGG  496



>ref|XP_002319770.2| hypothetical protein POPTR_0013s07310g [Populus trichocarpa]
 gb|EEE95693.2| hypothetical protein POPTR_0013s07310g [Populus trichocarpa]
Length=512

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/461 (63%), Positives = 360/461 (78%), Gaps = 2/461 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYL  SW     NLCDWY+ LL  SPT TI +HVLGN+ITANP N++YML T+
Sbjct  42    CNCEICDAYLNLSWAKSFDNLCDWYAHLLKHSPTKTIPIHVLGNIITANPENIKYMLKTR  101

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F+ ILGD LGRGIF VDGD+W+FQ+ MAS E   +SIRS AFEIV  E+  
Sbjct  102   FDNYPKGKPFSLILGDFLGRGIFNVDGDMWRFQKNMASLELDRLSIRSNAFEIVRCEIEK  161

Query  1184  RLFPLL-EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL PLL  F G+   +LD QDV RRFSFD+IC+FSFG+DP CL LSLP+S+FA AFDLAS
Sbjct  162   RLLPLLVSFSGKEDGILDLQDVFRRFSFDSICQFSFGLDPKCLQLSLPMSEFAVAFDLAS  221

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             K SAERA+  SP VWK+KR LNIGSEKK+ EAI +I+ LA+E++ QKR   G     DLL
Sbjct  222   KFSAERAMAVSPLVWKIKRKLNIGSEKKMKEAIKIIDILAQEVMRQKR-VKGFSTHKDLL  280

Query  827   SRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD  648
             SRFM  +DDD  LRDIVISFLLAGRDT+ASALTSFFWLL++HPE+   I+ E+ R++ P+
Sbjct  281   SRFMRTVDDDTYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEIGSAIQVEADRVLGPN  340

Query  647   QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYA  468
             Q+  ++++I+ ++YL AA+HESMRL+PP+QFDSKFC  DD LPDGTFV++GTRVTYHPYA
Sbjct  341   QEPKSFEEIQQLHYLQAAVHESMRLYPPIQFDSKFCQQDDVLPDGTFVKRGTRVTYHPYA  400

Query  467   MGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVA  288
             MGRM+ IWG DC EFKPERWL DGVF SEN YKYP+FQ G RVCLGKDMAL+E+KSV ++
Sbjct  401   MGRMEEIWGPDCLEFKPERWLRDGVFFSENPYKYPIFQGGFRVCLGKDMALMEIKSVCLS  460

Query  287   LIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             L++ F  ++V      PR++PGLT+T R GL V + ++  Q
Sbjct  461   LLQRFHFKLVFPCHSTPRFSPGLTSTFRDGLLVLVREKVTQ  501



>ref|XP_011077931.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1-like [Sesamum 
indicum]
Length=501

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/458 (65%), Positives = 361/458 (79%), Gaps = 11/458 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C+IC++Y+ S W ++  NLCDWY+ LL  SPT TIH+HVL N ITANP NVEYML T+
Sbjct  42    CTCDICQSYIESRWAVQFPNLCDWYAHLLRNSPTRTIHIHVLNNTITANPDNVEYMLKTR  101

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+NFPKGK F++ILGD LGRGIF VDGD W+FQRKMAS E G VSI ++AFE+V  E+  
Sbjct  102   FDNFPKGKPFSAILGDFLGRGIFNVDGDSWRFQRKMASLELGRVSIGAFAFEVVHQEIDR  161

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PL+E      EVLD QDV RRFSFD IC+FSFG+DP CL+LSLP+S+FA +FDLASK
Sbjct  162   RLIPLMESVSGGEEVLDLQDVFRRFSFDCICRFSFGLDPKCLELSLPLSEFAVSFDLASK  221

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSAERA+TASP VWK+KRLLNIGSE+K+  AI +IN LA E+I Q+RK G + DQ DLLS
Sbjct  222   LSAERAMTASPLVWKIKRLLNIGSERKIRRAIKIINVLAHEVIRQRRKFGFS-DQKDLLS  280

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFM  I DDK LRDIVISFLLAGRDT+ASALT+FFWL+SRHPEV   I           Q
Sbjct  281   RFMSSISDDKYLRDIVISFLLAGRDTVASALTTFFWLVSRHPEVEAAIL---------HQ  331

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
              L +++Q+R+++YL A+++ESMRL+PP+QFDSKFC  DD LPDG+FV++GTRVTYHPYAM
Sbjct  332   XLTSHEQMRELHYLHASVYESMRLYPPIQFDSKFCSEDDVLPDGSFVKRGTRVTYHPYAM  391

Query  464   GRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVAL  285
             GRM+ IWG DC EF+PERWL DGVF  EN +KYPVFQAG RVCLGK+MALVE+KSVA+ L
Sbjct  392   GRMEEIWGPDCSEFRPERWLRDGVFWPENPFKYPVFQAGIRVCLGKEMALVELKSVAITL  451

Query  284   IRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +R + +E +   +  PR++PGLTAT   GL  RI  R+
Sbjct  452   LRRYRLE-LAHPQPTPRFSPGLTATYGDGLRARIHPRQ  488



>ref|XP_008371286.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=501

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/469 (63%), Positives = 378/469 (81%), Gaps = 9/469 (2%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +L+P C C IC+++L+SSW+    NLCDWY+ LL KS +GTIHVHVLGN+ITANP NVE+
Sbjct  33    RLRPWCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENVEH  92

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ++ T F N+PKGK F +ILGDLLGRGIF VDG+ W+FQRKMAS E GSVS+RSYA EIV+
Sbjct  93    IINTNFHNYPKGKLFTTILGDLLGRGIFNVDGNGWRFQRKMASLELGSVSVRSYALEIVS  152

Query  1199  AEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKF  1032
             AE+++RL PLL       GEN  V+D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S F
Sbjct  153   AEIQSRLIPLLASVAGNEGEN-GVVDLQDLFRRFSFDNICKFSFGLDPGCLQLSLPISDF  211

Query  1031  AAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGG  852
             A AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ MI+Q+R+ G 
Sbjct  212   AVAFDLASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSMIKQRREMGT  271

Query  851   ARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
                Q DLLSRFM  +DDD+ LRDIV+SFLLAGRDTI+S LTS F+LL++HPEV   IR E
Sbjct  272   FSTQKDLLSRFMANMDDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLAKHPEVKREIREE  331

Query  671   SGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
               ++M P ++    A++ Q+R+M+YL A ++E+MRL+PP+QFDSKFC  DD LPDGTFVR
Sbjct  332   MDQVMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTFVR  391

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDM  321
              GTRVTYH YAMGRM+SIWG+DC +FKP+RWL+ G+F  E+ YKYP+FQ G RVCLGK++
Sbjct  392   SGTRVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGKEL  451

Query  320   ALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             A++EMK VAVAL+R FDI+++ E  +  ++ PGLTATVRGGL VRI +R
Sbjct  452   AVMEMKCVAVALVRRFDIQIL-EPERRXQFVPGLTATVRGGLPVRIEER  499



>ref|XP_010932013.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=509

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/462 (63%), Positives = 369/462 (80%), Gaps = 4/462 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             +P C C +CKAYL+SSWT E +NLCDWY+ LL +SPT TIH+HVL N +TA+PANVEYML
Sbjct  40    RPWCNCHVCKAYLSSSWTAEFTNLCDWYTHLLRQSPTRTIHIHVLDNTVTADPANVEYML  99

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+NFPKGK F+SILGDLLGRGIF VDGD W+FQRKMAS E GS+S+RS+AF IV+ E
Sbjct  100   QTRFDNFPKGKPFSSILGDLLGRGIFNVDGDTWQFQRKMASLELGSLSVRSHAFRIVSTE  159

Query  1193  VRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDL  1014
             VR RL PLL     +  V+D QDV RR +FDNICK SFG+DPGCL+ SLP+S+FAAAFD 
Sbjct  160   VRRRLIPLLTSASSDGRVIDLQDVFRRLAFDNICKISFGLDPGCLEASLPISEFAAAFDT  219

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             AS+LSA RA   +PA+WK+KR+LN+GSE++L   IGL+N LA+E+I QKRK G A    D
Sbjct  220   ASRLSARRATAVAPALWKLKRILNVGSERELRRVIGLVNVLADEVIRQKRKHGVA-SSDD  278

Query  833   LLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             LLSRFM  ++DD+ LRDI ISFLLAGRDT+AS LTSFF LLS+HP VT  IR E   +M 
Sbjct  279   LLSRFMCSVNDDRYLRDITISFLLAGRDTVASGLTSFFLLLSKHPAVTAAIRDEIADVMR  338

Query  653   --PDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                D ++A+ +Q+++M+Y+ AA++E++R++PPVQFDSK+C+ DDTLPDG+ VRKGTRVTY
Sbjct  339   GTGDDEVASLEQLKEMHYVHAAMYETLRVYPPVQFDSKYCVEDDTLPDGSLVRKGTRVTY  398

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM+SIWG DC EFKPERWL DG F   + +KYPVFQAG RVCLGK+MAL+EMK+
Sbjct  399   HPYAMGRMESIWGPDCEEFKPERWLRDGKFVPASPFKYPVFQAGVRVCLGKEMALMEMKT  458

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             + V+++  FD++V+   R  P++A GLTA++ GGL  ++  R
Sbjct  459   IVVSVVPRFDVQVLDVGRS-PKFAAGLTASIDGGLPAQVRRR  499



>ref|XP_010067149.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW65215.1| hypothetical protein EUGRSUZ_G02702 [Eucalyptus grandis]
Length=512

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/464 (62%), Positives = 368/464 (79%), Gaps = 3/464 (1%)
 Frame = -1

Query  1562  SKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVE  1383
             S+ + LC+C IC +Y TSSW  E  NLCDWY+ LL KSP+ TIH+HVLGNVITANP  VE
Sbjct  42    SRRRLLCRCHICDSYRTSSWANEFDNLCDWYTHLLKKSPSQTIHIHVLGNVITANPVVVE  101

Query  1382  YMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIV  1203
             YML T+F N+PKGK F+ ILGD LG+GIF VDGD W FQRKMAS E GS++IRS+A++ V
Sbjct  102   YMLKTRFNNYPKGKPFSMILGDFLGKGIFNVDGDWWMFQRKMASLELGSIAIRSHAYKTV  161

Query  1202  AAEVRTRLFPLLEFYGEN-REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
               E+ TRL PLL    E+ +++LD QDV +RFSFDNIC FSFG+DPGCL+ S+P+S FA 
Sbjct  162   TKEIETRLLPLLSAAAEDGKKILDLQDVFQRFSFDNICNFSFGVDPGCLESSMPISSFAE  221

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             +F+LA+KLSAERA+  +P VWK+KRLLN+GSEKKL +AI ++  LA+++I QKRK G + 
Sbjct  222   SFNLATKLSAERALAITPLVWKMKRLLNVGSEKKLNDAIKVVKVLAKDVISQKRKLGFSN  281

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q DLLSRFM  ++DDK L DIVISF+LAG+DT+ASAL++FFWLL +HPE   RIR+E+ 
Sbjct  282   HQ-DLLSRFMACVNDDKFLVDIVISFILAGQDTMASALSAFFWLLGKHPETVSRIRSEAK  340

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
              +M+ DQ+ A+++QIR ++YL A ++ES+RL PP+QFDSKF L DD LPDGT V++GTRV
Sbjct  341   EVMDGDQEFASFEQIRGLHYLHAVVYESLRLLPPIQFDSKFALKDDVLPDGTTVKEGTRV  400

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYHPYAM RMD IWG DC +FKPERW+E+G F   N YKYPVFQAG RVCLGK+MA+VEM
Sbjct  401   TYHPYAMARMDQIWGPDCMKFKPERWIENGKFCPPNAYKYPVFQAGSRVCLGKEMAIVEM  460

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K VA++++R FDI VV  +   PR++PGLTA ++GG+ V +  +
Sbjct  461   KIVALSVLRKFDITVVSPASG-PRFSPGLTAIMKGGVKVLVKKK  503



>ref|XP_008241266.1| PREDICTED: cytochrome P450 94C1-like [Prunus mume]
Length=497

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/465 (63%), Positives = 371/465 (80%), Gaps = 6/465 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AY+TS W+++  NLCDWY+ LL  SPT TIH+HVL N ITANP NVEYML T+
Sbjct  30    CNCEICHAYVTSCWSLKFDNLCDWYAHLLRDSPTKTIHIHVLRNTITANPENVEYMLKTR  89

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F++ILGD LG+GIF VDG  W+FQRKMAS E G  S+RS+AFEIV+ E+  
Sbjct  90    FENYPKGKPFSAILGDFLGQGIFNVDGHSWRFQRKMASLELGRHSVRSFAFEIVSHEIER  149

Query  1184  RLFPLLEFYGENRE----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             RL PLL  +  + +    VLD QDV +RFSFD+ICKFSFG+DP CL+LSLP+SKFA AFD
Sbjct  150   RLIPLLSSFSSSDDGGGSVLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSKFAVAFD  209

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
             +AS+LSA+RA+TASP +WK+KR+ N+GSEK+L E+I +I+ LA+E+I +KR+ G +  Q 
Sbjct  210   MASQLSAKRAMTASPLIWKIKRIFNLGSEKQLKESINMIDLLAKEVIARKRETGFS-TQK  268

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  ++D+  LRDIVISFLLAGRDT+ASALTSFFWL+  HP V   +R E+ R++
Sbjct  269   DLLSRFMRSVEDETYLRDIVISFLLAGRDTVASALTSFFWLMGTHPTVASAVRVEADRVL  328

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
              P+Q L  ++Q+ +++YL AAI+ESMRLFPP+QFDSKFC  DD LPDGTFVRKGTRVTYH
Sbjct  329   GPNQGLKNFEQMHELHYLQAAIYESMRLFPPIQFDSKFCAQDDVLPDGTFVRKGTRVTYH  388

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR+  IWG+DC EFKPERWL+D VF +E+ +KYPVFQ G RVCLGK+MAL+EMK+V
Sbjct  389   PYAMGRIQDIWGSDCMEFKPERWLKDSVFFTEDPFKYPVFQPGLRVCLGKEMALMEMKTV  448

Query  296   AVALIRAFDIE-VVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             A++L+R F+I  V  E  ++PR++PGLTAT   GL V + + + Q
Sbjct  449   ALSLLRRFNIHPVTHELGRVPRFSPGLTATFSDGLPVLVREMKTQ  493



>gb|KCW87400.1| hypothetical protein EUGRSUZ_B03878 [Eucalyptus grandis]
Length=500

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/466 (66%), Positives = 367/466 (79%), Gaps = 4/466 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V  + PLC C++C +YL+SSW+ E  NLCDWY+ LL  SPTGTIHVHVL N ITANP NV
Sbjct  31    VLAVAPLCSCDVCASYLSSSWSSEFPNLCDWYTHLLRSSPTGTIHVHVLRNTITANPVNV  90

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++  +F+N+PKGK F +ILGDLLGRGIF  DG+ W+FQRKMAS E GSVS+R+YAF+I
Sbjct  91    EHIVRARFDNYPKGKPFNAILGDLLGRGIFNADGESWRFQRKMASLELGSVSVRAYAFDI  150

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V  E+ TRL PLL        V D QDV RRFSFD+ICKFSFG+DPGCL LSLPVS FA 
Sbjct  151   VRGEIETRLVPLLASRMGCGNV-DLQDVFRRFSFDSICKFSFGLDPGCLQLSLPVSSFAL  209

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFDLAS+LSAERA   S  VWK KRLLN+GSE++L +AI L+N LAEE+I Q+R+ G   
Sbjct  210   AFDLASRLSAERAAHVSHGVWKAKRLLNVGSERRLRDAIKLVNALAEEVIRQRRRLGSFA  269

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              ++DLLSRFMG +DDD  LRDIVISFLLAGRDT+ASALT FFWLLSR+PEV   IR ES 
Sbjct  270   TRNDLLSRFMGTVDDDVYLRDIVISFLLAGRDTVASALTGFFWLLSRNPEVERLIRGESD  329

Query  665   RIMEPDQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
              +M       LA+++Q++ M+YL AA+HESMRLFPPVQFDSKF   DD LPDGT V  GT
Sbjct  330   LVMGSSAGDVLASFEQMQHMHYLHAAVHESMRLFPPVQFDSKFASADDMLPDGTAVGGGT  389

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM  IWG DC EF+PERWL+DGVF+ E+LYK+PVFQAGPR CLGK+MA+V
Sbjct  390   RVTYHPYAMGRMQRIWGPDCLEFRPERWLQDGVFRPESLYKFPVFQAGPRACLGKEMAVV  449

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             EMKSVA+AL+R FD+ VV   +Q  R++PGLTAT+ GGL V + +R
Sbjct  450   EMKSVALALVRRFDVRVVGTDQQA-RFSPGLTATMSGGLPVIVQER  494



>ref|XP_007203184.1| hypothetical protein PRUPE_ppa025166mg, partial [Prunus persica]
 gb|EMJ04383.1| hypothetical protein PRUPE_ppa025166mg, partial [Prunus persica]
Length=478

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 368/465 (79%), Gaps = 6/465 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AY+TS W+++  NLCDWY+ LL  SPT TIH+HVL N ITANP NVEYML T+
Sbjct  11    CNCEICHAYVTSCWSLKFDNLCDWYAHLLRDSPTKTIHIHVLRNTITANPENVEYMLKTR  70

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F++ILGD LG+GIF VDG  W+FQRKMAS E    S+RS+AFEIV+ E+  
Sbjct  71    FENYPKGKPFSAILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSFAFEIVSHEIEH  130

Query  1184  RLFPLLEFYGENRE----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             RL PLL  +  + +    VLD QDV +RFSFD+ICKFSFG+DP CL+LSLP+SKFA AFD
Sbjct  131   RLIPLLSSFSSSHDGGGSVLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSKFAVAFD  190

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
             +AS+LSA+RA+TASP +WK+KR+ N+GSEK+L E+I +I+ LA+E+I +KR+ G +  Q 
Sbjct  191   MASQLSAKRAMTASPLIWKIKRIFNLGSEKQLKESINMIDLLAKEVIARKRETGFS-TQK  249

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  ++D+  LRDIVISFLLAGRDT+ASALTSFFWL+  HP     +R E+ R++
Sbjct  250   DLLSRFMRSVEDETYLRDIVISFLLAGRDTVASALTSFFWLMGTHPAAASAVRVEADRVL  309

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
              P+Q L  ++Q+ +++YL AAI+ESMRLFPP+QFDSKFC  DD LPDGT VRKGTRVTYH
Sbjct  310   GPNQGLKNFEQMHELHYLQAAIYESMRLFPPIQFDSKFCAQDDVLPDGTSVRKGTRVTYH  369

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR+  IWG+DC EFKPERWL+D VF +E+ +KYPVFQ G RVCLGK+MAL+EMK+V
Sbjct  370   PYAMGRIQDIWGSDCMEFKPERWLKDSVFFTEDPFKYPVFQPGLRVCLGKEMALMEMKTV  429

Query  296   AVALIRAFDIE-VVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             A++L+R F I  V  E  ++PR++PGLTAT   GL V + +R+ Q
Sbjct  430   ALSLLRRFSIHPVTHELSRVPRFSPGLTATFSDGLPVLVRERKTQ  474



>ref|XP_010049665.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
 gb|KCW89218.1| hypothetical protein EUGRSUZ_A01523 [Eucalyptus grandis]
Length=496

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/462 (64%), Positives = 370/462 (80%), Gaps = 4/462 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +++ K  C CEIC+ YL+  W+  + NLCDWY+ LL  SPT T+H+HVLGN IT NP NV
Sbjct  35    LARPKLWCNCEICQTYLSLGWSKSYVNLCDWYAHLLRSSPTKTVHIHVLGNTITGNPDNV  94

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+FENFPKGK F++ILGD LG+GIF VDGD WKFQ+KMA+ E    +IRSYAFEI
Sbjct  95    EYMLKTRFENFPKGKPFSTILGDFLGQGIFNVDGDSWKFQKKMANLELDRFAIRSYAFEI  154

Query  1205  VAAEVRTRLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V  E+  RL  L     G+   VLD QDV +RFSFD IC+FSFG+DP CL+LSLP+S+FA
Sbjct  155   VKCEIENRLVALFSSVAGQEGGVLDLQDVFKRFSFDCICRFSFGLDPRCLELSLPMSEFA  214

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              +FDLASKLSAERA+ ASP VWK+KR  NIGSEK+L EAI +IN LA E+I+QKRK G +
Sbjct  215   LSFDLASKLSAERAMEASPLVWKIKRAFNIGSEKRLKEAINMINILALEVIKQKRKIGFS  274

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
              +  DLLSRFM  + D+  LRDI++SFLLAGRDT+ASALTSFFWL++++P+V  +I AE 
Sbjct  275   -NHRDLLSRFMCTVSDETYLRDIIVSFLLAGRDTVASALTSFFWLIAKNPQVLSKIHAEL  333

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
              R+M  DQ+L +Y QIR++ YL AAI+ESMRL+PP+QFDSKFC ++D LPDGTFV++GTR
Sbjct  334   DRVMG-DQELVSYDQIRELPYLQAAIYESMRLYPPIQFDSKFCEDNDILPDGTFVKRGTR  392

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYHPYAMGR++ IWG DC E+KPERWL++G+F +EN YKYPVFQAG RVCLGK+MAL+E
Sbjct  393   VTYHPYAMGRIEDIWGPDCLEYKPERWLKNGIFFAENPYKYPVFQAGLRVCLGKEMALLE  452

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             +KSVAV+L+R F IE+V    Q+ R++PGLTAT+RGGL V +
Sbjct  453   LKSVAVSLLRRFQIELVTPD-QVIRFSPGLTATIRGGLPVVV  493



>ref|XP_009366644.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=512

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/464 (62%), Positives = 369/464 (80%), Gaps = 7/464 (2%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
             LC CEIC+ YLTSSW+++  NLCDWY+ LL  SP+ TIH+HVL N ITANP NVEY+L T
Sbjct  43    LCSCEICQIYLTSSWSLKFINLCDWYAHLLRDSPSKTIHIHVLKNTITANPENVEYILKT  102

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             +FEN+PKGK F++ILGD LG+GIF VDG  W+FQRKMAS E    S+RSYA+EIV  E+ 
Sbjct  103   RFENYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAYEIVNHEIE  162

Query  1187  TRLFPLLEFYGENRE-----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              RL PLL     N +     VLD QDV +RFSFD+ICKFSFG+DP CL+LS+P+SKF  A
Sbjct  163   HRLIPLLSSVCSNSDNGNGVVLDLQDVFKRFSFDSICKFSFGLDPMCLELSMPLSKFTVA  222

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FD+ASKLSAERA+T SP +WK+KR+LN+GSEK+L E+I +I+ LA+E+I +KR+ G +  
Sbjct  223   FDMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINIIDGLAKEVIARKREVGFS-T  281

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             Q DLLSRFM  ++D+  LRDIV+SFLLAGRDT+ASALTSFFWL+  HP V   I  E+ R
Sbjct  282   QKDLLSRFMRSVEDESYLRDIVVSFLLAGRDTVASALTSFFWLIGTHPNVASAILLEADR  341

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             ++  +Q L ++ Q+++++YL +AI+ESMRL+PPVQFDSKFC  DD LPDGTFVRKGTRVT
Sbjct  342   VLGLNQGLKSFDQMQELHYLQSAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKGTRVT  401

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR+  IWG+DC EFKP+RWL+DGVF +EN ++YPVFQ G RVCLGK+MA++EMK
Sbjct  402   YHPYAMGRIQEIWGSDCMEFKPDRWLKDGVFFTENPFQYPVFQPGHRVCLGKEMAVMEMK  461

Query  302   SVAVALIRAFDIE-VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +V ++L+R F+IE    ES  +PR++PGLTAT+ GGL V + +R
Sbjct  462   TVVLSLLRRFNIEHAAHESSSVPRFSPGLTATLSGGLPVLVKER  505



>ref|XP_008784226.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=514

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/465 (63%), Positives = 367/465 (79%), Gaps = 8/465 (2%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYL+SSWT E  NLCDW++ LL +SPTGT+ +HVLGN IT NP NVEYML 
Sbjct  40    PWCNCHVCRAYLSSSWTTEFENLCDWFTHLLRESPTGTMDIHVLGNTITTNPNNVEYMLR  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK F+S+LGD LGRGIF VDG+ W+FQRKMAS E GSVS RSYAF IV++EV
Sbjct  100   TRFDNFPKGKPFSSLLGDFLGRGIFNVDGESWQFQRKMASLELGSVSARSYAFHIVSSEV  159

Query  1190  RTRLFPLLEFYGENR----EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             R RL PL     E       V+D QDV RRF+FDNIC+ SFG+DPGCL+ SLP S+FA A
Sbjct  160   RRRLLPLFATVSERSIAADSVIDLQDVFRRFTFDNICRISFGLDPGCLEGSLPASEFAEA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FD AS+LSA RA T +PAVWK+KRLLN+GSE++L  AI +++ LA+E+I ++RK G A +
Sbjct  220   FDTASRLSAGRATTVAPAVWKLKRLLNVGSERELKRAIRMVSALADEVIRRRRKLGFASN  279

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
               DLLSRFMG +DDD+ LRDIVISFLLAGRDT+AS LTSFF +LS+HP VT  IR E   
Sbjct  280   L-DLLSRFMGSVDDDRYLRDIVISFLLAGRDTVASGLTSFFLILSKHPAVTAAIRDEIAD  338

Query  662   IM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             +M    D + A+ +Q+++M+Y+ AA++ESMRL+PPVQFDSKFC+ D  LPDGTFVRKG R
Sbjct  339   VMSGSGDDEEASLKQLKEMHYVHAAMYESMRLYPPVQFDSKFCVEDAVLPDGTFVRKGAR  398

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYHPYAMGRM+ IWG DC EFKPERWL +  F   + +KYPVF AGPRVCLGK+MAL+E
Sbjct  399   VTYHPYAMGRMEDIWGPDCEEFKPERWLHNRKFVPASPFKYPVFHAGPRVCLGKEMALME  458

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             MK+V V+++R+FD++V+   R  PR+APGLTA++RGGLS R+  R
Sbjct  459   MKTVIVSVVRSFDVQVLDGGRP-PRFAPGLTASIRGGLSARVRRR  502



>ref|XP_009338906.1| PREDICTED: cytochrome P450 94C1-like, partial [Pyrus x bretschneideri]
Length=514

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/471 (63%), Positives = 377/471 (80%), Gaps = 9/471 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C IC+++L+SSW+    NLCDWY+ LL KS +GTIHVHVLGN+ITANP NV
Sbjct  44    IIRLRPWCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENV  103

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++ T F N+PKGK F +ILGDLLG GIF VDGD W+FQRKMAS E GSVS+RSYA EI
Sbjct  104   EHIIKTNFHNYPKGKLFTTILGDLLGLGIFNVDGDGWQFQRKMASLELGSVSVRSYALEI  163

Query  1205  VAAEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V+AE+++RL PLL       GEN  V+D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S
Sbjct  164   VSAEIQSRLIPLLASVAGNEGEN-GVVDIQDLFRRFSFDNICKFSFGLDPGCLQLSLPIS  222

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
               A AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ +I+Q+R+ 
Sbjct  223   DVAVAFDLASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSIIKQRREM  282

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    Q DLLSRFM  I+DD+ LRDIV+SFLLAGRDTI+S LTS F+LL+RHPEV   IR
Sbjct  283   GTFSTQKDLLSRFMANIEDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLARHPEVKREIR  342

Query  677   AESGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
              E  ++M P ++    A++ Q+R+M+YL A ++E+MRL+PP+QFDSKFC  DD LPDGTF
Sbjct  343   KELDQVMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTF  402

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             VR GTRVTYH YAMGRM+SIWG+DC +FKP+RWL+ G+F  E+ YKYP+FQ G RVCLGK
Sbjct  403   VRSGTRVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGK  462

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++A++EMK VAVAL+  FDI+++ E  + P++ PGLTATVRGGL VRI +R
Sbjct  463   ELAVMEMKCVAVALVGRFDIQIL-EPERRPQFVPGLTATVRGGLPVRIEER  512



>ref|XP_010045242.1| PREDICTED: cytochrome P450 94C1-like [Eucalyptus grandis]
Length=511

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/461 (66%), Positives = 365/461 (79%), Gaps = 4/461 (1%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             PLC C++C +YL+SSW+ E  NLCDWY+ LL  SPTGTIHVHVL N ITANP NVE+++ 
Sbjct  41    PLCSCDVCASYLSSSWSSEFPNLCDWYTHLLRSSPTGTIHVHVLRNTITANPVNVEHIVR  100

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
              +F+N+PKGK F +ILGDLLGRGIF  DG+ W+FQRKMAS E GSVS+R+YAF+IV  E+
Sbjct  101   ARFDNYPKGKPFNAILGDLLGRGIFNADGESWRFQRKMASLELGSVSVRAYAFDIVRGEI  160

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              TRL PLL        V D QDV RRFSFD+ICKFSFG+DPGCL LSLPVS FA AFDLA
Sbjct  161   ETRLVPLLASRMGCGNV-DLQDVFRRFSFDSICKFSFGLDPGCLQLSLPVSSFALAFDLA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSAERA   S  VWK KRLLN+GSE++L +AI L+N LAEE+I Q+R+ G    ++DL
Sbjct  220   SRLSAERAAHVSHGVWKAKRLLNVGSERRLRDAIKLVNALAEEVIRQRRRLGSFATRNDL  279

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG +DDD  LRDIVISFLLAGRDT+ASALT FFWLLSR+PEV   IR ES  +M  
Sbjct  280   LSRFMGTVDDDVYLRDIVISFLLAGRDTVASALTGFFWLLSRNPEVERLIRGESDLVMGS  339

Query  650   DQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
                  LA+++Q++ M+YL AA+HESMRLFPPVQFDSKF   DD LPDGT V  GTRVTYH
Sbjct  340   SAGDVLASFEQMQHMHYLHAAVHESMRLFPPVQFDSKFASADDMLPDGTAVGGGTRVTYH  399

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGRM  IWG DC EF+PERWL+DGVF+ E+LYK+PVFQAGPR CLGK+MA+VEMKSV
Sbjct  400   PYAMGRMQRIWGPDCLEFRPERWLQDGVFRPESLYKFPVFQAGPRACLGKEMAVVEMKSV  459

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             A+AL+R FD+ VV   +Q  R++PGLTAT+ GGL V + +R
Sbjct  460   ALALVRRFDVRVVGTDQQA-RFSPGLTATMSGGLPVIVQER  499



>ref|XP_008391766.1| PREDICTED: cytochrome P450 94C1-like [Malus domestica]
Length=512

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/463 (62%), Positives = 366/463 (79%), Gaps = 7/463 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC+ Y TSSW+++  NLCDWY+ LL  SP+ TIH+HVL N ITANP NVEYML T+
Sbjct  44    CSCEICQTYXTSSWSLKFINLCDWYAHLLRDSPSKTIHIHVLKNTITANPENVEYMLKTR  103

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F++ILGD LG+GIF VDG  W+FQRKMAS E    S+RSYA+EIV  E+  
Sbjct  104   FENYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAYEIVNHEIEH  163

Query  1184  RLFPLLEFYGENRE-----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             RL PLL     N +      LD QDV +RFSFD+ICKFSFG+DP CL+LSLP+SKF  AF
Sbjct  164   RLIPLLSSVCSNSDDGNGVFLDLQDVFKRFSFDSICKFSFGLDPMCLELSLPLSKFTIAF  223

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D+ASKLSAERA+T SP +WK+KR+LN+GSEK+L E+I +I+ LA+E+I +KR+ G +  Q
Sbjct  224   DMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINIIDGLAKEVIARKREVGFS-TQ  282

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLSRFM  ++D+  LRDIV+SFLLAGRDT+ASALTSFFWL+  HP V   IR E+ R+
Sbjct  283   KDLLSRFMRSVEDESYLRDIVVSFLLAGRDTVASALTSFFWLIGTHPNVASAIRLEADRV  342

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             +  +Q L ++ Q+++++YL +AI+ESMRL+PPVQFDSKFC  DD LPDGTFVRKGTRVTY
Sbjct  343   LGLNQGLKSFDQMQELHYLQSAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKGTRVTY  402

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGR+  IWG+DC EFKP+RWL+DGVF  EN ++YPVFQ G RVCLGK+MA++EMK+
Sbjct  403   HPYAMGRIQEIWGSDCMEFKPDRWLKDGVFFKENPFQYPVFQPGHRVCLGKEMAVMEMKT  462

Query  299   VAVALIRAFDIE-VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             V ++L+R F+IE    ES  +PR++PGLTAT+ GGL V + +R
Sbjct  463   VVLSLLRRFNIEHAAHESSSVPRFSPGLTATLSGGLPVLVKER  505



>ref|XP_008790927.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=514

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/471 (63%), Positives = 368/471 (78%), Gaps = 9/471 (2%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +CKAYL+SSWT E +NLCDWY+ LL +SPT TI++HVLGN +TANP NVEYML 
Sbjct  39    PWCNCHVCKAYLSSSWTGEFTNLCDWYTHLLRQSPTRTINIHVLGNTVTANPDNVEYMLA  98

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F NFPKGK F+S+LGDLLGRGIF VDG+ W+FQRKMAS E GSVS+RSYAF IV+AEV
Sbjct  99    TRFANFPKGKPFSSLLGDLLGRGIFNVDGESWQFQRKMASLELGSVSVRSYAFHIVSAEV  158

Query  1190  RTRLFPLLEFYGE-----NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             R RL PL     +        V+D QDV RRF+FDNICK SFG+DPGCL+ SLP+S+FAA
Sbjct  159   RRRLIPLFTSVSDGGAAAAAGVIDLQDVFRRFAFDNICKISFGLDPGCLEASLPISEFAA  218

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD AS++SA R    +PAVWK+KRLLN+GSE++L  AI L++ELA+E+I Q+RK G A 
Sbjct  219   AFDTASRMSALRGTAVAPAVWKLKRLLNLGSERELKRAIRLVDELADELIRQRRKLGYAS  278

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
                DLLSRFM  ++DD+ LRDIVISFLLAGRDT+AS LT FF LLS+HPEVT  IR E  
Sbjct  279   SH-DLLSRFMCSVNDDRYLRDIVISFLLAGRDTVASGLTCFFLLLSKHPEVTAAIRDEIA  337

Query  665   RIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
              ++    D +LA+++Q++ M+Y+ AA++ES+RL+PPVQ DSKFC+ DD LPDGTFVRKGT
Sbjct  338   DVIGGSGDDELASFEQLKKMHYVHAAMYESLRLYPPVQIDSKFCVEDDMLPDGTFVRKGT  397

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYHPYAMGRM+ IWG DC EFKPERWL DG F   + +KYPVFQAG RVCLGK+MAL+
Sbjct  398   RVTYHPYAMGRMERIWGPDCEEFKPERWLRDGKFVPASPFKYPVFQAGLRVCLGKEMALM  457

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             EMK+V V+++  FD++V+   R  P++APGL A++ GGL  ++  R    Q
Sbjct  458   EMKTVIVSVVPRFDVQVLDAGRS-PKFAPGLAASIDGGLPAQVRRRSSGEQ  507



>ref|XP_010907146.1| PREDICTED: cytochrome P450 94C1-like [Elaeis guineensis]
Length=505

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/462 (63%), Positives = 369/462 (80%), Gaps = 6/462 (1%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +CKA+L+SSWT E +NL DWY+ LL +SPTGTI++HVLGN +TANP NVEYML 
Sbjct  41    PWCNCHVCKAFLSSSWTAEFTNLSDWYTHLLRRSPTGTINIHVLGNTVTANPDNVEYMLK  100

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK F+S+LGDLLGRGIF VDGD W+FQRKMAS E GSVS+RSYAF IV AE+
Sbjct  101   TRFDNFPKGKPFSSLLGDLLGRGIFNVDGDSWQFQRKMASLELGSVSVRSYAFHIVTAEI  160

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             R RL PL  F   +  V+D QDV RRF+FD+ICK SFG+ PGCL+ SLP+S+FAAAFD A
Sbjct  161   RRRLIPL--FASLSDGVIDLQDVFRRFAFDSICKISFGLYPGCLEASLPMSEFAAAFDTA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA+R    +PA+WK+KRLLN+GSE++L  AI L+N LA+E+I Q+R+ G A    DL
Sbjct  219   SRLSAKRGTAVAPALWKLKRLLNVGSERELKRAIRLVNVLADEVIRQRRELGSASSH-DL  277

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM--  657
             LSRFM  ++DD+ LRDIVISFLLAGRDT+AS LT+FF +LS+HP VT  IR E   +M  
Sbjct  278   LSRFMCSVNDDRYLRDIVISFLLAGRDTVASGLTTFFLVLSKHPAVTAAIREEIANVMRG  337

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
               D D+A+++Q++ M+Y+ AA++ES+RL+PPVQFDSKFC+ DD LPDGTFVRKGTRVTYH
Sbjct  338   SGDDDVASFEQLKKMHYVHAAMYESLRLYPPVQFDSKFCVEDDVLPDGTFVRKGTRVTYH  397

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGRM+SIWG DC EFKPERWL DG F   + +KYPVFQ G RVCLGK+MAL+EMK+V
Sbjct  398   PYAMGRMESIWGPDCEEFKPERWLHDGKFVPASPFKYPVFQGGLRVCLGKEMALMEMKAV  457

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
              V+++  FD+ V+   R + ++APGL+A++ GGL  ++  RR
Sbjct  458   IVSVVPRFDLRVLDTGRSL-KFAPGLSASIDGGLPAQVRRRR  498



>ref|XP_010541286.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=498

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/467 (64%), Positives = 364/467 (78%), Gaps = 5/467 (1%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S+L   C CEIC  +++  W     NL DWY+ LL +S T T+HVHV+ N +TANP NV
Sbjct  27    ISRLNLWCTCEICDTFVSGRWRRRFDNLSDWYTDLLRRSATTTVHVHVINNTVTANPMNV  86

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E++L T F+N+PKGK F++ILGDLLGRGIF VDGD W+FQ+K+AS E GS S RS+AF++
Sbjct  87    EHILKTNFDNYPKGKPFSAILGDLLGRGIFNVDGDSWRFQKKLASLELGSASTRSFAFDV  146

Query  1205  VAAEVRTRLFPLL-EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             V  E+R RL PLL    G +  VLD QD+LRRF+FD ICKFSFG+DPGCL L LPVS+FA
Sbjct  147   VTFEIRQRLLPLLTSVSGRSDSVLDLQDILRRFTFDTICKFSFGLDPGCLRLPLPVSEFA  206

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD AS+LSA RA+ A P VWK+KRLLNIGSEKKL E+I L+N LAEE+I ++R+ G +
Sbjct  207   TAFDAASRLSAGRALVAVPLVWKIKRLLNIGSEKKLRESIQLVNRLAEELISERREKGFS  266

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
              D+ DLLSRFMG I+DDK LRDIVISF+LAGRDT+ASALTSFFWLL+++P     IR E 
Sbjct  267   -DKHDLLSRFMGAINDDKYLRDIVISFILAGRDTVASALTSFFWLLTQNPTAESSIRLEL  325

Query  668   GRIMEPDQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
              ++M P  D   ATY Q R+M+YL AA+HESMRL+PPVQFDSKF L+DD L DGTFV+KG
Sbjct  326   DQVMGPGPDPVTATYDQTREMHYLHAALHESMRLYPPVQFDSKFSLDDDVLTDGTFVKKG  385

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             T+VTYHPYAMGRMD IWG DC EF+PERWL+DG F SEN +KYPVFQAG RVCLGK+M+L
Sbjct  386   TKVTYHPYAMGRMDMIWGPDCDEFRPERWLKDGKFSSENPFKYPVFQAGLRVCLGKEMSL  445

Query  314   VEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VEMK VA+ALIR F I  V +   +P +  GLTATVRGGL V I +R
Sbjct  446   VEMKCVAIALIRRFRIR-VADPGWIPIFEAGLTATVRGGLPVLIEER  491



>ref|XP_011005435.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=512

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/461 (63%), Positives = 358/461 (78%), Gaps = 2/461 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYL  SW     NLCDWY+ LL  SPT T+ +HVLGN+ITANP N++YML T+
Sbjct  42    CNCEICDAYLNLSWAKSFDNLCDWYAHLLKHSPTKTVPIHVLGNIITANPENIKYMLKTR  101

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F+ ILGD LGRGIF VDGD+W+FQ+ MAS E   +SIRS AFEIV  E+  
Sbjct  102   FDNYPKGKPFSLILGDFLGRGIFNVDGDMWRFQKNMASLELDRLSIRSNAFEIVRCEIEK  161

Query  1184  RLFPLL-EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL PLL  F G+   +LD QDV RRFSFD+IC+FSFG+DP CL LSLP+S+FA AFDLAS
Sbjct  162   RLLPLLVSFSGKEDGILDLQDVFRRFSFDSICQFSFGLDPRCLQLSLPMSEFAVAFDLAS  221

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             K SAERA+  SP VWK+KR LNIGSEKK+ EAI +I+ LA+E++ QKR   G     DLL
Sbjct  222   KFSAERAMAVSPLVWKIKRKLNIGSEKKMKEAIKIIDILAQEVMRQKR-VKGFSTHKDLL  280

Query  827   SRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD  648
             SRFM  +DD+  LRDIVISFLLAGRDT+ASALTSFFWLL++HPE+   I+ E+ R++ P+
Sbjct  281   SRFMRTVDDETYLRDIVISFLLAGRDTVASALTSFFWLLAKHPEIGSAIQVEADRVLGPN  340

Query  647   QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYA  468
             Q   ++++I+ ++YL AA+HESMRL+PP+QFDSKFC  DD LPDGTFV++GTRVTYHPYA
Sbjct  341   QAPKSFEEIQQLHYLQAAVHESMRLYPPIQFDSKFCQQDDVLPDGTFVKRGTRVTYHPYA  400

Query  467   MGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVA  288
             MGRM+ IWG DC EFKPERWL DGVF SEN YKYPVFQ G RVCLGKDMAL+E+KSV ++
Sbjct  401   MGRMEEIWGPDCLEFKPERWLRDGVFFSENPYKYPVFQGGFRVCLGKDMALMEIKSVCLS  460

Query  287   LIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             L++ F  ++V      PR++PGLT+T   GL V + ++  Q
Sbjct  461   LLQRFHFKLVFPCHSTPRFSPGLTSTFIDGLLVLVREKVTQ  501



>ref|XP_009374745.1| PREDICTED: cytochrome P450 94C1-like [Pyrus x bretschneideri]
Length=513

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/466 (63%), Positives = 367/466 (79%), Gaps = 7/466 (2%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C CEIC+ YLTSSW++E  NLCDWY+ LL  SP+ TIH+HVL N ITANP NVEYML
Sbjct  42    KLWCSCEICQTYLTSSWSLEFVNLCDWYAHLLQDSPSKTIHIHVLRNTITANPENVEYML  101

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+N+PKGK F++ILGD LG+GIF VDG  W+FQRKMAS E    S+RSYAFEIV  E
Sbjct  102   KTRFKNYPKGKPFSTILGDFLGQGIFNVDGHSWRFQRKMASLELDRHSVRSYAFEIVNHE  161

Query  1193  VRTRLFPLLEFY-----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             +  RL PLL        G N  VLD QDV +RFSFD ICKFSFG+DP CL+LSLP+S+FA
Sbjct  162   IEHRLIPLLTSVCSNSDGGNGIVLDLQDVFKRFSFDTICKFSFGLDPMCLELSLPLSEFA  221

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD+ASKLSAERA+T SP +WK+KR+LN+GSEK+L E+I +IN LA+E+I +KR+ G +
Sbjct  222   IAFDMASKLSAERAMTPSPIIWKIKRILNLGSEKQLKESINMINALAKEVIARKRESGFS  281

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
               Q DLLSRFM  ++D+  LRDIVISFLLAGRDT+ASALTSFFWL+  HP     IR E+
Sbjct  282   -TQRDLLSRFMRSVEDEGYLRDIVISFLLAGRDTMASALTSFFWLMGTHPNAASAIRLEA  340

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
              R++  +Q L +++Q+++++YL AAI+ESMRL+PPVQFDSKFC  DD LPDGTFVRKGTR
Sbjct  341   DRVLGINQGLKSFEQMQELHYLQAAIYESMRLYPPVQFDSKFCEQDDVLPDGTFVRKGTR  400

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYHPYAMGR+   WG+DC EFKP+RWL+DGVF  EN +KYP+FQ G RVCLGK+MA++E
Sbjct  401   VTYHPYAMGRIQESWGSDCMEFKPDRWLKDGVFFMENPFKYPIFQPGLRVCLGKEMAVME  460

Query  308   MKSVAVALIRAFDIE-VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             MK+V ++L+R F+IE    ES ++P+++PGLTAT+  G  V + +R
Sbjct  461   MKTVVLSLLRRFNIEHAAHESCRVPKFSPGLTATLSSGFPVLVKER  506



>ref|XP_011024239.1| PREDICTED: cytochrome P450 94C1-like [Populus euphratica]
Length=499

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/459 (64%), Positives = 359/459 (78%), Gaps = 4/459 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC  YL S W+ E  N+CDWY+ LL  SP  TIH+HVLGN ITANP NVEY+L TK
Sbjct  39    CNCEICTNYLLSGWSREFKNICDWYTHLLQNSPRQTIHIHVLGNTITANPDNVEYILKTK  98

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKG+ F+ ILGD LG+GIF VDGDLW FQRKMAS E  SVSIR+YAFEIV  E++ 
Sbjct  99    FENYPKGRPFSMILGDFLGKGIFNVDGDLWLFQRKMASLELASVSIRNYAFEIVNTEIKC  158

Query  1184  RLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL    ++ +  ++D QDV RRFSFDNIC+FSFG+DPGCL+ SLP+S FA +FDLA
Sbjct  159   RLLPLLTSAAKSTDGDLIDLQDVFRRFSFDNICRFSFGLDPGCLESSLPISVFAESFDLA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             SKLSAERA+   P VWK+KR  NIG+EK L EAI ++N LA+E+I QKRK G + +Q DL
Sbjct  219   SKLSAERAMATLPLVWKIKRYFNIGTEKNLKEAIEVVNILADEVIMQKRKLGFSTNQ-DL  277

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFM  I DD+ LRDIVISF+LAGRDT+ASALT+FFWLL+ HP V  +IR ES R+M  
Sbjct  278   LSRFMACITDDRYLRDIVISFILAGRDTMASALTTFFWLLASHPNVVSKIREESNRVMAS  337

Query  650   DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
             +Q+ A+Y+QIR+M+YL A ++ES+RL+PPVQFDSKF + DD LPDGT VR+GTRVTYHPY
Sbjct  338   NQESASYEQIREMHYLHAVVNESLRLYPPVQFDSKFAMEDDVLPDGTPVRRGTRVTYHPY  397

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGRM+ IWG DC EF+PERWLE+G F   + +K PVFQAG RVCLGK+M+LVEMK VA+
Sbjct  398   AMGRMERIWGIDCLEFRPERWLENGTFCPISPFKCPVFQAGIRVCLGKEMSLVEMKIVAL  457

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +++R FDI++V      PR+  GLTA + GGL   I +R
Sbjct  458   SVVRRFDIKIV-PPEVSPRFNSGLTAMLSGGLQAEIRER  495



>gb|KEH42061.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=515

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/468 (62%), Positives = 365/468 (78%), Gaps = 13/468 (3%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CEIC+AYL+SSW+ + +NLCDWY+ LL KSPT TIH+HVL N+ITAN  NVEY+L T
Sbjct  48    FCSCEICQAYLSSSWSKDFNNLCDWYAHLLKKSPTKTIHIHVLRNIITANCENVEYILKT  107

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             KFEN+PKGK F+SILGD LGRGIF VDGDLWKFQ+KMAS E    SIRS+AFE+V  E+ 
Sbjct  108   KFENYPKGKPFSSILGDFLGRGIFNVDGDLWKFQKKMASLELNKQSIRSFAFEVVNNEIE  167

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL+    N+ V D QDV +RFSFD+IC+FSFG+DP CL+ SLP+S FA +FDLAS
Sbjct  168   NRLIPLLQNQNLNQVVFDLQDVFKRFSFDSICRFSFGLDPMCLETSLPMSDFALSFDLAS  227

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             KLSAERA+  SP +WK+KR  N+GSEK+L ++I +IN LA+ +I QKRK G +  + DLL
Sbjct  228   KLSAERAMVVSPLIWKIKRFFNMGSEKELQKSINIINMLAKVVINQKRKLGFSHHK-DLL  286

Query  827   SRFMG-IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             SRFM   I DD  LRDIVISFLLAGRDT+AS+LTSFFWLL+++PEV   I  E+ R++ P
Sbjct  287   SRFMSTTIHDDMFLRDIVISFLLAGRDTVASSLTSFFWLLAKNPEVEKEILLEAERVIGP  346

Query  650   DQD-----LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
               +     +  ++Q+R ++YL AA HESMRL+PP+QFDSKFCL+DD LPDGT V+ GTRV
Sbjct  347   HDENNIFGVTNFEQLRKLHYLQAAAHESMRLYPPIQFDSKFCLDDDVLPDGTKVKSGTRV  406

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYHPYAMGR++ +WG DC EFKPERWL+DGVF+  N +KYP+FQAG RVC+GK+MAL+E+
Sbjct  407   TYHPYAMGRLEELWGPDCLEFKPERWLKDGVFQPSNQFKYPIFQAGLRVCIGKEMALMEL  466

Query  305   KSVAVALIRAFDIEVVCESRQM----PRYAPGLTATVRGGLSVRITDR  174
             KSVA++L+R F IE+  E R M    PR++PGLTAT   GL V +  R
Sbjct  467   KSVAISLLRKFHIEL--EDRTMFHGNPRFSPGLTATFAFGLPVFVRPR  512



>ref|XP_009364325.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94C1 [Pyrus x 
bretschneideri]
Length=635

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/471 (63%), Positives = 377/471 (80%), Gaps = 9/471 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + +L+P C C IC+++L+SSW+    NLCDWY+ LL KS +GTIHVHVLGN+ITANP NV
Sbjct  165   IIRLRPWCNCHICRSFLSSSWSGSFDNLCDWYTHLLKKSLSGTIHVHVLGNIITANPENV  224

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+++ T F N+PKGK F +ILGDLLG GIF VDGD W+FQRKMAS E GSVS+RSYA EI
Sbjct  225   EHIIKTNFHNYPKGKLFTTILGDLLGLGIFNVDGDGWQFQRKMASLELGSVSVRSYALEI  284

Query  1205  VAAEVRTRLFPLLEFY----GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             V+AE+++RL PLL       GEN  V+D QD+ RRFSFDNICKFSFG+DPGCL LSLP+S
Sbjct  285   VSAEIQSRLIPLLASVAGNEGEN-GVVDIQDLFRRFSFDNICKFSFGLDPGCLQLSLPIS  343

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
               A AFDLASKLSAERA+T+SP VWK+KR  N+GSE++L EA+ +++ LA+ +I+Q+R+ 
Sbjct  344   DVAVAFDLASKLSAERAMTSSPIVWKIKRFFNLGSERQLKEAVKMVDNLAKSIIKQRREM  403

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G    Q DLLSRFM  I+DD+ LRDIV+SFLLAGRDTI+S LTS F+LL+RHPEV   IR
Sbjct  404   GTFSTQKDLLSRFMANIEDDQYLRDIVVSFLLAGRDTISSGLTSLFYLLARHPEVKREIR  463

Query  677   AESGRIMEPDQD---LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
              E  ++M P ++    A++ Q+R+M+YL A ++E+MRL+PP+QFDSKFC  DD LPDGTF
Sbjct  464   KELDQVMGPTREGLATASFDQMREMHYLHAVLYETMRLYPPIQFDSKFCQEDDVLPDGTF  523

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             VR GTRVTYH YAMGRM+SIWG+DC +FKP+RWL+ G+F  E+ YKYP+FQ G RVCLGK
Sbjct  524   VRSGTRVTYHQYAMGRMESIWGSDCLDFKPDRWLKKGLFSPESPYKYPIFQGGERVCLGK  583

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++A++EMK VAVAL+  FDI+++ E  + P++ PGLTATVRGGL VRI +R
Sbjct  584   ELAVMEMKCVAVALVGRFDIQIL-EPERRPQFVPGLTATVRGGLPVRIEER  633



>ref|XP_006577067.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=540

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/473 (61%), Positives = 369/473 (78%), Gaps = 10/473 (2%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CE C+AYLTS W+    NLCDWY+ LL  SPT TIH+HVL N ITANP NVEYML T
Sbjct  58    FCSCETCQAYLTSGWSKTFDNLCDWYAHLLRNSPTKTIHIHVLRNTITANPDNVEYMLKT  117

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             +F NFPKGK F++ILGD LGRGIF VDG+ W FQ+KMAS E    SIRS+AFE+V  E++
Sbjct  118   RFHNFPKGKTFSTILGDFLGRGIFNVDGESWSFQKKMASLELSKNSIRSFAFEVVKFEIK  177

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL    +N  VLD QDV +RFSFD+IC+FSFG+DP CL+LSLP+S+FA +FDLAS
Sbjct  178   DRLIPLLVLSKQNDCVLDLQDVFKRFSFDSICRFSFGLDPMCLELSLPISEFAMSFDLAS  237

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR---DQS  837
             KLSAERA++ SP +WK+KR LN+GSEKKL +AI +I+ LA E+I Q+RK G +     + 
Sbjct  238   KLSAERAMSVSPLIWKIKRFLNVGSEKKLRKAIKMIDILAREVIRQRRKMGFSSISPHKD  297

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  I DD  L+DI++SFLLAGRDT+ASALTSFFWLL++HPEV  +I  E+ +++
Sbjct  298   DLLSRFMRTITDDTYLKDIIVSFLLAGRDTVASALTSFFWLLAKHPEVESQILLEAEQVI  357

Query  656   EPD--QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
               D  +DL +Y++++ ++YL AA +ESMRL+PP+QFDSKFCL DD LPDGTFV++GTRVT
Sbjct  358   GSDYNKDLTSYEELQQLHYLQAAANESMRLYPPIQFDSKFCLEDDVLPDGTFVKRGTRVT  417

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR++ IWG+DC EF+PERWL++G+F  +N +KYPVFQAG RVCLGK+MAL+E+K
Sbjct  418   YHPYAMGRLEEIWGSDCFEFRPERWLKEGLFCPQNPFKYPVFQAGIRVCLGKEMALLELK  477

Query  302   SVAVALIRAFDIEVVC-----ESRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             SVA++L+R F IE+            PR++PGLTAT   GL V++ ++  Q++
Sbjct  478   SVALSLLRRFHIELAAPPPHHHHHSTPRFSPGLTATFSCGLRVKVREQGTQQR  530



>ref|XP_008443586.1| PREDICTED: cytochrome P450 94C1-like [Cucumis melo]
Length=495

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/464 (63%), Positives = 362/464 (78%), Gaps = 4/464 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K LC CEIC+AYL SSW+ +  NLCDWYS LL +SPT TIH+HVL N ITANP NVEY+L
Sbjct  30    KFLCSCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYIL  89

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              TKFEN+PKGK F+SILGD LGRGIF VDGDLW+FQ+KMA  E G  SIRSY FEIV+ E
Sbjct  90    KTKFENYPKGKIFSSILGDFLGRGIFNVDGDLWQFQKKMAIIELGQQSIRSYCFEIVSQE  149

Query  1193  VRTRLFPLLEFY--GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             + +RL PLL     G +   LD QDV RRF+FD+ICKFSFG+DP CL+LSLP+S FA AF
Sbjct  150   IHSRLLPLLSSVADGGSGGALDLQDVFRRFAFDSICKFSFGLDPMCLELSLPMSDFAVAF  209

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+   P +WK+KR+LN+G EK+L +AI LIN LA E+I Q+RK G +  +
Sbjct  210   DLASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINMLAREVIRQRRKLGFSTHR  269

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLS+FM I+ D+  LRDIV+SFLLAGRDTIASALTSFFW++S HP V   I+ E+ R+
Sbjct  270   -DLLSQFMRIVSDETFLRDIVVSFLLAGRDTIASALTSFFWVISSHPTVESAIQLEADRV  328

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + P+ +  ++ QIR+++YL AAI ESMRL+PP+QFDSKFC NDD LPDGTFVR+GTRV+Y
Sbjct  329   IGPNSNPTSFDQIRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRVSY  388

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGR++ IWG +C EF PERWL++ +F  EN +KYP+FQ G R+CLGK+MAL E+K 
Sbjct  389   HPYAMGRVEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRICLGKEMALFELKI  448

Query  299   VAVALIRAFDIEVVCESRQM-PRYAPGLTATVRGGLSVRITDRR  171
             VA+++IR F I+    S    PR++PGLTAT  GG  V ++ +R
Sbjct  449   VALSVIRHFRIQSTTPSSVAPPRFSPGLTATFCGGFKVLVSKKR  492



>ref|XP_007162882.1| hypothetical protein PHAVU_001G188500g [Phaseolus vulgaris]
 gb|ESW34876.1| hypothetical protein PHAVU_001G188500g [Phaseolus vulgaris]
Length=527

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 364/460 (79%), Gaps = 3/460 (1%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CE C+AYLTSSW+    NLCDWY+ LL  SPT TIH+HVL N ITANP NVEY+L T
Sbjct  52    FCNCETCEAYLTSSWSKNFHNLCDWYAHLLRNSPTKTIHIHVLQNTITANPDNVEYVLKT  111

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             +F NFPKGK F++ILGD LG GIF VDG+ W FQRK+AS E    SIRS+AFE+V  E++
Sbjct  112   RFNNFPKGKTFSAILGDFLGGGIFNVDGESWCFQRKIASLELSKTSIRSFAFEVVRFEIQ  171

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL    +N  VLD QDV +RFSFD+ICKFSFG+DP CL+ SLP+S FA +FD+AS
Sbjct  172   HRLIPLLALSKQNDGVLDLQDVFKRFSFDSICKFSFGLDPMCLEQSLPISDFARSFDMAS  231

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             KLSAERA++ SP +WK+KR LN+GSEKKL EA+  IN LA+E+I Q+RK        DLL
Sbjct  232   KLSAERAMSVSPLIWKIKRFLNVGSEKKLQEAVKTINILAKEVIRQRRKM-EFWSHEDLL  290

Query  827   SRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM--E  654
             SRFM  ++DD  L+DI++SFLLAGRDT+ASALT+FFWLL++HPEV  +I  E+  ++  E
Sbjct  291   SRFMSCVNDDTYLKDIIVSFLLAGRDTVASALTTFFWLLTKHPEVVSKIVVEAEGVIGRE  350

Query  653   PDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHP  474
               +D+A+++++++++YL AA +ESMRL+PP+Q DSKFCL DD LPDGTFV++GTRV+YHP
Sbjct  351   KSKDIASFEELQELHYLEAAAYESMRLYPPIQLDSKFCLEDDVLPDGTFVKRGTRVSYHP  410

Query  473   YAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVA  294
             YAMGR++ +WG DC EF+PERWL++GVF  EN +KYPVFQAG RVCLGK+MAL+E+KSVA
Sbjct  411   YAMGRLEELWGRDCLEFRPERWLKNGVFCPENPFKYPVFQAGMRVCLGKEMALLELKSVA  470

Query  293   VALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++++R F IE+V    + PR++PGLTAT+  GL V++ D+
Sbjct  471   ISVLRRFHIELVAPDHRTPRFSPGLTATLSSGLRVKVRDQ  510



>gb|KGN59117.1| hypothetical protein Csa_3G775300 [Cucumis sativus]
Length=495

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/464 (63%), Positives = 360/464 (78%), Gaps = 4/464 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K LC CEIC+AYL SSW+ +  NLCDWYS LL +SPT TIH+HVL N ITANP NVEY+L
Sbjct  30    KFLCNCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYIL  89

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              TKFEN+PKGK F+SILGD LGRGIF VDGDLW+FQ+KMA  E G  SIRSY FEIV+ E
Sbjct  90    KTKFENYPKGKIFSSILGDFLGRGIFNVDGDLWRFQKKMAIIELGQQSIRSYCFEIVSQE  149

Query  1193  VRTRLFPLLEFY--GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             + +RL PLL     G +  VLD QDV RRF+FD+ICKFSFG+DP CL+LSLP+S  A AF
Sbjct  150   IHSRLLPLLSSVADGGSGGVLDLQDVFRRFAFDSICKFSFGLDPMCLELSLPISDIAVAF  209

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+   P +WK+KR+LN+G EK+L +AI LIN LA E+I Q+RK G +  +
Sbjct  210   DLASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINVLAHEVIRQRRKLGFSTHR  269

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLS+FM  + D+  LRDI++SFLLAGRDTIASALTSFFW++S HP V   I+ E+ R+
Sbjct  270   -DLLSQFMRTVSDETFLRDIIVSFLLAGRDTIASALTSFFWVISTHPAVESAIQLEADRV  328

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + P  +  ++ QIR+++YL AAI ESMRL+PP+QFDSKFC NDD LPDGTFVR+GTRV+Y
Sbjct  329   IGPTSNPTSFDQIRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRVSY  388

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM+ IWG +C EF PERWL++ +F  EN +KYP+FQ G R CLGK+MAL E+K 
Sbjct  389   HPYAMGRMEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRFCLGKEMALFELKI  448

Query  299   VAVALIRAFDIEVVCESRQM-PRYAPGLTATVRGGLSVRITDRR  171
             VA+++IR F I+    S  + PR++PGLTAT  GG  V ++ +R
Sbjct  449   VALSVIRHFRIQSTTPSSSVAPRFSPGLTATFCGGFKVIVSKKR  492



>ref|XP_004149216.1| PREDICTED: cytochrome P450 94A1-like, partial [Cucumis sativus]
 ref|XP_004168802.1| PREDICTED: cytochrome P450 94A1-like, partial [Cucumis sativus]
Length=484

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/464 (63%), Positives = 360/464 (78%), Gaps = 4/464 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K LC CEIC+AYL SSW+ +  NLCDWYS LL +SPT TIH+HVL N ITANP NVEY+L
Sbjct  19    KFLCNCEICQAYLASSWSKDFHNLCDWYSHLLRQSPTKTIHIHVLRNTITANPDNVEYIL  78

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              TKFEN+PKGK F+SILGD LGRGIF VDGDLW+FQ+KMA  E G  SIRSY FEIV+ E
Sbjct  79    KTKFENYPKGKIFSSILGDFLGRGIFNVDGDLWRFQKKMAIIELGQQSIRSYCFEIVSQE  138

Query  1193  VRTRLFPLLEFY--GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             + +RL PLL     G +  VLD QDV RRF+FD+ICKFSFG+DP CL+LSLP+S  A AF
Sbjct  139   IHSRLLPLLSSVADGGSGGVLDLQDVFRRFAFDSICKFSFGLDPMCLELSLPISDIAVAF  198

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLASKLSAERA+   P +WK+KR+LN+G EK+L +AI LIN LA E+I Q+RK G +  +
Sbjct  199   DLASKLSAERAMAVPPLIWKIKRMLNLGREKELKKAIKLINVLAHEVIRQRRKLGFSTHR  258

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLS+FM  + D+  LRDI++SFLLAGRDTIASALTSFFW++S HP V   I+ E+ R+
Sbjct  259   -DLLSQFMRTVSDETFLRDIIVSFLLAGRDTIASALTSFFWVISTHPAVESAIQLEADRV  317

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + P  +  ++ QIR+++YL AAI ESMRL+PP+QFDSKFC NDD LPDGTFVR+GTRV+Y
Sbjct  318   IGPTSNPTSFDQIRNLHYLQAAIFESMRLYPPIQFDSKFCQNDDILPDGTFVRRGTRVSY  377

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM+ IWG +C EF PERWL++ +F  EN +KYP+FQ G R CLGK+MAL E+K 
Sbjct  378   HPYAMGRMEQIWGTNCLEFNPERWLKNNIFCPENPFKYPIFQGGFRFCLGKEMALFELKI  437

Query  299   VAVALIRAFDIEVVCESRQM-PRYAPGLTATVRGGLSVRITDRR  171
             VA+++IR F I+    S  + PR++PGLTAT  GG  V ++ +R
Sbjct  438   VALSVIRHFRIQSTTPSSSVAPRFSPGLTATFCGGFKVIVSKKR  481



>ref|XP_009414947.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=503

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/467 (61%), Positives = 359/467 (77%), Gaps = 7/467 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             + +P C C +C+AYL+S+WT E  NLCDWY+ LL +SPTGT+ +HVLGN ITANP NVEY
Sbjct  33    RWRPWCNCSVCRAYLSSTWTAEFDNLCDWYAHLLRQSPTGTVQIHVLGNTITANPDNVEY  92

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T F+NFPKGK F++ILGDLLG GIF VDG+ W+FQRKMAS E GS S+RSYAF IV+
Sbjct  93    MLKTNFDNFPKGKPFSTILGDLLGHGIFNVDGEAWRFQRKMASLELGSASLRSYAFRIVS  152

Query  1199  AEVRTRLFPLLEFYGE--NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
              EV  RL PLL F  +      ++ QDV RRF+FD +CK SFG+DPGCL+LSLP+S+FA 
Sbjct  153   GEVHHRLLPLLAFVSDPSGDNTVELQDVFRRFAFDTVCKISFGLDPGCLELSLPMSEFAM  212

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD AS L A R  T +P VWK+KR LN+GSE++L  +I  +N LA+E+I Q+R  G A 
Sbjct  213   AFDRASTLLARRGATIAPLVWKLKRFLNVGSERELRRSIRRVNVLADEVIRQRRVLGSAS  272

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
                DLLSRFM  ++DD+ LRDIVISFLLAGRDT+AS+LTS F+LLS+HP+V   IR E  
Sbjct  273   GH-DLLSRFMSSVEDDRYLRDIVISFLLAGRDTVASSLTSVFFLLSQHPKVVAAIRDEVA  331

Query  665   RIM---EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
              +    + + ++ TY+Q++ M+Y+TA +HES+RL+PPVQFDSKFCL DD LPDGT V K 
Sbjct  332   AVTKGKDENDEVPTYEQLKGMHYVTAVLHESLRLYPPVQFDSKFCLEDDVLPDGTMVTKN  391

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
              RVTYHPYAMGRM+ IWG+DC +FKPERWL DG+F  E L+KYPVFQAG RVCLGK+MAL
Sbjct  392   ARVTYHPYAMGRMERIWGSDCFDFKPERWLRDGLFTPEGLFKYPVFQAGLRVCLGKEMAL  451

Query  314   VEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +EMK+V V+++  FDIEV+   R  P + PGLTAT+ GGLSVR+  R
Sbjct  452   MEMKAVIVSVVPRFDIEVINGGRS-PHFTPGLTATITGGLSVRVHRR  497



>ref|XP_009800093.1| PREDICTED: cytochrome P450 94C1-like [Nicotiana sylvestris]
Length=521

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/464 (64%), Positives = 358/464 (77%), Gaps = 11/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C+IC  Y+TSSW  E +NL DWY+ LL  S + TIH+HVLGN+ITANP NVEYML TK
Sbjct  56    CTCDICHCYITSSWRKEFTNLVDWYAHLLRNSLSQTIHIHVLGNIITANPRNVEYMLKTK  115

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGK F+ ILGDLLG GIF VDGDLW FQRKMAS E GS+SIRSYAF  V  E++ 
Sbjct  116   FLNYPKGKPFSIILGDLLGDGIFNVDGDLWTFQRKMASLELGSMSIRSYAFNNVKNEIKF  175

Query  1184  RLFPLL------EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             RL PLL      +F G +   LD QDV RRFSFDNICKFSFG+DPGCL+LSLP+S FA +
Sbjct  176   RLLPLLSSIAQEDFRGTS---LDLQDVFRRFSFDNICKFSFGLDPGCLELSLPLSHFALS  232

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FDLA+KLSAERA+ ASP +WK+KRLL+IG+E+KL +AI  I+ LA E+I QKRK G +  
Sbjct  233   FDLATKLSAERAMAASPLIWKIKRLLDIGTERKLRKAIENIDVLAREVIRQKRKLGYSNH  292

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             Q DLLSRFMGIID++K LRDIVISF+LAGRDT+ASALTS FWLL+ HP+V  RIR E  R
Sbjct  293   Q-DLLSRFMGIIDNEKYLRDIVISFILAGRDTVASALTSIFWLLTSHPDVELRIREELSR  351

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             +M  DQD   ++QI  M+YL A IHESMRL+PPVQFDSKF   +D+LPDGTFV K  RVT
Sbjct  352   VMRQDQDFLMFEQINQMHYLNAVIHESMRLYPPVQFDSKFACENDSLPDGTFVAKNARVT  411

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YH YAMGRM+++WG D  +FKPERWL++G F  E+ +KYPVFQ G RVCLGK+MAL+EMK
Sbjct  412   YHVYAMGRMENLWGQDYMDFKPERWLKNGTFLRESPFKYPVFQGGVRVCLGKEMALMEMK  471

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
              V  ++++ FD+  V     + R+ PGLTAT+RGGL V +  RR
Sbjct  472   CVVASMLQHFDVRAVAAGGDL-RFDPGLTATMRGGLPVVVRWRR  514



>ref|XP_002315447.2| hypothetical protein POPTR_0010s24310g [Populus trichocarpa]
 gb|EEF01618.2| hypothetical protein POPTR_0010s24310g [Populus trichocarpa]
Length=499

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/459 (63%), Positives = 355/459 (77%), Gaps = 4/459 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC  YL S W+ E  N+CDWY+ LL  S   TIH+HVLGN ITANP NVEY+L TK
Sbjct  39    CNCEICTNYLLSGWSREFKNICDWYTHLLQNSSRQTIHIHVLGNTITANPDNVEYILKTK  98

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKG+ F+ ILGD LG+GIF VDGDLW FQRKMAS E  SVSIR+YAFEIV  E++ 
Sbjct  99    FENYPKGRPFSMILGDFLGKGIFNVDGDLWLFQRKMASLELASVSIRNYAFEIVDTEIKC  158

Query  1184  RLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL    ++ +  ++D QDV RRFSFDN CKFSFG+DPGCL+ SLP+S FA +FDLA
Sbjct  159   RLLPLLTSAAKSTDGGLIDLQDVFRRFSFDNNCKFSFGLDPGCLESSLPISVFAESFDLA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             SKLSAERA+   P VWK+KR  NIG+EK L EAI ++N LA+E+I QKRK G + +Q DL
Sbjct  219   SKLSAERAMATLPLVWKIKRYFNIGTEKNLKEAIEVVNILADEVIMQKRKLGFSTNQ-DL  277

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFM  I DD+ LRDIVISF+LAGRDT+ASALT+ FWLL+ HP V   IR ES R+M  
Sbjct  278   LSRFMACITDDRYLRDIVISFILAGRDTMASALTTLFWLLASHPNVVSMIREESNRVMAS  337

Query  650   DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
             +Q+ A+Y+QIR+M+YL A ++ES+RL+PPVQFDSKF + DD LPDGT VR+GTRVTYHPY
Sbjct  338   NQESASYEQIREMHYLHAVVNESLRLYPPVQFDSKFAMEDDVLPDGTLVRRGTRVTYHPY  397

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGRM+ IWG DC EF+PERWLE+G F   + +K PVFQAG RVCLGK+M+LVEMK VA+
Sbjct  398   AMGRMERIWGIDCMEFRPERWLENGTFCPISPFKCPVFQAGIRVCLGKEMSLVEMKIVAL  457

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +++R FD+++V      PR+  GLTA + GGL   I +R
Sbjct  458   SVVRRFDVKIV-PPEVSPRFNSGLTAMLSGGLQAEIRER  495



>ref|XP_009401100.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=494

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/465 (62%), Positives = 362/465 (78%), Gaps = 9/465 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C++CKAY++SSW  E  NLCDWY+ LL +SPTGTIH+HVLGN +TANPANVEYML T+
Sbjct  33    CSCDVCKAYVSSSWAAEFDNLCDWYAHLLRESPTGTIHIHVLGNTVTANPANVEYMLRTR  92

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+NFPKGK F+++LGDLLG+GIF VDGD W+FQRKMAS   GSV++RSYAF IVA E+  
Sbjct  93    FDNFPKGKPFSALLGDLLGQGIFNVDGDAWRFQRKMASLALGSVAVRSYAFGIVAGEIGR  152

Query  1184  RLFPLLEFYGENRE--VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              L PLL    +  +  V+D QDV RRF+FD ICK SFG+D GCL+L +P+S+FAAAFD A
Sbjct  153   GLLPLLSSIADRGDGAVVDLQDVFRRFAFDTICKISFGLDRGCLELPMPMSEFAAAFDTA  212

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R    +P +WK+KRLLN+GSE++L   I +IN LAEE+I Q+RK G A    DL
Sbjct  213   SRLSARRGTATAPLIWKLKRLLNVGSERELKRTIRMINVLAEEVIRQRRKLGFASSH-DL  271

Query  830   LSRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             LSRFMG +  DDDK +RDIVISFLLAGRD +AS L+SFF LLSRH  V   +R E   + 
Sbjct  272   LSRFMGSVVDDDDKYIRDIVISFLLAGRDAVASGLSSFFLLLSRHHNVAKAMREEIAGVT  331

Query  656   EPD-QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             + D  D+ +Y+Q+++M+Y+ AAI+ESMRLFPPVQFDSKFCL DD LPDGTFV + TRVTY
Sbjct  332   KADGADVVSYEQLKEMHYVHAAIYESMRLFPPVQFDSKFCLEDDVLPDGTFVSRNTRVTY  391

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRMDSIWG DC EF+P RWL  GVF  E+L+KYPVFQAG RVCLGK++AL+EMK+
Sbjct  392   HPYAMGRMDSIWGPDCDEFRPGRWLRGGVFTPESLFKYPVFQAGQRVCLGKELALMEMKT  451

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             V V+++  FD+EV+   R + ++ PGLTAT+ GGL  R+   RP+
Sbjct  452   VIVSVVSKFDVEVLPGGRPL-KFVPGLTATINGGLPARVC--RPK  493



>ref|XP_009403729.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/461 (63%), Positives = 364/461 (79%), Gaps = 5/461 (1%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             +P C C +C+AYL+SSW  E  NLCDWY+ LL +SPTGTIH+HVLGN +TANPANVEYML
Sbjct  30    RPWCSCHVCEAYLSSSWAAEFDNLCDWYAHLLRESPTGTIHIHVLGNTVTANPANVEYML  89

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+NFPKGK F+++LGDLLG+GIF VDGD W+FQRKMAS   GSV++RSYAF IV+ E
Sbjct  90    RTRFDNFPKGKPFSALLGDLLGQGIFNVDGDAWRFQRKMASLALGSVAVRSYAFGIVSDE  149

Query  1193  VRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             +R  L PLL    +  + V+D QDV R+F+FD ICK SFG+D GCL+LS+P+S+FAAAFD
Sbjct  150   IRRCLLPLLSSVADRGDGVVDLQDVFRKFAFDTICKISFGLDRGCLELSMPMSEFAAAFD  209

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
              AS+LSA R    +P VWK+KRLLN+GSE++L  AI +IN LAEE+I Q+RK G A    
Sbjct  210   TASRLSARRGTATAPVVWKLKRLLNVGSERELKRAIRMINMLAEEVIRQRRKQGFASSH-  268

Query  836   DLLSRFMGIIDD-DKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             DLLSRFMG +++ DK LRDIVISFLLAGRD +AS LTSFF LLSRH +V   +R E   +
Sbjct  269   DLLSRFMGSVEEEDKYLRDIVISFLLAGRDAVASGLTSFFLLLSRHEDVAAAMRDEIASV  328

Query  659   MEPD-QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
              + D  D+ +Y+++++M+Y+ AAI+ESMRLFPPVQFDSKFCL DD LPDGTFV + TRVT
Sbjct  329   TKGDGDDVVSYERLKEMHYVHAAIYESMRLFPPVQFDSKFCLEDDVLPDGTFVSRNTRVT  388

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRM+SIWG D  EFKPERWL  GVF  E+L+KYPVFQAG RVCLGK++A+VEMK
Sbjct  389   YHPYAMGRMESIWGPDWGEFKPERWLRGGVFTPESLFKYPVFQAGQRVCLGKELAMVEMK  448

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRIT  180
             +V V+++  FD +V+   R + ++ PGLTAT+ GG+  R+T
Sbjct  449   TVIVSMVTKFDFKVLQGGRTI-KFVPGLTATISGGVPARVT  488



>ref|XP_007145327.1| hypothetical protein PHAVU_007G229700g [Phaseolus vulgaris]
 gb|ESW17321.1| hypothetical protein PHAVU_007G229700g [Phaseolus vulgaris]
Length=510

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/458 (61%), Positives = 359/458 (78%), Gaps = 2/458 (0%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
             +C CE C+AYLTSSW+    NLCDWY+ LL  SPT TIH+HVL N ITAN  NVEY+L T
Sbjct  47    ICSCETCQAYLTSSWSQCFHNLCDWYTHLLQTSPTKTIHIHVLRNTITANAENVEYILKT  106

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             +F NFPKGK F++ILGD LG+GIF VDGD W+FQ+KMA+ E  + +I  + FEIV +E+ 
Sbjct  107   RFHNFPKGKPFSAILGDFLGKGIFNVDGDAWRFQKKMATLELNNHAITFFGFEIVKSEIH  166

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL     N  VLD QDV RRFSFD+IC+FSFG+DP CL+ SLP+S+FA  FDLAS
Sbjct  167   NRLVPLLHASTRNGVVLDLQDVFRRFSFDSICRFSFGLDPKCLERSLPMSEFAVCFDLAS  226

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             KLSAERA+  SP+VWK KR  N+GSEK+L EA+ +IN LA E+I+QKR+ G + ++ DLL
Sbjct  227   KLSAERAMAFSPSVWKAKRFFNVGSEKRLREAVEVINALAREVIKQKREMGFSENK-DLL  285

Query  827   SRFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             SRFM  + DDD  LRDIV+SFLLAGRDT+ASALTSFF+LL +HPEV   IR E+ R++ P
Sbjct  286   SRFMSTVHDDDTYLRDIVVSFLLAGRDTVASALTSFFYLLGKHPEVESEIRVEADRVIGP  345

Query  650   DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
              +DL ++Q+++ ++YL AA+HESMRLFPP+QFDSKFCL +D LPDGT V  GTRVTYHPY
Sbjct  346   HKDLTSFQELKQLHYLEAAMHESMRLFPPIQFDSKFCLEEDVLPDGTKVESGTRVTYHPY  405

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGR++ IWG DC EF+P+RWL+DGVF  +  +KYP+FQAG RVC+GK MAL+E+K+V++
Sbjct  406   AMGRLEEIWGCDCLEFRPQRWLKDGVFHPKCPFKYPIFQAGLRVCVGKKMALMELKTVSL  465

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +L+R F I++V  S   PR++PGLTAT   GL V++ +
Sbjct  466   SLLRKFHIQLVEPSCGNPRFSPGLTATFSFGLPVKVCE  503



>ref|XP_004139575.1| PREDICTED: cytochrome P450 94A1-like [Cucumis sativus]
 ref|XP_004161430.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94A1-like [Cucumis 
sativus]
Length=504

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 370/463 (80%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +L P C C  C+AYL+SSW+    NL DWY+ LL+ SPT T+H+HV+ N++TANP NV++
Sbjct  41    RLNPCCNCSFCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQH  100

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L + F N+PKGK F+SILGDLLG GIF VDG  W+FQRKMAS E GS+S+RS+AFEI+ 
Sbjct  101   ILKSNFHNYPKGKPFSSILGDLLGHGIFNVDGHSWRFQRKMASLELGSLSLRSHAFEILT  160

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+R+RL P ++  G+  EV+D QDV RRFSFDNIC+FSFG+DPGCL L LP S+FA AF
Sbjct  161   TEIRSRLLPTMKGVGKTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPTSEFAVAF  220

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLAS+LSAERA+ ASP +W++K+++ +GSE+KL EAI +++ LA E+I Q+RK G + ++
Sbjct  221   DLASRLSAERAMAASPIIWRIKKMMRVGSERKLREAIKMVDRLAMEVIRQRRKMGFS-NR  279

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM   +DD+ LRDIV+SFLLAGRDT+ASALTS FWLLS++PEV   I +ES RI
Sbjct  280   NDLLSRFMASTNDDRYLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRI  339

Query  659   MEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             M PD+D + ++  +++M+YL A ++E+MRLFPPVQFDSKF   DD LPDGTFV+KGTRVT
Sbjct  340   MGPDRDAVPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVT  399

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRMD IWG DC +FKPERWL++G F  EN +K+PVFQAG RVCLGK++A++++K
Sbjct  400   YHPYAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVK  459

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              VAV LIR F I +    R + R+APGLTA+ RGGL VRI +R
Sbjct  460   CVAVVLIRKFKIRLAGTDR-IARFAPGLTASWRGGLPVRIEER  501



>ref|XP_009411963.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=506

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/454 (63%), Positives = 356/454 (78%), Gaps = 3/454 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+T SW     NLCDWY+ LL +SPT TIH+HVL N +TANP NVE+ML  +
Sbjct  41    CSCPVCEAYVTKSWAARFDNLCDWYAHLLRESPTRTIHIHVLRNTVTANPDNVEHMLRAR  100

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F++ILGDLLGRGIF VDGD W+FQRKMAS E GS ++R +A  IV AEVR 
Sbjct  101   FDNYPKGKPFSAILGDLLGRGIFNVDGDPWRFQRKMASAELGSTAVRFFACCIVTAEVRE  160

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PL +       VLD QDV RRF+FDN+CK SFG+DPGCL+LSLP S+FAAAFD AS 
Sbjct  161   RLLPLFDAACAGYAVLDLQDVFRRFAFDNMCKISFGLDPGCLELSLPASEFAAAFDKASM  220

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA +  P VW+ KRLLN GSE++L +AI L+N LA+E+I Q+RK G + +  DLLS
Sbjct  221   LSAWRATSTMPIVWRAKRLLNRGSERELRDAIRLVNLLAKELIRQRRKLGFSSNH-DLLS  279

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFM  +DDDK LRDI ISFLLAGRDT+ASALTSFF LLSRHP+V   +R E  R++    
Sbjct  280   RFMACVDDDKYLRDITISFLLAGRDTVASALTSFFLLLSRHPDVRSAMRDEIDRVVGRGA  339

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
               A+Y  +RD++Y+ AAIHESMRL+PPVQFDSKFCL+DD LPDGTFV +GTRVTYH YAM
Sbjct  340   ATASYDHLRDLHYVHAAIHESMRLYPPVQFDSKFCLDDDVLPDGTFVGRGTRVTYHAYAM  399

Query  464   GRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVAL  285
             GRM+ +WG+DC EF+P+RWL +G F  E+ YKYPVFQ G RVCLGK+MAL+EMK+V VA+
Sbjct  400   GRMEELWGSDCHEFRPQRWLRNGTFAPESPYKYPVFQGGLRVCLGKEMALMEMKTVIVAV  459

Query  284   IRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             +R FDI+V  ++   P++APGLTA+++GGL VRI
Sbjct  460   VRQFDIDV--QAAWPPKFAPGLTASLKGGLPVRI  491



>ref|XP_003596778.1| Cytochrome P450 [Medicago truncatula]
 gb|AES67029.1| cytochrome P450 family 94 protein [Medicago truncatula]
Length=498

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/461 (60%), Positives = 364/461 (79%), Gaps = 2/461 (0%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +S++K  C C IC +Y+T +W  E  NL DWY+ LL KSPTGTIH+HVL N IT NP N+
Sbjct  37    ISRMKLWCNCHICWSYITMNWAKEFINLSDWYTHLLKKSPTGTIHIHVLNNTITCNPQNI  96

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML T+F+N+PKGK F++ILGDLLG GIF VDG  W FQRKMAS E  SV++RSYA EI
Sbjct  97    EHMLKTRFDNYPKGKPFSTILGDLLGNGIFNVDGVSWNFQRKMASLELTSVTVRSYALEI  156

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +  E+ TRL P L  +  + +V D QD++RRFSFDNICKFSFG DP CL LSLPVS  AA
Sbjct  157   INEEIHTRLVPFLFSFSRDEKVFDLQDIMRRFSFDNICKFSFGWDPQCLQLSLPVSDLAA  216

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD ASK+SA RA++ SP +WK+KR  NIGSEKKL EAI ++N+L E++I+ +++ G + 
Sbjct  217   AFDTASKISARRALSPSPLIWKIKRFFNIGSEKKLKEAINVVNKLTEKIIKNRKEIGFSA  276

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              ++DLLSRFM  ++++K LRDIV SFLLAGRDT+A+ LT  FWLLS++ EV ++I+ E  
Sbjct  277   -RNDLLSRFMCSVNEEKYLRDIVASFLLAGRDTVAAGLTCLFWLLSKNQEVEEKIQEEVN  335

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
             R+M P  + A++++IR+M+YL A ++E++RLFPPVQFDSKF  NDD LPDG++V KG+RV
Sbjct  336   RVMNPAHEYASFKEIREMHYLNAVVYETLRLFPPVQFDSKFAKNDDVLPDGSYVTKGSRV  395

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYHPYAMGRM+ +WG+DCR FKPERWL+DGVF SE+++KYPVFQ G RVCLGK++AL+EM
Sbjct  396   TYHPYAMGRMERVWGSDCRVFKPERWLKDGVFVSESMFKYPVFQGGARVCLGKELALMEM  455

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             K V V LIR F+I V  +++++ ++ PGLTA+++ GL VR+
Sbjct  456   KCVVVGLIRRFEIRVDGDNQEL-KFGPGLTASLKDGLMVRV  495



>gb|KGN64915.1| hypothetical protein Csa_1G154090 [Cucumis sativus]
Length=531

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/463 (62%), Positives = 370/463 (80%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +L P C C  C+AYL+SSW+    NL DWY+ LL+ SPT T+H+HV+ N++TANP NV++
Sbjct  68    RLNPCCNCSFCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQH  127

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L + F N+PKGK F+SILGDLLG GIF VDG  W+FQRKMAS E GS+S+RS+AFEI+ 
Sbjct  128   ILKSNFHNYPKGKPFSSILGDLLGHGIFNVDGHSWRFQRKMASLELGSLSLRSHAFEILT  187

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+R+RL P ++  G+  EV+D QDV RRFSFDNIC+FSFG+DPGCL L LP S+FA AF
Sbjct  188   TEIRSRLLPTMKGVGKTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPTSEFAVAF  247

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLAS+LSAERA+ ASP +W++K+++ +GSE+KL EAI +++ LA E+I Q+RK G + ++
Sbjct  248   DLASRLSAERAMAASPIIWRIKKMMRVGSERKLREAIKMVDRLAMEVIRQRRKMGFS-NR  306

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM   +DD+ LRDIV+SFLLAGRDT+ASALTS FWLLS++PEV   I +ES RI
Sbjct  307   NDLLSRFMASTNDDRYLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRI  366

Query  659   MEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             M PD+D + ++  +++M+YL A ++E+MRLFPPVQFDSKF   DD LPDGTFV+KGTRVT
Sbjct  367   MGPDRDAVPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVT  426

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRMD IWG DC +FKPERWL++G F  EN +K+PVFQAG RVCLGK++A++++K
Sbjct  427   YHPYAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVK  486

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              VAV LIR F I +    R + R+APGLTA+ RGGL VRI +R
Sbjct  487   CVAVVLIRKFKIRLAGTDR-IARFAPGLTASWRGGLPVRIEER  528



>ref|XP_010557399.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=492

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/464 (62%), Positives = 355/464 (77%), Gaps = 6/464 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AY+TSSW  +  NLCDWYS LL +SPT TI VHVL NVITANP NVE++L T+
Sbjct  28    CNCEICHAYITSSWRNDFDNLCDWYSHLLRRSPTLTIQVHVLNNVITANPDNVEHVLKTR  87

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK++S E GSVS+R +A +I+  E+  
Sbjct  88    FDNYPKGKQFSDILGDLLGRGIFNSDGDTWRFQRKLSSLELGSVSVRIFAHDIIKNEIEM  147

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL  +G++   LD QD  RRFSFD I K SFG DP CL L L  S+   AFD+AS 
Sbjct  148   RLVPLLNSFGDHGLDLDLQDAFRRFSFDTISKLSFGFDPVCLRLPLTSSELVDAFDMAST  207

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA+  SP  WK+KR LNIGSEKKL ++I +IN L  ++I+Q+RK G   + +DL+S
Sbjct  208   LSAHRALAPSPLFWKIKRFLNIGSEKKLKQSIDVINRLVGDLIKQRRKKGSGMNNNDLIS  267

Query  824   RFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD  648
             RFM ++ DDD+ LRDIV++FLLAGRDT+A+ LT FFWLL+RHPEV +RIR E  R+M P 
Sbjct  268   RFMAVVGDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLNRHPEVENRIREELERVMGPG  327

Query  647   QD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHP  474
              D   A++ Q+++MNYL + ++ESMRL PPVQFDSKF LN+D L DGTFV  G RVTYHP
Sbjct  328   LDPVTASFNQMQEMNYLHSTVYESMRLLPPVQFDSKFALNNDILADGTFVESGARVTYHP  387

Query  473   YAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             YAMGRMD +WG DC EF+PERWL+  G F+ EN  KYPVFQAGPRVC+GKDMA++EMKSV
Sbjct  388   YAMGRMDRVWGPDCEEFRPERWLDSAGKFRPENPVKYPVFQAGPRVCVGKDMAIMEMKSV  447

Query  296   AVALIRAFDIEVVCES--RQMPRYAPGLTATVRGGLSVRITDRR  171
             AV +IR F+I VV  +   + PR+APGLTATV GGL +R+ +RR
Sbjct  448   AVTIIRRFEIRVVGSNPISRAPRFAPGLTATVSGGLPIRVRERR  491



>ref|XP_010521668.1| PREDICTED: cytochrome P450 94C1-like [Tarenaya hassleriana]
Length=493

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/467 (63%), Positives = 357/467 (76%), Gaps = 9/467 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  E  NLCDWYS LL +SPT TI VHVL NV+TANPANVE++L T+
Sbjct  26    CNCEICHAYLTSSWRNEFDNLCDWYSHLLRRSPTSTIKVHVLNNVVTANPANVEHVLKTR  85

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK++S E GSVS+R++A +IV  E+ T
Sbjct  86    FDNYPKGKQFSDILGDLLGRGIFNSDGDAWRFQRKLSSIELGSVSVRAFAHDIVRDEIET  145

Query  1184  RLFPLLEFY---GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDL  1014
             RL PLL+ +     +   LD QDV RRFSFD I K SFG+DP CL L L  S+FA AFD+
Sbjct  146   RLVPLLQHFDDDRGDDLDLDLQDVFRRFSFDTISKLSFGLDPVCLRLPLTTSEFAVAFDI  205

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             AS LSA+RA++ SP  WK+KR LNIGSEKKL ++I +IN LA E+I Q+RK G   D +D
Sbjct  206   ASTLSAQRALSPSPIFWKIKRFLNIGSEKKLKQSIDVINRLAGELINQRRKTGLGMDNND  265

Query  833   LLSRFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             L+SRFM ++ DDD+ LRDIV+SFLLAGRDT+AS LT  FWLL+RHPEV +RI  E  R+M
Sbjct  266   LISRFMAVVGDDDEYLRDIVVSFLLAGRDTVASGLTGVFWLLNRHPEVKNRILEELDRVM  325

Query  656   EPDQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
              P  D   AT+ Q+R+MNYL A ++ESMRL PPVQFDSKF LNDD L DGTFV  GTRVT
Sbjct  326   GPGLDPVTATFDQMREMNYLHATLYESMRLLPPVQFDSKFALNDDVLADGTFVEIGTRVT  385

Query  482   YHPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             YHPYAM RM  +WG DC EF+PERWL+  G F+ EN  KYPVFQAG R+C+GKD+A++EM
Sbjct  386   YHPYAMARMGRVWGPDCEEFRPERWLDKTGNFRPENPVKYPVFQAGARICIGKDLAIMEM  445

Query  305   KSVAVALIRAFDIEVVCES--RQMPRYAPGLTATVRGGLSVRITDRR  171
             KSVA A+IR F+I VV      + P++APGLTAT+ GGL VR+  RR
Sbjct  446   KSVAAAIIRRFEIRVVVTDPISRTPKFAPGLTATMSGGLPVRVRQRR  492



>ref|XP_009388367.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=502

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/457 (64%), Positives = 359/457 (79%), Gaps = 2/457 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +CKAY+TSSW+ E  NLCDWY+ LL +SPT TI VHVLG  +TANP NVE+ML T+
Sbjct  38    CNCAVCKAYVTSSWSAEFDNLCDWYAHLLRESPTRTITVHVLGCTVTANPDNVEHMLKTR  97

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK FASILGDLLGRGIF VDG+ W+FQRKMAS E GS ++R +A +IVA EV  
Sbjct  98    FENYPKGKPFASILGDLLGRGIFNVDGEHWRFQRKMASAELGSAAVRVFASQIVAEEVGF  157

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL+   +N  VLD QDV RR +FD+ICK SFG+DPGCL LSLP+S+FAAAFD A++
Sbjct  158   RLLPLLDMACKNDAVLDLQDVFRRLAFDSICKISFGLDPGCLQLSLPMSEFAAAFDKATR  217

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             L A RA    PA+WKVKRL N GSE ++ EAI L++ LA+E++ Q+RK G A DQ DLLS
Sbjct  218   LLAGRATHTIPAIWKVKRLFNRGSEGQIREAIELVDLLAKEVVHQRRKYGFASDQ-DLLS  276

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFM  ID+D+ LRDIVISF+LAGRDT+ASALTSFF LLSR+P V   IR E   I+    
Sbjct  277   RFMRCIDNDRYLRDIVISFVLAGRDTVASALTSFFMLLSRYPAVCSAIRDEVEDIVGNAP  336

Query  644   DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAM  465
              LA+Y Q+R+++YL AA++ESMRL+PPVQFDSKFCL+DD LPDGTFVRKGTR+TYH YAM
Sbjct  337   ALASYDQLRELHYLHAALYESMRLYPPVQFDSKFCLDDDVLPDGTFVRKGTRMTYHAYAM  396

Query  464   GRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVAL  285
             GRM+ +WG+D  EF+PERW+  G F  E+ +KYPVF  G RVCLGK+MAL+EMKSV   +
Sbjct  397   GRMEELWGSDYAEFRPERWIRHGQFVPESPFKYPVFHGGLRVCLGKEMALMEMKSVVALV  456

Query  284   IRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             IR FD++V+  +R  P++APGLTAT+ GGL+VR   R
Sbjct  457   IRDFDVDVLGGNRP-PKFAPGLTATLSGGLAVRARRR  492



>ref|XP_008461642.1| PREDICTED: cytochrome P450 94C1 [Cucumis melo]
Length=504

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/463 (61%), Positives = 368/463 (79%), Gaps = 3/463 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +L P C C +C+AYL+SSW+    NL DWY+ LL+ SPT T+H+HV+ N++TANP NV++
Sbjct  41    RLNPCCNCSLCRAYLSSSWSSSFPNLSDWYTHLLSHSPTATLHLHVISNIVTANPDNVQH  100

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L + F N+PKGK F+SILGDLLG GIF VDG  W++QRKMAS E GS+S+RS+AFEI+ 
Sbjct  101   ILKSNFHNYPKGKPFSSILGDLLGHGIFNVDGHSWRYQRKMASLELGSLSLRSHAFEILT  160

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+R+RL P +   G   EV+D QDV RRFSFDNIC+FSFG+DPGCL L LP+S+FA AF
Sbjct  161   TEIRSRLVPTVNGIGRTMEVVDLQDVFRRFSFDNICRFSFGLDPGCLRLWLPMSEFAVAF  220

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             DLAS+LSAERA+  SP +W++K++L +GSE+KL EAI +++ LA E+I Q+R+ G + ++
Sbjct  221   DLASRLSAERAMAPSPIMWRIKKMLRVGSERKLREAIKMVDGLAMEVIRQRREMGFS-NR  279

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM   +DD+ LRDIV+SFLLAGRDT+ASALTS FWLLS++PEV   I +ES RI
Sbjct  280   NDLLSRFMASTNDDRYLRDIVVSFLLAGRDTVASALTSLFWLLSQNPEVETEIISESDRI  339

Query  659   MEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             M PD+D   ++  +++M+YL A ++E+MRLFPPVQFDSKF   DD LPDGTFV+KGTRVT
Sbjct  340   MGPDRDRFPSFDNLKEMHYLQAVVYENMRLFPPVQFDSKFAEEDDILPDGTFVQKGTRVT  399

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGRMD IWG DC +FKPERWL++G F  EN +K+PVFQAG RVCLGK++A++++K
Sbjct  400   YHPYAMGRMDRIWGLDCLQFKPERWLKNGYFTPENPFKFPVFQAGLRVCLGKELAVMDVK  459

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              VAV LIR F I +    R + R+APGLTA+ RGGL VRI +R
Sbjct  460   CVAVVLIRKFKIRLAGTDR-IARFAPGLTASWRGGLPVRIEER  501



>ref|XP_009414555.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=512

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/465 (63%), Positives = 360/465 (77%), Gaps = 4/465 (1%)
 Frame = -1

Query  1559  KLKPL-CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVE  1383
             +++P  C C +C+AY+TSSW  +  NLCDWY+ LL  SPT T+ VHVLG  +TAN  NVE
Sbjct  32    RIRPWWCNCAVCQAYVTSSWAADFDNLCDWYTHLLRTSPTRTVTVHVLGCTVTANSDNVE  91

Query  1382  YMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIV  1203
             +ML T+F+N+PKGK FA+ILGDLLGRGIF VDGDLW+FQRKMAS E GS ++R++A   V
Sbjct  92    HMLKTRFDNYPKGKPFATILGDLLGRGIFNVDGDLWRFQRKMASTELGSAAVRAFASRTV  151

Query  1202  AAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             AAEV  RL PLL+   E   VLD QDV +RF+FDNICK SFG+DPGC +LSL +S+FAAA
Sbjct  152   AAEVGGRLLPLLDVACECGRVLDLQDVFQRFAFDNICKISFGLDPGCFELSLSLSEFAAA  211

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FD A++LSA RA    P +WK KRL N GSE++L EAIGL++ LA+E+I Q+RK G A D
Sbjct  212   FDKATRLSARRATHTIPLIWKAKRLFNWGSERELREAIGLVDLLAKEVILQRRKLGFASD  271

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             Q DLLSRFMG +D+DK LRDIV+SF+LAGRDT+ASALTSFF LLSRHP     IR E   
Sbjct  272   Q-DLLSRFMGCVDNDKYLRDIVVSFMLAGRDTVASALTSFFMLLSRHPAACTAIRDEVEL  330

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+   Q L +  Q+R M+YL AAI ESMRL+PPVQFDSKFCL+DD LPDGTFVRKGTR+T
Sbjct  331   IVGNSQALPSCDQLRKMHYLNAAICESMRLYPPVQFDSKFCLDDDVLPDGTFVRKGTRMT  390

Query  482   YHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             YH YAMGRM+ +WG+D  EF+PERWL   G F  E+ +KYPVFQ G RVCLGK+MAL+EM
Sbjct  391   YHVYAMGRMEDLWGSDWAEFRPERWLRHTGAFTPESPFKYPVFQGGLRVCLGKEMALMEM  450

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             KSV  +++R FD+EV+ E  + P++APGLTA   GGL+VR+  R+
Sbjct  451   KSVIASVVREFDVEVI-EGNRPPKFAPGLTAIFSGGLAVRVHRRK  494



>ref|XP_008801229.1| PREDICTED: cytochrome P450 94C1 [Phoenix dactylifera]
Length=522

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/461 (61%), Positives = 365/461 (79%), Gaps = 5/461 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+TSSW  +  NL DWY+ LL +SPT TIH+HVL N ITANP NVE+ML ++
Sbjct  38    CNCPVCEAYVTSSWRADFDNLSDWYTHLLRQSPTRTIHIHVLRNTITANPDNVEHMLKSR  97

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F+SILGD LGRGIF VDGDLW+FQR +AS E GS+S+RS+AF IV++EV  
Sbjct  98    FDNYPKGKPFSSILGDFLGRGIFNVDGDLWRFQRMLASAELGSMSVRSFAFRIVSSEVCR  157

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL+   +  +VLDFQ+V RRF+FDNICK SFG+DPGCL+LSLP+S+FAAAFD AS+
Sbjct  158   RLLPLLDSAADTGQVLDFQNVFRRFAFDNICKISFGLDPGCLELSLPMSEFAAAFDTASR  217

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA    PA+WK KRLLN GSE++L  AI +++ LAEE+I Q+RK G +    DLLS
Sbjct  218   LSARRAAATVPAIWKAKRLLNSGSERELRRAIRVLDLLAEELICQRRKLGFSSSH-DLLS  276

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM---E  654
             RFM  +DDD+ LRDIV+SF+LAGRDT++SALTSFF LLSRHP    +IR+E  ++     
Sbjct  277   RFMVSVDDDRYLRDIVVSFMLAGRDTVSSALTSFFMLLSRHPAAQSKIRSEIEQVTWSGG  336

Query  653   PDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHP  474
                  A+Y Q+R+M+Y+ AA++ESMRL+PPVQF+SKF ++DD LPDGTF+ +GTRVTYH 
Sbjct  337   GGGGGASYDQLREMHYVRAALYESMRLYPPVQFNSKFSVDDDILPDGTFISRGTRVTYHA  396

Query  473   YAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVA  294
             YAMGRM+ +WG DC EF+PERWL++GVF  EN +KYPVFQ G RVCLGK+MAL+EMK+V 
Sbjct  397   YAMGRMEELWGTDCGEFRPERWLKNGVFACENPFKYPVFQGGLRVCLGKEMALMEMKTVI  456

Query  293   VALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
              ++++ FD++V+  SR  P+++PGLTA + GGL VR+  R+
Sbjct  457   ASVVQGFDVDVIDGSRP-PKFSPGLTAGLEGGLPVRVRRRK  496



>ref|XP_009393377.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=520

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/464 (63%), Positives = 359/464 (77%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+T+SW     NLCDWY+ LL +SPT TIH+HVL N +TANP NVE+ML  +
Sbjct  46    CSCPVCEAYVTNSWAARFDNLCDWYAHLLRESPTRTIHIHVLRNTVTANPDNVEHMLRAR  105

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F++ILGDLLGRGIF VDGD W FQRKMAS E G  S+R +A   VA+EVR 
Sbjct  106   FDNYPKGKPFSAILGDLLGRGIFNVDGDPWCFQRKMASAELGGASVRFFASCAVASEVRG  165

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL+       VLD QDV RRF+FD++CK SFG+DPGCL+LSLP+S FAAAFD AS+
Sbjct  166   RLLPLLDVACGGGRVLDLQDVFRRFAFDSMCKISFGLDPGCLELSLPMSDFAAAFDKASR  225

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA    P VWK KRLLN GSE++LG+AIGL+N LA+E+I Q+RK G + +  DLLS
Sbjct  226   LSAWRATATMPLVWKAKRLLNWGSERELGDAIGLVNLLAKELIRQRRKLGFSSNH-DLLS  284

Query  824   RFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             RFM  +  DDDK LRDI+ISFLLAGRDT+ASALT FF+LLSRHP+V   IR E  R++E 
Sbjct  285   RFMACVDDDDDKYLRDIIISFLLAGRDTVASALTCFFFLLSRHPDVRSAIRDEIDRVVER  344

Query  650   DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
             D   A+Y Q+RD+ Y+ AAI+ESMRL+PPVQFDSKFCL DD LPDGT VR+GTRVTYH Y
Sbjct  345   DAVTASYDQLRDLQYVHAAIYESMRLYPPVQFDSKFCLEDDVLPDGTAVRRGTRVTYHAY  404

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGRM+ +WG+DC EF+PERWL +G F  E+ YKYPVFQ G RVCLGK+MAL+EMK+V  
Sbjct  405   AMGRMEELWGSDCSEFRPERWLRNGAFNPESPYKYPVFQGGVRVCLGKEMALMEMKTVIT  464

Query  290   ALIRAFDIEVVCE-----SRQMPRYAPGLTATVRGGLSVRITDR  174
             A++R FD+EV+         + P++A GLTA+++GGL VR+  R
Sbjct  465   AVVRQFDVEVISADEGGGGNRPPKFATGLTASLKGGLPVRVRRR  508



>emb|CBI30267.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/463 (62%), Positives = 356/463 (77%), Gaps = 24/463 (5%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             +LK  C CEIC +Y+T SW+ +  NLCDWY+ LL  SPT TIHVHVLGN ITAN  NVEY
Sbjct  46    RLKLWCNCEICHSYVTLSWSKQFHNLCDWYTHLLRNSPTQTIHVHVLGNTITANQDNVEY  105

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+FEN+PKGK F++ILGD LGRGIF VDG+LW+FQRKMAS E G  SIRSYAFEIV 
Sbjct  106   MLKTRFENYPKGKPFSAILGDFLGRGIFNVDGELWRFQRKMASLELGRTSIRSYAFEIVN  165

Query  1199  AEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
              E+  RL PLL     N + VLD QDV RRFSFD+IC+FSFG+DPGCL+L          
Sbjct  166   YEIERRLLPLLWSVAGNEDGVLDLQDVFRRFSFDSICRFSFGLDPGCLEL----------  215

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
                        A+ ASP VW++KR+LN+G+EKKL +AI LIN LA+E+I+QKRK G +  
Sbjct  216   -----------AMAASPLVWRIKRVLNLGTEKKLRKAIKLINILAQEVIKQKRKMGFSAH  264

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             + DLLS FM  ++DD  LRDIVISFLLAGRDT+ASALTSFFWLLS HP+V   IR+E+ +
Sbjct  265   K-DLLSLFMRNLNDDTYLRDIVISFLLAGRDTVASALTSFFWLLSNHPKVGAAIRSEADK  323

Query  662   IMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
             I+ PDQ++ +++Q+++++YL AA+HESMRL+PP+QFDSKFC  DD LPDGTFV++GTRVT
Sbjct  324   IIGPDQEVTSFEQMQELHYLQAAVHESMRLYPPIQFDSKFCQEDDVLPDGTFVQRGTRVT  383

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR++ IWG DC EFKPERWL+DGVF  EN +KYPVFQAG RVCLGK+MAL+E K
Sbjct  384   YHPYAMGRIEGIWGPDCLEFKPERWLKDGVFFPENPFKYPVFQAGIRVCLGKEMALMEFK  443

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             SVA++L+R F IE+      +PR++PGLTAT   GL V +  R
Sbjct  444   SVALSLVRRFHIELATPC-PIPRFSPGLTATFGSGLPVLVRGR  485



>gb|KHN18751.1| Cytochrome P450 94A1 [Glycine soja]
Length=597

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/530 (55%), Positives = 374/530 (71%), Gaps = 67/530 (13%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CE C+AYLTS W+    NLCDWY+ LL  SPT TIH+HVL N ITANP NVEYML T
Sbjct  58    FCSCETCQAYLTSGWSKTFDNLCDWYAHLLRNSPTKTIHIHVLRNTITANPDNVEYMLKT  117

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             +F NFPKGK F++ILGD LGRGIF VDG+ W FQ+KMAS E    SIRS+AFE+V  E++
Sbjct  118   RFHNFPKGKTFSTILGDFLGRGIFNVDGESWSFQKKMASLELSKNSIRSFAFEVVKFEIK  177

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL    +N  VLD QDV +RFSFD+IC+FSFG+DP CL+LSLP+S+FA +FDLAS
Sbjct  178   DRLIPLLVLSKQNDCVLDLQDVFKRFSFDSICRFSFGLDPMCLELSLPISEFAMSFDLAS  237

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR---DQS  837
             KLSAERA++ SP +WK+KR LN+GSEKKL +AI +I+ LA E+I Q+RK G +     + 
Sbjct  238   KLSAERAMSVSPLIWKIKRFLNVGSEKKLRKAIKMIDILAREVIRQRRKMGFSSISPHKD  297

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFM  I DD  L+DI++SFLLAGRDT+ASALTSFFWLL++HPEV  +I  E+ +++
Sbjct  298   DLLSRFMRTITDDTYLKDIIVSFLLAGRDTVASALTSFFWLLAKHPEVESQILLEAEQVI  357

Query  656   EPD--QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
               D  +DL +Y++++ ++YL AA +ESMRL+PP+QFDSKFCL DD LPDGTFV++GTRVT
Sbjct  358   GSDYNKDLTSYEELQQLHYLQAAANESMRLYPPIQFDSKFCLEDDVLPDGTFVKRGTRVT  417

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YHPYAMGR++ IWG+DC EF+PERWL++G+F  +N +KYPVFQAG RVCLGK+MAL+E+K
Sbjct  418   YHPYAMGRLEEIWGSDCFEFRPERWLKEGLFCPQNPFKYPVFQAGIRVCLGKEMALLELK  477

Query  302   SVAVALIRAFDIEV------------------------------VCESRQM---------  240
             SVA++L+R F IE+                              VC  ++M         
Sbjct  478   SVALSLLRRFHIELAAPPPPHHHHSTLFCPQNPFKYPVFQAGIRVCLGKEMALLELKSVA  537

Query  239   -----------------------PRYAPGLTATVRGGLSVRITDRRPQRQ  159
                                    PR++PGLTAT   GL V++ ++  Q++
Sbjct  538   LSLLRRFHIELEPPPPHHHHHSTPRFSPGLTATFSCGLRVKVREQGTQQR  587



>ref|XP_004516191.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=520

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/475 (59%), Positives = 357/475 (75%), Gaps = 17/475 (4%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CEIC+AYLTSSW+ + +NL DWY+ LL KSPT TIH+HVL N IT+N  NVEYML T
Sbjct  49    FCSCEICQAYLTSSWSKDFNNLSDWYTHLLKKSPTKTIHIHVLRNTITSNSENVEYMLKT  108

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVR  1188
             KFEN+PKGK F+ ILGD LGRGIF VDG+LWKFQ+KMAS E    SIRS+AFE+V  E++
Sbjct  109   KFENYPKGKPFSMILGDFLGRGIFNVDGELWKFQKKMASLEINKHSIRSFAFEVVNNEIQ  168

Query  1187  TRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
              RL PLL+   +N  VLD QDV +R SFD IC+FSFG+DP CL+ SLP+S FA +FDLAS
Sbjct  169   NRLIPLLQ--NQNDVVLDLQDVFKRLSFDAICRFSFGLDPMCLEKSLPMSDFALSFDLAS  226

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             KLSAERA+T SP +WK+KR  N+GSEK+L ++I +IN LA+ +I Q+RK G   DQ DLL
Sbjct  227   KLSAERAMTVSPLIWKIKRFFNLGSEKELKKSITMINTLAKVVINQRRKMGFC-DQKDLL  285

Query  827   SRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD  648
             SRFM  + DD  LRDIVISFLLAGRDT+AS+LTSFFWLL+++PEV  +I  E+ R++   
Sbjct  286   SRFMSTVQDDIFLRDIVISFLLAGRDTVASSLTSFFWLLAKNPEVESQILLEAERVIGIG  345

Query  647   QDLAT---------YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
             +             ++Q+  ++YL AA HESMRL+PP+QFDSKFCL DD LPDGT V+ G
Sbjct  346   KHNKNNNNINVVTNFEQLTKLHYLEAATHESMRLYPPIQFDSKFCLEDDVLPDGTKVKSG  405

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             TRVTYHPYAMGR++ +WG DC EFKP+RWL+DGVF  +N +KYP+FQ G RVC+GK+MAL
Sbjct  406   TRVTYHPYAMGRLEELWGPDCLEFKPQRWLKDGVFHPQNQFKYPIFQGGLRVCIGKEMAL  465

Query  314   VEMKSVAVALIRAFDIEVVCES-----RQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             +E+K+V ++L+  F  E+  ++       +PR++PGLTAT   GL V +  R  Q
Sbjct  466   MELKTVVLSLLTNFHFELADQNTFHGFNHLPRFSPGLTATFAFGLPVFVRQRGNQ  520



>ref|XP_006294094.1| hypothetical protein CARUB_v10023087mg [Capsella rubella]
 gb|EOA26992.1| hypothetical protein CARUB_v10023087mg [Capsella rubella]
Length=492

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/464 (63%), Positives = 353/464 (76%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T 
Sbjct  29    CNCEICNAYLTSSWRKDFVNLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHILKTH  88

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  89    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRNEIET  148

Query  1184  RLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + ++   VLD QDV RRFSFD I K SFG DP CL L LP S+FA AFD AS
Sbjct  149   RLLPILTSFSDSPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAFDTAS  208

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+ + P +WK+KR   IGSEKKL E+I +IN LA ++I+Q+R  G     +DL+
Sbjct  209   TLSAKRALASFPLLWKLKRFFRIGSEKKLKESIDVINRLAGDLIKQRRLTGLV-GNNDLI  267

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV+SFLLAGRDT+A+ LT FFWLL+RHP+V +RI+ E  R+M 
Sbjct  268   SRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKVENRIQEELDRVMG  327

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                D   A+  ++RDMNYL A ++ESMRLFPPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  328   TGFDSVTASCNEMRDMNYLHATLYESMRLFPPVQFDSKFALNDDVLADGTFVKRGTRVTY  387

Query  479   HPYAMGRMDSIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRM  IWG DC EFKPERWL+ D  F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  388   HAYAMGRMGRIWGPDCEEFKPERWLDNDSKFRPENPVKYPVFQAGARVCVGKEMAIMEMK  447

Query  302   SVAVALIRAFDIEVVC-ESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+IR F+  V C ES  M R+APGLTATV GGL V I +R
Sbjct  448   SIAVAIIRRFETRVACPESTDMLRFAPGLTATVSGGLPVLIQER  491



>ref|XP_009103613.1| PREDICTED: cytochrome P450 94C1 [Brassica rapa]
Length=497

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/466 (62%), Positives = 352/466 (76%), Gaps = 6/466 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +V+TANP+NVE+ML T+
Sbjct  28    CSCEICHAYLTSSWRNDFVNLGDWYAHLLRRSPTSTIKVHVLNSVVTANPSNVEHMLKTR  87

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  88    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  147

Query  1184  RLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  F  E   VLD QDV RRFSFD I K SFG DP CL    P S+FA AFD AS
Sbjct  148   RLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAFDTAS  207

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WKVKR+  IGSEK+L E+I +IN LA ++I+Q+R  G     +DL+
Sbjct  208   TLSAKRALAPFPLLWKVKRMFKIGSEKELKESINVINRLAGDLIKQRRLTGLTNKNNDLI  267

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDDK LRDIV+SFLLAGRDT+A+ LT FFWLL+RHP++ +RIR E  R+M 
Sbjct  268   SRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREELDRVMG  327

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             P  D   A+  ++R+M+YL AA++ESMRL+PPVQFDSKF LNDD L DGT V  GTRVTY
Sbjct  328   PGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALNDDVLADGTRVTGGTRVTY  387

Query  479   HPYAMGRMDSIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             HPYAMGRM  IWG D  EFKPERWL+ +G F+SEN  KYP+FQAG RVC+GK+MA++EMK
Sbjct  388   HPYAMGRMSRIWGPDYEEFKPERWLDKEGKFRSENPVKYPIFQAGARVCVGKEMAIMEMK  447

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             S+AVA+I+ F+  V   S +  R+APGLTATV GGL V I +R+ +
Sbjct  448   SIAVAMIKKFETRVKGGSTETLRFAPGLTATVNGGLPVLIQERKAE  493



>ref|NP_180337.1| cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
 sp|Q9ZUX1.1|C94C1_ARATH RecName: Full=Cytochrome P450 94C1 [Arabidopsis thaliana]
 gb|AAK43912.1|AF370593_1 putative cytochrome P450 [Arabidopsis thaliana]
 gb|AAL58931.1|AF462844_1 At2g27690/F15K20.21 [Arabidopsis thaliana]
 gb|AAC73031.1| putative cytochrome P450 [Arabidopsis thaliana]
 gb|ABA61324.1| cytochrome P450 CYP94C1 [Arabidopsis thaliana]
 gb|ABH04493.1| At2g27690 [Arabidopsis thaliana]
 gb|AEC08026.1| cytochrome P450, family 94, subfamily C, polypeptide 1 [Arabidopsis 
thaliana]
Length=495

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/464 (63%), Positives = 353/464 (76%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T 
Sbjct  32    CNCEICHAYLTSSWKKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHILKTN  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  92    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  151

Query  1184  RLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + +N   VLD QDV RRFSFD I K SFG DP CL L  P+S+FA AFD AS
Sbjct  152   RLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPISEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WK KRLL IGSEKKL E+I +IN LA ++I+Q R+  G   ++DL+
Sbjct  212   LLSAKRALAPFPLLWKTKRLLRIGSEKKLQESINVINRLAGDLIKQ-RRLTGLMGKNDLI  270

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV+SFLLAGRDT+A+ LT FFWLL+RHPEV +RIR E  R+M 
Sbjct  271   SRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPEVENRIREELDRVMG  330

Query  653   PDQDLATYQ--QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                D  T +  ++R+M+YL A+++ESMRLFPPVQFDSKF LNDD L DGTFV  GTRVTY
Sbjct  331   TGFDSVTARCDEMREMDYLHASLYESMRLFPPVQFDSKFALNDDVLSDGTFVNSGTRVTY  390

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRMD IWG D  EFKPERWL++ G F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  391   HAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCIGKEMAIMEMK  450

Query  302   SVAVALIRAFDIEVVC-ESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+IR F+  V   E+ +  R+APGLTATV GGL V I +R
Sbjct  451   SIAVAIIRRFETRVASPETTETLRFAPGLTATVNGGLPVMIQER  494



>emb|CDY04506.1| BnaA07g13320D [Brassica napus]
Length=492

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/464 (62%), Positives = 350/464 (75%), Gaps = 6/464 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE+ML T+
Sbjct  28    CNCEICHAYLTSSWRNDFVNLGDWYAHLLRRSPTSTIKVHVLNSVITANPSNVEHMLKTR  87

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  88    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  147

Query  1184  RLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  F  E   VLD QDV RRFSFD I K SFG DP CL    P S+FA AFD AS
Sbjct  148   RLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAFDTAS  207

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WKVKR+  IGSEK+L E+I  IN LA ++I+Q+R  G     +DL+
Sbjct  208   MLSAKRALAPFPLLWKVKRMFKIGSEKELKESINAINRLAGDLIKQRRLTGLTNKNNDLI  267

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDDK LRDIV+SFLLAGRDT+A+ LT FFWLL+RHP++ +RIR E  R+M 
Sbjct  268   SRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREELDRVMG  327

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             P  D   A+  ++R+M+YL AA++ESMRL+PPVQFDSKF LNDD L DGT V  GTRVTY
Sbjct  328   PGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALNDDVLADGTRVTGGTRVTY  387

Query  479   HPYAMGRMDSIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             HPYAMGRM  IWG D  EFKPERWL+ +G F+SEN  KYP+FQAG RVC+GK+MA++EMK
Sbjct  388   HPYAMGRMSRIWGPDYEEFKPERWLDKEGKFRSENPVKYPIFQAGARVCVGKEMAIMEMK  447

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             S+AVA+I+ F+  V   S +  R+APGLTATV GGL V I +R+
Sbjct  448   SIAVAMIKKFETRVKGGSTETLRFAPGLTATVNGGLPVIIQERK  491



>ref|XP_008776666.1| PREDICTED: cytochrome P450 94C1-like [Phoenix dactylifera]
Length=515

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/467 (62%), Positives = 366/467 (78%), Gaps = 8/467 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+TSSWT +  NLCDWY+ LL +SPT TIH+HVL N ITANP NVE+ML T+
Sbjct  38    CNCPVCEAYVTSSWTADFDNLCDWYAHLLQQSPTRTIHIHVLCNTITANPDNVEHMLKTR  97

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F+ ILGD LGRGIF VDGD+W+FQRK+ S   GS S+RS+A  IV++E+R 
Sbjct  98    FDNYPKGKPFSLILGDFLGRGIFNVDGDVWRFQRKITSIALGSTSVRSFACRIVSSEIRH  157

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL+      +  DFQDV RRF+FDNICK SFG+D GCL+LSLP+S+FAAAFD AS+
Sbjct  158   RLLPLLDSLANTGQAFDFQDVFRRFAFDNICKISFGLDSGCLELSLPMSEFAAAFDTASR  217

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA  A+P VWK KR LN GSE++L  AI L+N LAEE I Q+RK G +    DLLS
Sbjct  218   LSALRAAAAAPVVWKAKRFLNWGSERELRRAIQLVNLLAEEAIRQRRKLGFSSSH-DLLS  276

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFM  ID+D  LRDIVISF+LAGRDT+ASALTSFF LLSRHP V   IR E   +     
Sbjct  277   RFMASIDNDCYLRDIVISFMLAGRDTVASALTSFFMLLSRHPAVLSNIRREIELVTRSGG  336

Query  644   D-----LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             D     +A+Y+Q+++M+Y+ AA++ESMRL+PPVQFDSKFC++DD LPDGTFV +GT+VTY
Sbjct  337   DGSGSAVASYEQLKEMHYVHAALYESMRLYPPVQFDSKFCVDDDVLPDGTFVSRGTKVTY  396

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             H YAMGRM+ +WG+DCREF+PERWL +G+F  EN ++YPVFQ G RVCLGK+MAL+EMK+
Sbjct  397   HAYAMGRMEELWGSDCREFQPERWLRNGMFTCENPFRYPVFQGGLRVCLGKEMALMEMKN  456

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             V VA+++ FD+++V  SR  P+++PGLTA++ GGL VR+  RR Q++
Sbjct  457   VIVAVVQGFDVDMVDGSRP-PKFSPGLTASLGGGLPVRVR-RRKQKE  501



>ref|XP_004487513.1| PREDICTED: cytochrome P450 94A1-like [Cicer arietinum]
Length=498

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/462 (59%), Positives = 351/462 (76%), Gaps = 3/462 (1%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             ++KP C C IC +YLT SW  E  N+ DWY+ LL KSPTGTIH+HVL N IT NP N+E+
Sbjct  40    RMKPWCSCNICWSYLTMSWANEFINISDWYTHLLKKSPTGTIHIHVLNNTITCNPKNIEH  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T+F+N+PKGK F++ILGDLLG GIF VDG  W FQRKMAS E  SV++RS+A +I+ 
Sbjct  100   ILKTRFDNYPKGKPFSAILGDLLGNGIFNVDGVSWNFQRKMASLELTSVTVRSHALQIIT  159

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E+ TRL P +       +V+D QD++RRFSFDNICKFSFG DP CL  +LPVS+ A  F
Sbjct  160   EEIHTRLIPFMISSARAEKVIDLQDIMRRFSFDNICKFSFGWDPLCLQPNLPVSELAENF  219

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D+ASKLSA RA++  P  WK+KR LN+GSEKKL EAI ++N L E++I + R+ G +  +
Sbjct  220   DIASKLSAMRAMSVLPLTWKIKRFLNVGSEKKLKEAILVVNNLTEKIINKCREIGFS-TR  278

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             +DLLSRFM  ++DDK LRDIVISFLLAGRDT+A+ LT  FWLL R+  V   I  E  R+
Sbjct  279   NDLLSRFMCSVNDDKYLRDIVISFLLAGRDTVAAGLTCLFWLLKRNQRVEKIILEEVNRV  338

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             M P Q+   ++QIR+MNYL A ++E+MRL+PPVQFDSKF   DD LPDG++V+KG+RVTY
Sbjct  339   MNPVQEYPNFEQIREMNYLNAVVYETMRLYPPVQFDSKFAKEDDVLPDGSYVKKGSRVTY  398

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM+ +WG+DC EFKPERWL+DGVF +E+++KYPVFQ G RVCLGK++AL+EMK 
Sbjct  399   HPYAMGRMERVWGSDCCEFKPERWLKDGVFVNESVFKYPVFQGGVRVCLGKELALMEMKC  458

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             V VAL+R F++ V  E     ++ PGLT T+R GL VR+ ++
Sbjct  459   VIVALVRRFEVRV--EGNGEIQFVPGLTTTLRDGLPVRVFEK  498



>ref|XP_010232583.1| PREDICTED: cytochrome P450 94C1 [Brachypodium distachyon]
Length=529

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/464 (59%), Positives = 351/464 (76%), Gaps = 7/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW+ E  NLCDWY+ LL +SP  T+HVHVL NV+TANPA V++ML  +
Sbjct  58    CDCAVCEAYLTASWSGEFDNLCDWYAHLLRRSPAQTVHVHVLRNVLTANPAAVDHMLRAR  117

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +V++E+RT
Sbjct  118   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAANVVSSELRT  177

Query  1184  RLFPLL-----EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             RL PLL     + + +N +VLD QDV RRF+FD ICK SFG+DPGCL+LS+PV  F  AF
Sbjct  178   RLLPLLHSASSQSHEDNNKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVLAFVDAF  237

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D AS LSA RA      +W++KRL N+G E++L +A+ L++  A E+I Q+ K GGA   
Sbjct  238   DTASMLSARRATVPMQIIWRLKRLFNVGDERRLRDAVRLVDAFATEVIRQRHKLGGAASG  297

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             SDLLSRFMG I DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HPE    IR E  R+
Sbjct  298   SDLLSRFMGSISDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPETAAAIRDEVSRV  357

Query  659   M--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
                + D D  ++ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTLPDGT V KGTRV
Sbjct  358   AGDDYDDDRPSFGRLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTAVAKGTRV  417

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             TYH YAMGRM+S+WG DC EF+PERWL DG F   + Y+YPVFQAG RVC+GKD+AL+EM
Sbjct  418   TYHAYAMGRMESVWGRDCGEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLALMEM  477

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+V VA++R FDIE +  S + P++APGLTAT  GGL VR+  R
Sbjct  478   KAVIVAVVRGFDIEAIARSSRRPKFAPGLTATFAGGLPVRVRRR  521



>ref|XP_002458797.1| hypothetical protein SORBIDRAFT_03g040440 [Sorghum bicolor]
 gb|EES03917.1| hypothetical protein SORBIDRAFT_03g040440 [Sorghum bicolor]
Length=528

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/458 (61%), Positives = 350/458 (76%), Gaps = 8/458 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  +  NLCDWY+ LL  SP  T+HVHVL NV+TANPA V++ML  +
Sbjct  54    CACPVCEAYLTASWAADFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPATVDHMLRAR  113

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R+
Sbjct  114   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASELRS  173

Query  1184  RLFPLL-----EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             RL PLL     E  GE   VLD QDV RRF+FD ICK SFG+DPGCL+LS+PVS F  AF
Sbjct  174   RLIPLLHSASREREGEEGRVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSSFERAF  233

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D+AS LSA RA      +WK+KRLLN G E++L +A+ L++ LA E+I Q+RK GGA   
Sbjct  234   DMASTLSARRATVPMHIIWKLKRLLNFGDERRLRDAVHLVDTLAAEVIRQRRKLGGAASG  293

Query  839   -SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
              SDLLSRFMG I+DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   IR E+ R
Sbjct  294   GSDLLSRFMGSINDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEATR  353

Query  662   IMEPDQDL--ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             +   D  L  +T+ +++ M+Y+ AA+ ESMRLFPPVQFDSKF   DDTLPDGT V KGTR
Sbjct  354   VAGDDVRLTASTFNKLKGMHYVHAALSESMRLFPPVQFDSKFAAGDDTLPDGTAVAKGTR  413

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYH YAMGRM+S+WG DC EF+PERWL++G F  EN Y+YPVFQAG RVC+GK++AL+E
Sbjct  414   VTYHAYAMGRMESVWGPDCGEFRPERWLQNGRFVPENPYRYPVFQAGARVCIGKELALME  473

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             MK+V VA++R+FDIE    S + P++APGLTAT  GGL
Sbjct  474   MKAVIVAVVRSFDIEATDRSSRRPKFAPGLTATFAGGL  511



>dbj|BAK08034.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/459 (60%), Positives = 347/459 (76%), Gaps = 2/459 (0%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  E  NLCDWY+ LL +SP+ T+HVHVL NV+TANP  V++ML  +
Sbjct  44    CNCAVCEAYLTASWAGEFDNLCDWYAHLLRRSPSQTVHVHVLRNVLTANPVTVDHMLRAR  103

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F++IL DLLGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R 
Sbjct  104   FDNYPKGKPFSAILADLLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAAGVVASELRG  163

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL PLL     + +VLD QDV RRF+FD ICK SFG+DPGCL+LS+PVS F  AFD AS 
Sbjct  164   RLLPLLHSACSSSKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSAFVDAFDTASM  223

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             LSA RA      +W++KR  N+G E+KL E++ L++  A E+  Q+ K GGA   SDLLS
Sbjct  224   LSARRATAPMQIIWRLKRFFNVGDERKLRESVRLVDGFAAEVTRQRHKLGGAASGSDLLS  283

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ  645
             RFMG I D+K LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   IR E  R+   D 
Sbjct  284   RFMGSISDEKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVSRVTGDDD  343

Query  644   D--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPY  471
             D    ++ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DD LPDGT V KGTRVTYH Y
Sbjct  344   DRPRPSFSKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDKLPDGTVVAKGTRVTYHAY  403

Query  470   AMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             AMGRM+S+WGADC EF+PERWL DG F   + Y+YPVFQAG RVC+GKD+AL+EM++V V
Sbjct  404   AMGRMESVWGADCSEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLALMEMEAVIV  463

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             A++R+FDIE +  S   P++APGLTAT  GGL VR+  R
Sbjct  464   AVVRSFDIEAIDRSSHRPKFAPGLTATFAGGLPVRVRRR  502



>ref|XP_010510742.1| PREDICTED: cytochrome P450 94C1-like [Camelina sativa]
Length=495

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/464 (62%), Positives = 349/464 (75%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +V+TANP+NVE++L T 
Sbjct  32    CNCEICHAYLTSSWRKDFVNLSDWYTHLLRRSPTSTIKVHVLNSVVTANPSNVEHILKTH  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  92    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRNEIET  151

Query  1184  RLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + ++   VLD QDV RRFSFD I K SFG DP CL L LP S+FA AFD AS
Sbjct  152   RLVPILTSFSDSLGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WK+KR   IGSEKKL E+I +IN LA ++I+Q+R  G     +DL+
Sbjct  212   TLSAKRALAPFPLLWKLKRFFRIGSEKKLKESIDVINRLAGDLIKQRRLTGLV-GNNDLI  270

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV+SFLLAGRDT+AS LT FFWLL+RHP+V +RIR E  R+M 
Sbjct  271   SRFMAVVAEDDDEYLRDIVVSFLLAGRDTVASGLTGFFWLLTRHPKVENRIREELDRVMG  330

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                    A Y ++RDMNYL A ++ESMRL+PPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  331   TGFGSVTAGYDEMRDMNYLHATLYESMRLYPPVQFDSKFALNDDVLSDGTFVKRGTRVTY  390

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRM  IWG D  EFKPERWL++ G F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  391   HAYAMGRMGRIWGPDYEEFKPERWLDNQGKFRPENPVKYPVFQAGARVCVGKEMAIMEMK  450

Query  302   SVAVALIRAFDIEVVC-ESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+IR F+  V   ES  M R+APGLTA V GGL V I +R
Sbjct  451   SIAVAIIRRFETRVAGPESTDMLRFAPGLTAMVNGGLPVMIQER  494



>gb|AFW78139.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=521

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/458 (59%), Positives = 350/458 (76%), Gaps = 3/458 (1%)
 Frame = -1

Query  1559  KLKP--LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +L+P   C C +C+AY+T+SWT E  NLCDWY+ LL+++P  T+HVHVLGNV+TANP  V
Sbjct  46    RLRPPWWCACAVCEAYVTASWTAEFDNLCDWYAHLLSRAPGRTVHVHVLGNVLTANPPTV  105

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             ++ML  +F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R +A  +
Sbjct  106   DHMLRGRFDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRCFAAGV  165

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             VA+E+R RL PLL     + ++LD QDV RRF+FD IC+ SFG+DPGCL+LSLP+S FA 
Sbjct  166   VASELRCRLIPLLHSSAGDEKLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFAD  225

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD AS LSA RA       WK+KRLLN+G E++L +AIGL++ LA E+I Q+RK G A 
Sbjct  226   AFDTASMLSARRATAPMHVFWKLKRLLNVGEERQLRDAIGLVDTLAAEVIRQRRKLGTAA  285

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
                DLLSRFMG IDDDK LRDIV+SF+LAGRDT+ASALT+FF LLS HP+V   IR E  
Sbjct  286   SGDDLLSRFMGSIDDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPDVATAIRDEVS  345

Query  665   RIM-EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             R+  + D   AT ++++DM+Y+ AA+HE MRLFPPVQFDSKF   DD LPDGTFV +GTR
Sbjct  346   RVTGDGDGHAATSEKLKDMHYVHAALHECMRLFPPVQFDSKFAAGDDMLPDGTFVARGTR  405

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYH YAMGRM+S+WG DC EF+P RWL DG F  E+ Y+YPVFQ G RVC+G+++A++E
Sbjct  406   VTYHAYAMGRMESVWGPDCAEFRPGRWLHDGRFVPESPYRYPVFQGGVRVCIGRELAIME  465

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             MKSV V+++++FDIE V  S   P++APGLTAT  GG+
Sbjct  466   MKSVIVSVVQSFDIEAVSRSSHRPKFAPGLTATFAGGV  503



>gb|EAY76557.1| hypothetical protein OsI_04502 [Oryza sativa Indica Group]
Length=524

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/454 (61%), Positives = 345/454 (76%), Gaps = 4/454 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  E  NLCDWY+ LL  SP  T+HVHVL NV+TANP  V+++L  +
Sbjct  53    CDCTVCEAYLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPVTVDHVLRAR  112

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R 
Sbjct  113   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAARVVASELRC  172

Query  1184  RLFPLLEFYGE--NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL       N +VLD QD+ RRF+FD+ICK SFG+DPGCL+LS+PVS    AFD A
Sbjct  173   RLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLELSMPVSTLVEAFDTA  232

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S LSA RA      +W++KR LN+G E+KL +A+ L++ LA E+I Q+RK GGA   SDL
Sbjct  233   STLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEVIRQRRKLGGAATGSDL  292

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG IDDDK LRDIV+SF+LAGRDTIASALT+FF LLS HPEV   IR E  R+   
Sbjct  293   LSRFMGSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVATAIRDEVARVTGD  352

Query  650   DQDL--ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
                   AT+ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTLPDGT V KGTRVTYH
Sbjct  353   GNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDTLPDGTVVAKGTRVTYH  412

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
              YAMGRM+S+WG DC EF+PERWL DG F  E+ Y+YPVFQAG RVC+GK++AL+EMK+V
Sbjct  413   AYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQAGVRVCIGKELALMEMKAV  472

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
              VA++R+FDIE +  S + P++APGLTAT  GGL
Sbjct  473   IVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGL  506



>ref|XP_002880978.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57237.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/464 (62%), Positives = 352/464 (76%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T 
Sbjct  32    CNCEICHAYLTSSWRKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHILKTH  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F ++PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  92    FHSYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  151

Query  1184  RLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + +N   VLD QDV RRFSFD I K SFG DP CL L  P+S+FA AFD AS
Sbjct  152   RLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPMSEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WK+KR L IGSEKKL E+I +IN LA ++I+  R+  G   ++DL+
Sbjct  212   TLSAKRALAPFPLLWKIKRFLRIGSEKKLKESINVINRLAGDLIKH-RRLTGLMGKNDLI  270

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV++FLLAGRDT+A+ LT FFWLL RHP+V +RIR E  R+M 
Sbjct  271   SRFMAVVAEDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLMRHPDVENRIREELDRVMG  330

Query  653   PDQDLATYQ--QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                D  T +  ++R+M+YL AA++ESMRLFPPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  331   TGFDSVTARCDEMREMDYLHAALYESMRLFPPVQFDSKFALNDDVLSDGTFVKRGTRVTY  390

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRMD IWG D  EFKPERWL++ G F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  391   HAYAMGRMDRIWGPDYEEFKPERWLDNEGKFRPENPVKYPVFQAGARVCVGKEMAIMEMK  450

Query  302   SVAVALIRAFDIEVVC-ESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+IR F   +   ES +  R+APGLTATV GGL V I +R
Sbjct  451   SIAVAIIRRFKTRLASLESTKTLRFAPGLTATVNGGLPVMIQER  494



>gb|KHN48177.1| Cytochrome P450 94A1 [Glycine soja]
Length=493

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 357/462 (77%), Gaps = 6/462 (1%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CE C+ YLTSSW+    NLCDWY+ LL  SP  TIH+HVL N ITAN  NVEY+L T
Sbjct  22    FCSCETCQTYLTSSWSETFDNLCDWYAHLLRNSPNKTIHIHVLRNTITANAENVEYILKT  81

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSI-RSYAFEIVAAEV  1191
             KFENFPKGK F++ILGD LG+G+F VDGD W+FQ+KMAS    + S+  S+AFEIV  E+
Sbjct  82    KFENFPKGKPFSAILGDFLGKGVFNVDGDAWRFQKKMASLHLNNNSVVASFAFEIVNDEI  141

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPG-CLDLSLPVSKFAAAFDL  1014
             + RL PLL    +N  VLD QDV +RFSFD IC+FSFG+DP  CL+ S  +  FA +FDL
Sbjct  142   KNRLTPLLLMNQKNGVVLDLQDVFQRFSFDCICRFSFGLDPDFCLE-SGSMLVFAKSFDL  200

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             ASKLSAERA   SP VWK KRLLN+GSEK+L +A+ +IN LA+E+I+Q+R+ G + ++ D
Sbjct  201   ASKLSAERATAVSPYVWKAKRLLNLGSEKRLKKALRVINALAKEVIKQRREKGFSENK-D  259

Query  833   LLSRFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             LLSRFM  I DDD  LRD+V+SFLLAGRDT+ASALTSFF+LL +HPEV   IR E+ R++
Sbjct  260   LLSRFMNTIHDDDTYLRDVVVSFLLAGRDTVASALTSFFYLLGKHPEVESLIRDEADRVI  319

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
               D+DL ++++++ ++YL AA HESMRLFPP+QFDSKFCL DD LPDGT V  GTRVTYH
Sbjct  320   GHDKDLTSFEELKQLHYLQAATHESMRLFPPIQFDSKFCLEDDVLPDGTKVESGTRVTYH  379

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR++ IWG DC EF+P+RWL+DGVF+  N ++YPVFQAG RVC+GK++AL+EMKSV
Sbjct  380   PYAMGRLEEIWGCDCLEFRPQRWLKDGVFQPMNPFEYPVFQAGLRVCVGKEVALMEMKSV  439

Query  296   AVALIRAFDIEVVCE-SRQMPRYAPGLTATVRGGLSVRITDR  174
             AV+L+R F IE++   S   PR++PGLTAT   GL V + +R
Sbjct  440   AVSLLRKFHIELLAPLSFGNPRFSPGLTATFSFGLPVMVRER  481



>ref|NP_001172660.1| Os01g0858350 [Oryza sativa Japonica Group]
 dbj|BAB63711.1| putative cytochrome P450-dependent fatty acid hydroxylase [Oryza 
sativa Japonica Group]
 gb|EAZ14211.1| hypothetical protein OsJ_04135 [Oryza sativa Japonica Group]
 dbj|BAG87747.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91390.1| Os01g0858350 [Oryza sativa Japonica Group]
Length=524

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/454 (60%), Positives = 345/454 (76%), Gaps = 4/454 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+A+LT+SW  E  NLCDWY+ LL  SP  T+HVHVL NV+TANP  V+++L  +
Sbjct  53    CDCTVCEAFLTASWAGEFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPVTVDHVLRAR  112

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R 
Sbjct  113   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAARVVASELRC  172

Query  1184  RLFPLLEFYGE--NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL       N +VLD QD+ RRF+FD+ICK SFG+DPGCL+LS+PVS    AFD A
Sbjct  173   RLIPLLHSASREGNGKVLDLQDMFRRFAFDSICKISFGLDPGCLELSMPVSTLVEAFDTA  232

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S LSA RA      +W++KR LN+G E+KL +A+ L++ LA E+I Q+RK GGA   SDL
Sbjct  233   STLSARRATVPMQIIWRLKRFLNVGDERKLRDAVRLVDALAAEVIRQRRKLGGAATGSDL  292

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG IDDDK LRDIV+SF+LAGRDTIASALT+FF LLS HPEV   IR E  R+   
Sbjct  293   LSRFMGSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVATAIRDEVARVTGD  352

Query  650   DQDL--ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
                   AT+ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTLPDGT V KGTRVTYH
Sbjct  353   GNRTMAATFDKLKDMHYVHAAMYESMRLFPPVQFDSKFAAGDDTLPDGTVVAKGTRVTYH  412

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
              YAMGRM+S+WG DC EF+PERWL DG F  E+ Y+YPVFQAG RVC+GK++AL+EMK+V
Sbjct  413   AYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQAGVRVCIGKELALMEMKAV  472

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
              VA++R+FDIE +  S + P++APGLTAT  GGL
Sbjct  473   IVAVVRSFDIEAIARSSRRPKFAPGLTATFAGGL  506



>ref|XP_009421132.1| PREDICTED: cytochrome P450 94C1-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/460 (61%), Positives = 355/460 (77%), Gaps = 5/460 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYL+SSW  E  NLCDW++ LL +SPTGTIHVHVLG+ ITANP NVEYML T+
Sbjct  34    CTCHVCRAYLSSSWAAEFDNLCDWHAHLLRESPTGTIHVHVLGSTITANPTNVEYMLKTR  93

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+NFPKGK F+++LGDLLG GIF VDGD W+FQRKMAS   GS+S+RSYA  IV++E+  
Sbjct  94    FDNFPKGKGFSALLGDLLGDGIFNVDGDSWRFQRKMASLALGSISVRSYALGIVSSEISR  153

Query  1184  RLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             +L PLL    + R+ V+D QDV RRF+FD ICK SFG+D  CL+ S+P+S+FAAAFD AS
Sbjct  154   KLLPLLSSVADRRDGVVDLQDVFRRFAFDTICKISFGLDRSCLERSMPMSEFAAAFDAAS  213

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
             KL A R +  +  +WK+KRL N+GSE+KL  AI  IN LAE++I Q+R+ G      DLL
Sbjct  214   KLLARRGMATASMLWKLKRLFNVGSERKLRRAIRKINMLAEDIIRQRRRLGFTSGH-DLL  272

Query  827   SRFMGIIDDD-KLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE-SGRIME  654
             SRFM ++DDD K LRDIVISFLLAGRD +AS LTSFF LLS++P     +R E +G I +
Sbjct  273   SRFMCLVDDDDKFLRDIVISFLLAGRDAVASGLTSFFLLLSQNPYTAAAMRDEIAGVIKD  332

Query  653   PDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHP  474
              ++D   Y+Q+++M+Y+ A ++ES+RLFPPVQFDSKFCL DD LPDGTFV K TRVTYHP
Sbjct  333   GNEDTVNYEQLKEMHYVHAVLYESLRLFPPVQFDSKFCLEDDVLPDGTFVSKNTRVTYHP  392

Query  473   YAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVA  294
             YAMGRM+SIWG DCREFKPERWL  GVF   NL+ YPVFQAG RVCLGK++AL EMK+V 
Sbjct  393   YAMGRMESIWGPDCREFKPERWLRGGVFTPANLFNYPVFQAGQRVCLGKELALEEMKAVV  452

Query  293   VALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             V+++  FD+EV+ +  Q  ++  GLTAT+ GG+S R++ R
Sbjct  453   VSVVSKFDVEVL-QGAQPLKFDVGLTATINGGVSARVSRR  491



>ref|XP_003541451.1| PREDICTED: cytochrome P450 94A1-like [Glycine max]
Length=522

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 357/462 (77%), Gaps = 6/462 (1%)
 Frame = -1

Query  1547  LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTT  1368
              C CE C+ YLTSSW+    NLCDWY+ LL  SP  TIH+HVL N ITAN  NVEY+L T
Sbjct  51    FCSCETCQTYLTSSWSETFDNLCDWYAHLLRNSPNKTIHIHVLRNTITANAENVEYILKT  110

Query  1367  KFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSI-RSYAFEIVAAEV  1191
             KFENFPKGK F++ILGD LG+G+F VDGD W+FQ+KMAS    + S+  S+AFEIV  E+
Sbjct  111   KFENFPKGKPFSAILGDFLGKGVFNVDGDAWRFQKKMASLHLNNNSVVASFAFEIVNDEI  170

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPG-CLDLSLPVSKFAAAFDL  1014
             + RL PLL    +N  VLD QDV +RFSFD IC+FSFG+DP  CL+ S  +  FA +FDL
Sbjct  171   KNRLTPLLLMNQKNGVVLDLQDVFQRFSFDCICRFSFGLDPDFCLE-SGSMLVFAKSFDL  229

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             ASKLSAERA   SP VWK KRLLN+GSEK+L +A+ +IN LA+E+I+Q+R+ G + ++ D
Sbjct  230   ASKLSAERATAVSPYVWKAKRLLNLGSEKRLKKALRVINALAKEVIKQRREKGFSENK-D  288

Query  833   LLSRFMGII-DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             LLSRFM  I DDD  LRD+V+SFLLAGRDT+ASALTSFF+LL +HPEV   IR E+ R++
Sbjct  289   LLSRFMNTIHDDDTYLRDVVVSFLLAGRDTVASALTSFFYLLGKHPEVESLIRDEADRVI  348

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
               D+DL ++++++ ++YL AA HESMRLFPP+QFDSKFCL DD LPDGT V  GTRVTYH
Sbjct  349   GHDKDLTSFEELKQLHYLQAATHESMRLFPPIQFDSKFCLEDDVLPDGTKVESGTRVTYH  408

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR++ IWG DC EF+P+RWL+DGVF+  N ++YPVFQAG RVC+GK++AL+EMKSV
Sbjct  409   PYAMGRLEEIWGCDCLEFRPQRWLKDGVFQPMNPFEYPVFQAGLRVCVGKEVALMEMKSV  468

Query  296   AVALIRAFDIEVVCE-SRQMPRYAPGLTATVRGGLSVRITDR  174
             AV+L+R F IE++   S   PR++PGLTAT   GL V + +R
Sbjct  469   AVSLLRKFHIELLAPLSFGNPRFSPGLTATFSFGLPVMVRER  510



>ref|XP_006409751.1| hypothetical protein EUTSA_v10016556mg [Eutrema salsugineum]
 gb|ESQ51204.1| hypothetical protein EUTSA_v10016556mg [Eutrema salsugineum]
Length=497

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/465 (61%), Positives = 347/465 (75%), Gaps = 7/465 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T+
Sbjct  32    CNCEICHAYLTSSWRKDFVNLSDWYAHLLRRSPTSTIKVHVLNSVITANPSNVEHILKTR  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A  IV  E+ T
Sbjct  92    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHAIVRTEIET  151

Query  1184  RLFPLL-EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  F  E   VLD QDV RRFSFD I K SFG DP CL L  P S+FA AFD AS
Sbjct  152   RLIPVLTSFSSEPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPTSEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+  SP +WK+KR+L IGSEK+L E+I +IN LA ++I+ +R  G     +DL+
Sbjct  212   TLSAKRALAPSPLLWKIKRVLRIGSEKQLKESIDVINRLAGDLIKHRRLTGLTEKNNDLI  271

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  +DD+ LRDIV+SFLLAGRDT+A+  T FFWLL  HP+V +RIR E  R+M 
Sbjct  272   SRFMAVVAEEDDEYLRDIVVSFLLAGRDTVAAGSTGFFWLLIHHPKVENRIREELDRVMG  331

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             P  +   A+  ++RDM+YL AA++ESMRL+PPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  332   PGFESVTASCDEMRDMDYLHAALYESMRLYPPVQFDSKFALNDDVLSDGTFVKRGTRVTY  391

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             HPYAMGRM  IWG D +EFKPERWL + G F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  392   HPYAMGRMGRIWGPDYQEFKPERWLNNEGKFRPENPVKYPVFQAGARVCVGKEMAIMEMK  451

Query  302   SVAVALIRAFDIEVVCES-RQMPRYAPGLTATVRGGLSVRITDRR  171
             S+AVA+IR F I        +  R+ PGLTATV GGL V I + R
Sbjct  452   SIAVAIIRRFKIRAAGLGFTETLRFMPGLTATVNGGLPVLIQEMR  496



>ref|XP_006361448.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=509

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/470 (61%), Positives = 347/470 (74%), Gaps = 9/470 (2%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             K    C C+IC  YLTSSW  E +NL DWY+ LL  SP+ TI +H L N+ITANP NVEY
Sbjct  40    KFWSWCTCDICHCYLTSSWRKEFTNLGDWYAHLLRNSPSQTIRIHALDNIITANPRNVEY  99

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T F N+PKGK F+ ILGDLLG GIF VDGDLW FQRKM+S E GS+SIRSYAF  V 
Sbjct  100   MLKTNFLNYPKGKPFSMILGDLLGDGIFNVDGDLWMFQRKMSSLELGSMSIRSYAFNNVK  159

Query  1199  AEVRTRLFPLL------EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
              E+  RL PLL           + + LD QDV RRFSFDNICKFSFG+DP CL+LSLP+S
Sbjct  160   NEINFRLIPLLSSHVVVSSSQHDFKSLDLQDVFRRFSFDNICKFSFGLDPCCLELSLPLS  219

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
              FA +FDLA+KLSAERA+ ASP +WK+KRL +IG+EKKL  AI  IN LA E+I QKRK 
Sbjct  220   HFAYSFDLATKLSAERAMVASPLIWKIKRLFDIGTEKKLKGAIEDINVLANEVIRQKRKL  279

Query  857   GGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
             G +  Q DLLSRFM ++D+D  LRDIVISF+LAGRDT+AS LTS FWLL+ HP+V  RIR
Sbjct  280   GYSNHQ-DLLSRFMTMVDNDVYLRDIVISFILAGRDTVASGLTSVFWLLTSHPDVELRIR  338

Query  677   AESGRIMEP-DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
              E+ R+ME  D+    ++++  M+YL A IHESMRL+PPVQFDSKF   +D   DGTFV 
Sbjct  339   EETSRVMEKNDEGFLKFEEMNQMHYLNAVIHESMRLYPPVQFDSKFASENDVFVDGTFVG  398

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDM  321
             K  RVTYH YAMGRM++IWG D  EFKPERWL++G+F  ++ +KYPVFQ G RVCLGK++
Sbjct  399   KNDRVTYHVYAMGRMENIWGKDYMEFKPERWLKNGIFCQQSPFKYPVFQGGIRVCLGKEL  458

Query  320   ALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             AL+EMK V  ++++ F+I  +    + PR+ PGLTATVRGGL V +  RR
Sbjct  459   ALMEMKCVVASMLQHFEIRAMAVGGE-PRFDPGLTATVRGGLPVVVRRRR  507



>gb|EAY98229.1| hypothetical protein OsI_20140 [Oryza sativa Indica Group]
Length=519

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/463 (60%), Positives = 349/463 (75%), Gaps = 7/463 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+T+SW  E  NLCDWY+ LL ++P  T+HVHVLGNV+TANPA V++ML  +
Sbjct  52    CACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLRCR  111

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S +IR++A  +VA+E+R 
Sbjct  112   FDNYPKGAPFSAILADFLGRGIFNVDGDGWLFQRKLAAAELASPAIRAFAANVVASELRC  171

Query  1184  RLFPLL---EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDL  1014
             RL PLL     YG  R +LD QDV RRF+FD ICK SFG+DPGCL+LSLP+S FA AFD 
Sbjct  172   RLIPLLRSASSYGSER-LLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFDT  230

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             AS LSA RA      VWK+KRLLNIG E++L +AI L++ LA E+I Q+RK G A    D
Sbjct  231   ASMLSARRATVPMHVVWKLKRLLNIGEERELRDAIRLVDALAAEVIRQRRKLGSAASGDD  290

Query  833   LLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM-  657
             LLSRFMG I+DDK LRDIV+SF+LAGRDT+AS LT+FF LLS HPEV   IR E  R+  
Sbjct  291   LLSRFMGSINDDKYLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRDEVFRVAG  350

Query  656   --EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVT  483
               +P      + +++DM+Y+ AA++ESMRLFPPVQFDSKF   +DTLPDGTFV KGTRVT
Sbjct  351   GRDPTAASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGTRVT  410

Query  482   YHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             YH YAMGRM+S+WG DC  F+PERWL  G F  E+ Y+YPVFQ G RVC+GKD+A++EMK
Sbjct  411   YHAYAMGRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCIGKDLAIMEMK  470

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +V VA++ +FD+E V  S + P++APGLTAT  GG+ VR+  R
Sbjct  471   AVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR  513



>ref|XP_010473161.1| PREDICTED: cytochrome P450 94C1 [Camelina sativa]
Length=498

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/464 (62%), Positives = 349/464 (75%), Gaps = 8/464 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC  YLTSSW  +  NL DWY+ LL +S T TI VHVL +V+TANP+NVE++L T 
Sbjct  32    CNCEICHGYLTSSWRKDFVNLSDWYTHLLRRSRTSTIKVHVLNSVVTANPSNVEHILKTH  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  92    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVRTEIET  151

Query  1184  RLFPLLEFYGEN-REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + ++   VLD QDV RRFSFD I K SFG DP CL L LP S+FA AFD AS
Sbjct  152   RLVPILTSFSDSPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPLPTSEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WK+KR   IGSEKKL E+I +IN LA ++I+Q+R  G     +DL+
Sbjct  212   TLSAKRALAPFPLLWKLKRFFRIGSEKKLRESIDVINRLAGDLIKQRRLTGLV-GNNDLI  270

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV+SFLLAGRDT+A+ LT FFWLL+RHP+V +RIR E  RIM 
Sbjct  271   SRFMAVVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKVENRIREELDRIMG  330

Query  653   PDQDLATY--QQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                +  T    ++RDMNYL A ++ESMRL+PPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  331   TGFESVTAGCDEMRDMNYLHATLYESMRLYPPVQFDSKFALNDDVLSDGTFVKRGTRVTY  390

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRM  IWG D  EFKPERWL++ G F+ EN  KYPVFQAG RVC+GK+MA++EMK
Sbjct  391   HAYAMGRMGRIWGPDYEEFKPERWLDNQGKFRPENPVKYPVFQAGARVCVGKEMAIMEMK  450

Query  302   SVAVALIRAFDIEVV-CESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+IR F+  V   ES +M R+APGLTATV GGL V I +R
Sbjct  451   SIAVAIIRRFETRVAGSESTEMLRFAPGLTATVNGGLPVLIQER  494



>ref|XP_004970645.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=528

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 346/457 (76%), Gaps = 8/457 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  E  NLCDWY+ LL  SP  T+HVHVL NV+TANP  V++ML  +
Sbjct  54    CACHVCEAYLTASWAGEFDNLCDWYAHLLRSSPAQTVHVHVLRNVLTANPVTVDHMLRGR  113

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R+
Sbjct  114   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASELRS  173

Query  1184  RLFPLLEF---YGENR---EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAA  1023
             RL PLL      G+ R   +VLD QDV RRF+FD ICK SFG+DPGCL+LS+PVS F  A
Sbjct  174   RLIPLLHSASRQGKGRGKGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSSFENA  233

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FD+AS LSA RA      +W++KR  N G E+KL +A+ L++ LAEE+I Q+RK GGA  
Sbjct  234   FDVASTLSARRATVPMQIIWRLKRFFNYGDERKLRDAVRLVDRLAEEVIRQRRKLGGAAS  293

Query  842   QSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
              SDLLSRFMG I+DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   IR E  R
Sbjct  294   GSDLLSRFMGSINDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVAR  353

Query  662   IMEPDQDL--ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             +   D  L  +T+ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DD LPDGT V KGTR
Sbjct  354   VGGDDDRLTASTFSKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDKLPDGTAVAKGTR  413

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             VTYH YAMGRM+S+WG DC EF+PERWL +G F  E+ Y+YPVFQAG RVC+GK++ALVE
Sbjct  414   VTYHAYAMGRMESVWGPDCGEFRPERWLRNGRFVPESPYRYPVFQAGARVCIGKELALVE  473

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGG  198
             MK+V  A++R+FDIE +  S + P++APGLTAT   G
Sbjct  474   MKAVIFAVVRSFDIEAIDRSSRRPKFAPGLTATFASG  510



>emb|CDX71432.1| BnaC04g16670D [Brassica napus]
Length=493

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/465 (61%), Positives = 348/465 (75%), Gaps = 7/465 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW     NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T+
Sbjct  28    CNCEICHAYLTSSWRNNFVNLGDWYAHLLRRSPTSTIKVHVLKSVITANPSNVEHILKTR  87

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  88    FHNYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  147

Query  1184  RLFPLLE-FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  F  E   VLD QDV RRFSFD I K SFG DP CL    P S+FA AFD AS
Sbjct  148   RLIPVLNSFSTEPGSVLDLQDVFRRFSFDTISKLSFGFDPNCLRFPFPTSEFAVAFDTAS  207

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WKVKR+  IGSEK+L E+I +IN LA ++I+Q+R  G     +DL+
Sbjct  208   MLSAKRALAPFPLLWKVKRMFKIGSEKELKESINVINRLAGDLIKQRRLTGLTNKNNDLI  267

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDDK LRDIV+SFLLAGRDT+A+ LT FFWLL+RHP++ +RIR E  R+M 
Sbjct  268   SRFMAVVAEDDDKYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPKMENRIREELDRVMG  327

Query  653   P--DQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             P  D   A+  ++R+M+YL AA++ESMRL+PPVQFDSKF L DD L DGT V  GTRVTY
Sbjct  328   PGFDSFTASCGEMREMHYLHAALYESMRLYPPVQFDSKFALKDDVLADGTRVTGGTRVTY  387

Query  479   HPYAMGRMDSIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             HPYAMGRM  IWG D  EFKPERWL+ +G F+SE+  KYP+FQAG RVC+GK+MA++EMK
Sbjct  388   HPYAMGRMIRIWGPDYEEFKPERWLDKEGKFRSESPVKYPIFQAGARVCVGKEMAIMEMK  447

Query  302   SVAVALIRAFDIEVVCE-SRQMPRYAPGLTATVRGGLSVRITDRR  171
             S+AVA+IR F+  V    S +  R++PGLTATV GGL V I  R+
Sbjct  448   SIAVAMIRKFETRVKGPGSTETLRFSPGLTATVNGGLPVIIKVRK  492



>gb|EYU35153.1| hypothetical protein MIMGU_mgv1a026773mg [Erythranthe guttata]
Length=511

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/471 (59%), Positives = 359/471 (76%), Gaps = 16/471 (3%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C ICKAY+ SSW +   NLCDWY+ LL  SPT TIH+H L N ITANP NVE+ML T+
Sbjct  40    CNCGICKAYIESSWRVRFPNLCDWYTHLLRNSPTRTIHIHALNNTITANPENVEHMLKTR  99

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGK F++ILGD LGRGIF  DGD W+FQR++AS E G VSIR+Y+ ++   E+R 
Sbjct  100   FHNYPKGKPFSAILGDFLGRGIFNSDGDSWRFQRRIASLELGRVSIRAYSSDVANQEIRR  159

Query  1184  RLFPLLE----FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLD--LSLPVSKFAAA  1023
              L P++E            LD QDV RRFSF +IC+FSFG+DP   D  LSLP+S+FAAA
Sbjct  160   YLLPVMESAAAAGRGGNGALDLQDVFRRFSFFSICRFSFGLDPDIFDDHLSLPLSQFAAA  219

Query  1022  FDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARD  843
             FD AS+LSAERA++ASP +WKVKRLLN+GSE+KL  AIG ++ LA E I Q+R+    + 
Sbjct  220   FDSASELSAERAMSASPIIWKVKRLLNVGSERKLRRAIGTVHVLAGEFISQRRRSADFKS  279

Query  842   QS----DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
              S    DL+SRFM  + D+  LRDI++SFLLAGRDT+ASALTSFF L++RHP V   I  
Sbjct  280   SSDQKKDLMSRFMASVADETYLRDIIVSFLLAGRDTVASALTSFFMLVARHPRVEATILL  339

Query  674   ESGRIMEPDQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
             E+ +++ P  +   A+Y+Q+R+++YL AA+HESMRL+PP+QF+SKFC NDD LPDGTFV+
Sbjct  340   EAEKVIGPHNENRPASYEQLRELHYLHAAVHESMRLYPPIQFNSKFCSNDDVLPDGTFVK  399

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWL-EDGV-FKSENLYKYPVFQAGPRVCLGK  327
             KGTRVTYHPYAMGRM+ IWG DC +FKPERWL +DGV F  +N +KYPVFQAG RVCLG+
Sbjct  400   KGTRVTYHPYAMGRMEEIWGPDCLDFKPERWLNKDGVFFHDQNPFKYPVFQAGIRVCLGR  459

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++ALVE+K+VA++L+R+F +E+V E+  +PR++PGLTAT R GL V +  R
Sbjct  460   EVALVEIKTVAISLLRSFHLELVDEN--IPRFSPGLTATFRHGLQVFVRAR  508



>ref|NP_001055681.1| Os05g0445100 [Oryza sativa Japonica Group]
 gb|AAU44273.1| putative cytochrome P450 [Oryza sativa Japonica Group]
 dbj|BAF17595.1| Os05g0445100 [Oryza sativa Japonica Group]
 dbj|BAG97167.1| unnamed protein product [Oryza sativa Japonica Group]
Length=519

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 352/470 (75%), Gaps = 9/470 (2%)
 Frame = -1

Query  1559  KLKP--LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +L+P   C C +C+AY+T+SW  E  NLCDWY+ LL ++P  T+HVHVLGNV+TANPA V
Sbjct  45    RLRPPWWCACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATV  104

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             ++ML  +F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S +IR++A  +
Sbjct  105   DHMLRCRFDNYPKGAPFSAILADFLGRGIFNVDGDGWLFQRKLAAAELASPAIRAFAANV  164

Query  1205  VAAEVRTRLFPLL---EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSK  1035
             VA+E+R RL PLL     YG  R +LD QDV RRF+FD ICK SFG+DPGCL+LSLP+S 
Sbjct  165   VASELRCRLIPLLRSASSYGSER-LLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISA  223

Query  1034  FAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCG  855
             FA AFD AS LSA RA      VWK+KRL NIG E++L +AI L++ LA E+I Q+RK G
Sbjct  224   FADAFDTASMLSARRATVPMHVVWKLKRLRNIGEERELRDAIRLVDALAAEVIRQRRKLG  283

Query  854   GARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
              A    DLLSRFMG I+DDK LRDIV+SF+LAGRDT+AS LT+FF LLS HPEV   IR 
Sbjct  284   SAASCDDLLSRFMGSINDDKYLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPEVAAAIRD  343

Query  674   ESGRIM---EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFV  504
             E  R+    +P      + +++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTLPDGTFV
Sbjct  344   EVFRVAGGRDPTAASFDFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTFV  403

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKD  324
              KGTRVTYH YAMGRM+S+WG DC  F+PERWL  G F  E+ Y+YPVFQ G RVC+GKD
Sbjct  404   AKGTRVTYHAYAMGRMESLWGPDCAVFRPERWLSGGRFVPESPYRYPVFQGGVRVCVGKD  463

Query  323   MALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +A++EMK+V VA++ +FD+E V  S + P++APGLTAT  GG+ VR+  R
Sbjct  464   LAIMEMKAVIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGVPVRVRRR  513



>ref|XP_006645049.1| PREDICTED: cytochrome P450 94A1-like [Oryza brachyantha]
Length=523

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/454 (60%), Positives = 343/454 (76%), Gaps = 4/454 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT SW  E  NLCDWY+ LL  SP  T+H+HVL NV+TANP  V+++L  +
Sbjct  52    CDCAVCEAYLTGSWAGEFDNLCDWYAHLLRSSPAQTVHLHVLRNVLTANPVTVDHVLRAR  111

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +V++E+R 
Sbjct  112   FDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRAFAARVVSSELRC  171

Query  1184  RLFPLLEFYGE--NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL       N +VLD QDV RRF+FD ICK SFG+DPGCL+LS+PVS    AFD A
Sbjct  172   RLIPLLHSASREGNGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSTLVEAFDTA  231

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S LSA RA      +W++KRLLN+G EKKL +A+ L++ LA E+I Q+RK GGA   SDL
Sbjct  232   SNLSARRATVPMQIIWRLKRLLNVGDEKKLRDAVRLVDALAAEVIRQRRKLGGAASGSDL  291

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG IDDDK LRDIV+SF+LAGRDTIASALT+FF LLS HPEV   IR E  R+   
Sbjct  292   LSRFMGSIDDDKYLRDIVVSFMLAGRDTIASALTAFFLLLSDHPEVAAAIRDEVNRVTGD  351

Query  650   DQD--LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
                   AT+++++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTL DGT V KGTRVTYH
Sbjct  352   GNRPIAATFEKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLTDGTVVAKGTRVTYH  411

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
              YAMGRM+S+WG DC EF+P+RWL DG F  E+ Y+YPVFQAG RVC+GK++AL+EMK+V
Sbjct  412   AYAMGRMESVWGPDCAEFRPDRWLRDGRFVPESPYRYPVFQAGVRVCVGKELALMEMKAV  471

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
              VA++R+FDIE +  S + P++APGLTA   GGL
Sbjct  472   IVAVVRSFDIEAIARSSRRPKFAPGLTAPFAGGL  505



>emb|CBX25407.1| hypothetical_protein [Oryza brachyantha]
Length=502

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/469 (61%), Positives = 354/469 (75%), Gaps = 18/469 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  36    PWCSCHVCRAYLTGSWRRDFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANVEYMLK  95

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK FA++LGDLLG GIF VDGD+W+ QRKMAS E GSVS+RSYAF+IVA EV
Sbjct  96    TRFDNFPKGKPFAALLGDLLGDGIFNVDGDMWRHQRKMASLELGSVSVRSYAFKIVAQEV  155

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              TRL P+L    +   VLD QDV RRF+FD ICK SFG+DPGCLD  +PVS+ A AFD A
Sbjct  156   ETRLMPVLSDAADRGAVLDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDTA  215

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KRLLNIGSE++L +AI LI+ LA  MI +++K  G  +  DL
Sbjct  216   SRLSAMRGAAASPLLWKMKRLLNIGSERELKKAIRLIDGLAAAMIRERQKL-GVGNSHDL  274

Query  830   LSRFMGIIDD------DKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
             LSRFM    D      DK LRDIV+SFLLAGRDT++SALT+ F LLS+HP+V   +RAE+
Sbjct  275   LSRFMASAGDAHSAAEDKFLRDIVVSFLLAGRDTVSSALTTLFMLLSKHPDVAAAMRAEA  334

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             G   +P    ATY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V    R
Sbjct  335   GAGEKP----ATYEHLKRLHYTHAVVYENMRLFPPVQFDSKFCAAADVLPDGTYVDGDAR  390

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             V YHPYAMGRM  IWGADC  F+P+RWL    G F  E+LYKYPVFQAG RVCLGK++A+
Sbjct  391   VMYHPYAMGRMPRIWGADCDAFRPDRWLTGAGGTFVPESLYKYPVFQAGLRVCLGKELAV  450

Query  314   VEMKSVAVALIRAFDIEVVCESRQ-----MPRYAPGLTATVRGGLSVRI  183
              EMK+V+VA++RAFD+EVV E+ +      PR+ PGLTA++RGGL V+I
Sbjct  451   TEMKAVSVAVVRAFDVEVVGENGRSSAAAAPRFVPGLTASIRGGLPVKI  499



>emb|CDM80095.1| unnamed protein product [Triticum aestivum]
Length=527

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/455 (60%), Positives = 346/455 (76%), Gaps = 5/455 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  E  NLCDWY+ LL +SP+ T+HVHVL NV+TANP  V++ML  +
Sbjct  55    CDCAVCEAYLTASWAGEFDNLCDWYAHLLRRSPSQTVHVHVLRNVLTANPVTVDHMLRAR  114

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKGK F++IL DLLGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R 
Sbjct  115   FDNYPKGKPFSAILADLLGRGIFNVDGDAWLFQRKLAAAELASPALRAFASGVVASELRG  174

Query  1184  RLFPLLE----FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             RL PLL+       +  +VLD QDV RRF+FD ICK SFG+DPGCL+LS+PVS F  AFD
Sbjct  175   RLVPLLDSACSHDDDGGKVLDLQDVFRRFAFDCICKISFGLDPGCLELSMPVSAFVDAFD  234

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
              AS LSA RA      +W++KR  N+G E+KL E++ L++  A E+  Q+ K GGA   S
Sbjct  235   TASMLSARRATAPLQIIWRLKRFFNVGDERKLRESVRLVDGFAAEVTRQRHKLGGAASGS  294

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
             DLLSRFMG I D+K LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   IR E  R+ 
Sbjct  295   DLLSRFMGSISDEKYLRDIVVSFVLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVSRVA  354

Query  656   -EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
              + D D  ++ +++DM+Y+ AA++ESMRLFPPVQFDSKF   DDTLPDGT V KGTRVTY
Sbjct  355   GDDDNDRPSFSKLKDMHYVHAALYESMRLFPPVQFDSKFAAGDDTLPDGTAVAKGTRVTY  414

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             H YAMGRM+S+WG DC EF+PERWL DG F   + Y+YPVFQAG RVC+GKD+AL+EMK+
Sbjct  415   HAYAMGRMESVWGPDCSEFRPERWLRDGQFVPVSPYRYPVFQAGVRVCVGKDLALMEMKA  474

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             V VA++R+FDIE +  S + P++APGLTAT  GGL
Sbjct  475   VIVAVVRSFDIEAIGRSSRRPKFAPGLTATFAGGL  509



>dbj|BAJ99856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=509

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/468 (59%), Positives = 348/468 (74%), Gaps = 17/468 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C++YLT SW  + +NL DWY+ LL  SPTGT+ VHVLG  ITANPANVE+ML 
Sbjct  44    PWCSCHVCRSYLTGSWARDFTNLGDWYAHLLRCSPTGTVAVHVLGCTITANPANVEHMLH  103

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK F+++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA+ IVA EV
Sbjct  104   TRFDNFPKGKPFSAVLGDLLGGGIFNVDGAAWRHQRKMASLELGSVAVRSYAYGIVAEEV  163

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL PLL    +N  V+D QDV RRF+FD ICK SFG+DPGCL+L +P+SK AAAFD A
Sbjct  164   EARLLPLLADAADNGRVIDLQDVFRRFAFDTICKISFGLDPGCLELDMPMSKLAAAFDTA  223

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP VW+VKRLLN+GSE++L ++I L++ELA  MI Q+RK G A    DL
Sbjct  224   SRLSAMRGAAASPLVWRVKRLLNVGSERELRKSIRLVDELAAAMIRQRRKLGVAGSH-DL  282

Query  830   LSRFM-----GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEV-----TDRI  681
             LSRFM     G   DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V      +  
Sbjct  283   LSRFMASEAHGTAVDDKYLRDIVVSFLLAGRDTVSSALTTIFMLLSKNPAVAAGMRAEAA  342

Query  680   RAESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
              +E  R+        TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC  DD LPDGT+V 
Sbjct  343   ASEKTRMASK----TTYEHLKSLHYTHAVLYENMRLFPPVQFDSKFCAADDVLPDGTYVT  398

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGK  327
              G RV YHPYAMGRM  IWG DC +F+PERWL    G F  E+LY+YPVFQAG RVCLGK
Sbjct  399   AGARVMYHPYAMGRMPRIWGDDCEKFRPERWLTGTGGTFVPESLYRYPVFQAGLRVCLGK  458

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             ++A++EMK+V+VA+++ FD+EVV E    PR+APGLTA++ GGL VR+
Sbjct  459   ELAVMEMKAVSVAVVKQFDVEVVGEQGAAPRFAPGLTASISGGLPVRV  506



>ref|XP_008657035.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW84499.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=549

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/471 (60%), Positives = 346/471 (73%), Gaps = 21/471 (4%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AYLT+SW  +  NLCDWY+ LL  SP  T+HVHVL NV+TANPA V++ML  +
Sbjct  55    CACPVCEAYLTASWAGDFDNLCDWYAHLLRTSPAQTVHVHVLRNVLTANPATVDHMLRAR  114

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R++A  +VA+E+R 
Sbjct  115   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPALRAFAVRVVASELRG  174

Query  1184  RLFPLLEFYG--ENRE---------VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVS  1038
             RL PLL        RE         VLD QDV RRF+FD ICK SFG+DPGCL LS+PVS
Sbjct  175   RLIPLLRSAACASGREGGGGGGGGRVLDLQDVFRRFAFDCICKISFGLDPGCLQLSMPVS  234

Query  1037  KFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC  858
              F  AFD AS LSA RA      VWK+KRLLN+G E++L +A+ L++ LA E+I Q+RK 
Sbjct  235   SFEDAFDTASTLSARRATAPMHVVWKLKRLLNLGDERRLRDAVHLVDALAAEVIRQRRKL  294

Query  857   GGARDQ-SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRI  681
             GGA    SDLLSRFMG IDDDK LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   I
Sbjct  295   GGAASSGSDLLSRFMGSIDDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAI  354

Query  680   RAESGRIMEPDQDL---------ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDD  528
             R E+ R+   D D          + + +++ M+Y+ AA++ESMRLFPPVQFDSKF   DD
Sbjct  355   RDEAARVAGDDDDGDGDDGRLTDSAFGKLKGMHYVHAALYESMRLFPPVQFDSKFAAGDD  414

Query  527   TLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAG  348
             TLPDGT V KGTRVTYH YAMGRM+S+WG DC EF+PERWL DG F  E+ Y+YPVFQAG
Sbjct  415   TLPDGTAVAKGTRVTYHAYAMGRMESVWGPDCGEFRPERWLRDGRFVPESPYRYPVFQAG  474

Query  347   PRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
              RVC+GK++AL+EMK+V VA++R FDIE V  S + PR+APGLTAT  GGL
Sbjct  475   ARVCVGKELALMEMKAVIVAVVRGFDIEAVGRSSRRPRFAPGLTATFAGGL  525



>ref|XP_006654479.1| PREDICTED: cytochrome P450 94A2-like [Oryza brachyantha]
Length=524

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/455 (60%), Positives = 343/455 (75%), Gaps = 5/455 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+T+SW  E  NLCDWY+ LL ++P  T+HVHVLGNV+TANPA V++ML  +
Sbjct  53    CACPVCEAYVTASWAREFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPATVDHMLRCR  112

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S +IR++A  +VA+E+R 
Sbjct  113   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPAIRAFAGNVVASELRC  172

Query  1184  RLFPLLEFYGEN--REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL     +    +LD QDV RRF+FD ICK SFG+DPGCL+LSLP+S FA AFD A
Sbjct  173   RLVPLLHSASSDGSERLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPISAFADAFDTA  232

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S LSA RA      VWK+KRLLNIG E++L +AI L++ LA E+I Q+RK G A    DL
Sbjct  233   SMLSARRATVPMHVVWKLKRLLNIGEERELRDAIHLVDALAAEVIRQRRKLGSAASGYDL  292

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG I+DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HPEV   IR E  R+   
Sbjct  293   LSRFMGSINDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPEVAAAIRDEVFRVAGG  352

Query  650   DQDLAT---YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                +A    + +++DM+Y+ AA++ESMRLFPPVQFDSKF   +DTLPDGTFV KGTRVTY
Sbjct  353   RDPIAASFEFDKLKDMHYVHAALYESMRLFPPVQFDSKFAAGEDTLPDGTFVAKGTRVTY  412

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             H YAMGRM+S+WG DC  F+PERWL  G F  E+ Y YPVFQ G RVC+GKD+A++EMK+
Sbjct  413   HAYAMGRMESVWGPDCAAFRPERWLSGGQFVPESPYHYPVFQGGVRVCIGKDLAIMEMKA  472

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             V VA++ +FD+E V  S + P++APGLTAT  GG+
Sbjct  473   VIVAVVLSFDVEAVDRSSRRPKFAPGLTATFAGGV  507



>dbj|BAJ85532.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88967.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=506

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 349/472 (74%), Gaps = 15/472 (3%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
              P C C +C+AYLT SW  + +NL DWY+ LL +SPTGT+ +HVLG  +TANPANVEYML
Sbjct  40    NPWCGCHVCQAYLTGSWAKDFTNLADWYAHLLRESPTGTVQLHVLGCTVTANPANVEYML  99

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+NFPKGK+FA++LGDLLG GIF VDGD W+ QRKMAS + GSV++RSYA++IVA E
Sbjct  100   KTRFDNFPKGKRFAALLGDLLGDGIFNVDGDAWRHQRKMASLQLGSVTVRSYAYKIVAQE  159

Query  1193  VRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDL  1014
             V +RL P+L    +  +V+D QDV RRF+FD ICK SFG+DPGCLDL +P+S  A AFD 
Sbjct  160   VESRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLANAFDD  219

Query  1013  ASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSD  834
             AS+L A R   ASP VWKVKR+LNIGSE++L +AI L+++LA  MI Q+R   G  +  D
Sbjct  220   ASRLCAMRGAAASPLVWKVKRMLNIGSERELKKAINLVDDLASAMILQRRSL-GFDNSHD  278

Query  833   LLSRFMG--IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             LLSRFM   +  DDK LRDIV+SFLLAGRDT+ASALT+ F  L ++PEVT  IRAE+G  
Sbjct  279   LLSRFMASDVGMDDKYLRDIVVSFLLAGRDTVASALTTLFIHLHKNPEVTAAIRAEAG--  336

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                    +TY+ +  + Y  A + E+MRLFPPVQFDSKFC   D LPDGT+V   +RV Y
Sbjct  337   ---GDKPSTYEHLMSLQYTHAVLFENMRLFPPVQFDSKFCAAADVLPDGTYVEGESRVMY  393

Query  479   HPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             HPYAMGRM SIWGAD   F+P+RWL    G F   NLYKYPVFQAG RVCLGK++A++EM
Sbjct  394   HPYAMGRMPSIWGADYEAFRPDRWLTGPGGSFAPANLYKYPVFQAGLRVCLGKELAVIEM  453

Query  305   KSVAVALIRAFDIEVVCE---SRQMPRYAPGLTATVRGGLSVRITDRRPQRQ  159
             K+V VA++ AFD+EVV E   S   P ++PGLTA++ GGL VRI  +R  RQ
Sbjct  454   KAVGVAVVTAFDVEVVGENGRSGWAPTFSPGLTASISGGLPVRI--KRASRQ  503



>ref|XP_003577893.2| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=515

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/470 (58%), Positives = 346/470 (74%), Gaps = 9/470 (2%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  +  NL DWY+ LL +SPTGT+ VHVLG V+TA+PANVE++L 
Sbjct  45    PWCGCHVCRAYLTGSWAKDFVNLGDWYAHLLRRSPTGTLAVHVLGCVVTASPANVEHVLR  104

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
              +F+N+PKGK FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA+ IV  EV
Sbjct  105   HRFDNYPKGKPFAAVLGDLLGGGIFNVDGDAWRRQRKMASLELGSVAVRSYAYSIVNQEV  164

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L     N  V+D QDV RRF+FD ICK SFG+DPGCL+L +P+S+ AAAFD A
Sbjct  165   HGRLLPVLAAAAGNGAVVDLQDVFRRFAFDTICKISFGLDPGCLELDMPMSELAAAFDTA  224

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASPAVWK KRLLN+GSE++L +AI L++ELA  MI Q+RK  G  +  DL
Sbjct  225   SRLSAMRGAAASPAVWKAKRLLNVGSERELRKAIALVDELAAAMIRQRRKL-GFDNSHDL  283

Query  830   LSRFMGII-----DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             LSRFM         DDK LRDIV+SFLLAGRDT++SALT+ F LLS HP V   IRAE  
Sbjct  284   LSRFMAASAGDDEHDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSEHPAVASAIRAELD  343

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
                 P+    TY+Q++ ++Y  A ++E+MRL+PPVQFDSKFC   D LPDGT+V  G RV
Sbjct  344   LATSPESMATTYEQLKSLHYAHAVVYENMRLYPPVQFDSKFCAAADVLPDGTYVAAGARV  403

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
              YHPYAMGRM +IWG DC  F+P+RWL    G F+  +LY+YPVFQAG RVCLGK++A++
Sbjct  404   MYHPYAMGRMPTIWGDDCESFRPDRWLTGAGGAFQPASLYRYPVFQAGLRVCLGKELAVM  463

Query  311   EMKSVAVALIRAFDIEVV-CESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             EMK+ AVA++R FD+E++       P++APGLTA++ GGL VR+    P+
Sbjct  464   EMKAAAVAVVREFDVEIINGNGGASPKFAPGLTASISGGLPVRVRRLAPR  513



>dbj|BAJ94069.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85878.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/474 (58%), Positives = 350/474 (74%), Gaps = 9/474 (2%)
 Frame = -1

Query  1559  KLKP--LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +L+P   C C +C+AYLT+SWT E  NLCDW++ LL + P  T+HVHVLGNV+TANPA V
Sbjct  43    RLRPPWWCACSVCEAYLTASWTGEFDNLCDWFAHLLRREPGRTVHVHVLGNVLTANPATV  102

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML  +F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S +IR++   +
Sbjct  103   EHMLRGRFDNYPKGAPFSAILADFLGRGIFNVDGDPWLFQRKLAAAELASPAIRAFTASV  162

Query  1205  VAAEVRTRLFPLLEFYGENR---EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSK  1035
             V++E+R RL PLL      +   ++LD QDV RRF+FD ICK SFG+DPGCL+LSLP+S 
Sbjct  163   VSSELRCRLIPLLHSATAGQGGDKLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPMSA  222

Query  1034  FAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCG  855
             FA AFD AS LSA RA      +WK+KRLLNIG E++L +AIGL+++LA E+I Q+RK  
Sbjct  223   FANAFDTASMLSARRATAPMHVLWKLKRLLNIGDERELRDAIGLVDDLAAEVIRQRRKLR  282

Query  854   GARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
              A    DLLSRFMG I+DDK LRDI++SF+LAGRDT+ASALT+FF LLS HP V D IR 
Sbjct  283   SATSGDDLLSRFMGSINDDKYLRDIIVSFMLAGRDTVASALTAFFLLLSDHPHVADAIRD  342

Query  674   ESGRIM----EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
             E  R+     E     AT  +++ M+Y+ AA+ E MRLFPPVQFDSKF   +DTLPDGT 
Sbjct  343   EVFRVAGGRGEGHPTTATSGELKRMHYVHAALFECMRLFPPVQFDSKFAAGEDTLPDGTP  402

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGK  327
             V KGTRVTYH YAMGRM+S+WG DC EF+PERWL  G F  E+ Y+YPVFQ G RVC+GK
Sbjct  403   VAKGTRVTYHAYAMGRMESVWGPDCAEFRPERWLRGGQFVPESPYRYPVFQGGVRVCIGK  462

Query  326   DMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             ++A++EMK+  VA++++FDIE V  S + P++A GLTAT  GG+ VR+  R  Q
Sbjct  463   ELAIMEMKAAIVAVVQSFDIEAVGRSSRRPKFAAGLTATFVGGVPVRVRRRASQ  516



>ref|XP_002439880.1| hypothetical protein SORBIDRAFT_09g021890 [Sorghum bicolor]
 gb|EES18310.1| hypothetical protein SORBIDRAFT_09g021890 [Sorghum bicolor]
Length=535

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/459 (58%), Positives = 344/459 (75%), Gaps = 9/459 (2%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+AY+T+SW  E  NLCDWY+ LL ++P  T+HVHVLGNV+TANP  +++ML  +
Sbjct  57    CACAVCEAYVTASWAAEFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPPTIDHMLRGR  116

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S ++R +A  +VA+E+R 
Sbjct  117   FDNYPKGAPFSAILADFLGRGIFNVDGDSWLFQRKLAAAELASPALRCFAAGVVASELRC  176

Query  1184  RLFPLLEFYGENRE-----VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
             RL PLL     + +     +LD QDV RRF+FD IC+ SFG+DPGCL+LSLP+S FA AF
Sbjct  177   RLIPLLYSAAGDGDSSGDRLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFADAF  236

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
             D AS LSA RA      +WK+KRLLN+G E++L +AI L++ LA E+I Q+RK G A   
Sbjct  237   DTASMLSARRATAPMHVLWKLKRLLNVGEERELRDAIRLVDTLAAEVIRQRRKLGTAASG  296

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLSRFMG I+DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HP+V   IR E  R+
Sbjct  297   DDLLSRFMGSINDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPDVATAIRDEVSRV  356

Query  659   MEPD----QDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
                D       A+ ++++DM+Y+ AA+HE MRLFPPVQFDSKF   DD LPDGTFV +GT
Sbjct  357   AGDDDRDGHAAASSEKLKDMHYVHAALHECMRLFPPVQFDSKFAAGDDMLPDGTFVARGT  416

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
             RVTYH YAMGRM+S+WG DC EF+P+RWL DG F  E+ Y+YPVFQ G RVC+G+++A++
Sbjct  417   RVTYHAYAMGRMESVWGPDCAEFRPDRWLHDGRFVPESPYRYPVFQGGVRVCIGRELAIM  476

Query  311   EMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             EMKSV V+++++FDIE V  S   P++APGLTAT  GG+
Sbjct  477   EMKSVIVSVVQSFDIEAVGRSSHRPKFAPGLTATFAGGV  515



>gb|AJD25222.1| cytochrome P450 CYP94C55 [Salvia miltiorrhiza]
Length=488

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/464 (58%), Positives = 351/464 (76%), Gaps = 8/464 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V + +  C CEIC+ Y  S W ++  NLCDWY+ LL  SP  T+H+HVL N ITANP NV
Sbjct  31    VMRKRVWCSCEICETYSESQWRIQFQNLCDWYTHLLKNSPNRTVHIHVLNNTITANPDNV  90

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EYML T+F+NFPKGK F++ILGD LGRGIF VDG  W FQRKMA+ E   VS R+Y+F +
Sbjct  91    EYMLKTRFDNFPKGKPFSAILGDFLGRGIFNVDGTFWTFQRKMATLELARVSTRAYSFHV  150

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             V  E++ RL PL+     + ++LD QD+ R+FSFD I +F FG+DP  L+LSLP+S F A
Sbjct  151   VNLEIQQRLMPLMA----STQILDLQDLFRKFSFDCISRFCFGLDPTRLELSLPLSDFVA  206

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             +FDLASKLSAERA+  SP VWKVKR LNIGSE++L  AIG I+ +A + I ++RK G + 
Sbjct  207   SFDLASKLSAERALATSPVVWKVKRFLNIGSERRLRRAIGTIHVIARDFIRERRKLGFSE  266

Query  845   DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
              Q DLLSRFM  + DDK L DIVISFLLAGRDT+ASALTSFFWL++ HP+V   I AE+ 
Sbjct  267   RQ-DLLSRFMSSVGDDKFLIDIVISFLLAGRDTVASALTSFFWLVACHPDVEAAILAEAE  325

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
              ++    +L +  Q+R+++YL AA++ESMRL+PP+QFDSKFCL DD LPDG+FV+ GTRV
Sbjct  326   EVIP--AELRSCDQLRELHYLHAAVYESMRLYPPIQFDSKFCLEDDVLPDGSFVKGGTRV  383

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             T+HPYAMGRM+ IWG+DC EFKP+RW+ DGVF  EN +K P+FQAG RVCLGK++AL+E+
Sbjct  384   TFHPYAMGRMEEIWGSDCLEFKPQRWMRDGVFVHENPFKCPIFQAGIRVCLGKELALMEL  443

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K+VA++++R F +E+  +  Q P ++PGLTAT + GL  RI  R
Sbjct  444   KTVALSVLRRFRVELD-QPDQPPCFSPGLTATFKDGLRARIRAR  486



>ref|XP_006436643.1| hypothetical protein CICLE_v10033768mg [Citrus clementina]
 ref|XP_006492206.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
 gb|ESR49883.1| hypothetical protein CICLE_v10033768mg [Citrus clementina]
Length=510

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 355/473 (75%), Gaps = 10/473 (2%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             + + K  C CEIC +Y++SSW+ E  NLCDWY+ LL KS   TI +HVL N ITANP NV
Sbjct  37    IQRQKFWCNCEICSSYISSSWSNEFKNLCDWYTHLLQKSKNQTIQIHVLNNTITANPDNV  96

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             EY+L T+F N+PKGK F+ ILGDLLG+GIF VDGDLW FQRK+A+    S+SIR+YAFE+
Sbjct  97    EYILKTRFNNYPKGKPFSMILGDLLGKGIFNVDGDLWIFQRKIATLVLASISIRTYAFEL  156

Query  1205  VAAEVRTRLF-------PLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSL  1047
             V  E++ RL           +    N  V+D Q V RRFSFDNICKFSFG+DP  L+ SL
Sbjct  157   VTNEIKYRLLPLLSSSLANNDTTSNNNSVVDLQGVFRRFSFDNICKFSFGLDPYYLESSL  216

Query  1046  PVSKFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQK  867
             P+S+FA AFDLASKLSAERA+ A P  WK+KRL N+G+EK+L +AI ++N+LA E+I QK
Sbjct  217   PISQFANAFDLASKLSAERAMAALPLAWKIKRLFNMGTEKRLKKAIEVVNDLAMEVIMQK  276

Query  866   RKCGGARDQS-DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVT  690
             RK   + + S DLLSRFM  I DD  LRDIV+SF+LAGRDT+A+ALT+FF+LL+ HP+V 
Sbjct  277   RKLDLSTENSQDLLSRFMNCISDDNYLRDIVVSFILAGRDTMAAALTTFFFLLAHHPQVV  336

Query  689   DRIRAESGRIMEPDQD-LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDG  513
              +IR E  ++M  DQ+ LA+Y QIR+M+YL AA++ES+RL+PPVQFDSKF   DD L DG
Sbjct  337   LKIRQEFDQVMSLDQEVLASYNQIREMHYLHAAVNESLRLYPPVQFDSKFAQADDILADG  396

Query  512   TFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCL  333
             T+V KGTRVTYHPYAMGRM+ IWG D  EFKPERWL++ +F  +  YKYPVFQAG R CL
Sbjct  397   TYVNKGTRVTYHPYAMGRMEKIWGQDFMEFKPERWLKNAMFCPQCQYKYPVFQAGARACL  456

Query  332   GKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             GK++AL E+K VA++++  FDIE+V E R  PR+  GLTA +R GL V I +R
Sbjct  457   GKELALAEIKMVALSVLSKFDIEIV-EPRGAPRFDNGLTAMLRDGLQVLIKER  508



>ref|NP_001066166.2| Os12g0150200 [Oryza sativa Japonica Group]
 dbj|BAF29185.2| Os12g0150200, partial [Oryza sativa Japonica Group]
Length=511

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/472 (59%), Positives = 350/472 (74%), Gaps = 18/472 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYL  SW  E +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  39    PWCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLK  98

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKG+ FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++IVA EV
Sbjct  99    TRFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEV  158

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    ++  V+D QDV RRF+FD ICK SFG+DPGCLD  +PVS+ A AFD A
Sbjct  159   EARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LN+GSE++L +AI LI+ LA  MI ++RK G A +  DL
Sbjct  219   SRLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA-NSHDL  277

Query  830   LSRFMGI-------IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             LSRFM           DDK LRDIV+SFLLAGRDT++SALT+ F +LS++P+V   +RAE
Sbjct  278   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  337

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             +G        + +Y+ ++ +NY  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G 
Sbjct  338   AGAAAGESAAV-SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGGA  396

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             RV YHPYAMGRM  IWGADC  F+PERWL    G F  E+L+KYPVFQAG RVCLGK++A
Sbjct  397   RVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKELA  456

Query  317   LVEMKSVAVALIRAFDIEVVCESRQ-------MPRYAPGLTATVRGGLSVRI  183
             + EMK+V+VA++RAFD+EVV E+ +        PR+ PGLTA++ GGL V+I
Sbjct  457   ITEMKAVSVAVVRAFDVEVVGENGRCGGGAAAAPRFVPGLTASISGGLPVKI  508



>gb|ABA95812.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAY82271.1| hypothetical protein OsI_37479 [Oryza sativa Indica Group]
 dbj|BAG89061.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/472 (59%), Positives = 350/472 (74%), Gaps = 18/472 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYL  SW  E +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  37    PWCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLK  96

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKG+ FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++IVA EV
Sbjct  97    TRFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEV  156

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    ++  V+D QDV RRF+FD ICK SFG+DPGCLD  +PVS+ A AFD A
Sbjct  157   EARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAA  216

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LN+GSE++L +AI LI+ LA  MI ++RK G A +  DL
Sbjct  217   SRLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA-NSHDL  275

Query  830   LSRFMGI-------IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             LSRFM           DDK LRDIV+SFLLAGRDT++SALT+ F +LS++P+V   +RAE
Sbjct  276   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  335

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             +G        + +Y+ ++ +NY  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G 
Sbjct  336   AGAAAGESAAV-SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGGA  394

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             RV YHPYAMGRM  IWGADC  F+PERWL    G F  E+L+KYPVFQAG RVCLGK++A
Sbjct  395   RVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKELA  454

Query  317   LVEMKSVAVALIRAFDIEVVCESRQ-------MPRYAPGLTATVRGGLSVRI  183
             + EMK+V+VA++RAFD+EVV E+ +        PR+ PGLTA++ GGL V+I
Sbjct  455   ITEMKAVSVAVVRAFDVEVVGENGRCGGGAAAAPRFVPGLTASISGGLPVKI  506



>ref|XP_008662461.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW56035.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=509

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/467 (59%), Positives = 345/467 (74%), Gaps = 8/467 (2%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTVHVHVLGCTVTANPANVEYMLK  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLGRGIF VDG  W+ QRKMAS E GSV++RSYAF I+A EV
Sbjct  100   TNFDNFPKGKTFAALLGDLLGRGIFNVDGHAWRHQRKMASLELGSVTVRSYAFGIIAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL PLL    ++  V+D QDV RRF+FD ICK SFG+DPGCL+  +PVS+ A AFD A
Sbjct  160   EARLLPLLAGAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLEPEMPVSELADAFDTA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++LSA R   A+P +W+ KRLLN+GSE++L  AI L++ELA  +I ++RK G A    DL
Sbjct  220   TRLSATRGAAAAPLLWRAKRLLNVGSERELRAAIKLVDELAATVIRERRKLGVAPSGHDL  279

Query  830   LSRFM---GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             LSRFM   G  DDD+ LRDIV+SFLLAGRDT++SALT+ F LLS +P V   +RAE+G  
Sbjct  280   LSRFMASAGADDDDRYLRDIVVSFLLAGRDTVSSALTTLFMLLSENPGVAAAMRAEAGDG  339

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                     TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  GTRV Y
Sbjct  340   DGGPAPPLTYEHLKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVPGGTRVMY  399

Query  479   HPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             HPYAMGRM  IWGAD   F+P RWL    G F  E+LY+YPVFQAG RVCLGK++A+ EM
Sbjct  400   HPYAMGRMPRIWGADHGAFRPGRWLTGAGGSFVPESLYRYPVFQAGLRVCLGKELAVTEM  459

Query  305   KSVAVALIRAFDIEVVCESRQM---PRYAPGLTATVRGGLSVRITDR  174
             K+VAVA++RAFD+ VV +S      P++  GLTA++ GGL VRI+ R
Sbjct  460   KAVAVAVVRAFDVHVVGDSSSAACKPKFVSGLTASISGGLPVRISRR  506



>ref|XP_002862559.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38817.1| CYP94C1 [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/464 (60%), Positives = 341/464 (73%), Gaps = 19/464 (4%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C CEIC AYLTSSW  +  NL DWY+ LL +SPT TI VHVL +VITANP+NVE++L T 
Sbjct  32    CNCEICHAYLTSSWRKDFINLSDWYTHLLRRSPTSTIKVHVLNSVITANPSNVEHILKTH  91

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F ++PKGKQF+ ILGDLLGRGIF  DGD W+FQRK+AS E GSVS+R +A EIV  E+ T
Sbjct  92    FHSYPKGKQFSVILGDLLGRGIFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIET  151

Query  1184  RLFPLLEFYGENR-EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLAS  1008
             RL P+L  + +N   VLD QDV RRFSFD I K SFG DP CL L  P+S+FA AFD AS
Sbjct  152   RLLPILTSFSDNPGSVLDLQDVFRRFSFDTISKLSFGFDPDCLRLPFPMSEFAVAFDTAS  211

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLL  828
              LSA+RA+   P +WK+KRLL IGSEKKL E+I +IN LA ++I+  R+  G   ++DL+
Sbjct  212   TLSAKRALAPFPLLWKIKRLLRIGSEKKLKESINVINRLAGDLIKH-RRLTGLMGKNDLI  270

Query  827   SRFMGII--DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIME  654
             SRFM ++  DDD+ LRDIV++FLLAGRDT+A+ LT FFWLL RHP+V +RIR E  R+M 
Sbjct  271   SRFMAVVAEDDDEYLRDIVVNFLLAGRDTVAAGLTGFFWLLMRHPDVENRIREELDRVMG  330

Query  653   PDQDLATYQ--QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
                D  T +  ++R+M+YL AA++ESMRLFPPVQFDSKF LNDD L DGTFV++GTRVTY
Sbjct  331   TGFDSVTARCDEMREMDYLHAALYESMRLFPPVQFDSKFALNDDVLSDGTFVKRGTRVTY  390

Query  479   HPYAMGRMDSIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             H YAMGRMD IWG D  EFKPERWL+ +G F+ EN  KYPVFQAG R           MK
Sbjct  391   HAYAMGRMDRIWGPDYEEFKPERWLDSEGKFRPENPVKYPVFQAGAR-----------MK  439

Query  302   SVAVALIRAFDIEVVC-ESRQMPRYAPGLTATVRGGLSVRITDR  174
             S+AVA+ R F   +   ES +  R+APGLTATV GGL V I +R
Sbjct  440   SIAVAINRRFKTRLASLESTKTLRFAPGLTATVNGGLPVIIQER  483



>ref|XP_008662467.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|AFW56045.1| putative cytochrome P450 superfamily protein [Zea mays]
Length=507

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 346/467 (74%), Gaps = 10/467 (2%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +S TGT+HVHVLG  +TANPANVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESATGTVHVHVLGCTVTANPANVEYMLK  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLGRGIF VDG  W+ QRKMAS E GSV++RSYAF I+A EV
Sbjct  100   TNFDNFPKGKTFAALLGDLLGRGIFNVDGHAWRHQRKMASLELGSVTVRSYAFGIIAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL PL+    +   V+D QDV RRF+FD ICK SFG+DPGCL+  +P+S+ A A D A
Sbjct  160   EARLLPLVASAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEPEMPMSELADALDTA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++LSA R   A+P +W+ KRLLN+GSE++L  AI L++ELA  +I ++RK G A    DL
Sbjct  220   TRLSATRGAAAAPLLWRAKRLLNVGSERELRAAIKLVDELAAAVIRERRKLGVAASGHDL  279

Query  830   LSRFM---GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
             LSRFM   G  DDD+ LRDIV+SFLLAGRDT++SALT+ F LLS +P V   +RAE+G  
Sbjct  280   LSRFMASAGADDDDRYLRDIVVSFLLAGRDTVSSALTTLFMLLSENPGVAAAMRAEAGD-  338

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
               P   L TY+ ++ M+Y  A ++E+MRLFPPVQFDSKFC+  D LPDGT+V  GTRVTY
Sbjct  339   GGPAPPL-TYEHLKRMHYTHAVLYENMRLFPPVQFDSKFCVGPDVLPDGTYVPGGTRVTY  397

Query  479   HPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             HPYAMGRM  IWGAD   F+P RWL    G F  E+LYKYPVFQAG RVCLGK++A+ EM
Sbjct  398   HPYAMGRMPRIWGADHGAFRPGRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAVTEM  457

Query  305   KSVAVALIRAFDIEVVCESRQM---PRYAPGLTATVRGGLSVRITDR  174
             K+VAVA++RAFD+ VV +S      P++  GLTA++ GGL VRI+ R
Sbjct  458   KAVAVAVVRAFDVHVVGDSGSAACKPKFVSGLTASISGGLPVRISRR  504



>ref|XP_004961922.1| PREDICTED: cytochrome P450 94A2-like [Setaria italica]
Length=524

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 345/462 (75%), Gaps = 9/462 (2%)
 Frame = -1

Query  1559  KLKP--LCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             +L+P   C C +C+AY+T+SW  E  NLCDWY+ LL ++P  T+HVHVLGNV+TANP  V
Sbjct  46    RLRPPWWCACAVCEAYVTASWAGEFDNLCDWYAHLLRRAPGRTVHVHVLGNVLTANPPTV  105

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             ++ML  +F+N+PKG  F++IL D LG GIF VDGD W FQRK+A+ E  + ++R YA  +
Sbjct  106   DHMLRGRFDNYPKGAPFSAILADFLGCGIFNVDGDSWLFQRKLAAAELAAPALRGYATGV  165

Query  1205  VAAEVRTRLFPLLEFYGENRE-VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
             VA+E+R RL PLL       E +LD QDV RRF+FD IC+ SFG+DPGCL+LSLP+S FA
Sbjct  166   VASELRCRLIPLLHSASSGGEKLLDLQDVFRRFAFDCICRISFGLDPGCLELSLPMSAFA  225

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA  849
              AFD AS LSA RA       WK+KRLLN+G E++L +AI L++ LA E+I Q+RK G A
Sbjct  226   DAFDTASMLSARRATAPMHVFWKLKRLLNVGEERELRDAIRLVDTLAAEVIRQRRKLGTA  285

Query  848   RDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE-  672
                 DLLSRFMG I+DDK LRDIV+SF+LAGRDT+AS LT+FF LLS HP+V   IR E 
Sbjct  286   ASGDDLLSRFMGSINDDKYLRDIVVSFMLAGRDTVASGLTAFFLLLSDHPDVATAIRDEV  345

Query  671   ----SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFV  504
                  GR  +P    AT ++++DM+Y+ AA++E MRLFPPVQFDSKF   DDTLPDGTFV
Sbjct  346   SGVAGGRGDDPAA-AATSEKLKDMHYVHAALYECMRLFPPVQFDSKFAAGDDTLPDGTFV  404

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKD  324
              +GTRVTYH YAMGRM+S+WG DC EF+PERWL DG F  E+ Y+YPVFQ G RVC+GK+
Sbjct  405   ARGTRVTYHAYAMGRMESVWGPDCAEFRPERWLRDGRFVPESPYRYPVFQGGVRVCVGKE  464

Query  323   MALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGG  198
             +A++EMKSV V+++++FDIE V  S   P++APGLTAT  GG
Sbjct  465   LAIMEMKSVIVSVVQSFDIEAVGRSSHRPKFAPGLTATFAGG  506



>ref|XP_003566202.1| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=529

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/454 (59%), Positives = 342/454 (75%), Gaps = 4/454 (1%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C +C+ YL++SW  E  NLCDWY+ LL   P  T+HVHVLGNV+TANP  VE+ML  +
Sbjct  57    CACAVCECYLSASWAGEFDNLCDWYAHLLRAVPGRTVHVHVLGNVLTANPPTVEHMLRAR  116

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F+N+PKG  F++IL D LGRGIF VDGD W FQRK+A+ E  S +IR++A  +VA+E+R 
Sbjct  117   FDNYPKGAPFSAILADFLGRGIFNVDGDAWLFQRKLAAAELASPAIRAFAANVVASELRC  176

Query  1184  RLFPLLE--FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
             RL PLL         ++LD QDV RRF+FD ICK SFG+DPGCL+LSLP+S FA AFD A
Sbjct  177   RLIPLLHGSASSSASKLLDLQDVFRRFAFDCICKISFGLDPGCLELSLPMSAFADAFDAA  236

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S LSA RA      +WK+KRLLN+G E++L +AIGL++ LA E+I Q+RK   +    DL
Sbjct  237   SMLSARRAAAPMHVLWKLKRLLNVGEERELRDAIGLVDALAAEVIRQRRKLASSGGGDDL  296

Query  830   LSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEP  651
             LSRFMG I+DDK LRDIV+SF+LAGRDT+ASALT+FF LLS HP V D IR E  R+ + 
Sbjct  297   LSRFMGSINDDKYLRDIVVSFMLAGRDTVASALTAFFLLLSDHPRVADAIRDEVSRVTKE  356

Query  650   DQDL--ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
             D  L  AT ++++DM+Y+  A++E MRLFPPVQFDSKF   DDTLPDGTFV +GTRVTYH
Sbjct  357   DNPLTIATPEKLKDMHYVHTALYECMRLFPPVQFDSKFAAGDDTLPDGTFVARGTRVTYH  416

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
              YAMGRM+S+WG+DC EF+PERWL  G F  E+ Y+YPVFQ G RVC+GK++A++EMK+ 
Sbjct  417   AYAMGRMESVWGSDCAEFRPERWLRGGRFVPESPYRYPVFQGGVRVCIGKELAIMEMKAA  476

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
              VA+++ FDIE V  S + P++APGLTAT  GGL
Sbjct  477   IVAVVQRFDIEAVGRSSRRPKFAPGLTATFAGGL  510



>emb|CBI40252.3| unnamed protein product [Vitis vinifera]
Length=480

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/456 (59%), Positives = 327/456 (72%), Gaps = 57/456 (13%)
 Frame = -1

Query  1553  KPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYML  1374
             K  C C+IC  YLTSSW ME  NLCDWY+ LL KSPT TIH+HVLGN ITANP NVEYML
Sbjct  4     KVWCNCDICCGYLTSSWLMEFGNLCDWYTHLLQKSPTHTIHIHVLGNTITANPDNVEYML  63

Query  1373  TTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAE  1194
              T+F+N+PKGK F++ILGDLLG+GIF VDGD W FQRKMAS E GSVSIRS+AFE+V AE
Sbjct  64    KTRFDNYPKGKPFSTILGDLLGKGIFNVDGDSWVFQRKMASLELGSVSIRSFAFEVVMAE  123

Query  1193  VRTRLFPLLEFYGE-NREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFD  1017
             ++ RL PLL  Y E +  VLD QDV RRF+FDNICKFSFG+DP                 
Sbjct  124   IKHRLLPLLSSYAEKDGSVLDLQDVFRRFTFDNICKFSFGLDP-----------------  166

Query  1016  LASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS  837
                    ERA+ ASP +WK+KRLLN+GSE++L EAI  +N                    
Sbjct  167   -------ERAMVASPLIWKIKRLLNLGSERRLKEAIKKVN--------------------  199

Query  836   DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM  657
                        DD  LRDIVISF+LAGRDT+ASALT+FFWL++ HPEV  +IR E+ RIM
Sbjct  200   -----------DDDYLRDIVISFILAGRDTMASALTTFFWLVATHPEVESKIRDEADRIM  248

Query  656   EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYH  477
              P+Q+  +++ IR+M+YL AA+HES+RL+PPVQFDSKF   DD L DGTFV KGTRVTYH
Sbjct  249   HPNQEFPSFELIREMHYLHAAVHESLRLYPPVQFDSKFARQDDVLRDGTFVMKGTRVTYH  308

Query  476   PYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             PYAMGR+++IWG DC EF+P+RWL +G F  ++ +K+PVFQAG RVCLGK+MA+V MKSV
Sbjct  309   PYAMGRIEAIWGPDCMEFRPQRWLNNGTFFPQSPFKFPVFQAGIRVCLGKEMAVVAMKSV  368

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSV  189
             A A++R F+I VV  +   PR+  GLTATVRGGL V
Sbjct  369   AAAVLRPFNIHVV-HANVAPRFDSGLTATVRGGLPV  403



>ref|XP_004977561.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=503

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/470 (59%), Positives = 348/470 (74%), Gaps = 15/470 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  38    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTVHVHVLGCTVTANPANVEYMLK  97

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++I+A EV
Sbjct  98    TNFDNFPKGKTFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIIAQEV  157

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    +   V+D QDV RRF+FD ICK SFG+DPGCL+  +P+SK A AFD A
Sbjct  158   EARLMPVLADAADRGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPMSKLADAFDTA  217

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP +W++KRLLNIGSE++L +AI L++ELA  MI ++RK G A +  DL
Sbjct  218   TRLCAMRGAAASPLLWRMKRLLNIGSERELKKAIKLVDELAAAMIRERRKLGFA-NSHDL  276

Query  830   LSRFMGIID-----DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             LSRFM         DDK LRDIV+SFLLAGRDT++SALT  F LLS++P+V   +RAE+G
Sbjct  277   LSRFMASAGDAHAVDDKYLRDIVVSFLLAGRDTVSSALTMLFMLLSKNPDVAAAMRAEAG  336

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
                  D    TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G RV
Sbjct  337   ----DDSTPVTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVSGGARV  392

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
              YHPYAMGRM  IWGAD  EF+P+RWL    G F  E+LYKYPVFQAG RVCLGK++A+ 
Sbjct  393   MYHPYAMGRMPRIWGADHGEFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAIT  452

Query  311   EMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGGLSVRITDRR  171
             EMK+V+VA++RAFD+EVV ES      P++  GLTA++ GGL VRI   R
Sbjct  453   EMKAVSVAVVRAFDVEVVGESGSGACAPKFVSGLTASISGGLPVRIRRAR  502



>ref|XP_002450277.1| hypothetical protein SORBIDRAFT_05g003100 [Sorghum bicolor]
 gb|EES09265.1| hypothetical protein SORBIDRAFT_05g003100 [Sorghum bicolor]
Length=509

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/467 (60%), Positives = 342/467 (73%), Gaps = 13/467 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL  SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRDSPTGTVHVHVLGCTVTANPANVEYMLR  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLG GIF VDG  W  QRKMAS E GSV++RSYAF IVA EV
Sbjct  100   TNFDNFPKGKAFAAVLGDLLGGGIFNVDGHAWLHQRKMASLELGSVAVRSYAFGIVAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              +RL P+L    +   V+D QDV RRF+FD ICK SFG+DPGCLDL +PVSK A AFD A
Sbjct  160   ESRLVPVLASAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLDLEMPVSKLADAFDTA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP +WK KRLLN+GSE++L EAI L++EL+  MI ++RK G A    DL
Sbjct  220   TRLCAMRGAAASPLLWKAKRLLNVGSERELREAIKLVDELSAAMIRERRKLGVAGSH-DL  278

Query  830   LSRFMGIID------DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
             LSRFM          DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V   +RAE+
Sbjct  279   LSRFMASSGDARHDVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVASAMRAEA  338

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
                 E    L TY+ ++ ++Y  A ++E+MRLFPPVQFDSKF    D LPDGT+V  GTR
Sbjct  339   AGGDESTAAL-TYEHLKRLHYTHAVLYENMRLFPPVQFDSKFSAGSDVLPDGTYVAGGTR  397

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             VTYHPYAMGRM  IWGAD   F+P+RWL    G F  E+LY+YPVFQAG RVCLGK++A+
Sbjct  398   VTYHPYAMGRMPRIWGADHGAFRPDRWLTGPGGTFVPESLYRYPVFQAGLRVCLGKELAV  457

Query  314   VEMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGGLSVRI  183
              EMK+VAVA++RAFD+EVV +       P++  GLTA++ GGL VRI
Sbjct  458   TEMKAVAVAVVRAFDVEVVGDGGNAACAPKFVSGLTASISGGLPVRI  504



>ref|XP_003578905.1| PREDICTED: cytochrome P450 94C1-like [Brachypodium distachyon]
Length=518

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/467 (60%), Positives = 348/467 (75%), Gaps = 12/467 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL  SPTGT+HVHVLG  +TANP NVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWAKDFTNLGDWYAHLLRASPTGTVHVHVLGCTVTANPGNVEYMLR  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGKQFA++LGDLLG GIF VDGD W+ QRKMAS E GSVS+RSYA++IVA EV
Sbjct  100   TRFDNFPKGKQFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVSVRSYAYKIVAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              TRL P+L    +  +V+D QDV RRF+FD ICK SFG+DPGCLDL +P+S  A +FD A
Sbjct  160   ETRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLAESFDAA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP VWK+KR LN+GSE++L +AI L+++LA  MI Q+RK  G  +  DL
Sbjct  220   SRLSAMRGAAASPLVWKLKRFLNVGSERELRKAIRLVDDLAAAMILQRRKL-GFENSHDL  278

Query  830   LSRFMGIID------DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
             LSRFM   D      DDK LRDIV+SFLLAGRDT+ASALT+ F  LS +PEV   IRAE+
Sbjct  279   LSRFMASADAGAGAMDDKYLRDIVVSFLLAGRDTVASALTTLFIHLSSNPEVAAAIRAEA  338

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
             G   E D   ++Y+ ++ + Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V   +R
Sbjct  339   GAGDEDDNKPSSYEHLKGLQYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVAAESR  398

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             V YHPYAMGRM SIWGADC  F+P RWL    G F   +LYKYPVFQAG RVCLGK++A+
Sbjct  399   VMYHPYAMGRMPSIWGADCEAFRPARWLTGPGGSFAPPSLYKYPVFQAGLRVCLGKELAI  458

Query  314   VEMKSVAVALIRAFDIEVVCESRQM---PRYAPGLTATVRGGLSVRI  183
              EMK+V VA++R+FD+EV+ E+ +    P++ PGLTA++ GGL  RI
Sbjct  459   TEMKTVCVAMVRSFDVEVLGENGRAGCKPKFVPGLTASISGGLPARI  505



>emb|CBX25324.1| hypothetical_protein [Oryza brachyantha]
Length=509

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/470 (58%), Positives = 341/470 (73%), Gaps = 18/470 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  E +NL DWY+ LL  SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  39    PWCSCHVCRAYLTGSWAREFTNLGDWYAHLLRLSPTGTVHVHVLGCTVTANPANVEYMLK  98

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA++I+A EV
Sbjct  99    TRFDNFPKGKPFAALLGDLLGNGIFNVDGGAWRHQRKMASLELGSVAVRSYAYKIIAQEV  158

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    +   VLD QDV RRF+FD ICK SFG+DP CLD  +PVS+ A AFD A
Sbjct  159   DARLMPVLTDAADRGAVLDLQDVFRRFAFDTICKISFGLDPCCLDREMPVSELADAFDTA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LNIGSE++L +AI +++ELA  MI +++K  G     DL
Sbjct  219   SRLSAMRGAAASPLLWKMKRFLNIGSERELKKAIKIVDELAAAMIRERQKL-GVGSSHDL  277

Query  830   LSRFMGIID------DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAES  669
             LSRFM          DDK LRDIV+SFLLAGRDT+++ALT+ F +LS++PEV   +RAE+
Sbjct  278   LSRFMASTGVDPHAADDKFLRDIVVSFLLAGRDTVSTALTTLFMILSKNPEVAAAMRAEA  337

Query  668   GRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTR  489
                   ++   TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V    R
Sbjct  338   ---GAGEKGATTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVEGDAR  394

Query  488   VTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDMAL  315
             V YHPYAMGRM  IWGAD   F+PERWL      F   N YK+PVFQAG RVCLGK++A+
Sbjct  395   VMYHPYAMGRMPHIWGADHGAFRPERWLTGPGASFVPANPYKFPVFQAGQRVCLGKELAI  454

Query  314   VEMKSVAVALIRAFDIEVVCESRQM------PRYAPGLTATVRGGLSVRI  183
              EMK+V+VA++RAFDIEVV E+ +       PR+ PGLTA++ GGL VR+
Sbjct  455   TEMKAVSVAVVRAFDIEVVGENGRTGGAAAAPRFVPGLTASISGGLQVRV  504



>ref|NP_001065766.1| Os11g0151400 [Oryza sativa Japonica Group]
 gb|AAX92767.1| Cytochrome P450 [Oryza sativa Japonica Group]
 gb|AAX94835.1| Cytochrome P450 [Oryza sativa Japonica Group]
 gb|ABA91454.1| Cytochrome P450 family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27611.1| Os11g0151400 [Oryza sativa Japonica Group]
 gb|EEC67683.1| hypothetical protein OsI_35132 [Oryza sativa Indica Group]
 emb|CBX25523.1| hypothetical_protein [Oryza glaberrima]
Length=520

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/479 (57%), Positives = 348/479 (73%), Gaps = 16/479 (3%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V++  P C C +C+AYLT SW  E +NL DWY+ LL +SPTGT+HVHVLG  +TANPANV
Sbjct  40    VARRWPWCSCHVCRAYLTGSWAREFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANV  99

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML T+F+NFPKG+ FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA++I
Sbjct  100   EHMLRTRFDNFPKGRPFAALLGDLLGDGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKI  159

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +A EV  RL P+L    +   VLD QDV RRF+FDNICK SFG+DPGCLD  +PVS+ A 
Sbjct  160   IAQEVEARLMPVLADAADRGAVLDLQDVFRRFAFDNICKISFGLDPGCLDREMPVSELAD  219

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             AFD AS+LSA R   ASP +W+ KR LN+GSE++L +AI +++ELA  MI +++K  G  
Sbjct  220   AFDAASRLSAMRGAAASPLLWRAKRFLNVGSERELRKAIKVVDELAAAMIRERQKL-GVG  278

Query  845   DQSDLLSRFM---GIID---DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDR  684
                DLLSRFM   G+ D   DDK LRDIV+SFLLAGRDT+++ALT+ F LLS++PEV   
Sbjct  279   SSHDLLSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDTVSTALTTLFMLLSKNPEVAAA  338

Query  683   IRAESGRIMEPDQDLA-TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
             +RAE+      +   A TY+ ++ ++Y  A +HE+MRLFPPVQFDSKFC   D LPDGT+
Sbjct  339   MRAEAEAGDGGETGAAITYEHLKGLHYTHAVLHENMRLFPPVQFDSKFCAAADVLPDGTY  398

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCL  333
             V    RV YHPYAMGRM  IWGAD   F+P RWL      F   N YKYPVFQAG RVCL
Sbjct  399   VGGDARVMYHPYAMGRMPHIWGADYAAFRPARWLTGPGASFVPANPYKYPVFQAGQRVCL  458

Query  332   GKDMALVEMKSVAVALIRAFDIEVVCESRQ------MPRYAPGLTATVRGGLSVRITDR  174
             GK++A+ EMK+ +VA++RAFD+EVV E+ +       PR+ PGLTA++ GGL VR+  R
Sbjct  459   GKELAVTEMKAASVAVVRAFDVEVVGENGRSGGAAAAPRFVPGLTASISGGLQVRVRRR  517



>dbj|BAJ88829.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/466 (60%), Positives = 347/466 (74%), Gaps = 16/466 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+ YLT SW  + +NL DWY+ LL +SPTGT+H+HVLG  +TANPANVEYML 
Sbjct  38    PWCSCHVCRTYLTGSWAKDFTNLGDWYAHLLRESPTGTVHIHVLGCTVTANPANVEYMLK  97

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK+FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++IVA EV
Sbjct  98    TNFDNFPKGKRFAALLGDLLGGGIFNVDGDAWRHQRKMASLELGSVTVRSYAYKIVAHEV  157

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              TRL P+L    +  +V+D QDV RRF+FD ICK SFG+DPGCLDL +P+S  A AFD A
Sbjct  158   ETRLLPVLADAADKGKVVDLQDVFRRFAFDTICKISFGLDPGCLDLDMPMSDLANAFDTA  217

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP VWK+KR+LNIGSE++L +AI L+++LA  MI Q+RK  G  +  DL
Sbjct  218   SRLSAMRGAAASPFVWKLKRMLNIGSERELKKAIKLVDDLASAMILQRRKL-GFENSHDL  276

Query  830   LSRFM---GIID--DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             LSRFM   G +   D+K LRDIV+SFLLAGRDT+ASALT+ F  LS++PEV   IR E+G
Sbjct  277   LSRFMASDGDVQAMDNKYLRDIVVSFLLAGRDTVASALTTLFIHLSKNPEVAAAIRTEAG  336

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
                      +TY+ ++ + Y  A ++E+MRLFPPVQFDSKF    D LPDGT+V   +RV
Sbjct  337   -----GDKPSTYEHLKSLQYTHAVLYENMRLFPPVQFDSKFSAAADVLPDGTYVEGESRV  391

Query  485   TYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
              YHPYAMGRM SIWGAD   F+P+RWL    G F   +LYKYPVFQAG RVCLGK++A+ 
Sbjct  392   MYHPYAMGRMPSIWGADYEAFRPDRWLTGPGGSFAPASLYKYPVFQAGLRVCLGKELAVT  451

Query  311   EMKSVAVALIRAFDIEVVCE---SRQMPRYAPGLTATVRGGLSVRI  183
             EMK+V+VA++RAFD+EVV E   S   PR+  GLTA++ GGL VRI
Sbjct  452   EMKAVSVAVVRAFDVEVVGENGRSGWAPRFVAGLTASISGGLPVRI  497



>ref|XP_006481812.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Citrus sinensis]
Length=451

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/462 (57%), Positives = 327/462 (71%), Gaps = 53/462 (11%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
             KLK  C CEIC  YLT SW+ +  NLCDWY+ LL+KSPT TIH+HVLGN ITANP NVEY
Sbjct  43    KLKLWCNCEICDGYLTMSWSKQFDNLCDWYAHLLSKSPTKTIHIHVLGNTITANPDNVEY  102

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             ML T+F+NFPKGK F++ILGD LGRGIF VDGD W+FQ++MAS E    SIRSYA EIV 
Sbjct  103   MLKTRFDNFPKGKPFSTILGDFLGRGIFNVDGDSWRFQKEMASLELRRFSIRSYALEIVN  162

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              E++TRL P                                                   
Sbjct  163   QEIKTRLIP---------------------------------------------------  171

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQ  840
              L S ++AERA+T SP VWK+KR+LN+GSEK+L EAI +I+ LA E+I+Q+RK G +   
Sbjct  172   -LLSSVAAERAMTVSPLVWKIKRMLNLGSEKQLKEAIKMIDLLALEVIKQRRKMGFS-TH  229

Query  839   SDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRI  660
              DLLSRFM  ++DD  LRDIVISFLLAGRDT+ASALTSF WLL ++P V   IRAE+ RI
Sbjct  230   KDLLSRFMSSVNDDTYLRDIVISFLLAGRDTVASALTSFVWLLGKNPRVCSEIRAEADRI  289

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             +  +Q+L ++ Q+R+++YL AA+ ES RL+PP+QFDSKFC  DD LPDGT+V+KGTRVTY
Sbjct  290   LGQNQELTSFDQLRELHYLQAAVSESTRLYPPIQFDSKFCEEDDVLPDGTYVKKGTRVTY  349

Query  479   HPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             HPYAMGRM  IWG +C EF PERWL++GVF  EN YKYPVFQAG RVCLGK+MALVE+KS
Sbjct  350   HPYAMGRMREIWGQNCLEFNPERWLKNGVFLPENPYKYPVFQAGFRVCLGKEMALVEIKS  409

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VA++L+R F I+++   R +PR++PGLTAT  GGL V +  R
Sbjct  410   VALSLVRQFQIQLMSPYRNIPRFSPGLTATFNGGLPVLLQQR  451



>ref|XP_006662735.1| PREDICTED: cytochrome P450 94A1-like [Oryza brachyantha]
Length=511

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/472 (57%), Positives = 341/472 (72%), Gaps = 20/472 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  E +NL DWY+ LL  SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  39    PWCSCHVCRAYLTGSWAREFTNLGDWYAHLLRLSPTGTVHVHVLGCTVTANPANVEYMLK  98

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKGK FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA++I+A EV
Sbjct  99    TRFDNFPKGKPFAALLGDLLGNGIFNVDGGAWRHQRKMASLELGSVAVRSYAYKIIAQEV  158

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    +   VLD QDV RRF+FD ICK SFG+DP CLD  +PVS+ A AFD A
Sbjct  159   DARLMPVLTDAADRGAVLDLQDVFRRFAFDTICKISFGLDPCCLDREMPVSELADAFDTA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LNIGSE++L +AI +++ELA  MI +++K  G     DL
Sbjct  219   SRLSAMRGAAASPLLWKMKRFLNIGSERELKKAIKIVDELAAAMIRERQKL-GVGSSHDL  277

Query  830   LSRFMGIID--------DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
             LSR M +          DDK LRDIV+SFLLAGRDT+++ALT+ F +LS++PEV   +RA
Sbjct  278   LSRVMVMASTGVDPHAADDKFLRDIVVSFLLAGRDTVSTALTTLFMILSKNPEVAAAMRA  337

Query  674   ESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
             E+      ++   TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V   
Sbjct  338   EA---GAGEKGATTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVEGD  394

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCLGKDM  321
              RV YHPYAMGRM  IWGAD   F+PERWL      F   N YK+PVFQAG RVCLGK++
Sbjct  395   ARVMYHPYAMGRMPHIWGADHGAFRPERWLTGPGASFVPANPYKFPVFQAGQRVCLGKEL  454

Query  320   ALVEMKSVAVALIRAFDIEVVCESRQM------PRYAPGLTATVRGGLSVRI  183
             A+ EMK+V+VA++RAFDIEVV E+ +       PR+ PGLTA++ GGL VR+
Sbjct  455   AITEMKAVSVAVVRAFDIEVVGENGRTGGAAAAPRFVPGLTASISGGLQVRV  506



>ref|XP_006851517.1| hypothetical protein AMTR_s00040p00166370 [Amborella trichopoda]
 gb|ERN13098.1| hypothetical protein AMTR_s00040p00166370 [Amborella trichopoda]
Length=538

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/506 (53%), Positives = 342/506 (68%), Gaps = 52/506 (10%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             C C++C+ YLT SW  + SNLCD+Y+ LL  S T TI VHVL N+ITANP NVE++L T+
Sbjct  35    CNCKVCRTYLTKSWVSQFSNLCDFYTHLLKSSKTQTIKVHVLNNIITANPKNVEHILKTQ  94

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             FEN+PKGK F +IL DLLGRGIF VDG+LW+FQRKMAS E GS ++R+   + V AE+ T
Sbjct  95    FENYPKGKPFHTILHDLLGRGIFNVDGELWRFQRKMASYELGSQAVRAMVAKTVLAEIET  154

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASK  1005
             RL P+L         LD QDVL++F+FDNICK SFG+DP CL+L+ P+S+FA AFD AS 
Sbjct  155   RLEPILADSVSKGSKLDLQDVLKKFTFDNICKISFGLDPCCLELTQPISEFAQAFDRASH  214

Query  1004  LSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLS  825
             L A RAV A   +WK+K+ LN+GSE+ L EAI +++ +A E+I Q++  G   + SDLLS
Sbjct  215   LCAGRAVVAPSLIWKIKKFLNLGSERSLREAINMVDLMAIEVIRQRKVVGS--EASDLLS  272

Query  824   RFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIM----  657
             RFM  + DDK LRDI++SFLLAGRDT+ASALTSFFWL+++HPEV +++  E  R+M    
Sbjct  273   RFMTTVSDDKFLRDIIVSFLLAGRDTVASALTSFFWLMAKHPEVEEKVHDEIVRVMGKGV  332

Query  656   ---------------------------------------------EPDQDLATYQQIRDM  612
                                                          E  + +A+Y ++R+M
Sbjct  333   EREREEGGAREGESGVERGERVSEELRERGKWGRDKEEREGEDFRERKEVIASYGKLREM  392

Query  611   NYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADC  432
             +YL AA+ ESMRL+PPVQFDSKF   DD LPDGT V+KGTRVTYHPYAMGRM+SIWG DC
Sbjct  393   HYLHAALSESMRLYPPVQFDSKFAEKDDILPDGTVVKKGTRVTYHPYAMGRMESIWGKDC  452

Query  431   REFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCE  252
              EF PERWLE+G F  EN +KYPVFQAG RVCLGK+MA ++MKSV  +++    + V+  
Sbjct  453   MEFNPERWLENGFFVPENPFKYPVFQAGLRVCLGKEMAFLQMKSVVASVVYKHKL-VLVN  511

Query  251   SRQMPRYAPGLTATVRGGLSVRITDR  174
                 PR+   LTA V GGL V +  R
Sbjct  512   PDYTPRFVTSLTANVSGGLEVFVESR  537



>ref|XP_010686047.1| PREDICTED: cytochrome P450 94C1 [Beta vulgaris subsp. vulgaris]
Length=496

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/473 (56%), Positives = 340/473 (72%), Gaps = 19/473 (4%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEY  1380
              L P CKCEIC++++TSSW  + +NL DWY+ LL  SPT TIH+H L N + A+P NVE+
Sbjct  30    NLNPWCKCEICQSFITSSWREKFTNLPDWYAHLLQNSPTNTIHIHTLNNTVIAHPKNVEH  89

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T F+N+PKGK  ++ILGDLLGRGIF VDGD W+FQRK+AS E GSVS+R+YA E++ 
Sbjct  90    ILRTNFDNYPKGKPMSTILGDLLGRGIFIVDGDHWRFQRKLASLELGSVSVRAYAHEVLN  149

Query  1199  AEVRTRLFPLL----EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKF  1032
              E+  +L P L            V+D Q   R+FSF NICKFSFG+DP  LD        
Sbjct  150   KEIEAKLVPALLKVPSSPQPPSSVIDLQVEFRKFSFVNICKFSFGVDPTGLD------GL  203

Query  1031  AAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGG  852
             A AFD+ASKLS+ERA++ S   W+ KRL N+GSEK+L  AI  +N LAE +++++RK G 
Sbjct  204   AEAFDVASKLSSERALSPSWITWRAKRLFNVGSEKRLKGAISKVNALAENIMQERRKIGF  263

Query  851   ARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
                + DLLSRFMG + DDK LRDIV+SFLLAGRDT+AS LT FF+L++R+P    RI  E
Sbjct  264   T-TKMDLLSRFMGSVSDDKYLRDIVVSFLLAGRDTVASGLTMFFYLMARNPIAEARIIEE  322

Query  671   SGRIMEPDQ------DLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGT  510
             S R M P        +  T +++R M+YL AAI+E++RL+PPVQ DSKF +NDD LPDGT
Sbjct  323   SNRAMGPQHSSNSSINFPTLEELRKMHYLQAAIYETLRLYPPVQIDSKFAINDDVLPDGT  382

Query  509   FVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCL  333
             FV+KGTRV+YHPY+MGRM+SIWG D  EFKPERWL +DGVF   + YKYPVFQAG RVCL
Sbjct  383   FVKKGTRVSYHPYSMGRMESIWGPDYLEFKPERWLNDDGVFSPVSPYKYPVFQAGVRVCL  442

Query  332   GKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             GKDM+++ MK VA+ L+R F I  + +    P + PGLTAT++ GL V +T+R
Sbjct  443   GKDMSMLSMKVVALILVRRFHI-TLADLNWTPHFVPGLTATLKDGLPVVVTER  494



>ref|NP_001183398.1| putative cytochrome P450 superfamily protein [Zea mays]
 gb|ACR36647.1| unknown [Zea mays]
 tpg|DAA59256.1| TPA: putative cytochrome P450 superfamily protein [Zea mays]
Length=513

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/475 (57%), Positives = 343/475 (72%), Gaps = 19/475 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ L+ +S TGT+HVHVLG  +TANPANVEYML 
Sbjct  39    PWCSCHVCRAYLTGSWERDFTNLGDWYAHLIRESATGTVHVHVLGCTVTANPANVEYMLK  98

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKG+ FA++LGDLLG GIF VDG  W++QRKMAS E GSV++RSYAF I+A EV
Sbjct  99    TNFDNFPKGETFATLLGDLLGCGIFNVDGHAWRYQRKMASLELGSVAVRSYAFGIIAREV  158

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL PLL    +   V+D QDV RRF+FD ICK SFG+DPGCL+  +P+SK A AFD A
Sbjct  159   EARLMPLLAGAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPMSKLADAFDTA  218

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP +W+ KRLLN+GSE++L EAI L++ELA  +I ++RK G A    DL
Sbjct  219   TRLCAMRGAAASPLLWRAKRLLNVGSERELREAIRLVDELAAAVIRERRKLGVASSH-DL  277

Query  830   LSRFM----------GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRI  681
             LSRFM          G+  DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V   +
Sbjct  278   LSRFMVASAGGDAHPGV--DDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVVAAM  335

Query  680   RAESGRIMEPDQDLA-TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFV  504
             RAE+G           TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDG +V
Sbjct  336   RAEAGDGDGDGDSAPLTYEHLKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGIYV  395

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLG  330
               GTRV YHPYAMGRM  IWGAD   F+P+RWL    G F  E+LYKYPVFQAG RVCLG
Sbjct  396   SGGTRVMYHPYAMGRMPRIWGADHDAFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLG  455

Query  329   KDMALVEMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGGLSVRITDR  174
             K++A+ EMK+V VA++RAFD+ VV +S      P++  GLTA++ GGL VRI+ R
Sbjct  456   KELAITEMKAVGVAVVRAFDVHVVGDSGSAACAPKFVSGLTASISGGLPVRISRR  510



>ref|XP_004978691.1| PREDICTED: cytochrome P450 94A1-like [Setaria italica]
Length=501

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/466 (59%), Positives = 343/466 (74%), Gaps = 14/466 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+  L +S TGTIHVHVLG  +TANPANVEYML 
Sbjct  35    PWCSCHVCRAYLTGSWARDFTNLGDWYAHQLRESATGTIHVHVLGCTVTANPANVEYMLK  94

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA++I+A EV
Sbjct  95    TNFDNFPKGKTFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKIIAQEV  154

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    ++  V+D QDV RRF+FD ICK SFG+DPGCL+  +PVSK A AFD A
Sbjct  155   EARLMPVLTDAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPVSKLANAFDAA  214

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP +WKVKR+LN+GSE++L +AI L+NELA  MI ++RK G A +  DL
Sbjct  215   TRLCAMRGAAASPLLWKVKRMLNVGSERELKKAIKLVNELAAAMIRERRKLGFA-NSHDL  273

Query  830   LSRFMGIID-----DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESG  666
             LSRFM         DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V   +RAE+G
Sbjct  274   LSRFMASAGDAHAVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVAAAMRAEAG  333

Query  665   RIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRV  486
                  D    TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G RV
Sbjct  334   ---GDDSTPVTYEHLKSLHYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVSGGARV  390

Query  485   TYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMALV  312
              YHPY+MGRM  IWGAD   F+P+RWL    G F  E+LYKYPVFQAG RVCLGK++A+ 
Sbjct  391   MYHPYSMGRMPRIWGADHGVFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKELAIT  450

Query  311   EMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGGLSVRI  183
             EMK+VAVA++R FD+EVV ES      P++  GLTA++ GGL VRI
Sbjct  451   EMKAVAVAVVRGFDVEVVGESGSGACAPKFVSGLTASISGGLPVRI  496



>ref|XP_002442803.1| hypothetical protein SORBIDRAFT_08g003110 [Sorghum bicolor]
 gb|EES16641.1| hypothetical protein SORBIDRAFT_08g003110 [Sorghum bicolor]
Length=509

 Score =   529 bits (1363),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 280/472 (59%), Positives = 348/472 (74%), Gaps = 18/472 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +SP+GT+HVHVLG  +TANPANVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPSGTVHVHVLGCTVTANPANVEYMLK  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYAF I+A EV
Sbjct  100   TNFDNFPKGKTFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAFRIIAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    +   V+D QDV RRF+FD ICK SFG+DPGCL+  +PVSK A AFD A
Sbjct  160   EARLMPVLAAAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEKEMPVSKLADAFDTA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP +WK KRLLN+GSE++L EAI L++ELA  MI ++RK G A +  DL
Sbjct  220   TRLCAMRGAAASPLLWKAKRLLNVGSERELREAIKLVDELAAAMIRERRKLGVA-NSHDL  278

Query  830   LSRFMG--------IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
             LSRFM            DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V D +RA
Sbjct  279   LSRFMASAGDDAHHDDVDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPAVADAMRA  338

Query  674   ESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
             E+G    P     TY+Q++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G
Sbjct  339   EAGGSEAP----LTYEQLKRLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVSGG  394

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDM  321
             TRV YHPYAMGRM  IWGAD   F+P+RWL    G F  E+LYKYPVFQAG RVCLGK++
Sbjct  395   TRVMYHPYAMGRMPRIWGADHGAFRPDRWLTGAGGSFVPESLYKYPVFQAGLRVCLGKEL  454

Query  320   ALVEMKSVAVALIRAFDIEVVCESRQ---MPRYAPGLTATVRGGLSVRITDR  174
             A+ EMK+VAVA++RAFD++VV +S      P++  GLTA++ GGL VRI+ R
Sbjct  455   AITEMKAVAVAVVRAFDVQVVGDSGSAACAPKFVSGLTASISGGLPVRISRR  506



>ref|XP_008664407.1| PREDICTED: cytochrome P450 94C1-like [Zea mays]
 gb|ACG28209.1| cytochrome P450 CYP94C20 [Zea mays]
Length=507

 Score =   525 bits (1352),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 278/464 (60%), Positives = 345/464 (74%), Gaps = 18/464 (4%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYLT SW  + +NL DWY+ LL +SPTGTIHVHVLG  +TANPANVEYML 
Sbjct  40    PWCSCHVCRAYLTGSWARDFTNLGDWYAHLLRESPTGTIHVHVLGCTVTANPANVEYMLR  99

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T F+NFPKGK FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYAF IVA EV
Sbjct  100   TNFDNFPKGKAFAALLGDLLGGGIFNVDGHAWRHQRKMASLELGSVAVRSYAFGIVAQEV  159

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
              +RL P+L    +   V+D QDV RRF+FD ICK SFG+DPGCL+  +PVS+ A AFD+A
Sbjct  160   ESRLVPVLAAAADAGAVVDLQDVFRRFAFDTICKISFGLDPGCLEREMPVSRLADAFDVA  219

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             ++L A R   ASP VW+ KRLLN+GSE++L EAI L++ELA  +I ++RK G A    DL
Sbjct  220   TRLCAMRGAAASPLVWRAKRLLNVGSERELREAIALVDELAAAVIRERRKLGVAGSH-DL  278

Query  830   LSRFM---GIID-DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGR  663
             LSRFM   G  D DDK LRDIV+SFLLAGRDT++SALT+ F LLS++P V   +RAE+G 
Sbjct  279   LSRFMASAGAGDGDDKYLRDIVVSFLLAGRDTVSSALTTLFMLLSKNPGVAAAMRAEAG-  337

Query  662   IMEPDQDLA---TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
                 D + A   TY+ ++ ++Y  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  GT
Sbjct  338   ----DGESAAPLTYEHLKGLHYTHAVLYENMRLFPPVQFDSKFCAGPDVLPDGTYVAGGT  393

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             RVTYHPYAMGRM  IWGAD   F+P+RWL      F  E+LY+YPVFQAG RVCLGK++A
Sbjct  394   RVTYHPYAMGRMPRIWGADHGAFRPDRWLTGAGASFVPESLYRYPVFQAGLRVCLGKELA  453

Query  317   LVEMKSVAVALIRAFDIEVVCESRQM---PRYAPGLTATVRGGL  195
             + EMK VAVA++RAFD+EVV +S      P++  GLTA++ GGL
Sbjct  454   VTEMKVVAVAVVRAFDVEVVGDSGATACAPKFVSGLTASISGGL  497



>gb|EAZ17458.1| hypothetical protein OsJ_32985 [Oryza sativa Japonica Group]
Length=499

 Score =   512 bits (1318),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 262/479 (55%), Positives = 333/479 (70%), Gaps = 37/479 (8%)
 Frame = -1

Query  1565  VSKLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANV  1386
             V++  P C C +C+AYLT SW  E +NL DWY+ LL +SPTGT+HVHVLG  +TANPANV
Sbjct  40    VARRWPWCSCHVCRAYLTGSWAREFTNLGDWYAHLLRRSPTGTVHVHVLGCTVTANPANV  99

Query  1385  EYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEI  1206
             E+ML T+F+NFPKG+ FA++LGDLLG GIF VDG  W+ QRKMAS E GSV++RSYA++I
Sbjct  100   EHMLRTRFDNFPKGRPFAALLGDLLGDGIFNVDGHAWRHQRKMASLELGSVAVRSYAYKI  159

Query  1205  VAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAA  1026
             +A EV  RL P+L    +   VLD QDV RRF+FDNICK SFG+DPGCLD  +PVS+ A 
Sbjct  160   IAQEVEARLMPVLADAADRGAVLDLQDVFRRFAFDNICKISFGLDPGCLDREMPVSELAD  219

Query  1025  AFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR  846
             A                      KR LN+GSE++L +AI +++ELA  MI +++K  G  
Sbjct  220   A---------------------AKRFLNVGSERELRKAIKVVDELAAAMIRERQKL-GVG  257

Query  845   DQSDLLSRFM---GIID---DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDR  684
                DLLSRFM   G+ D   DDK LRDIV+SFLLAGRDT+++ALT+ F LLS++PEV   
Sbjct  258   SSHDLLSRFMASTGVDDAAADDKFLRDIVVSFLLAGRDTVSTALTTLFMLLSKNPEVAAA  317

Query  683   IRAESGRIMEPDQDLA-TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTF  507
             +RAE+      +   A TY+ ++ ++Y  A +HE+MRLFPPVQFDSKFC   D LPDGT+
Sbjct  318   MRAEAEAGDGGETGAAITYEHLKGLHYTHAVLHENMRLFPPVQFDSKFCAAADVLPDGTY  377

Query  506   VRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLE--DGVFKSENLYKYPVFQAGPRVCL  333
             V    RV YHPYAMGRM  IWGAD   F+P RWL      F   N YKYPVFQAG RVCL
Sbjct  378   VGGDARVMYHPYAMGRMPHIWGADYAAFRPARWLTGPGASFVPANPYKYPVFQAGQRVCL  437

Query  332   GKDMALVEMKSVAVALIRAFDIEVVCESRQ------MPRYAPGLTATVRGGLSVRITDR  174
             GK++A+ EMK+ +VA++RAFD+EVV E+ +       PR+ PGLTA++ GGL VR+  R
Sbjct  438   GKELAVTEMKAASVAVVRAFDVEVVGENGRSGGAAAAPRFVPGLTASISGGLQVRVRRR  496



>ref|XP_010683845.1| PREDICTED: cytochrome P450 94C1-like [Beta vulgaris subsp. vulgaris]
Length=515

 Score =   509 bits (1311),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 249/471 (53%), Positives = 333/471 (71%), Gaps = 15/471 (3%)
 Frame = -1

Query  1544  CKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLTTK  1365
             CKC+IC  Y+TS+W+ +  N+CDWY+ LL  SP+ TIH+HVL N+ITANP NVEYML T 
Sbjct  43    CKCDICHTYVTSNWSKKFPNICDWYTHLLQNSPSKTIHIHVLDNIITANPKNVEYMLKTN  102

Query  1364  FENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRT  1185
             F N+PKGK F++ILGDLLG GIF VDGD W+FQRKMAS E    S+RSY+F++V  ++  
Sbjct  103   FNNYPKGKPFSTILGDLLGHGIFNVDGDAWRFQRKMASLELDRYSVRSYSFQVVKEQIDN  162

Query  1184  RLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCL-DLSLPVSKFAAAFDLAS  1008
              L P L +   + +++D Q++ R FS   I KFSFG+    L D+  P   F+++FDLA+
Sbjct  163   HLLPYL-YAKMDGQIVDLQEIFRAFSLSTISKFSFGVKIEPLHDIVSPFKDFSSSFDLAT  221

Query  1007  KLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA-------  849
             KLSA+RA+      W++KR L IG EK L +AI  I+ +A E+I+Q+RK   +       
Sbjct  222   KLSAKRALEVCSISWRLKRFLGIGEEKNLRDAIKEIDVIAMEVIKQRRKKLSSSPSLIIH  281

Query  848   RDQSDLLSRFM--GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRA  675
              ++++LLSRFM   + D+D+ LRDI++SFLLAGRD++ASALTS F L+++HP V   I  
Sbjct  282   EEENNLLSRFMKSSVKDNDQYLRDIIVSFLLAGRDSVASALTSIFLLMAQHPRVEFAILL  341

Query  674   ESGRIM--EPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDG-TFV  504
             E+ R++     Q +++Y Q+ ++NYL A I ESMRL+PPVQFDSK+ LN+D  PD  T V
Sbjct  342   EANRVLGQGQQQHVSSYDQLGELNYLQAVIFESMRLYPPVQFDSKYALNNDVFPDKITKV  401

Query  503   RKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKD  324
              KGTRVTYHPYAMGRM  IWG DC EF PERWL+DGVF  EN +KYPVFQAG RVCLGK+
Sbjct  402   MKGTRVTYHPYAMGRMKQIWGKDCLEFNPERWLKDGVFMHENAFKYPVFQAGVRVCLGKE  461

Query  323   MALVEMKSVAVALIRAFDIEVVCESR-QMPRYAPGLTATVRGGLSVRITDR  174
             MAL+E+K V ++L++ F  ++   S  Q PR++ GLTA+  GGL V    R
Sbjct  462   MALMEIKCVVLSLLKEFHFQLPNTSYCQTPRFSTGLTASFSGGLPVTFCTR  512



>emb|CBX24475.1| hypothetical_protein [Oryza glaberrima]
Length=479

 Score =   491 bits (1265),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 321/472 (68%), Gaps = 48/472 (10%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYL  SW  E +NL DWY                              ML 
Sbjct  37    PWCGCHVCRAYLAGSWRREFANLGDWY------------------------------MLK  66

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKG+ FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++IVA EV
Sbjct  67    TRFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEV  126

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    ++  V+D QDV RRF+FD ICK SFG+DPGCLD  +PVS+ A AFD A
Sbjct  127   EARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAA  186

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LN+GSE++L +AI LI+ LA  MI ++RK G A +  DL
Sbjct  187   SRLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA-NSHDL  245

Query  830   LSRFMGI-------IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             LSRFM           DDK LRDIV+SFLLAGRDT++SALT+ F +LS++P+V   +RAE
Sbjct  246   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  305

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             +G        + +Y+ ++ +NY  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G 
Sbjct  306   AGAAAGESAAV-SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGGA  364

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKDMA  318
             RV YHPYAMGRM  IWGADC  F+PERWL    G F  E+L+KYPVFQAG RVCLGK++A
Sbjct  365   RVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQAGLRVCLGKELA  424

Query  317   LVEMKSVAVALIRAFDIEVV-------CESRQMPRYAPGLTATVRGGLSVRI  183
             + EMK+V+VA++RAFD+EVV             PR+ PGLTA++ GGL V+I
Sbjct  425   ITEMKAVSVAVVRAFDVEVVGENGRCGGGGAAAPRFVPGLTASISGGLPVKI  476



>gb|EAZ19658.1| hypothetical protein OsJ_35235 [Oryza sativa Japonica Group]
Length=515

 Score =   492 bits (1267),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 243/411 (59%), Positives = 302/411 (73%), Gaps = 11/411 (3%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGNVITANPANVEYMLT  1371
             P C C +C+AYL  SW  E +NL DWY+ LL +SPTGT+HVHVLG  +TANPANVEYML 
Sbjct  37    PWCGCHVCRAYLAGSWRREFANLGDWYADLLRRSPTGTVHVHVLGCTVTANPANVEYMLK  96

Query  1370  TKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEV  1191
             T+F+NFPKG+ FA++LGDLLG GIF VDGD W+ QRKMAS E GSV++RSYA++IVA EV
Sbjct  97    TRFDNFPKGRPFAALLGDLLGDGIFNVDGDAWRHQRKMASLELGSVAVRSYAYKIVAQEV  156

Query  1190  RTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLA  1011
               RL P+L    ++  V+D QDV RRF+FD ICK SFG+DPGCLD  +PVS+ A AFD A
Sbjct  157   EARLMPVLANAADSGAVVDLQDVFRRFAFDTICKISFGLDPGCLDREMPVSELADAFDAA  216

Query  1010  SKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDL  831
             S+LSA R   ASP +WK+KR LN+GSE++L +AI LI+ LA  MI ++RK G A +  DL
Sbjct  217   SRLSAMRGAAASPLLWKMKRFLNVGSERELKKAIKLIDGLAAAMIRERRKLGVA-NSHDL  275

Query  830   LSRFMGI-------IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             LSRFM           DDK LRDIV+SFLLAGRDT++SALT+ F +LS++P+V   +RAE
Sbjct  276   LSRFMASSGDDARGAADDKFLRDIVVSFLLAGRDTVSSALTTLFMILSKNPDVAAAMRAE  335

Query  671   SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGT  492
             +G        + +Y+ ++ +NY  A ++E+MRLFPPVQFDSKFC   D LPDGT+V  G 
Sbjct  336   AGAAAGESAAV-SYEHLKRLNYTHAVLYENMRLFPPVQFDSKFCAAADVLPDGTYVDGGA  394

Query  491   RVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGP  345
             RV YHPYAMGRM  IWGADC  F+PERWL    G F  E+L+KYPVFQ  P
Sbjct  395   RVMYHPYAMGRMPRIWGADCDAFRPERWLTGAGGAFVPESLFKYPVFQGRP  445



>ref|XP_007037964.1| Cytochrome P450 94A2 [Theobroma cacao]
 gb|EOY22465.1| Cytochrome P450 94A2 [Theobroma cacao]
Length=508

 Score =   462 bits (1189),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 234/450 (52%), Positives = 306/450 (68%), Gaps = 15/450 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SP+ TI V  LG    V+TANPANVEYML T F NFPKGK F  ILGDL
Sbjct  59    LLDWYTDLLSESPSQTIVVRRLGARRTVVTANPANVEYMLKTNFNNFPKGKPFTEILGDL  118

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+LW  QRK+AS EF + S+R +  + +  EV  RL PLL+   E+ +VLD
Sbjct  119   LGCGIFNVDGELWSTQRKLASHEFSTKSLREFVVKTLQEEVENRLLPLLQEAMESEKVLD  178

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLDLS PV     AFD+AS++SA R +     VWK+K
Sbjct  179   LQDVLRRFAFDTICKVSLGHDPCCLDLSKPVPPLVKAFDIASEISAMRGMAPMFVVWKIK  238

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR-----DQSDLLSRFMGIIDDDKLL  789
             R LNIGSEKKL EAI L+ +   E+I  K++   A      D  DLLSR +    D++++
Sbjct  239   RALNIGSEKKLKEAIKLVQDCVLEIIRNKKRALEAETKCCDDAEDLLSRLLSAGHDEEVV  298

Query  788   RDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMN  609
             RD+VISF++AGRDT +SA++  FWLLS+H    + I  E   ++   +    ++ +++MN
Sbjct  299   RDMVISFIMAGRDTTSSAMSWLFWLLSKHQNAQNMIVKEVESMLCNGEKELNFEVLKEMN  358

Query  608   YLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCR  429
              + A + ESMRL+PPV +DSK  LNDD LPDGTFV KG RVTY PY MGRM+ +WG D  
Sbjct  359   CVKACLCESMRLYPPVAWDSKHALNDDVLPDGTFVEKGDRVTYFPYGMGRMEELWGKDRF  418

Query  428   EFKPERWL-----EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIE  264
             EFKP+RW      E+G+ KS + +K+PVFQAGPRVCLGK+MA ++MK V  +++R F+I 
Sbjct  419   EFKPDRWFQESDAENGLLKSVSPFKFPVFQAGPRVCLGKEMAFIQMKYVVASILRRFEIR  478

Query  263   VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              VC+  + P + P LTA + GGL+V +  R
Sbjct  479   PVCQ--EQPVFVPLLTAHMAGGLNVLVRRR  506



>ref|XP_002278009.1| PREDICTED: cytochrome P450 94A1 [Vitis vinifera]
Length=500

 Score =   447 bits (1150),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 308/447 (69%), Gaps = 16/447 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L++ PT T  +   G    VITANP NVE+ML T FEN+PKG QF SIL D LG
Sbjct  52    DWTTDVLSRCPTNTSTIRRPGGIHGVITANPLNVEHMLKTNFENYPKGPQFISILEDFLG  111

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  D DLWK QRK AS EF + S+R++ FE V  E +TRL P+L+   E   VLD Q
Sbjct  112   RGIFNSDADLWKVQRKTASYEFNTKSLRNFVFESVTVETQTRLVPILKKAAETGRVLDVQ  171

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPVS-KFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L RF+FDN+CK +F +DP CL         F  AF+ A+ LS+ R + A  ++WK+++
Sbjct  172   DILERFAFDNVCKLAFNVDPACLGGDATAGGDFMRAFEDAATLSSGRFMYAFQSIWKMEK  231

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLLRDIVI  774
               N+  EK+L ++I +++E AE++I+ + +        DLLSRF+G  D+  + LRDIVI
Sbjct  232   FFNMRKEKRLKKSIAIVHEFAEKIIQSRLEQKAENKDQDLLSRFVGNYDNSPEFLRDIVI  291

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRDT +SALT FFWLLS +PEV        + +RA +G+ +    D   + ++R+
Sbjct  292   SFILAGRDTTSSALTWFFWLLSLNPEVETNILKELETVRARNGKSI---GDTYNFDELRE  348

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             ++YL AAI E+MRL+PPV  D+K+CLNDD LPDGTFV KG  +TY PY+MGR++SIWG D
Sbjct  349   LHYLHAAISETMRLYPPVPVDTKYCLNDDVLPDGTFVGKGWFMTYIPYSMGRIESIWGKD  408

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             C +FKPERWLE+GV++ EN ++YP+F AGPR+CLGKDMA ++MKS+A +++  F+++V  
Sbjct  409   CLQFKPERWLENGVYRQENPFRYPIFHAGPRMCLGKDMAYIQMKSIAASVMEQFEVKVE-  467

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDR  174
             E  + P +   LT  + GGL VR+ +R
Sbjct  468   EKDKCPEHYLSLTLRMTGGLEVRVKER  494



>ref|XP_002511196.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF51798.1| cytochrome P450, putative [Ricinus communis]
Length=480

 Score =   445 bits (1144),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 225/451 (50%), Positives = 297/451 (66%), Gaps = 16/451 (4%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL+ SPT TI V  LG    V+TANPANVE+ML + F NFPKGK F  ILGDL
Sbjct  28    LLDWYTDLLSVSPTQTIEVQRLGGRRIVVTANPANVEHMLKSNFSNFPKGKPFTEILGDL  87

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF  DG+LW  QRK+AS EF + S+R +  + +   V  RL PLLE   +   VLD
Sbjct  88    LGCGIFNADGELWSTQRKLASHEFSTKSLREFVVKTLQEVVENRLIPLLEDAADRESVLD  147

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD +C  S G DP CLD S P+     AFD AS++SA R      AVWK K
Sbjct  148   LQDVLRRFAFDIVCLVSLGTDPFCLDFSRPIPPLVKAFDTASEISAMRGTAPVYAVWKTK  207

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDDKLLRDIVI  774
             R+LN+G+EKKL EA+ +++    E+++ K+K       SDLLSR +    D++++RD+VI
Sbjct  208   RMLNLGTEKKLKEAVKMVHSSVLEIVKNKKKVLENDQGSDLLSRLLSGGHDEEVIRDMVI  267

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTAA  594
             SF++AGRDT ++A+T  FWLLS++    + I  E   ++   +    ++ +++MN+L A+
Sbjct  268   SFIMAGRDTTSAAMTWLFWLLSKNKNSEEMIVKEVTTLLNRGEKAIDFELLKEMNFLKAS  327

Query  593   IHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPE  414
             + ESMRL+PPV +DSK  L+DD LPDGTFV KG RVTY PY MGRM+ +WG DC EFKP+
Sbjct  328   LCESMRLYPPVAWDSKHALSDDILPDGTFVGKGDRVTYFPYGMGRMEKLWGKDCFEFKPD  387

Query  413   RWLE-----------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDI  267
             RW             D V KS + YK+PVFQAGPRVCLGK+MA ++MK VA +++R F+I
Sbjct  388   RWFNKPVGFGFESTGDRVMKSVSPYKFPVFQAGPRVCLGKEMAFIQMKYVAASILRRFEI  447

Query  266   EVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
               V E +  P   P LTA + GGL V +  R
Sbjct  448   RPVREDQ--PVLVPLLTAHMAGGLKVTVKRR  476



>ref|XP_010250749.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=488

 Score =   444 bits (1141),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 229/453 (51%), Positives = 296/453 (65%), Gaps = 16/453 (4%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL +SP  TI V  LG    VITANP NVEYML T F NFPKGK F  ILGDL
Sbjct  26    LLDWYTELLAQSPAKTIVVQRLGARRTVITANPDNVEYMLRTNFSNFPKGKPFTEILGDL  85

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+LW+ QRK+ S EF + S+R +  + +  EV  RL PLLE    N +V+D
Sbjct  86    LGYGIFNVDGELWRTQRKLVSHEFTTKSLREFVVKTLVEEVEERLLPLLESASANNKVVD  145

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              Q++LRRF+FD +CK S GMDPGCLD SL +S  A AFD+AS++SA RA     AVWK+K
Sbjct  146   MQELLRRFAFDTVCKVSLGMDPGCLDASLTISPLARAFDVASEISARRAAAPVFAVWKIK  205

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRK------CGGARDQSDLLSRFMGIIDDDKL  792
             RLL +GSE +L +AI  ++   EE+I  K+K        G  D  DLLSR +    DD +
Sbjct  206   RLLRMGSEWQLKQAIEDVHRSVEEIIRDKKKKISAGESRGEHDNGDLLSRLISAGHDDDV  265

Query  791   LRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-TYQQIRD  615
              RD+VISF++AGRDT ++A+T  FW LSRHP     +  E    +  D+  +  Y+ ++D
Sbjct  266   TRDMVISFIMAGRDTTSAAMTWLFWSLSRHPNTEKEVVKEVVTALGNDEPKSLDYEALKD  325

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             +  L A + ESMRL+PPV +DSK  +  DTLPDGT V  G RVTY PY MGRM+S+WG D
Sbjct  326   LPLLKACLCESMRLYPPVAWDSKHSVRADTLPDGTKVGVGDRVTYFPYGMGRMESLWGKD  385

Query  434   CREFKPERWL-----EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFD  270
               EFKP+RW      E G  K  + YK+PVFQAGPRVCLGK+MA ++MK V  +++R F+
Sbjct  386   RLEFKPDRWFLEPDKEGGALKEVSPYKFPVFQAGPRVCLGKEMAFIQMKYVVASILRRFE  445

Query  269   IEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             +  V   R+ P + P LTA + GG +V +  R+
Sbjct  446   LRPVASERK-PVFVPLLTAHMAGGFNVNVVVRQ  477



>ref|XP_009150186.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
Length=502

 Score =   439 bits (1128),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 306/459 (67%), Gaps = 20/459 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L  WY+ LL  SP+ TI + +LGN   ++T NP NVEY+L T F NFPKG+ 
Sbjct  47    SFNKNRHRLLQWYTKLLRLSPSQTITIPLLGNRRTIVTTNPENVEYILKTNFFNFPKGRP  106

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  +LGDLLG+GIF VDG  W  QRK+AS EF + S+RS+AFE++  EV TR+ P+L   
Sbjct  107   FTDLLGDLLGQGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLREEVETRIVPVLSTA  166

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    +D QDV +RF+FD +CK S G DP CLDL+ PV+  A AFD A+++SA RA   
Sbjct  167   ADVGTTVDLQDVFKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTAAEISARRATEP  226

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFMGI  810
               AVWK KR+LN+GSE++L EAI  ++EL  E++  KRK      G   + DLLSRF+  
Sbjct  227   LYAVWKAKRVLNVGSERRLREAIRTVHELVSEIVRAKRKSLEIGTGQEAKQDLLSRFLAS  286

Query  809   IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLAT-  633
               D + +RD+VISF++AGRDT ++A+T  FWLLS + +V  ++  E    +EP   L   
Sbjct  287   GHDSEAVRDMVISFIMAGRDTTSAAMTWLFWLLSENDDVEKKLLQE----VEPLMSLGLG  342

Query  632   YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMD  453
             ++++++M+Y+ A + E+MRL+PPV +DSK   NDD LPDGT V+KG +VTY PY MGRM+
Sbjct  343   FEELKEMSYMKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGRME  402

Query  452   SIWGADCREFKPERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             ++WG DC EFKP RW +      + V K  + +K+PVFQAGPRVC+GK+MA ++MK V  
Sbjct  403   NLWGKDCEEFKPSRWFDSEPGITEPVLKPVSPFKFPVFQAGPRVCIGKEMAFMQMKFVVG  462

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +++  F  E++  S+  P + P LTA + GGL V+I  R
Sbjct  463   SVLSRF--EIIPVSKHKPVFVPLLTAHMAGGLKVKIKRR  499



>ref|XP_010111213.1| Cytochrome P450 94A1 [Morus notabilis]
 gb|EXC30691.1| Cytochrome P450 94A1 [Morus notabilis]
Length=508

 Score =   439 bits (1128),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 302/449 (67%), Gaps = 13/449 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DW + +L+++PT T     LGNV    TANP NVEYML T FEN+PKG  F S+LG+ 
Sbjct  55    LLDWLTEVLSQTPTNTAVARRLGNVRGVTTANPLNVEYMLKTNFENYPKGDGFVSVLGNF  114

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG+GIF  DG++WK QRK AS EF + S+R++  E V  E++TRL P L    E  +VLD
Sbjct  115   LGQGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVVVEIKTRLVPGLNKAVETGQVLD  174

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLD----LSLPVSKFAAAFDLASKLSAERAVTASPAV  966
              QDVL RF+FDNICK +F +DP CL           +F  AF+ A+ LS+ R   A P +
Sbjct  175   IQDVLERFAFDNICKLAFNVDPCCLAGDGFFGNDTGEFMKAFEEAATLSSGRFRYAFPYL  234

Query  965   WKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLL  789
             WK+KR  N+GSEK+L E I  +++ A+E+I ++ +      + DLLSRFM   +   + L
Sbjct  235   WKIKRFFNVGSEKRLRECIATVHQFADEIILRRMENKEENTEEDLLSRFMACHNGSPEFL  294

Query  788   RDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD-QDLA---TYQQI  621
             RDI+ISF+LAGRDT +SALT FFW+LS  P++ ++I  E   I   + +D+     + ++
Sbjct  295   RDIIISFILAGRDTTSSALTWFFWILSSRPDIEEKILNELETIRTRNGKDIGETYNFNEL  354

Query  620   RDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWG  441
             RDM+YL AAI ESMRL+PPV  D+K C NDD +PDGTFV K   VTYH YAMGRM++IWG
Sbjct  355   RDMHYLHAAISESMRLYPPVPADTKVCRNDDVMPDGTFVGKDWFVTYHTYAMGRMENIWG  414

Query  440   ADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEV  261
              +C EF PERWLE+G+ + E+ +++P+F AGPR+CLGKDMA ++MKS+A  +I  F IEV
Sbjct  415   KNCLEFVPERWLENGICRQESPFRFPIFHAGPRMCLGKDMAYIQMKSIAATVIEKFHIEV  474

Query  260   VCESRQMPRYAPGLTATVRGGLSVRITDR  174
               +  + P Y   LT  +RGGL +R+ +R
Sbjct  475   Q-DKGKTPDYVLSLTLRMRGGLLLRVRER  502



>emb|CDP15011.1| unnamed protein product [Coffea canephora]
Length=509

 Score =   436 bits (1121),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 303/443 (68%), Gaps = 12/443 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ +L++SP+ T+ +   G    ++TANP NVEY+L T F N+PKGK F  ILGD 
Sbjct  59    LLDWYTEILSQSPSQTMVIKRFGAPRTIVTANPQNVEYILKTNFNNYPKGKPFTEILGDF  118

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF  DG LW+ QRK+AS EF + S+R +  + +  +V+ +LFP+LE   E   VLD
Sbjct  119   LGRGIFNADGHLWQVQRKLASHEFSAKSLREFVVKTLEEQVQNKLFPVLEMAVEKNMVLD  178

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S GMDP CLD+S PV   A AFD AS++ A R V   PAVWK++
Sbjct  179   LQDVLRRFAFDTICKVSLGMDPRCLDISQPVPPLAIAFDKASEICARRGVAPIPAVWKMR  238

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKR-KCGGARDQ----SDLLSRFMGIIDDDKLL  789
             R LN+GSEK+L EA+ L++   +++I+ K+ K     D+    +DLLSR +    DD+++
Sbjct  239   RALNLGSEKELKEAVDLVHGCVDDIIQTKKTKLNEIADKKTSNNDLLSRLLLAGLDDEMV  298

Query  788   RDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMN  609
             RD+VISFL+AGRDT +SALT  FWLLS H  V   +  E   I+   +     + +++M 
Sbjct  299   RDMVISFLMAGRDTTSSALTWLFWLLSNHHAVKKNVMNEL-EILNLKEKPLDVEDLKEMK  357

Query  608   YLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCR  429
             Y+ A + ESMRL+PPV +DSK   NDD LPDGT V KG RVTY  Y MGR++ +WG DC 
Sbjct  358   YIKACLCESMRLYPPVVWDSKHAENDDILPDGTIVYKGNRVTYFQYGMGRIEELWGKDCF  417

Query  428   EFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCE  252
             EF+P+RW +D G+ K  + YK+PVFQAGPRVCLGK+MA ++MK V  +++R ++I+ V +
Sbjct  418   EFRPDRWFDDNGMLKMVDPYKFPVFQAGPRVCLGKEMAFIQMKHVVASILRRYEIKKVDD  477

Query  251   SRQMPRYAPGLTATVRGGLSVRI  183
             ++  P + P LTA + GGL VRI
Sbjct  478   NQ--PIFVPLLTAFMAGGLKVRI  498



>ref|XP_007210176.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
 gb|EMJ11375.1| hypothetical protein PRUPE_ppa017252mg, partial [Prunus persica]
Length=505

 Score =   435 bits (1119),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 225/460 (49%), Positives = 302/460 (66%), Gaps = 21/460 (5%)
 Frame = -1

Query  1517  LTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPK  1347
             L S +  +H NL DWY+ LL+ SP+ TI VH +G    ++TANP+NVE++L T F NFPK
Sbjct  49    LISFYKNQH-NLLDWYTSLLSNSPSQTIVVHRIGARRTIVTANPSNVEHVLKTNFTNFPK  107

Query  1346  GKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLL  1167
             GK     LGDLLG GIF VDGDLW  QRK+AS EF + S+R +  + +  EV  RL PLL
Sbjct  108   GKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEHRLIPLL  167

Query  1166  EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERA  987
             E   E + VLD Q++LRRF+FD +CK S G DP CLDL+ P+     AFD AS++SA RA
Sbjct  168   EEAAECKSVLDLQEILRRFAFDTVCKVSLGSDPFCLDLTRPLPPLVEAFDCASEISARRA  227

Query  986   VTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGARDQSDLLSRFM  816
                   +WKVKR LNIGSE KL EA+ L++    E+I+ K+K        +  D+LSR +
Sbjct  228   TAPLYLMWKVKRALNIGSENKLKEAVKLVHGSVHEIIQNKKKILQKDEGCESHDMLSRLL  287

Query  815   GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA  636
                  ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP +  +I  E   ++   Q+ +
Sbjct  288   LAGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPSINHQIVNEVENVL--GQNTS  345

Query  635   T----YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYA  468
             T    ++ ++ M +L A + ESMRL+PPV +DSK    D  LPDGT+V KG RVTY PY 
Sbjct  346   TEKLGFEDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYG  405

Query  467   MGRMDSIWGADCREFKPERWL-------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             MGRM+ +WG D  EF P RW        + GV KS + YK+PVFQAGPRVCLGK+MA ++
Sbjct  406   MGRMEELWGKDRFEFNPNRWFDIEPGCDDGGVLKSISPYKFPVFQAGPRVCLGKEMAFIQ  465

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSV  189
             MK V  +++R F+I+ VCE +  P + P LTA + GGL V
Sbjct  466   MKYVIASVLRRFEIKQVCE-KDHPVFVPLLTAHMAGGLKV  504



>ref|XP_011041380.1| PREDICTED: cytochrome P450 94A1-like [Populus euphratica]
Length=499

 Score =   434 bits (1117),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 306/447 (68%), Gaps = 16/447 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             +W +  L+  PT T   H  G V   ITANP NVEY+L T FEN+PKG +F ++L D LG
Sbjct  57    EWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNFENYPKGDRFINLLEDFLG  116

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  DG+LW+ QRK AS EF + S+R++  + V  E+ TRL P+L    + ++VLD Q
Sbjct  117   RGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTRLVPILAQASKTKQVLDLQ  176

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L RF+FDNICK +F +DP CL        +F  AF+ AS LS+ R +   P  WK+ R
Sbjct  177   DILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDASTLSSGRFMYVLPVFWKINR  236

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLLRDIVI  774
               N+G+EK L E++ +++E A+EMI  + +    ++  DLLSRF+G  ++  + LRDIVI
Sbjct  237   FFNVGTEKTLRESVKIVHEFADEMIRSRMEQITEKNDEDLLSRFIGKDENSTEFLRDIVI  296

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRDT +SAL+ FFWLLS +P V        + IR+ +G+ +    D  +++++RD
Sbjct  297   SFILAGRDTTSSALSWFFWLLSLNPAVEGNILKELETIRSSNGKNL---GDTYSFEELRD  353

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M+YL AAI E++RL+PPV  D+K C +DD LPDGTFV K   VTYH YAMGRM+SIWG +
Sbjct  354   MHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKWFVTYHAYAMGRMESIWGKN  413

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             CR+F PERWLE+G+++ E+ +K+PVF AGPR+CLGKDMA ++MKS+A ++I  F+I+V  
Sbjct  414   CRDFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDVQN  473

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDR  174
             + +  P +   LT  ++GGL V++ +R
Sbjct  474   KEK-CPEHLLSLTLRMKGGLQVKVKER  499



>ref|XP_002279981.1| PREDICTED: cytochrome P450 94B3-like [Vitis vinifera]
Length=512

 Score =   435 bits (1118),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 302/458 (66%), Gaps = 18/458 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L +WY+ LL++SP+ TI VH LG    V+TAN ANVEY+L T F NFPKGK 
Sbjct  54    SFYQNRRRLLEWYTDLLSESPSQTIVVHRLGARRTVVTANAANVEYVLKTNFSNFPKGKP  113

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGDLLG GIF VDGDLW  QRK+AS EF + S+R +   I+  EV  RL PLLE  
Sbjct  114   FTEILGDLLGFGIFNVDGDLWSSQRKLASHEFSTKSLREFVMRILEEEVEGRLLPLLESA  173

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E  EVLD QDVLRRF+F+ +CK S G+DP CLDLS PV     AFD AS++ A R +  
Sbjct  174   MEKNEVLDLQDVLRRFAFETVCKVSLGVDPCCLDLSRPVPPLVRAFDRASEICAMRGMAP  233

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIE-QKRKCGGAR---DQSDLLSRFMGI  810
               AVWK+KR  N+GSE+KL E++ L++    E+I+ +KRK    R   D  DLL+  +  
Sbjct  234   VYAVWKMKRAFNVGSERKLKESVQLVHSSVREIIQNKKRKLEEDRAEGDGGDLLTSLLSA  293

Query  809   IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATY  630
                ++++RD+VISF++AGRDT ++A+T  FWLLS+HP +   I A    +     D   +
Sbjct  294   GHGEEVVRDMVISFIMAGRDTTSAAMTWLFWLLSQHPPIESAIVAHVDSLYRNPLD---F  350

Query  629   QQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDS  450
             + +++MN++ A + ESMRL+PPV +DSK    DDTLPDGT +R+G RVTY PY MGRM+ 
Sbjct  351   ETLKEMNFVKACLCESMRLYPPVVWDSKHAAADDTLPDGTALREGDRVTYFPYGMGRMEH  410

Query  449   IWGADCREFKPERWLED------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVA  288
             +WG D  EF+P+RWLE+      G  K+ + YK+PVFQAGPRVCLGK+MA ++MK V  +
Sbjct  411   LWGKDRFEFRPDRWLEEPEADGGGPLKAVSPYKFPVFQAGPRVCLGKEMAFIQMKYVVAS  470

Query  287   LIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             ++R F+I     +R  P + P LTA + GG  V +  R
Sbjct  471   ILRRFEIRPAGSNR--PVFVPLLTAHMAGGFKVVVRKR  506



>ref|XP_002322606.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
 gb|EEF04367.2| hypothetical protein POPTR_0016s03160g [Populus trichocarpa]
Length=499

 Score =   434 bits (1116),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 213/449 (47%), Positives = 305/449 (68%), Gaps = 16/449 (4%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
               +W +  L+  PT T   H  G V   ITANP NVEY+L T FEN+PKG +F ++L D 
Sbjct  55    FLEWTTETLSHCPTNTAVFHRPGKVHGIITANPLNVEYILKTNFENYPKGDRFINLLEDF  114

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF  DG+LW+ QRK AS EF + S+R++  E V  E+ TRL P+L    + ++VLD
Sbjct  115   LGRGIFNSDGELWRVQRKTASYEFNTKSLRNFVMENVEVEISTRLVPILAKASKTKQVLD  174

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASPAVWKV  957
              QD+L RF+FDNICK +F +DP CL        +F  AF+ A+  S+ R +   P  WK+
Sbjct  175   LQDILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAATFSSGRFMYVLPVFWKI  234

Query  956   KRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLLRDI  780
              R  N+G+EK L E++ +++E A+EMI  + +    ++  D LSRF+G  ++  + LRDI
Sbjct  235   NRFFNVGTEKTLRESVKIVHEFADEMIRSRMELKTEKNDEDFLSRFIGKDENSTEFLRDI  294

Query  779   VISFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQI  621
             VISF+LAGRDT +SAL+ FFWLLS +P+V        + IR+ +G+ +    D  +++++
Sbjct  295   VISFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETIRSSNGKNL---GDTYSFEEL  351

Query  620   RDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWG  441
             RDM+YL AAI E++RL+PPV  D+K C +DD LPDGTFV K   VTYH YAMGRM+SIWG
Sbjct  352   RDMHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKNWFVTYHAYAMGRMESIWG  411

Query  440   ADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEV  261
              +CR+F PERWLE+G+++ E+ +K+PVF AGPR+CLGKDMA ++MKS+A ++I  F+I+V
Sbjct  412   KNCRDFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDV  471

Query  260   VCESRQMPRYAPGLTATVRGGLSVRITDR  174
               + +  P +   LT  ++GGL V++ +R
Sbjct  472   QNKEK-CPDHLLSLTLRMKGGLQVKVKER  499



>ref|XP_006477025.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   434 bits (1116),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 225/461 (49%), Positives = 303/461 (66%), Gaps = 18/461 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L +WY+ LL++SPT TI V  LG    ++TANPANVEYML + F NFPKG+ 
Sbjct  43    SFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGRP  102

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGDLLG GIF VDG+LW  QRK+AS EF + S+R +  + +  EV  RL P+LE  
Sbjct  103   FTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEEA  162

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E+R VLDFQD+LRRF+FD +CK S G DP CLDLS P+     AFD AS++SA R +  
Sbjct  163   AESRRVLDFQDILRRFAFDVVCKVSLGTDPFCLDLSRPLPPLVKAFDAASEISAMRGMAP  222

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR--DQSDLLSRFMGIID  804
                VWK+KRLLNIGSEKKL E++ L++E   E+I  K++       +  DLLSR +    
Sbjct  223   VFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLLSAGH  282

Query  803   DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLA  636
              +++ RD+ ISF++AGRDT ++A+T  FWLLS++  V   I  E  ++++ +        
Sbjct  283   GEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDEVKQVIDKNNIGRARAL  342

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
              ++ +++MN+L A + ESMRL+PPV +DSK     D LPDGT VRKG RVTY PY MGRM
Sbjct  343   DFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMGRM  402

Query  455   DSIWGADCREFKPERWLED-------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             +++WG D  EFKP+RWL+D        V K  + YK+PVFQAGPRVCLGK+MA ++MK V
Sbjct  403   ETLWGKDRLEFKPDRWLDDVGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMKYV  462

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
               +++R F+I+ V  S   P + P LT  + GGL V +  R
Sbjct  463   VGSVLRRFEIKPV--SGNQPVFVPLLTGHMIGGLKVLVRKR  501



>ref|XP_010677888.1| PREDICTED: cytochrome P450 94B3 [Beta vulgaris subsp. vulgaris]
Length=532

 Score =   435 bits (1118),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 304/458 (66%), Gaps = 24/458 (5%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V  LG    ++TANP NVEY+L T F NFPKGK  A ILGDL
Sbjct  73    LLDWYTDLLSESPTQTIIVSRLGARKVIVTANPDNVEYILKTNFHNFPKGKPLAEILGDL  132

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG+GIF VDG+LW  QRK+AS EF + ++R +  + +  EV +RL PLL+   +  +++D
Sbjct  133   LGKGIFNVDGELWATQRKLASHEFTTKTLREFVVKTLEEEVESRLIPLLQLAAQQNKIID  192

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              Q+VL+RF++D ICK S G+DP CLDLS+P+    AAF+ A+ +SA+RA +   A+WK+K
Sbjct  193   LQEVLKRFTYDTICKVSLGIDPNCLDLSIPIPPLIAAFENAAAISAKRATSPIYAIWKLK  252

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQS---DLLSRFMGIIDDDKLLRD  783
             R LNIGSE +L ++I +++ L + +I  K+      +++   DLLSRF+    D +L RD
Sbjct  253   RALNIGSEHQLKQSINILHGLVKTIISTKQNSIANSNETENQDLLSRFLSAGYDGELARD  312

Query  782   IVISFLLAGRDTIASALTSFFWLLSR---HPEVTDRIRAESGRIMEPD--QDLATYQQIR  618
             +VISF++AGRDT A+A+T  FWLL      P   D I +E     +PD   D  +Y+ ++
Sbjct  313   MVISFIMAGRDTTAAAMTWLFWLLLSGLADPATRDNIMSELASGSDPDSGSDSLSYELVK  372

Query  617   DMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGA  438
             +M Y+ A + E+MRL+PPV +DSK  L DD LPDGT ++KG RVTY PY MGRM+ IWG 
Sbjct  373   NMKYMHACLCEAMRLYPPVAWDSKHALKDDILPDGTKLKKGDRVTYFPYGMGRMEVIWGE  432

Query  437   DCREFKPERWLEDGV-----------FKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             D  +F P+RW E  V            K  N Y+YP+FQAGPRVCLGK+MA ++MK V  
Sbjct  433   DRLKFNPDRWFESQVDKQSNNYNTRKLKMVNPYEYPIFQAGPRVCLGKEMAFLQMKYVMA  492

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITD  177
             +++  FD E++  S + P + P LTA + GGL VR+ +
Sbjct  493   SIMNRFDFELL--SNEPPVFVPLLTAHMGGGLRVRVKE  528



>ref|XP_008239459.1| PREDICTED: cytochrome P450 94B3 [Prunus mume]
Length=510

 Score =   434 bits (1116),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 226/462 (49%), Positives = 303/462 (66%), Gaps = 21/462 (5%)
 Frame = -1

Query  1517  LTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPK  1347
             L S +  +H NL DWY+ LL+ SP+ TI V  +G    ++TANP+NVE++L T F NFPK
Sbjct  49    LISFYKNQH-NLLDWYTSLLSNSPSQTIVVRRIGARRTIVTANPSNVEHVLKTNFTNFPK  107

Query  1346  GKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLL  1167
             GK     LGDLLG GIF VDGDLW  QRK+AS EF + S+R +  + +  EV  RL PLL
Sbjct  108   GKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEHRLIPLL  167

Query  1166  EFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERA  987
             E   E++ VLD Q++LRRF+FD +CK S G DP CLDL+ PV     AFD AS +SA RA
Sbjct  168   EEAAESKSVLDLQEILRRFAFDTVCKVSLGSDPFCLDLTRPVPPLVEAFDCASGISARRA  227

Query  986   VTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGARDQSDLLSRFM  816
                   +WKVKR LNIGSEKKL EA+ L++    E+I+ K+K        +  D+LSR +
Sbjct  228   TAPLYLMWKVKRALNIGSEKKLKEAVKLVHGSVHEIIQNKKKILEKDEGCESHDMLSRLL  287

Query  815   GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA  636
                  ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP +  +I  E   ++   Q+ +
Sbjct  288   LAGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPSINHQIVNEVENVL--GQNTS  345

Query  635   T----YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYA  468
             T    ++ ++ M +L A + ESMRL+PPV +DSK    D  LPDGT+V KG RVTY PY 
Sbjct  346   TEKLGFEDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYG  405

Query  467   MGRMDSIWGADCREFKPERWL-------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVE  309
             MGRM+ +WG D  EF P+RW        + GV KS + YK+PVFQAGPRVCLGK+MA ++
Sbjct  406   MGRMEELWGKDWFEFNPDRWFDIEHGCDDGGVLKSISPYKFPVFQAGPRVCLGKEMAFIQ  465

Query  308   MKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRI  183
             MK V  +++R F+I+ V E  Q P + P LTA + GGL V +
Sbjct  466   MKYVMASVLRRFEIKPVYEKEQ-PIFVPLLTAHMAGGLKVLV  506



>ref|XP_010247227.1| PREDICTED: cytochrome P450 94B3 [Nelumbo nucifera]
Length=507

 Score =   434 bits (1116),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 307/451 (68%), Gaps = 23/451 (5%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L+++PT T   +  G V   ITANP NVE+ML   FEN+PKG +F ++L D LG
Sbjct  57    DWTTDVLSRTPTNTATFYRPGKVNGIITANPLNVEHMLKANFENYPKGDRFIALLKDFLG  116

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             +GIF  DGDLW+ QRK AS EF + S+RS+  E V AE+ TRL PLL+   E  ++LD Q
Sbjct  117   QGIFNSDGDLWRVQRKTASFEFNTKSLRSFVMENVKAEIETRLIPLLKRASETNQILDIQ  176

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPVS-KFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L RF+FDN+CK +F +DP CL      S +F  AF+ A++LSA R +   P +WKVK+
Sbjct  177   DILERFAFDNVCKLAFDIDPVCLGGDGTTSGEFMQAFEEAARLSAGRFMYLFPFLWKVKK  236

Query  950   LLNIGSEKKLGEAIGLINELAEEMI----EQKRKCGGARDQSDLLSRFM-GIIDDDKLLR  786
              LNIGSE++L +AI  +++ A+++I    E +R+    ++  DLLSRFM    +  + LR
Sbjct  237   ALNIGSERRLKQAISTVHDFADKIIWSRMENRRQ---KQNNDDLLSRFMEDEFNSAEFLR  293

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQ  627
             DIVISF+LAGRDT +S+L  FFW+LS  P++        + +RA  G+ +    D  +Y 
Sbjct  294   DIVISFILAGRDTTSSSLAWFFWILSSRPDIERNILDELESVRARKGKCI---GDTYSYD  350

Query  626   QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSI  447
             ++R+M YL AA+ E +RL+PPV  D+K C  DD LPDG+F++KG  +TYH YAMGRM++I
Sbjct  351   ELREMQYLQAALSEGLRLYPPVAVDTKACREDDVLPDGSFIKKGWFITYHTYAMGRMEAI  410

Query  446   WGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDI  267
             WG DCREFKP+RWLE G  + E+ ++YP+F AGPR+CLGKDMA ++MKS+A ++I  F +
Sbjct  411   WGKDCREFKPQRWLESGTCRQESPFRYPIFHAGPRMCLGKDMAYIQMKSIAASVIERFHV  470

Query  266   EVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +VV +  + P +   LT  ++GGL VRI  R
Sbjct  471   DVV-DGDKCPEHLLSLTLRIKGGLRVRIKQR  500



>ref|XP_002318721.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
 gb|EEE96941.2| hypothetical protein POPTR_0012s09880g [Populus trichocarpa]
Length=631

 Score =   437 bits (1123),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 222/448 (50%), Positives = 300/448 (67%), Gaps = 13/448 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL+ SPT TI V  LG    ++TANP NVEY+L T F NFPKGK F  ILGDL
Sbjct  58    LLDWYTNLLSVSPTQTIVVKRLGARRIIVTANPENVEYVLKTNFINFPKGKSFTEILGDL  117

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF  DG+LW  QRK+AS EF + S+R +    +  EV  RL PLLE   E + VLD
Sbjct  118   LGCGIFNADGELWSTQRKLASHEFSTKSLREFVVMTLQEEVENRLIPLLEEAVEAKSVLD  177

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QD+LRRFSFD +C+ S G DP CLDLS P+     AFD AS++SA R +    AVWK K
Sbjct  178   LQDLLRRFSFDIVCRVSLGTDPSCLDLSRPIPPLVKAFDAASEISAMRGMAPVYAVWKAK  237

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFMGIIDDDKLLR  786
             +L N+G+EKKL EAI L+++   E+++ K++        + +SDLLSR +     ++++R
Sbjct  238   KLFNLGAEKKLKEAIKLVHDSVSEIVKTKKRVLENDREGKLESDLLSRLLLAGHGEEVVR  297

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             D+VISF++AGRDT ++A+T  FWLLS+H      I  E   +++  +    Y+ ++ MN+
Sbjct  298   DMVISFIMAGRDTTSAAMTWLFWLLSKHRNSEKMIVKEVKSLLDDREKAIDYEVLKGMNF  357

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L A++ ESMRL+PPV +DSK  + DD LPDGT VRKG RVTY PY MGRM+ +WG D  E
Sbjct  358   LKASLCESMRLYPPVPWDSKHAIIDDVLPDGTSVRKGDRVTYFPYGMGRMEKLWGKDRFE  417

Query  425   FKPERWLE----DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVV  258
             F+P+RW +    D   KS + Y +PVFQAGPRVCLGK+MA+++MK V  +++R F+I+ V
Sbjct  418   FRPDRWFQEIGNDQTLKSVSPYTFPVFQAGPRVCLGKEMAMIQMKYVMASVLRRFEIKPV  477

Query  257   CESRQMPRYAPGLTATVRGGLSVRITDR  174
              ++   P +AP LTA + GGL V +  R
Sbjct  478   FDNE--PVFAPLLTAHMVGGLKVMVKRR  503



>gb|KDO52651.1| hypothetical protein CISIN_1g036030mg [Citrus sinensis]
Length=503

 Score =   432 bits (1110),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 302/461 (66%), Gaps = 18/461 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L +WY+ LL++SPT TI V  LG    ++TANPANVEYML + F NFPKG+ 
Sbjct  42    SFYRNRHQLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGRP  101

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGDLLG GIF VDG+LW  QRK+AS EF + S+R +  + +  EV  RL P+LE  
Sbjct  102   FTEILGDLLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEEA  161

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E+R VLDFQD+LRRF+FD +CK S G DP CLD S P+     AFD AS++SA R +  
Sbjct  162   AESRRVLDFQDILRRFAFDVVCKVSLGTDPFCLDHSQPLPPLVKAFDAASEISAMRGMAP  221

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR--DQSDLLSRFMGIID  804
                VWK+KRLLNIGSEKKL E++ L++E   E+I  K++       +  DLLSR +    
Sbjct  222   VFLVWKIKRLLNIGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLLSAGH  281

Query  803   DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLA  636
              +++ RD+ ISF++AGRDT ++A+T  FWLLS++  V   I  E  ++++ +        
Sbjct  282   GEQVARDMAISFIMAGRDTTSAAMTWLFWLLSQNEAVEREIVDEVKQVIDKNNIGRARAL  341

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
              ++ +++MN+L A + ESMRL+PPV +DSK     D LPDGT VRKG RVTY PY MGRM
Sbjct  342   DFEALKEMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMGRM  401

Query  455   DSIWGADCREFKPERWLED-------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             +++WG D  EFKP+RWL+D        V K  + YK+PVFQAGPRVCLGK+MA ++MK V
Sbjct  402   ETLWGKDRLEFKPDRWLDDLGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMKYV  461

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
               +++R F+I+ V  S   P + P LT  + GGL V +  R
Sbjct  462   VGSVLRRFEIKPV--SGNQPVFVPLLTGHMIGGLKVLVRKR  500



>ref|XP_004236332.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=491

 Score =   431 bits (1108),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 295/444 (66%), Gaps = 10/444 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V   G    +ITANP NVEYML T F N+PKGK F  ILGD 
Sbjct  49    LLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDF  108

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF VDG+LW  QRK+AS EF + S+R +  + +   V  RL PLL     + +VLD
Sbjct  109   LGRGIFNVDGELWNAQRKLASHEFSTNSLREFVVKTLEEVVENRLVPLLIQAANSGKVLD  168

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLD    V     +FD AS+  A R +    A+WK K
Sbjct  169   LQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASRACAMRGMAPVYAIWKSK  228

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGARDQSDLLSRFMGIIDDDKLLRD  783
             R LN+GSEKKL E +  ++   +E+IE+K++        DQ DLLSR +    D++++RD
Sbjct  229   RALNLGSEKKLKENVKRVHCCIDEIIEEKKQKIATENGGDQMDLLSRLLLAGHDNEVVRD  288

Query  782   IVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYL  603
             +VISFL+AGRDT +SALT  FWL + H +V D +  E   I   D+ L  + ++++M +L
Sbjct  289   MVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKALE-FDELKEMKHL  347

Query  602   TAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREF  423
              A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY PY MGRM+ IWG D  EF
Sbjct  348   AACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEF  407

Query  422   KPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESR  246
             KP+RW+ E+G  KS + Y+YPVFQAGPRVCLGK+MA  +MK V  +++R F+I+ V  + 
Sbjct  408   KPDRWIDENGGLKSVSPYEYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPV--NV  465

Query  245   QMPRYAPGLTATVRGGLSVRITDR  174
             + P + P LTA + GG +VRI  R
Sbjct  466   EKPVFLPLLTAHMVGGFNVRIYGR  489



>gb|KFK34160.1| hypothetical protein AALP_AA5G108200 [Arabis alpina]
Length=503

 Score =   431 bits (1108),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 302/459 (66%), Gaps = 20/459 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L  WY+ LL  SPT TI + +LGN   ++T NP NVEY+L T F NFPKGK 
Sbjct  48    SFNKNRHRLLQWYTELLRLSPTQTISIPLLGNRRTIVTTNPENVEYILKTNFFNFPKGKP  107

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  +LGDLLG+GIF VDG  W  QRK+AS EF + S+RS+AFE++  EV TRL P+L   
Sbjct  108   FTDLLGDLLGKGIFNVDGHSWSSQRKLASHEFSTRSLRSFAFEVLKDEVETRLVPVLSTA  167

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    +D QDVL+RF+FD +CK S G DP CLDLS PV+    AFD A+++SA RA   
Sbjct  168   ADVGATMDLQDVLKRFAFDVVCKVSLGWDPDCLDLSRPVNPLLEAFDTAAEISARRATEP  227

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFMGI  810
               AVWK+KR+LN+GSE++L EAI  ++ L  E++  K+K      G   + DLLSRF+  
Sbjct  228   VYAVWKMKRVLNVGSERRLREAIKTVHVLVSEIVRAKKKSLEIGTGVEAKQDLLSRFLAA  287

Query  809   IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLAT-  633
               D + +RD+VISF++AGRDT ++A+T  FWLL+ + EV  +I  E    ++P   L   
Sbjct  288   GHDGEAVRDMVISFIMAGRDTTSAAMTWLFWLLTENGEVERKILEE----VDPLVSLGLG  343

Query  632   YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMD  453
             +++++DM+Y  A + E+MRL+PPV +DSK   NDD LPDGT V++G +VTY PY MGRM+
Sbjct  344   FEELKDMSYTKACLCETMRLYPPVSWDSKHAANDDVLPDGTRVKRGDKVTYFPYGMGRME  403

Query  452   SIWGADCREFKPERWLED------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAV  291
             ++WG D  +FKP RW +        V K  + +K+PVFQAGPRVC+GK+MA ++MK V  
Sbjct  404   TLWGKDWEQFKPNRWFDSEPGSIRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYVVG  463

Query  290   ALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             +++  F  E+V   +  P + P LTA + GGL V+I  R
Sbjct  464   SVLSRF--EIVPVKKDQPVFVPLLTAHMAGGLMVKIKRR  500



>ref|XP_004236553.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=492

 Score =   430 bits (1105),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 227/452 (50%), Positives = 293/452 (65%), Gaps = 9/452 (2%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L DWY+ LL++SPT TI V   G    +ITANP NVEYML T F N+PKGK 
Sbjct  41    SFYKNRHRLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  100

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGD LGRGIF VDG+LW  QRK+AS EF + S+R +  + +   V  RL PLL   
Sbjct  101   FTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQV  160

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
               + +VLD QDVLRRF+FD ICK S G DP CLD    V     +FD AS   A R +  
Sbjct  161   ANSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAP  220

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGARDQSDLLSRFMGII  807
               A+WK KR LN GSEKKL E +  ++   +E+IE+K++        +Q DLLSR +   
Sbjct  221   VYAIWKSKRALNFGSEKKLRENVKRVHCCIDEIIEEKKQKIATENGGNQMDLLSRLLLAG  280

Query  806   DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQ  627
              D++++RD+VISFL+AGRDT +SALT  FWL + H +V D +  E   I   D+ L  + 
Sbjct  281   HDNEVVRDMVISFLIAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSIYNGDKALE-FD  339

Query  626   QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSI  447
             ++++M YL A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY PY MGRM+ I
Sbjct  340   ELKEMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEI  399

Query  446   WGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFD  270
             WG D  EFKP+RW+ E+G  K  + YKYPVFQAGPRVCLGK+MA  +MK V  +++R F+
Sbjct  400   WGKDRLEFKPDRWIDENGALKMVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFE  459

Query  269   IEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             I+ V    + P + P LTA + GG +VRI  R
Sbjct  460   IKPVVNVEK-PVFLPLLTAHMAGGFNVRIYHR  490



>gb|ADE75655.1| unknown [Picea sitchensis]
Length=559

 Score =   432 bits (1111),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/486 (48%), Positives = 312/486 (64%), Gaps = 52/486 (11%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             +W + +L +SPT TI V  LG    V+TANP N+E++L T+F+N+PKG  F +IL DLLG
Sbjct  68    EWAAEMLAESPTQTIVVERLGGIRTVLTANPENLEHILKTRFDNYPKGNPFTAILHDLLG  127

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             +GIF  DGD WK QRK+AS EF S S+R++  ++V  EV  RL P+L    E    L+ Q
Sbjct  128   KGIFNADGDTWKLQRKVASYEFSSGSLRNFVLKVVE-EVTDRLLPMLHNASETGRCLNLQ  186

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRL  948
             D+L+RF+FD ICK +FG+DP  LD     S+ A A D+A+KLSA R+      VWK+KR+
Sbjct  187   DILQRFAFDTICKVAFGVDPAWLDGRFAESELAGALDVAAKLSAGRSAAPIQLVWKMKRM  246

Query  947   LNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGAR------DQSDLLSRFMGIID---  804
             LNIGSEK+L EA+ +++E A E+I ++R     GG        +QSDLLSRFM +     
Sbjct  247   LNIGSEKRLSEAVAVVHEFAMEVIRRRRSQISNGGCTASDSKWEQSDLLSRFMVLSSTNS  306

Query  803   ------------------------DDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPE  696
                                      D+ LRD++ISF+LAGRDT +SALT FFWLLS HP 
Sbjct  307   NSTCKGHGHDMPTDAMGVEREDCCSDEFLRDMIISFILAGRDTTSSALTWFFWLLSSHPH  366

Query  695   VTDRIRAESGRIMEP-DQD---------LATYQQIRDMNYLTAAIHESMRLFPPVQFDSK  546
             V + I  E   ++    QD         L +Y+++++M+YL A+I ESMRL+PPV  DSK
Sbjct  367   VGEAIYKEIAHLIAARSQDIDSSSSSPVLFSYKEMQNMHYLHASICESMRLYPPVLLDSK  426

Query  545   FCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWL-EDGVFKSENLYK  369
               L++D LPDGTFV KGTRVTYHPYAMGRM++IWGADC +FKPERW+ +DG F  ++ +K
Sbjct  427   HALHNDVLPDGTFVGKGTRVTYHPYAMGRMNAIWGADCLQFKPERWVNKDGHFVPQSPFK  486

Query  368   YPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQ-MPRYAPGLTATVRGGLS  192
             + VFQ G RVCLGK+MA +EMK VA  +I  F ++   +SRQ  P+    LTA + GG  
Sbjct  487   FAVFQGGVRVCLGKEMAFIEMKFVAATVISMFRLQPPVDSRQRTPKLVHCLTARMEGGFP  546

Query  191   VRITDR  174
             V +  R
Sbjct  547   VVVQRR  552



>ref|XP_011044159.1| PREDICTED: cytochrome P450 94B3-like [Populus euphratica]
Length=509

 Score =   430 bits (1106),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 221/448 (49%), Positives = 298/448 (67%), Gaps = 13/448 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL+ SPT TI V  LG    ++TANP NVEY+L T F NFPKGK F  ILGDL
Sbjct  58    LLDWYTNLLSVSPTQTIVVQRLGARRIIVTANPENVEYVLKTNFINFPKGKPFTEILGDL  117

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF  DG+LW  QRK+AS EF + S+R +    +  EV+ RL PLLE   E + VLD
Sbjct  118   LGCGIFNADGELWSTQRKLASHEFSTKSLREFVVMTLQEEVQNRLIPLLEEAVEAKSVLD  177

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QD+LRRFSFD +C+ S G DP  LDLS P+     AFD AS++SA R +    AVWK K
Sbjct  178   LQDLLRRFSFDIVCRVSLGTDPSSLDLSRPMPPLVKAFDAASEISAMRGMAPVYAVWKAK  237

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFMGIIDDDKLLR  786
             +L N+G+EKKL EAI L+++   E++  K++        + +SDLLSR +     ++++R
Sbjct  238   KLFNLGAEKKLKEAIKLVHDSVSEIVTTKKRVLENDREGKLESDLLSRLLLAGHGEEVVR  297

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             D+V+SF++AGRDT ++A+T  FWLLS+H    + I  E   +++       Y+ ++ MN+
Sbjct  298   DMVVSFIMAGRDTTSAAMTWLFWLLSKHRNSEEMIVKEVKSLLDDGGKAIDYEVLKGMNF  357

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L A++ ESMRL+PPV +DSK  + DD LPDGT VRKG RVTY PY MGRM+ +WG D  E
Sbjct  358   LKASLCESMRLYPPVPWDSKHAIIDDVLPDGTSVRKGDRVTYFPYGMGRMEKLWGKDRFE  417

Query  425   FKPERWLE----DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVV  258
             F+P+RW +    D   KS + Y +PVFQAGPRVCLGK+MA+++MK V  A++R F+I  V
Sbjct  418   FRPDRWFQEIGNDQTLKSVSPYTFPVFQAGPRVCLGKEMAMIQMKYVMAAVLRRFEIIPV  477

Query  257   CESRQMPRYAPGLTATVRGGLSVRITDR  174
              ++   P +AP LTA + GGL V +  R
Sbjct  478   FDNE--PVFAPLLTAHMVGGLKVMVRRR  503



>gb|KGN63489.1| hypothetical protein Csa_1G002090 [Cucumis sativus]
Length=515

 Score =   430 bits (1106),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 214/457 (47%), Positives = 294/457 (64%), Gaps = 18/457 (4%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L  WY+ LL+ SPT TI +H LG+   ++TANPANVE+ML T F N+PKGK F  ILGDL
Sbjct  60    LLTWYTDLLSDSPTQTIVMHRLGSRRTILTANPANVEHMLKTNFLNYPKGKPFTDILGDL  119

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDGDLW  QRK+AS  F + S+R +  + +  EV  RL PLL        VLD
Sbjct  120   LGCGIFNVDGDLWSTQRKLASHAFSAKSLREFVVKTLEDEVHFRLIPLLHNAARTNAVLD  179

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVL R +FD +CK + G D  CLD+S P+ +   AFD+A+ +SA RAVT     WKVK
Sbjct  180   LQDVLGRLAFDTVCKVTLGTDEQCLDMSRPIPEIVKAFDVATAISARRAVTPLYLTWKVK  239

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQK---------RKCGGARDQSDLLSRFMGIIDD  801
             R+LN+GSEKKL + +  ++E    +I  K         R     ++ SDLLSR +    +
Sbjct  240   RMLNLGSEKKLKQVVQTVHEWISNIIHNKVLNNNDNKDRNHNQTQNNSDLLSRLLSAGLN  299

Query  800   DKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLAT----  633
             ++++RD+++SF++AGRDT ++A+T  FWLL+ H  +   I  E+  + + D    T    
Sbjct  300   EEVIRDMIVSFIMAGRDTTSAAMTWLFWLLTNHRNIEQTIINEATSLSDHDYSKTTSLGY  359

Query  632   -YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
              Y++++DM YL A + ESMRL+PPV +DSK     D LPDGT VRKG RVTY PY MGRM
Sbjct  360   GYEELKDMKYLKACLCESMRLYPPVAWDSKHAAAADILPDGTQVRKGDRVTYFPYGMGRM  419

Query  455   DSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
             + +WG D  EFKPERW ++G  K+ + +K+PVFQAGPR+CLG +MA ++MK V   +++ 
Sbjct  420   EELWGKDRLEFKPERWFQNGELKTVSAFKFPVFQAGPRMCLGTEMAFIQMKYVMATVLKR  479

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             F+   V E+ + P + P LTA + GGL V + +R  Q
Sbjct  480   FEFRRVSENNE-PVFVPLLTAHMAGGLKVYVRERTEQ  515



>ref|XP_006440103.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
 gb|ESR53343.1| hypothetical protein CICLE_v10019793mg [Citrus clementina]
Length=506

 Score =   429 bits (1104),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 301/455 (66%), Gaps = 20/455 (4%)
 Frame = -1

Query  1487  NLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGD  1317
              L +WY+ LL++SPT TI V  LG    ++TANPANVEYML + F NFPKG+ F  ILGD
Sbjct  50    QLLNWYTDLLSQSPTQTIIVQRLGARRTIVTANPANVEYMLKSNFTNFPKGRPFTEILGD  109

Query  1316  LLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVL  1137
             LLG GIF VDG+LW  QRK+AS EF + S+R +  + +  EV  RL P+LE   E+R VL
Sbjct  110   LLGCGIFNVDGELWSMQRKLASHEFSAKSLREFTVKTLQQEVDDRLIPMLEEAAESRRVL  169

Query  1136  DFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKV  957
             DFQD+LRRF+FD +CK S G DP CLD S P+     AFD AS++SA R +     VWK+
Sbjct  170   DFQDILRRFAFDVVCKVSLGTDPFCLDHSQPLPPLVKAFDAASEISAMRGMAPVFLVWKI  229

Query  956   KRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGAR--DQSDLLSRFMGIIDDDKLLRD  783
             KRLLN+GSEKKL E++ L++E   E+I  K++       +  DLLSR +     +++ RD
Sbjct  230   KRLLNMGSEKKLKESVNLVHESVMEIIRNKKENNSVNGDEGGDLLSRLLSAGHGEQVARD  289

Query  782   IVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-----TYQQIR  618
             + ISF++AGRDT ++A+T  FWLLS++ E  +R   +  +++    ++       ++ ++
Sbjct  290   MAISFIMAGRDTTSAAMTWLFWLLSQN-EAVERAIVDEVKLVTDKNNIGRARALDFETLK  348

Query  617   DMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGA  438
             +MN+L A + ESMRL+PPV +DSK     D LPDGT VRKG RVTY PY MGRM+++WG 
Sbjct  349   EMNFLKACLCESMRLYPPVAWDSKHAAAYDVLPDGTPVRKGDRVTYMPYGMGRMETLWGK  408

Query  437   DCREFKPERWLED-------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIR  279
             D  EFKP+RWL+D        V K  + YK+PVFQAGPRVCLGK+MA ++MK V  +++R
Sbjct  409   DRLEFKPDRWLDDLGEEWENRVLKPVSPYKFPVFQAGPRVCLGKEMAFIQMKYVVGSVLR  468

Query  278   AFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              F+I+ V  S   P + P LT  + GGL V +  R
Sbjct  469   RFEIKPV--SGNQPVFVPLLTGHMIGGLKVLVRKR  501



>ref|XP_002282477.2| PREDICTED: cytochrome P450 94A1-like [Vitis vinifera]
 emb|CBI17962.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   430 bits (1105),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 301/448 (67%), Gaps = 19/448 (4%)
 Frame = -1

Query  1475  WYSCLLNKSPTGTIHVH-VLGN--VITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             W S L+  SP+ T+ +H  LG   V+T NP+NV+++L T F N+ KG+ FA  L D LG 
Sbjct  117   WTSDLIRASPSATVVIHRFLGTRVVLTGNPSNVQHILKTHFHNYHKGQTFAINLSDFLGG  176

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF  DGD WKFQR+++S EF + S+R +   +V AE+  RL P+L     N  +LDFQD
Sbjct  177   GIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDRLIPILSMAAANNSILDFQD  236

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +L+RF+FDNICK +FG DP  L  SLP +KFA AF+ A+++S+ER  +  P VW++KRL+
Sbjct  237   ILQRFAFDNICKIAFGYDPAYLLPSLPQAKFAVAFEDAARISSERFSSIRPTVWRLKRLM  296

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFM--GIIDDDKLLRDI  780
              +GSEK+L  A+G + E A+ +I +K+   K   + D +DLLSRF+  G  D+D  + DI
Sbjct  297   GVGSEKRLKLAVGEVREFAKNIIREKKEELKHKSSLDSTDLLSRFLSSGHSDED-FVTDI  355

Query  779   VISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLT  600
             VISF+LAGRDT ++ALT FFWLL ++P+V D+I  E    +    +L  + +++DM Y  
Sbjct  356   VISFILAGRDTTSAALTWFFWLLFKNPDVEDQILNE----INEKSELPVFDEVKDMIYTH  411

Query  599   AAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFK  420
             A++ ESMR +PPV  DSK  ++DD LPDGT VRKG RVTYHPYAMGR++ +WG+D  EF+
Sbjct  412   ASLCESMRFYPPVPADSKEAVSDDVLPDGTVVRKGMRVTYHPYAMGRLEELWGSDWPEFR  471

Query  419   PERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVV  258
             PERWL+         F + + Y YPVFQAGPR+CLGK+MA ++MK V   ++R F +  V
Sbjct  472   PERWLQRDPDTGKWSFVARDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRFQVVPV  531

Query  257   CESRQMPRYAPGLTATVRGGLSVRITDR  174
              E    P +   LTA ++GG  VRI +R
Sbjct  532   VEDGGEPVFTADLTAKMKGGFPVRIVER  559



>ref|XP_006351474.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=492

 Score =   427 bits (1098),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 222/449 (49%), Positives = 292/449 (65%), Gaps = 6/449 (1%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L DWY+ LL++SPT TI V   G    +ITANP NVEYML T F N+PKGK 
Sbjct  44    SFYKNRHQLLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKP  103

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGD LGRGIF VDG+LW  QRK+AS EF + S+R    + +   V  RL PLL   
Sbjct  104   FTDILGDFLGRGIFNVDGELWSAQRKLASHEFSTNSLRELVVKALEEVVENRLIPLLIQA  163

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              ++ +VLD QDVLRRF+FD ICK S G DP CLD    V     +FD AS   A R +  
Sbjct  164   AKSGKVLDLQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVESFDTASLACAMRGMAP  223

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD  798
               A+WK KR LN+GSEKKL E +  ++   +E+I +K++   + +  DLLSR +    ++
Sbjct  224   VYAIWKSKRALNLGSEKKLKENVKRVHCCIDEIIVEKKQKIVSGNHMDLLSRLLLAGHEN  283

Query  797   KLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIR  618
             +++RD+VISFL+AGRDT +SALT  FWL++ H ++ D++  E   I   D     + +++
Sbjct  284   EVVRDMVISFLIAGRDTTSSALTWLFWLITNHHDIKDKMIKEITSINNGDHKALEFDELK  343

Query  617   DMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGA  438
             +M YL A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY  Y MGRM+ IWG 
Sbjct  344   EMKYLAACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFQYGMGRMEEIWGK  403

Query  437   DCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEV  261
             D  EFKPERW+ E+G  K  + YKYPVFQAGPRVCLGK+MA  +MK V  +++R F+I+ 
Sbjct  404   DRLEFKPERWMDENGELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKP  463

Query  260   VCESRQMPRYAPGLTATVRGGLSVRITDR  174
             V    + P + P LTA + GG +VRI  R
Sbjct  464   V--KVEKPVFMPLLTAHMVGGFNVRIHHR  490



>ref|XP_009610819.1| PREDICTED: cytochrome P450 94A1-like [Nicotiana tomentosiformis]
Length=510

 Score =   427 bits (1099),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 293/453 (65%), Gaps = 16/453 (4%)
 Frame = -1

Query  1493  HSNLCDWYSCLLNKSPTGT---IHVHVLGNVITANPANVEYMLTTKFENFPKGKQFASIL  1323
             H     W S ++  +P  T   I       + TANP+NV++ML T F+ + KG    + L
Sbjct  60    HDQRIKWISDIILSTPNLTFTLIRPLNFHTIFTANPSNVQHMLKTNFQVYQKGHNSNTTL  119

Query  1322  GDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENRE  1143
              D L  GIF VDGD+WK+QR++AS EF + S+R +   +V  E+  RL P+L     N+ 
Sbjct  120   KDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTELSERLIPILATAAANKT  179

Query  1142  VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVW  963
             VLDFQD+L+RF+FDNICK +FG DPG L  SLP ++FA AF+ A +LS ER +   P +W
Sbjct  180   VLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAVAFEDAVRLSTERFILPFPLIW  239

Query  962   KVKRLLNIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFMGI-IDDDK  795
             K+KR LNIGSEKKL  A+  + E A+E++ +K+   K   + D +DLLSRF+     D+ 
Sbjct  240   KMKRALNIGSEKKLRFAVEQVREFAKEIVREKQRELKDKSSLDSADLLSRFLSTGHSDEN  299

Query  794   LLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRD  615
              + DIVISF+LAGRDT ++ALT FFWL+S+HPEV  +I  E G   E  + L  Y ++++
Sbjct  300   FVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQILKEIG---EKSESLLLYDEVKN  356

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M Y  A++ ESMR +PPV  D+K    DD LPDGTFV+KG RVTYHPYAMGR++ +WG D
Sbjct  357   MIYTHASLCESMRFYPPVPMDTKEATKDDILPDGTFVKKGNRVTYHPYAMGRVEKVWGKD  416

Query  434   CREFKPERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAF  273
               EF+PERWL+      +  F S++ Y YPVFQAGPRVCLGK+MA ++MK V   ++R F
Sbjct  417   WAEFRPERWLDKDEVTGNWTFVSKDAYTYPVFQAGPRVCLGKEMAFLQMKRVVAGVLRRF  476

Query  272   DIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              +  V E    P +   LTA ++GG  V I +R
Sbjct  477   KVVPVVEQGAEPVFISYLTAKMKGGFPVTIEER  509



>ref|XP_011083758.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=545

 Score =   428 bits (1101),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/444 (49%), Positives = 295/444 (66%), Gaps = 7/444 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++S T TI VH LG    ++TANP NVEY+L T F NFPKGK F  +LGD 
Sbjct  105   LLDWYTELLSQSETQTIVVHRLGAPRTIVTANPDNVEYILKTNFANFPKGKPFTELLGDF  164

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+ W  QRK+AS EF + S+R +  +++  EV +RL P+L+   EN  ++D
Sbjct  165   LGLGIFNVDGEKWSIQRKLASHEFSAKSLREFVVKVLEDEVESRLIPILDDAAENDRIID  224

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              Q+VLRRF+FD ICK S GMDP CLDL+ P    A+AFD AS +SA R      AVWK+K
Sbjct  225   MQEVLRRFAFDTICKVSLGMDPLCLDLARPPPPLASAFDAASAISAMRGTAPVFAVWKLK  284

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDDKLLRDIVI  774
             R LN+G EK+L EA+ L++   +EMI  K+   G     DLLSRF+    DD+++RD+VI
Sbjct  285   RTLNVGLEKELKEAVKLVHGCVDEMIRSKKGTMGGNSGGDLLSRFLESGLDDEMVRDMVI  344

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTAA  594
             SFL+AGRDT ++A+T  FWLL+ H  +  ++  E   +    + L  +  ++ +N++ A 
Sbjct  345   SFLMAGRDTTSAAVTWLFWLLTGHRGIEKQVVDEITSMKNGGEQLG-FDDLKGLNFIKAC  403

Query  593   IHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPE  414
             + + MRL+PPV +DSK  + DD LPDGT V +G RVTY  Y MGRM+ +WG D  EF+PE
Sbjct  404   LCDDMRLYPPVVWDSKHAVKDDVLPDGTPVYRGNRVTYFQYGMGRMEEVWGKDRLEFRPE  463

Query  413   RWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMP  237
             RWL E G+ K  + YK+ VFQAGPRVCLGK+MA ++MK V  +++R F++  V    + P
Sbjct  464   RWLDESGMVKMVSPYKFAVFQAGPRVCLGKEMAFIQMKYVVASVLRRFELHPV--RSEPP  521

Query  236   RYAPGLTATVRGGLSVRITDRRPQ  165
              + P LTA + GG +VR+  R  Q
Sbjct  522   VFVPLLTAYMGGGFNVRVQRRGQQ  545



>ref|XP_006351473.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=489

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/442 (51%), Positives = 292/442 (66%), Gaps = 8/442 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL+ SPT TI V   G    +ITANP NVEYML T F N+PKGK F  ILGD 
Sbjct  49    LLDWYTQLLSDSPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDF  108

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF VDG+LW  QRK+AS EF + S+R +  + +   V  RL PLL    ++ + LD
Sbjct  109   LGRGIFNVDGELWNAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQAAKSGKALD  168

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRFSFD ICK S G DP CLD    V     +FD AS+  A R +    A+WK K
Sbjct  169   LQDVLRRFSFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASRACAMRGMAPVYAIWKSK  228

Query  953   RLLNIGSEKKLGEAIGLINELAEEMI-EQKRKCGGARDQSDLLSRFMGIIDDDKLLRDIV  777
             R LN+GSEK+L E +  ++   +E+I E+K K     +  DLLSR +    +D++LRD+V
Sbjct  229   RALNLGSEKQLKENVKRVHCCIDEIIQEKKEKIIINENGGDLLSRLLIAGHEDEVLRDMV  288

Query  776   ISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTA  597
             ISFL+AGRDT +SALT  FWL + HP + + +  E   I   D+ L  + ++++M YL A
Sbjct  289   ISFLMAGRDTTSSALTWLFWLTTNHPNIKNEMIDEITSINNGDKALE-FDELKEMKYLAA  347

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
              ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY PY MGRM+ IWG D  EFKP
Sbjct  348   CLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEFKP  407

Query  416   ERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQM  240
             +RW+ E+G  KS   YKYPVFQAGPR+CLGK+MA  +MK V  +++R F+I+ V  + + 
Sbjct  408   DRWIDENGGSKSVCPYKYPVFQAGPRMCLGKEMAFTQMKYVLASVLRRFEIKPV--NVEK  465

Query  239   PRYAPGLTATVRGGLSVRITDR  174
             P + P LTA + GG +VRI +R
Sbjct  466   PVFLPLLTAHMVGGFNVRIYER  487



>ref|XP_004236333.1| PREDICTED: cytochrome P450 94B3-like [Solanum lycopersicum]
Length=494

 Score =   427 bits (1097),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 224/444 (50%), Positives = 292/444 (66%), Gaps = 10/444 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V   G    +ITANP NVEYML T F N+PKGK F  ILGD 
Sbjct  49    LLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDF  108

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF VDG+LW  QRK+AS EF + S+R +  + +   V  RL PLL     + +VLD
Sbjct  109   LGRGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVENRLIPLLIQTANSGKVLD  168

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLD    V     +FD AS   A R +    A+WK K
Sbjct  169   LQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASLACAMRGMAPVYAIWKSK  228

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGARDQSDLLSRFMGIIDDDKLLRD  783
             R LN+GSEKKL E +  ++   +++IE+K++        +  DLLSR +    +++++RD
Sbjct  229   RALNLGSEKKLKENVKRVHCCIDKIIEEKKQKIATENGGNHMDLLSRLLLAGHENEVVRD  288

Query  782   IVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYL  603
             +VISFL+AGRDT +SALT  FWL + H +V D +  E   I   D+ L  + ++++M Y+
Sbjct  289   MVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKALE-FDELKEMKYI  347

Query  602   TAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREF  423
             TA ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY PY MGRM+ IWG D  EF
Sbjct  348   TACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFPYGMGRMEEIWGKDRLEF  407

Query  422   KPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESR  246
             KPERW+ E+G  K  + YKYPVFQAGPRVCLGK+MA  +MK V  +++R F+I+ V    
Sbjct  408   KPERWMEENGELKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPV--KL  465

Query  245   QMPRYAPGLTATVRGGLSVRITDR  174
             + P + P LTA + GG +VRI  R
Sbjct  466   EKPVFLPLLTAHMVGGFNVRIHHR  489



>ref|XP_010250748.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=516

 Score =   427 bits (1098),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 228/477 (48%), Positives = 301/477 (63%), Gaps = 28/477 (6%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEY  1380
             PL  C I       S+      L DWY+ LL  SP  TI +   G    V+TANP NVEY
Sbjct  45    PLIGCLI-------SFYKNRRRLLDWYTDLLADSPMQTIVIRRFGARRTVVTANPDNVEY  97

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +LTT F NFPKG+ F  ILGDLLG GIF VDG+LW+ QRK+AS EF + S+R +  + + 
Sbjct  98    ILTTNFNNFPKGQPFTDILGDLLGCGIFNVDGELWRAQRKLASHEFSTKSLREFVGKTLN  157

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
               V+ RL P+L    E  +++D QD+LRRF+FD +C  S G+DPGCLD SLPVS  A AF
Sbjct  158   QVVKNRLTPVLASAMETDQIVDLQDLLRRFAFDTVCMVSLGIDPGCLDSSLPVSALAGAF  217

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK-------  861
             D+AS++SA RA     AVWK+KR L +GSE++L EAI  ++   EE+I  K+K       
Sbjct  218   DIASEISARRASAPVFAVWKIKRALCLGSERRLKEAIQHVHGSVEEIIRDKKKLMLNRVR  277

Query  860   ---CGGARDQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVT  690
                        DLLSR +    DD+++RD+VISF++AGRDT ++A+T  FWLLS HP + 
Sbjct  278   KEEINNNNSNGDLLSRLISSGYDDEVIRDMVISFIMAGRDTASAAMTWLFWLLSCHPHIE  337

Query  689   DRIRAESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGT  510
             + +  E   I   D  L  Y+ ++++  L A + ESMRL+PP+ +DSK  + DDTLPDGT
Sbjct  338   NEVVKEVEAINTGDSPL-DYEALKELPLLKACLCESMRLYPPIAWDSKHVVEDDTLPDGT  396

Query  509   FVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWL-----EDGVFKSENLYKYPVFQAGP  345
              VR G RVTY PY MGRM+ +WG D  EFKP+RW      E G  K  + +K+PVFQAGP
Sbjct  397   RVRAGDRVTYFPYGMGRMEGLWGKDRFEFKPDRWFVEPDKEGGALKEVSPFKFPVFQAGP  456

Query  344   RVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             RVCLGK+MA V+MK V  +L++ F  + V    + P + P LTA + GGL+V I  R
Sbjct  457   RVCLGKEMAFVQMKYVMASLLKQFQFKSV--GLEEPAFVPLLTAHMAGGLNVLIRPR  511



>ref|XP_002282468.1| PREDICTED: cytochrome P450 94A1 [Vitis vinifera]
 emb|CBI17961.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   426 bits (1096),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 217/450 (48%), Positives = 298/450 (66%), Gaps = 19/450 (4%)
 Frame = -1

Query  1481  CDWYSCLLNKSPTGTIHVH-VLGN--VITANPANVEYMLTTKFENFPKGKQFASILGDLL  1311
               W S L+  SP+ T+ +H  LG   V+T NP+NV+++L T F N+ KG+ F  IL D L
Sbjct  57    VQWTSDLIRASPSATVVIHRCLGTRVVLTGNPSNVQHILKTHFHNYHKGQFFRIILSDFL  116

Query  1310  GRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDF  1131
             G GIF  DGD WKFQR+++S EF + S+R +   +V AE+  RL P+L     N  VLDF
Sbjct  117   GGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDRLIPILSTAAANNSVLDF  176

Query  1130  QDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             QD+L+RF+FDNICK +FG DP  L  SLP +KFA AF+ A+++S+ER     P VWK+KR
Sbjct  177   QDILQRFAFDNICKIAFGYDPDYLLPSLPQAKFAVAFEDAARISSERFTLILPIVWKLKR  236

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFM--GIIDDDKLLR  786
             L+ +GSEK+L  A+  + E A+ ++ +K+   K   + D +DLLSRF+  G  D+D  + 
Sbjct  237   LMGVGSEKRLKLAVAEVREFAKNIVREKKEELKHKSSLDSTDLLSRFLSSGHSDED-FIT  295

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             DIVISF+LAGRDT ++ALT FFWLL +HP+V D+I  E    +    +L  + +++DM Y
Sbjct  296   DIVISFILAGRDTTSAALTWFFWLLFKHPDVEDQILNE----INEKSELPVFDEVKDMVY  351

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
               A++ ESMR +PPV  DSK  ++DD LPDGT V+KG RVTYHPYAMGR++ +WG+D  E
Sbjct  352   THASLCESMRFYPPVPVDSKEVVSDDVLPDGTVVKKGMRVTYHPYAMGRLEELWGSDWPE  411

Query  425   FKPERWL------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIE  264
             F+PERWL      E   F + + Y YPVFQAGPR+CLGK+MA ++MK V   ++R F + 
Sbjct  412   FRPERWLQRDPDTEKWSFVARDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRFQVV  471

Query  263   VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V E    P Y   L A ++GG  VRI +R
Sbjct  472   PVVEDGGEPVYTADLAAKMKGGFLVRIVER  501



>ref|XP_010045498.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=518

 Score =   427 bits (1098),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 304/465 (65%), Gaps = 21/465 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S+L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGDLLG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVENRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQD-  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++    + I +E   I++   + 
Sbjct  291   LAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYNK  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+P V +DSK    DD LPDGT VRKG RVTY PY MG
Sbjct  351   CLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGTPVRKGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             RM+ +WG D  EFKP+RWL         +G  ++ + YK+PVFQAGPRVCLGK+MA ++M
Sbjct  411   RMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             K V  +++R F+I  V E+R  P + P LTA + GGL V +  R+
Sbjct  471   KYVVASILRRFEIRPVLENR--PVFVPLLTAHMAGGLKVVVKKRK  513



>ref|XP_008788895.1| PREDICTED: cytochrome P450 94B3-like [Phoenix dactylifera]
Length=516

 Score =   426 bits (1096),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 218/447 (49%), Positives = 297/447 (66%), Gaps = 8/447 (2%)
 Frame = -1

Query  1487  NLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGD  1317
              L DW++ LL  SPT TI +  LG    V+TAN  NVEYML T F+N+PKGK F  ILGD
Sbjct  48    RLLDWFTELLAASPTQTIVLERLGARRTVVTANADNVEYMLKTNFDNYPKGKPFTDILGD  107

Query  1316  LLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVL  1137
             LLG GIF  DG+LW  QRK+AS EF + S+R +  + + AE   RL P+L    ++R  +
Sbjct  108   LLGCGIFNADGELWHTQRKLASHEFTTRSLREFVVKTLDAETNERLLPILSSACKDRRTV  167

Query  1136  DFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKV  957
             D QD+LRRF+FD +CK + G DPG LD SLP+S  AAAF++AS + A R      AVWKV
Sbjct  168   DMQDLLRRFAFDTVCKVALGTDPGFLDPSLPMSNLAAAFEVASGICARRGAALVSAVWKV  227

Query  956   KRLLNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGARDQSDLLSRFMGIIDDDKLLR  786
             KR L +GSE +L  ++ LI+E    +I ++++    G   ++SDLLSR +     D+++R
Sbjct  228   KRTLGVGSEGRLRASVRLIHESVMGLIRRRKEEAAAGKGAERSDLLSRLISGGHSDEVIR  287

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             D+VISF++AGRDT ++ALT FFWL+SR PE+   +  E+    +  Q L  YQ++++M +
Sbjct  288   DMVISFVMAGRDTTSAALTWFFWLISRQPEIEREVVREAADRADRGQGLDRYQELKEMKF  347

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L A + ESMRL+PPV +DSK    DD LPDGT VR+G RVTY PY MGRM+ +WG D  E
Sbjct  348   LEACLCESMRLYPPVAWDSKHAARDDVLPDGTEVRRGDRVTYFPYGMGRMERLWGKDWME  407

Query  425   FKPERWLE-DG-VFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCE  252
             F+P RWLE +G      + YK+ VFQAGPRVCLGK+MA V+MK +A A++R F++     
Sbjct  408   FEPRRWLEAEGRELARVSAYKFAVFQAGPRVCLGKEMAFVQMKYIAAAVLRHFELRRAGG  467

Query  251   SRQMPRYAPGLTATVRGGLSVRITDRR  171
              ++ P   P LTA + GGL + + +RR
Sbjct  468   EQRPPVLVPLLTAHMAGGLKMVVRERR  494



>ref|XP_010045499.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=528

 Score =   426 bits (1096),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 219/465 (47%), Positives = 303/465 (65%), Gaps = 21/465 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHVLKNNFHNYPKGVP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGD LG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQD-  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++    + I +E   I++   + 
Sbjct  291   LAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYNK  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+PPV +DSK    DD LPDGT VR+G RVTY PY MG
Sbjct  351   CLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAVRRGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             R++ +WG D  EFKP+RWL         +G  ++ + Y+YPVFQAGPRVCLGK+MA ++M
Sbjct  411   RLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             K V  +++R F+I  V E+R  P + P LTA + GGL V +  R+
Sbjct  471   KYVVASILRRFEIRPVLENR--PVFVPLLTAHMAGGLKVVVKKRK  513



>ref|XP_010026539.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83160.1| hypothetical protein EUGRSUZ_B00115 [Eucalyptus grandis]
Length=518

 Score =   426 bits (1095),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/465 (48%), Positives = 302/465 (65%), Gaps = 21/465 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYQNRSRLLDWYTDLLSRSPTHTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGDLLG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQISLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDILDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD-QD  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++      I +E   I++   ++
Sbjct  291   LAAGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAIVSEVDSILDRSYKN  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+PPV +DSK    DD LPDGT VRKG RVTY PY MG
Sbjct  351   CLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPVRKGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             RM  +WG D  EFKP+RWL         +G  ++ + YK+PVFQAGPRVCLGK+MA ++M
Sbjct  411   RMKELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             K V  +++  F+I  V E+R  P + P LTA + GGL V +  R+
Sbjct  471   KYVVASILGRFEIRPVLENR--PAFVPLLTAHMTGGLKVVVNKRQ  513



>emb|CAN75729.1| hypothetical protein VITISV_031409 [Vitis vinifera]
Length=506

 Score =   426 bits (1094),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 216/450 (48%), Positives = 298/450 (66%), Gaps = 19/450 (4%)
 Frame = -1

Query  1481  CDWYSCLLNKSPTGTIHVH-VLGN--VITANPANVEYMLTTKFENFPKGKQFASILGDLL  1311
               W S L+  SP+ T+ +H  LG   V+T NP+NV+++L T F N+ KG+ F  IL D L
Sbjct  58    VQWTSDLIRASPSATVVIHRCLGTRVVLTGNPSNVQHILKTHFHNYHKGQFFRIILSDFL  117

Query  1310  GRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDF  1131
             G GIF  DGD WKFQR+++S EF + S+R +   +V AE+  RL P+L     N  VLDF
Sbjct  118   GGGIFNADGDNWKFQRQVSSHEFNTKSLRKFIETVVDAELSDRLIPILSTAAANNSVLDF  177

Query  1130  QDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             QD+L+RF+FDNICK +FG DP  L  SLP +KFA AF+ A+++S+ER     P VWK+KR
Sbjct  178   QDILQRFAFDNICKIAFGYDPDXLLPSLPQAKFAVAFEDAARISSERFTLILPIVWKLKR  237

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFM--GIIDDDKLLR  786
             L+ +GSEK+L  A+  + E A+ ++ +K+   K   + D +DLLSRF+  G  D+D  + 
Sbjct  238   LMGVGSEKRLKLAVAEVREFAKNIVREKKEELKHKSSLDSTDLLSRFLSSGHSDED-FIT  296

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             DIVISF+LAGRDT ++ALT FFWLL +HP+V D+I  E    +    +L  + +++DM Y
Sbjct  297   DIVISFILAGRDTTSAALTWFFWLLFKHPDVEDQILNE----INEKSELPVFDEVKDMVY  352

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
               A++ ESMR +PPV  DSK  ++DD LPDGT V+KG RVTYHPYAMGR++ +WG+D  E
Sbjct  353   THASLCESMRFYPPVPVDSKEVVSDDVLPDGTVVKKGMRVTYHPYAMGRLEELWGSDWPE  412

Query  425   FKPERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIE  264
             F+PERWL+         F + + Y YPVFQAGPR+CLGK+MA ++MK V   ++R F + 
Sbjct  413   FRPERWLQRDPDTXKWSFVARDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRFQVV  472

Query  263   VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V E    P Y   L A ++GG  VRI +R
Sbjct  473   PVVEDGGEPVYTADLAAKMKGGFLVRIVER  502



>ref|XP_006482029.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   425 bits (1093),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 300/449 (67%), Gaps = 16/449 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L   P GT   +  G   +VITANPANVE++L T FEN+PKG++F ++L D LG
Sbjct  56    DWSTEILKHCPKGTTIFYSPGEIHSVITANPANVEHILKTNFENYPKGQRFVNLLEDFLG  115

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  DG+LWK QRK AS EF + S+R++  + V  E  +RL P+L       +VLD Q
Sbjct  116   RGIFNSDGELWKVQRKTASYEFSTKSLRNFVMDNVRFETLSRLVPILVKASRTGQVLDLQ  175

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPV-SKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L R+ FDNICK +F  DPGCL       S+F  AF+ A+ LS+ R + A   +W VK+
Sbjct  176   DILERYGFDNICKVAFKFDPGCLGGDGTAGSEFMRAFEDAATLSSGRFLYAFKHMWNVKK  235

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGI-IDDDKLLRDIVI  774
               NIGSE+ L  +I +++E A  +I  + +   A  + DLLSRF+G   +  + LRDIVI
Sbjct  236   FFNIGSERTLKNSIAIVHEFANNIIRSRMEEKKANMEDDLLSRFIGNGKNSTEFLRDIVI  295

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRD+ +SAL+ FFWLL+ HP+V        + IRA +GR +       +++++RD
Sbjct  296   SFILAGRDSTSSALSWFFWLLASHPKVEQNILKELESIRARNGRSVGATY---SFEELRD  352

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M+YL AA+ E++RL+PPV  DSK C NDD LPDGTFV K   VTYH YAMGRM+SIWG +
Sbjct  353   MHYLHAALSETLRLYPPVPVDSKACRNDDILPDGTFVEKDWYVTYHAYAMGRMESIWGEN  412

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             C E+ PERWLEDG+++SEN++++PVF AGPR+CLGKDMA ++MKS+A ++I  F ++V  
Sbjct  413   CNEYLPERWLEDGIYRSENVFRFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFAVDVQH  472

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDRRP  168
             +    P     LT  ++ GL V + +R P
Sbjct  473   KD-TCPEKVLSLTLRIKDGLHVTVRERCP  500



>ref|XP_002979339.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ19747.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=461

 Score =   424 bits (1089),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 214/435 (49%), Positives = 290/435 (67%), Gaps = 9/435 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV--ITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             +W +  +  SP+ T      G+   IT NPA VE++L T FEN+PKG+     L DLLG 
Sbjct  26    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  85

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF VDG+LWK QR++AS EF + S+R +  + +A EV +RL P L     + + +D QD
Sbjct  86    GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  145

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +  RF+FDNICK SFG+DP CLD S P  KFA AFD A+ LS  R     P VWK+ R L
Sbjct  146   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  205

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIID---DDKLLRDIVI  774
             N+G E++L E + ++NE A  +++++R+  G  +Q DLLSRF+G+      D+ LRDI+I
Sbjct  206   NVGPERELKEVLDVVNEFAVSVVQKRREEKGRVNQ-DLLSRFIGLDSTSFSDEFLRDIII  264

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTAA  594
             SF+LAG+DTIA +L+ FFWLLS HP V   I  E G     ++   TY+++RDM YL AA
Sbjct  265   SFVLAGKDTIAVSLSWFFWLLSNHPGVQQEIIREVGSTKGSNRPF-TYKELRDMVYLQAA  323

Query  593   IHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPE  414
             + ESMRL+PPV  D+K   N D LPDG  V KG +V+YH YAMGRM+S+WG DC EFKPE
Sbjct  324   LCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFKPE  383

Query  413   RWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPR  234
             RW++DG F   + +K+PVFQAGPRVCLGK+MA+++MK V  AL+  F++ VV   ++ P 
Sbjct  384   RWIQDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVV--GKEEPC  441

Query  233   YAPGLTATVRGGLSV  189
             Y   +T  ++ GL V
Sbjct  442   YGINMTLIMKDGLPV  456



>ref|XP_009359442.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
Length=511

 Score =   425 bits (1093),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 220/461 (48%), Positives = 298/461 (65%), Gaps = 17/461 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+     NL DWY+ LL+ SP+ TI VH +G    V+T NP+NVE++L T F NFPKGK 
Sbjct  51    SFYKNQHNLLDWYTSLLSGSPSQTIVVHRIGAPRTVVTGNPSNVEHILKTNFANFPKGKP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
                 LGDLLG GIF VDGD+W  QRK+AS EF   S+R +    +  EV  RL PLLE  
Sbjct  111   LTEFLGDLLGCGIFNVDGDMWSTQRKLASHEFSIKSLREFVVNTLEEEVENRLIPLLEEA  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E++ VLD Q++LRRF+FD + K S G DP CLDL+ PV     AF+ A+++SA R    
Sbjct  171   AESQRVLDMQEILRRFAFDTVSKVSLGSDPFCLDLTRPVPPLVKAFECAAEISARRGTAP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGARDQS-DLLSRFMGI  810
                +WK+KR L+IGSEKKL EA+ +++    E+I+ K+K     G R +S D+LSR +  
Sbjct  231   LYLMWKMKRALSIGSEKKLKEAVRVVHGSVHEIIQNKKKVFERDGERSESHDMLSRLLLA  290

Query  809   IDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRI--RAESGRIMEPDQDLA  636
                ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP++T +I    E+  I     +  
Sbjct  291   GHSEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHKIANEVENVVIQRNGTEKL  350

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
              +  ++ M +L A + ES+RL+PPV +DSK    D  LPDGT+V KG RVTY PY MGRM
Sbjct  351   GFDDLQKMRFLRACLCESLRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYGMGRM  410

Query  455   DSIWGADCREFKPERWLE-------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             + +WG D  EF P+RW +       D V KS + YK+PVFQAGPRVCLGK+MA ++MK V
Sbjct  411   EELWGKDRFEFNPDRWFDIEPGCDGDKVLKSVSPYKFPVFQAGPRVCLGKEMAFIQMKYV  470

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
               +++R F+I  VC   Q P + P LTA + GGL V +  R
Sbjct  471   MASVLRRFEIRPVCGEDQ-PAFVPLLTAHMAGGLKVLVRKR  510



>ref|XP_002988642.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ10438.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=491

 Score =   424 bits (1091),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 215/436 (49%), Positives = 290/436 (67%), Gaps = 9/436 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV--ITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             +W +  +  SP+ T      G+   IT NPA VE++L T FEN+PKG+     L DLLG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF VDG+LWK QRK+AS EF + S+R +  + +A EV +RL P L     + + +D QD
Sbjct  114   GIFNVDGELWKIQRKLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +  RF+FDNICK SFG+DP CLD S P  KFA AFD A+ LS  R     P VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIID---DDKLLRDIVI  774
             N+G E++L E + ++NE A  +++++R+  G  +Q DLLSRF+G+      D+ LRDI+I
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRREEKGRVNQ-DLLSRFIGLDSTSFSDEFLRDIII  292

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-TYQQIRDMNYLTA  597
             SF+LAG+DT A +L+ FFWLLS HP V   I  E G I+    +   TY+++RDM YL A
Sbjct  293   SFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSNRPFTYKELRDMVYLQA  352

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
             A+ ESMRL+PPV  D+K   N D LPDG  V KG +V+YH YAMGRM+S+WG DC EFKP
Sbjct  353   ALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFKP  412

Query  416   ERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMP  237
             ERW++DG F   + +K+PVFQAGPRVCLGK+MA+++MK V  AL+  F++ VV   ++ P
Sbjct  413   ERWIQDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVV--GKEEP  470

Query  236   RYAPGLTATVRGGLSV  189
              Y   +T  ++ GL V
Sbjct  471   CYGINMTLIMKDGLPV  486



>emb|CDP06233.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   425 bits (1092),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 212/450 (47%), Positives = 299/450 (66%), Gaps = 8/450 (2%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLG--NVITANPANVEYMLTTKFENFPKGKQFASI  1326
             +      DW + +L+K PT T      G   + TANP  VE+ML  KFEN+PKG +F  +
Sbjct  50    LNRHQFLDWSTEILSKCPTHTAVFRRPGVRGITTANPRVVEHMLKAKFENYPKGPRFIGL  109

Query  1325  LGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENR  1146
             L D LG+GIF  DG+LWK QRK AS EF + S+R++  E V  EV+TRL PL E   +  
Sbjct  110   LEDFLGKGIFNSDGELWKVQRKTASYEFNTKSLRNFVIENVRVEVQTRLIPLFEDAAKVD  169

Query  1145  EVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSK-FAAAFDLASKLSAERAVTASPA  969
              VLD QDVL RF+FDNIC+ +F +DPGCL       + F  AF+ A+ LS+ R + A PA
Sbjct  170   RVLDLQDVLERFAFDNICELAFNVDPGCLGGDATSGREFMEAFEDAATLSSGRFMYAIPA  229

Query  968   VWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KL  792
              +  K+  NIGSEK+L ++I  ++E A+++I+ + + G  R   DLLSRF+G  ++  + 
Sbjct  230   FYLFKKFFNIGSEKRLKQSIDTVHEFADKIIKSRLEEGVERKDEDLLSRFIGNSENSAEF  289

Query  791   LRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE----SGRIMEPDQDLATYQQ  624
             LRDI+ISF+LAGRDT +SAL+ FFWLLS  P +  +I  E      R  +   D   + +
Sbjct  290   LRDIIISFILAGRDTTSSALSWFFWLLSTRPIIERKILQELDLIRNRSHKKIGDAYDFDE  349

Query  623   IRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIW  444
             +R+M+YL AA+ E+MRL+PPV  D++ CL DD LP+GTF+ K   ++YH YAMGRM+SIW
Sbjct  350   LREMHYLHAALSETMRLYPPVPIDTRACLGDDVLPEGTFIAKSWFISYHTYAMGRMESIW  409

Query  443   GADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIE  264
             G DC +FKPERWLE+G++K EN +K+P+F AGPR+C+GKDMA ++MKS+A  ++  F I+
Sbjct  410   GKDCYDFKPERWLENGIYKQENPFKFPIFHAGPRMCIGKDMAYIQMKSIAACVLERFGID  469

Query  263   VVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V +  + P     LT  ++GGLSV++ +R
Sbjct  470   AVLKDGKCPEPLLSLTLRMKGGLSVKVKER  499



>ref|XP_009763713.1| PREDICTED: cytochrome P450 94A1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009763715.1| PREDICTED: cytochrome P450 94A1-like isoform X2 [Nicotiana sylvestris]
 gb|AAL54887.1|AF092916_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=511

 Score =   425 bits (1092),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 292/453 (64%), Gaps = 16/453 (4%)
 Frame = -1

Query  1493  HSNLCDWYSCLLNKSPTGT---IHVHVLGNVITANPANVEYMLTTKFENFPKGKQFASIL  1323
             H     W S ++  +P  T   I       + TANP+NV+++L T F+ + KG    S L
Sbjct  61    HDRRIKWISDIILTTPNLTFTLIRPLNFRTIFTANPSNVQHVLKTNFQVYQKGHGSYSTL  120

Query  1322  GDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENRE  1143
              D L  GIF VDGD+WK+QR++AS EF + S+R +   +V  E+  RL P+L     N+ 
Sbjct  121   KDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTELSERLIPILATAAANKT  180

Query  1142  VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVW  963
             VLDFQD+L+RF+FDNICK +FG DPG L  SLP ++FA AF+ A +LS ER +     +W
Sbjct  181   VLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAVAFEDAVRLSTERFIVPFSLIW  240

Query  962   KVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK---CGGARDQSDLLSRFMGI-IDDDK  795
             K+KR LNIGSEKKL  A+  + E A+E++ +K+K      + D +DLLSRF+     D+ 
Sbjct  241   KIKRALNIGSEKKLRVAVEQVREFAKEIVREKQKELNDKSSLDSADLLSRFLSTGHSDED  300

Query  794   LLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRD  615
              + DIVISF+LAGRDT ++ALT FFWL+S+HPEV  +I  E G   E  + L  Y ++++
Sbjct  301   FVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQIMKEVG---EKSESLLLYDEVKN  357

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M Y  A++ ESMR +PPV  DSK    DD LPDGTFV+KGTRVTYHPYAMGR++ +WG D
Sbjct  358   MMYTHASLCESMRFYPPVPMDSKEATKDDILPDGTFVKKGTRVTYHPYAMGRVEKVWGED  417

Query  434   CREFKPERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAF  273
               EFKPERWL+      +  F  ++ Y YPVFQAGPR+CLGK+MA ++MK V   ++R F
Sbjct  418   WAEFKPERWLDKDEVTGNWTFVPKDAYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLRRF  477

Query  272   DIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              +  V E    P +   LTA ++GG  V I +R
Sbjct  478   KVVPVVEQGVEPVFISYLTAKMKGGFPVTIEER  510



>ref|XP_008443231.1| PREDICTED: cytochrome P450 94A1-like [Cucumis melo]
Length=511

 Score =   425 bits (1092),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 215/454 (47%), Positives = 301/454 (66%), Gaps = 13/454 (3%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFAS  1329
             +      DW + +L    T T      G V   ITANP  VE++L T+FEN+PKG++F S
Sbjct  53    LNRHRFLDWSTEVLRNCRTNTAVFKRPGKVHGVITANPLVVEHILKTQFENYPKGERFIS  112

Query  1328  ILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGEN  1149
             +L D LGRGIF  DG++WK QRK AS EF + S+R++  E V  E+++RL P+     E 
Sbjct  113   LLEDFLGRGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVRVEIQSRLLPIFGKACET  172

Query  1148  REVLDFQDVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASP  972
               +LD QDVL RF+FDN+CK +F  DP CL       ++F  AF+ A+ LS+ R + A P
Sbjct  173   ERILDLQDVLERFAFDNVCKLAFNYDPACLGGDGTAATEFMRAFEHAATLSSGRFMYAFP  232

Query  971   AVWKVKRLLNIGSEKKLGEAIGLINELAEEMIE---QKRKCGGARDQSDLLSRFMGIIDD  801
               +KVK+  NIGSEK L E+I ++++ AE++I    +++K     +  DLLSRFMG  ++
Sbjct  233   GSYKVKKFFNIGSEKTLKESIAVVHKFAEDIIHSRLEEKKTTQIENDQDLLSRFMGDQNN  292

Query  800   D-KLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLA  636
               + LRDI+ISF+LAGRDT +SALT FFW+LS  P+V  +I AE   I         ++ 
Sbjct  293   SPQFLRDIIISFILAGRDTTSSALTWFFWILSSRPDVEQKILAELETIRTKAHKEIGEMY  352

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
             ++ ++RDM+YL AA+ E++RL+PPV  D+K C NDD LPDGTF+ K   VTYH YAMGRM
Sbjct  353   SFDELRDMHYLQAALSETLRLYPPVPVDTKACRNDDVLPDGTFIGKSWFVTYHTYAMGRM  412

Query  455   DSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
             +SIWG D  EF PERWLE+GV K+E+ +++P+F AGPR+CLGKDMA ++MKS+A A+I  
Sbjct  413   ESIWGKDYGEFSPERWLENGVCKTESPFRFPIFHAGPRMCLGKDMAYIQMKSIAAAVIEK  472

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             F++E+V E ++ P++   LT  +  GL V I  R
Sbjct  473   FEVEMV-EKKKSPKHLLSLTLRMENGLQVMIKRR  505



>gb|KCW83159.1| hypothetical protein EUGRSUZ_B00114, partial [Eucalyptus grandis]
Length=508

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 301/459 (66%), Gaps = 21/459 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S+L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYRNRSHLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPDNVEHVLRANFHNYPKGVP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGDLLG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVENRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQD-  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++    + I +E   I++   + 
Sbjct  291   LAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYNK  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+P V +DSK    DD LPDGT VRKG RVTY PY MG
Sbjct  351   CLDFEALKEMKFLKACLCESMRLYPSVAWDSKHAAVDDVLPDGTPVRKGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             RM+ +WG D  EFKP+RWL         +G  ++ + YK+PVFQAGPRVCLGK+MA ++M
Sbjct  411   RMEELWGKDRLEFKPDRWLVGPGMEGGAEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSV  189
             K V  +++R F+I  V E+R  P + P LTA + GGL V
Sbjct  471   KYVVASILRRFEIRPVLENR--PVFVPLLTAHMAGGLKV  507



>gb|ADO24345.1| cytochrome P450 A [Capsicum annuum]
Length=497

 Score =   424 bits (1090),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 221/445 (50%), Positives = 293/445 (66%), Gaps = 11/445 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V   G    +ITANP NVE+ML T F N+PKG+ F  ILGD 
Sbjct  54    LLDWYTQLLSESPTQTILVQRFGAPRTIITANPNNVEHMLKTNFTNYPKGQPFTEILGDF  113

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LGRGIF VDG+ W  QRK+AS EF + S+R +  + +   V TRL PLL    ++ +VLD
Sbjct  114   LGRGIFNVDGEQWSAQRKLASHEFSTKSLREFVVKTLEEVVDTRLIPLLNHAAKSGKVLD  173

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLD    V     +FD AS+  A R +    A+WK K
Sbjct  174   LQDVLRRFAFDTICKVSLGTDPHCLDDLSDVPSLVDSFDTASQAGAMRGMAPVYAIWKGK  233

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFMGIIDDDKLLR  786
             R LN+ SEKKL E +  ++    ++IE+K++     G      DLLSR +    +D+++R
Sbjct  234   RALNLRSEKKLKENVKRVHCCINDIIEKKKQTINENGKNSKNMDLLSRLLIAGHEDEVVR  293

Query  785   DIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNY  606
             D+VISFL+AGRDT +SALT  FWL + HP+V + +  E   I   D+ L  + + ++M Y
Sbjct  294   DMVISFLMAGRDTTSSALTWLFWLTTNHPDVKNEMINEITSINIGDKALE-FDESKEMKY  352

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY  Y MGRM+ IWG D  E
Sbjct  353   LQACLNESMRLYPPVAWDSKHAATDDILPDGTRVQKGNRVTYFQYGMGRMEEIWGKDRLE  412

Query  425   FKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCES  249
             FKP+RW+ E+G+ KS + YK+PVFQAGPRVCLGK+MA ++MK V  +++R F+I+ V   
Sbjct  413   FKPDRWIDENGLLKSVSAYKFPVFQAGPRVCLGKEMAFMQMKYVLASVLRRFEIKPV--K  470

Query  248   RQMPRYAPGLTATVRGGLSVRITDR  174
              + P + P LTA + GG +VRI  R
Sbjct  471   VEKPVFMPLLTAHMAGGFNVRICHR  495



>ref|XP_009149812.1| PREDICTED: cytochrome P450 94B3 [Brassica rapa]
 emb|CDY08079.1| BnaA06g16470D [Brassica napus]
Length=506

 Score =   424 bits (1091),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 301/461 (65%), Gaps = 20/461 (4%)
 Frame = -1

Query  1514  TSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKG  1344
             T S+      L  WY+ LL  SP+ TI + +LG+   ++TANP NVEY+L T F NFPKG
Sbjct  46    TLSFNKNRHRLLQWYTELLRLSPSQTISIPLLGSRRTIVTANPENVEYILKTNFFNFPKG  105

Query  1343  KQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLE  1164
             K F  +LGDLLG+GIF VDG  W  QRK+AS EF + S+RS++FE++  EV  RL P L 
Sbjct  106   KPFTDLLGDLLGKGIFNVDGHAWSSQRKLASHEFSARSLRSFSFEVLKEEVENRLVPGLS  165

Query  1163  FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAV  984
                +    +D QDVL+RF+FD +CK S G DP CLDL+ PV+  A AFD A+++SA RA 
Sbjct  166   AAADAGTTVDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTATEISARRAT  225

Query  983   TASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFM  816
                 AVWKVKR LN+GSE++L EAI  ++ L  E++  K+K      G   + DLLSRF+
Sbjct  226   EPVYAVWKVKRALNVGSERRLREAIRTVHVLVSEIVRAKKKSLEIGTGEEAKQDLLSRFL  285

Query  815   GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA  636
                 D + +RD+VISF++AGRDT ++A+T  FWLLS +  V  ++  E    ++P   L 
Sbjct  286   AAGHDGESVRDMVISFIMAGRDTTSAAMTWLFWLLSENGNVERKLLEE----VDPLISLG  341

Query  635   T-YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGR  459
               ++++++M+Y  A + E+MRL+PPV +DSK   NDD LPDGT V+KG +VTY PY MGR
Sbjct  342   LGFEELKEMSYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGR  401

Query  458   MDSIWGADCREFKPERWLED------GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             M+++WG D  EFKP RW +        V K  + +K+PVFQAGPRVC+GK+MA ++MK V
Sbjct  402   MENLWGKDWDEFKPSRWFDSEPGSTRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYV  461

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
                ++  F  E+V  ++  P + P LTA + GGL V+I  R
Sbjct  462   VGYVLSRF--EIVTVNKDKPAFVPLLTAHMAGGLKVKIKRR  500



>emb|CDY59153.1| BnaC08g48490D [Brassica napus]
Length=506

 Score =   424 bits (1090),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 302/461 (66%), Gaps = 20/461 (4%)
 Frame = -1

Query  1514  TSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKG  1344
             T S+      L  WY+ LL  SP+ TI + +LGN   ++TANP NVEY+L T F NFPKG
Sbjct  46    TLSFNKNRRRLLQWYTELLRLSPSQTISIPLLGNRRTIVTANPENVEYILKTNFFNFPKG  105

Query  1343  KQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLE  1164
             K F  +LGDLLG+GIF VDG  W  QRK+AS  F + S+RS++FE++  EV  RL P+L 
Sbjct  106   KPFTDLLGDLLGKGIFNVDGHAWSSQRKLASHVFSARSLRSFSFEVLKEEVENRLVPVLL  165

Query  1163  FYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAV  984
                +    +D QDVL+RF+FD +CK S G DP CLDL+ PV+  A AFD A+++SA RA 
Sbjct  166   AAADAGMAVDLQDVLKRFAFDVVCKVSLGWDPDCLDLTRPVNPLAEAFDTAAEISARRAT  225

Query  983   TASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQSDLLSRFM  816
                 AVWKVKR LN+GSE++L EAI  ++ L  E++  K+K      G   + DLLSRF+
Sbjct  226   EPVYAVWKVKRALNVGSERRLREAIRTVHVLVSEIVRAKKKSLEIGTGEEAKQDLLSRFL  285

Query  815   GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA  636
                 D + +RD+VISF++AGRDT ++A+T  FWLLS + +V  ++  E    ++P   L 
Sbjct  286   AAGHDGESVRDMVISFIMAGRDTTSAAMTWLFWLLSENGDVERKLLEE----VDPLISLG  341

Query  635   T-YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGR  459
               ++++++M+Y  A + E+MRL+PPV +DSK   NDD LPDGT V+KG +VTY PY MGR
Sbjct  342   LGFEELKEMSYTKACLCEAMRLYPPVSWDSKHAANDDVLPDGTRVKKGDKVTYFPYGMGR  401

Query  458   MDSIWGADCREFKPERWLEDG------VFKSENLYKYPVFQAGPRVCLGKDMALVEMKSV  297
             M+++WG D  EFKP RW +        V K  + +K+PVFQAGPRVC+GK+MA ++MK V
Sbjct  402   MENLWGKDWDEFKPSRWFDSKPGSTRPVLKPVSPFKFPVFQAGPRVCVGKEMAFMQMKYV  461

Query  296   AVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
                ++  F  E+V  ++  P + P LTA + GGL V+I  R
Sbjct  462   VGYVLSRF--EIVTVNKHKPAFVPLLTAHMAGGLKVKIKRR  500



>ref|XP_002964775.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
 gb|EFJ33613.1| medium chain fatty acid hydroxylase [Selaginella moellendorffii]
Length=490

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 290/436 (67%), Gaps = 10/436 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV--ITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             +W +  +  SP+ T      G+   IT NPA VE++L T FEN+PKG+     L DLLG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF VDG+LWK QR++AS EF + S+R +  + +A EV +RL P L     + + +D QD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +  RF+FDNICK SFG+DP CLD S P  KFA AFD A+ LS  R     P VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIID---DDKLLRDIVI  774
             N+G E++L E + ++NE A  +++++R+  G  +Q DLLSRF+G+      D+ LRDI+I
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRREEKGRVNQ-DLLSRFIGLDSTSFSDEFLRDIII  292

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-TYQQIRDMNYLTA  597
             SF+LAG+DT A +L+ FFWLLS HP V   I  E G I+    D   TY+++RDM YL A
Sbjct  293   SFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSDRPFTYEELRDMVYLQA  352

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
             A+ ESMRL+PPV  D+K   N D LPDG  V KG +V+YH YAMGRM+S+WG DC EFKP
Sbjct  353   ALCESMRLYPPVPIDTKVVKNSDVLPDGNSVEKGMKVSYHVYAMGRMESLWGKDCLEFKP  412

Query  416   ERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMP  237
             ERW++DG F + + +K+PVFQAGPRVCLGK+MA+++MK V  AL+  F++ V    ++ P
Sbjct  413   ERWIQDGQFVAVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVV---GKEEP  469

Query  236   RYAPGLTATVRGGLSV  189
              Y   +T  ++ GL V
Sbjct  470   CYGINMTLIMKDGLPV  485



>gb|EPS62279.1| hypothetical protein M569_12509, partial [Genlisea aurea]
Length=497

 Score =   424 bits (1089),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 223/454 (49%), Positives = 293/454 (65%), Gaps = 18/454 (4%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVH-VLGN--VITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
                W + ++  +P+ T  +   LG+  +ITA+P NV ++L T F  + KG  F  +LGDL
Sbjct  45    FVQWTAEIVKTTPSNTFTLRRPLGHEILITADPDNVRHILKTNFHVYEKGDLFKDLLGDL  104

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF  DG++WKFQR++AS EF + S+R +    V+AE+  RL PLL+    +  VLD
Sbjct  105   LGNGIFNADGEVWKFQRQIASHEFNTKSLRKFVDTAVSAELSGRLLPLLKNAAADNTVLD  164

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
             FQD+L+RF+FD+ICK +FG DP CL  SLP S FA AFD A + S+ER  T  P VWKVK
Sbjct  165   FQDILQRFAFDSICKIAFGYDPECLAPSLPESAFAVAFDNAVRFSSERFNTFHPGVWKVK  224

Query  953   RLLNIG-SEKKLGEAIGLINELAEEMIEQKRKCGGARDQ-------SDLLSRFMGI-IDD  801
             R LN+G SE++L  A+  I  LA+E+I QK+K     D        SDLLSRF+     D
Sbjct  225   RALNLGESERELKSAVTQIQNLAKEIIRQKKKKKNHLDNNDVDEEDSDLLSRFLSSGHSD  284

Query  800   DKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQI  621
             ++ + DIVISF+LAGRDT ++ALT FFWLLS HP V   I  E     +P+   A Y ++
Sbjct  285   EQFVMDIVISFILAGRDTTSAALTWFFWLLSSHPHVETAILQEINNAKQPESGGA-YDEV  343

Query  620   RDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWG  441
             ++M Y+ A+I E+MRL+PPV FDSK    DD LPDG+ VRK   V YHPYAMGR D IWG
Sbjct  344   KEMLYIHASISEAMRLYPPVPFDSKCATADDVLPDGSIVRKDMVVAYHPYAMGRDDKIWG  403

Query  440   ADCREFKPERWLEDG-----VFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
             +D  EF+PERWLE+       F + + Y +PVFQAGPR+CLGK+MA ++MKSV   ++R 
Sbjct  404   SDWSEFRPERWLENKSADKLTFVNRDAYTFPVFQAGPRICLGKEMAFMQMKSVIAGVVRD  463

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             F I  V E    P Y   LTA ++GG  VRI  R
Sbjct  464   FKIVPVAEEGYEPEYLAFLTAKMKGGFPVRIQTR  497



>ref|XP_002961706.1| hypothetical protein SELMODRAFT_76541 [Selaginella moellendorffii]
 gb|EFJ36966.1| hypothetical protein SELMODRAFT_76541 [Selaginella moellendorffii]
Length=490

 Score =   423 bits (1088),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 214/436 (49%), Positives = 290/436 (67%), Gaps = 10/436 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV--ITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             +W +  +  SP+ T      G+   IT NPA VE++L T FEN+PKG+     L DLLG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF VDG+LWK QR++AS EF + S+R +  + +A EV +RL P L     + + +D QD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +  RF+FDNICK SFG+DP CLD S P  KFA AFD A+ LS  R     P VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPEVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIID---DDKLLRDIVI  774
             N+G E++L E + ++NE A  +++++R+  G  +Q DLLSRF+G+      D+ LRDI+I
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRREEKGRVNQ-DLLSRFIGLDSTSFSDEFLRDIII  292

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-TYQQIRDMNYLTA  597
             SF+LAG+DT A +L+ FFWLLS HP V   I  E G I+    D   TY+++RDM YL A
Sbjct  293   SFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIREVGSIVAKGSDRPFTYEELRDMVYLQA  352

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
             A+ ESMRL+PPV  D+K   N D LPDG  V KG +V+YH YAMGRM+S+WG DC EFKP
Sbjct  353   ALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAMGRMESLWGKDCLEFKP  412

Query  416   ERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMP  237
             ERW++DG F + + +K+PVFQAGPRVCLGK+MA+++MK V  AL+  F++ V    ++ P
Sbjct  413   ERWIQDGQFVAVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVV---GKEEP  469

Query  236   RYAPGLTATVRGGLSV  189
              Y   +T  ++ GL V
Sbjct  470   CYGINMTLIMKDGLPV  485



>ref|XP_006373690.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP51487.1| cytochrome P450 family protein [Populus trichocarpa]
Length=499

 Score =   423 bits (1088),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 210/447 (47%), Positives = 305/447 (68%), Gaps = 17/447 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             +W +  L+  PT T      G V   ITANP NVEY+L T FEN+PKG +F  +LGD LG
Sbjct  58    EWTTETLSHCPTNTAVFPRPGKVHGIITANPLNVEYILKTNFENYPKGNRFIKLLGDFLG  117

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  DG+LW+ QRK AS EF + S+R++  + V  E+ TRL P+L    + ++VLD Q
Sbjct  118   RGIFNSDGELWRVQRKTASYEFNTKSLRNFVMDNVEVEISTRLVPILAKASKTKQVLDLQ  177

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L RF+FDNICK +F +DP CL        +F  AF+ A+ L + R ++     WK+ R
Sbjct  178   DILERFAFDNICKVAFNVDPACLGGDGTSGGEFMRAFEDAATLCSGRFMSVHRVFWKINR  237

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLLRDIVI  774
               N+G+EK L E++ +++E A+EMI  + +    +++ D LSRF+G  ++  + LRDI+I
Sbjct  238   FFNVGTEKTLRESVKIVHEFADEMIRSRMEQKTEKNE-DFLSRFIGKDENSTEFLRDIII  296

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRDT +SAL+ FFWLLS +P+V        + IR+ +G+ +    D  +++++RD
Sbjct  297   SFILAGRDTTSSALSWFFWLLSLNPDVEGNILKELETIRSSNGKNL---GDTYSFEELRD  353

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M+YL AAI E++RL+PPV  D+K C +DD LPDGTFV K   VTYH YAMGRM+SIWG +
Sbjct  354   MHYLQAAISETLRLYPPVPVDTKACQSDDVLPDGTFVGKKWFVTYHAYAMGRMESIWGKN  413

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             CR+F PERWLE+G+++ E+ +K+PVF AGPR+CLGKDMA ++MKS+A ++I  F+I+V  
Sbjct  414   CRDFVPERWLENGIYRQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFEIDVQN  473

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDR  174
             + +  P +   LT  ++GGL V++ +R
Sbjct  474   KEK-CPDHLLSLTLRMKGGLQVKVKER  499



>ref|XP_010929779.1| PREDICTED: cytochrome P450 94B3-like [Elaeis guineensis]
Length=513

 Score =   424 bits (1090),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 223/471 (47%), Positives = 304/471 (65%), Gaps = 16/471 (3%)
 Frame = -1

Query  1559  KLKPLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPAN  1389
             K+ P   C      L S +  +H  L DWY+ LL  SPT TI +  LG   NV+TANP N
Sbjct  48    KMHPFIGC------LISFYKNQH-RLLDWYTELLTASPTQTIVLERLGARRNVVTANPDN  100

Query  1388  VEYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFE  1209
             VEYML T F+N+PKGK F  ILGDLLG GIF  DG+LW  QRK+AS EF + S+R +  +
Sbjct  101   VEYMLKTNFDNYPKGKPFTDILGDLLGCGIFNADGELWHTQRKLASHEFSTRSLREFVVK  160

Query  1208  IVAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFA  1029
              +  E   RL P+L     +R  +D QD+LRRF+FD I K + G DPG LD SLP+S  A
Sbjct  161   TLDNETNHRLLPILSSACADRRTVDMQDLLRRFAFDTIWKVTLGTDPGFLDPSLPMSDLA  220

Query  1028  AAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CG  855
             AAF++AS +SA R      AVWKVKR   +GSE +L  ++ LI+E    +I ++++   G
Sbjct  221   AAFEVASGISARRGAALVSAVWKVKRAFGVGSEGRLRASVKLIHESVMAIIRRRKEEAAG  280

Query  854   GAR-DQSDLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIR  678
               R + SDLLSR +     D+++RD+VISF++AGRDT ++ALT FFWL+S HPE+   + 
Sbjct  281   DKRPESSDLLSRLISGGHSDEVIRDMVISFVMAGRDTTSAALTWFFWLMSCHPEIEREVI  340

Query  677   AESGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRK  498
              E   I +  ++L  YQ++++M +L A + ESMRL+PPV +DSK   ++D LPDGT VR+
Sbjct  341   KEVKNIHK-SRELDRYQELKEMKFLEACLCESMRLYPPVAWDSKHAASNDMLPDGTEVRR  399

Query  497   GTRVTYHPYAMGRMDSIWGADCREFKPERWL--EDGVFKSENLYKYPVFQAGPRVCLGKD  324
             G RVTY PY MGRM+ +WG + +EF+P RW+  E       + YK+ VFQ GPRVCLGK+
Sbjct  400   GDRVTYFPYGMGRMERLWGKEWKEFEPRRWMAAEGREVARVSAYKFAVFQGGPRVCLGKE  459

Query  323   MALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRR  171
             MA V+MK VA A++R F++      R+ P   P +TA + GGL + +  RR
Sbjct  460   MAFVQMKYVAAAVLRRFELRRAGGERRPPVLVPLMTAHMAGGLKMVVGGRR  510



>ref|XP_010679201.1| PREDICTED: cytochrome P450 94A1-like [Beta vulgaris subsp. vulgaris]
Length=524

 Score =   424 bits (1090),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 227/493 (46%), Positives = 313/493 (63%), Gaps = 28/493 (6%)
 Frame = -1

Query  1568  SVSKLKPLCKC---EICKAYLTSSW---TMEHSN-LCDWYSCLLNKSPTGTIHVH-VLG-  1416
             S S+ K  C+    E  KAY         ++H N    W + L++ SPT T  +H +LG 
Sbjct  28    SSSQTKRTCQSTSFEFPKAYPLIGHLLAVLKHKNERLRWLTSLVHNSPTFTFVIHRLLGQ  87

Query  1415  -NVITANPANVEYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFG  1239
              +++T NPANV+++L T+F  + KG  F +IL DLLG GIF VDG++WKFQR++AS EF 
Sbjct  88    KSILTGNPANVQHILKTQFPLYEKGPLFKTILQDLLGDGIFNVDGEMWKFQRQIASHEFS  147

Query  1238  SVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCL  1059
             + S+R++   +V  E+  RL P+L    +N+ VLD QD+L+RF+FDNICK +FG DP  L
Sbjct  148   TKSLRNFVETVVDTELSDRLIPILSDAAKNKTVLDLQDILQRFAFDNICKIAFGYDPEYL  207

Query  1058  DLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEM  879
               SLP SKFAAAF+ A  +S +R  T  P +WK++R LNIGSEKKL EA+  I   A+ +
Sbjct  208   SPSLPHSKFAAAFEDAVMISTQRFRTFFPIIWKIRRFLNIGSEKKLKEAVSEIRNFAKSL  267

Query  878   IEQKRKCG-------GARDQSDLLSRFMGI-IDDDKLLRDIVISFLLAGRDTIASALTSF  723
             + QK++          + +  DLLSRF+     D+  + DIVISF+LAGRD+ +SALT F
Sbjct  268   VSQKKQGMLKNLEGFHSSESEDLLSRFLKSGHSDENFVTDIVISFILAGRDSTSSALTWF  327

Query  722   FWLLSRHPEVTDRIRAE----SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQF  555
             +WLL ++  V + I  E     G+     +  +  ++++DM Y+ AA++ESMRL+PPV  
Sbjct  328   YWLLYKNKHVEEEIIQEINKNRGKQSNKTEHSSVLEEVKDMVYIHAALYESMRLYPPVPI  387

Query  554   DSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGV------  393
             D+K    +D LPDGT V KG+ VTYHPYAMGRM SIWG D  E++PERWLE G       
Sbjct  388   DTKQANANDVLPDGTRVEKGSWVTYHPYAMGRMKSIWGIDWAEYRPERWLEVGTGEVKWK  447

Query  392   FKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTA  213
             F  ++ Y YPVFQAGPRVCLGKDMA ++MK V   ++  F +  V +    P Y P LTA
Sbjct  448   FVPKDPYSYPVFQAGPRVCLGKDMAFLQMKRVVAGILERFRVVPVVDDGFEPVYIPNLTA  507

Query  212   TVRGGLSVRITDR  174
              ++GGL VR  +R
Sbjct  508   KMQGGLQVRFEER  520



>ref|XP_006364779.1| PREDICTED: cytochrome P450 94A2-like [Solanum tuberosum]
Length=497

 Score =   423 bits (1087),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 211/452 (47%), Positives = 301/452 (67%), Gaps = 12/452 (3%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFAS  1329
             +      +W + +L+   T T   +  GNV   +TANP NVE+ML   FENFPKG +F +
Sbjct  46    LNRHRFLEWTTDVLSNCVTNTAVFYRPGNVHGVMTANPLNVEHMLKANFENFPKGFRFYT  105

Query  1328  ILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGEN  1149
              L D LG GIF VDG++WK QRK AS EF + S+R++  E    E+ TRL P+LE   + 
Sbjct  106   RLQDFLGDGIFNVDGEIWKIQRKSASYEFSTRSLRNFVMETAQVEIHTRLIPILEEATKK  165

Query  1148  REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPA  969
               ++D QD+L RF+FDNI K +F +DP CL  +   S+F  AFD+A+ LS+ R + A P 
Sbjct  166   DRIIDIQDILERFAFDNIIKLAFNVDPNCLGGA--ESEFMQAFDIATTLSSGRFMYAIPF  223

Query  968   VWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDD--DK  795
             ++K+K+  NIGSEKKL ++I +++E A+ +I  + +    +   DLLSRFMG  +    K
Sbjct  224   LYKIKKTFNIGSEKKLQKSIKIVHEFADNIINSRIEERAEKKDEDLLSRFMGDSNQVSAK  283

Query  794   LLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD----QDLATYQ  627
              LRDIVISF+LAGRDT +SALT FFW+LS   ++  +I  E  +I + +     +  T+ 
Sbjct  284   FLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEQKILEELVQIRQRNGKKIGEAYTFD  343

Query  626   QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSI  447
             ++R+M YL AAI ESMRL+PPV  D++ CL DD LPDGTF+ K   ++Y  Y+MGRM++I
Sbjct  344   ELREMQYLHAAISESMRLYPPVPIDTRSCLKDDILPDGTFIGKDWFISYQTYSMGRMENI  403

Query  446   WGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFD  270
             WG DC E+KPERW  E+GV+K EN +K+PVF AGPR+CLGKDMA ++MKS+A +++  F+
Sbjct  404   WGKDCCEYKPERWFDENGVYKQENPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVLEMFE  463

Query  269   IEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              +V  E+ + P Y   LT  ++GGL V++ +R
Sbjct  464   FDVQLENGKCPEYVLSLTLRMKGGLPVKVKER  495



>ref|XP_006351475.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum]
Length=495

 Score =   422 bits (1086),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 293/447 (66%), Gaps = 12/447 (3%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V   G    +ITANP NVEYML T F N+PKGK F  ILGD 
Sbjct  49    LLDWYTQLLSESPTQTILVQRFGAPRTIITANPDNVEYMLKTNFINYPKGKPFTDILGDF  108

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+LW  QRK+AS EF + S+R +  + +   V TRL PLL    ++ +VL+
Sbjct  109   LGGGIFNVDGELWSAQRKLASHEFSTNSLREFVVKTLEEVVETRLVPLLIQAAKSGKVLN  168

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLD    V     +FD AS+  A R +    A+WK K
Sbjct  169   LQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPVLVDSFDTASQACAMRGMAPVYAIWKSK  228

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKR------KCGGARDQSDLLSRFMGIIDDDKL  792
             R LN+GSEKKL E +  ++   +E+IE+K+      + G     +DLLSR +    ++++
Sbjct  229   RALNLGSEKKLKENVKRVHCCIDEIIEEKKLKNIATENGDHMKNTDLLSRLLIAGYENEV  288

Query  791   LRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDM  612
             +RD+VISFL+AGRDT +SALT  FWL + H +V D +  E   I   D+ L  + ++++M
Sbjct  289   VRDMVISFLMAGRDTTSSALTWLFWLTTNHRDVKDEMIKEITSINNGDKSL-DFDELKEM  347

Query  611   NYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADC  432
              YL A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY  Y MGRM+ IWG D 
Sbjct  348   KYLAACLNESMRLYPPVVWDSKHAAKDDILPDGTRVQKGNRVTYFQYGMGRMEEIWGKDR  407

Query  431   REFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
              EFKP+RW+ E+G  K  + YKYPVFQAGPRVCLGK+MA  +MK V  +++R F+I+ V 
Sbjct  408   LEFKPDRWIDENGALKIVSPYKYPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVV  467

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDR  174
                + P + P LTA + GG +VRI  R
Sbjct  468   NVEK-PVFVPLLTAHMAGGFNVRIYHR  493



>gb|KCW83161.1| hypothetical protein EUGRSUZ_B00116 [Eucalyptus grandis]
Length=511

 Score =   423 bits (1087),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 299/457 (65%), Gaps = 21/457 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTRTIVIHRLGACRTVVTANPENVEHVLKNNFHNYPKGVP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGD LG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFLVRTLEAEVENRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRALNIGSEKKLAEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQD-  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++    + I +E   I++   + 
Sbjct  291   LAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEEEIVSEVDSILDRSYNK  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+PPV +DSK    DD LPDGT VR+G RVTY PY MG
Sbjct  351   CLDFEALKEMKFLKACLCESMRLYPPVAWDSKHAAVDDVLPDGTAVRRGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             R++ +WG D  EFKP+RWL         +G  ++ + Y+YPVFQAGPRVCLGK+MA ++M
Sbjct  411   RLEELWGKDRLEFKPDRWLVEPGVEGGAEGELRAVSPYEYPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGL  195
             K V  +++R F+I  V E+R  P + P LTA + GGL
Sbjct  471   KYVVASILRRFEIRPVLENR--PVFVPLLTAHMAGGL  505



>gb|EYU43048.1| hypothetical protein MIMGU_mgv1a026913mg, partial [Erythranthe 
guttata]
Length=462

 Score =   421 bits (1082),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 295/457 (65%), Gaps = 11/457 (2%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L  WY+ LL++S T TI VH L     ++TANP NVEY+L T+F NFPKGK 
Sbjct  7     SFYKNRRRLLSWYTDLLSESATQTIVVHRLWAPRTIVTANPDNVEYILKTRFSNFPKGKP  66

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  +LGD LG GIF VDG  W  QRK+AS EF + S+R +  +++  EV  RL P+LE  
Sbjct  67    FTELLGDFLGVGIFNVDGGQWSVQRKLASHEFSAKSLREFVVKVLEDEVSKRLIPILENA  126

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              EN  VLD Q+VLRRF+FD IC  S G+DP CLD S      AAAFD AS++SA R    
Sbjct  127   AENGGVLDMQEVLRRFAFDTICHVSLGIDPCCLDFSRAPPPLAAAFDAASEISAMRGAAP  186

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK-----CGGARDQSDLLSRFMG  813
               AVW++KR LN+GSE++L EA+ L+    +EMI ++ K      GG+    DLLSRF+G
Sbjct  187   VSAVWRLKRALNLGSERELKEAVKLVRGCVDEMISERIKNGGGGGGGSGGGGDLLSRFLG  246

Query  812   IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLAT  633
                +D+++RD+VISFL+AGRDT +SA+T   WLLS H  +  R   E   I +  Q    
Sbjct  247   AGLEDEMVRDMVISFLMAGRDTTSSAVTWLLWLLSGHRGIEKRAVEEIASIGDTTQRQLG  306

Query  632   YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMD  453
             +  +++MN++ A + ESMRL+PPV +DSK    DD LPDGT V +G RVTY  Y MGRM+
Sbjct  307   FDDLKEMNFIQACLCESMRLYPPVVWDSKHAAEDDVLPDGTPVSRGDRVTYFQYGMGRME  366

Query  452   SIWGADCREFKPERWLE-DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
              +WG D  EF+P+RWL+  G  K  + YKYPVFQAGPRVCLGK+MA ++MK V  +++  
Sbjct  367   ELWGPDRLEFRPDRWLDRAGSVKKVSPYKYPVFQAGPRVCLGKEMAFIQMKYVVASVLSR  426

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDRRPQ  165
             F  E+V    + P + P LTA + GG +VR+  RR Q
Sbjct  427   F--ELVPVRPETPAFVPLLTAYMAGGFNVRVRRRRGQ  461



>ref|XP_006430501.1| hypothetical protein CICLE_v10011533mg [Citrus clementina]
 gb|ESR43741.1| hypothetical protein CICLE_v10011533mg [Citrus clementina]
Length=504

 Score =   422 bits (1086),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 298/449 (66%), Gaps = 16/449 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW +  L   PTGT   +  G    VITANPANVE++L T FEN+PKG++F ++L D LG
Sbjct  56    DWSTETLKHCPTGTAIFYRPGKIHGVITANPANVEHILKTNFENYPKGQRFVTLLEDFLG  115

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  DG+LWK QRK AS EF + S+R++  + V  E  +RL P+L         LD Q
Sbjct  116   RGIFNSDGELWKVQRKTASYEFNTKSLRNFVMDSVRFETLSRLVPILTKASRTGLALDLQ  175

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPV-SKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L R++FDNICK +F  DPGCL       S+F  AF+ A+ LS+ R   A   +W VK+
Sbjct  176   DILERYAFDNICKVAFNFDPGCLGGDGTAGSEFMRAFEDAATLSSGRFRYAFRRMWSVKK  235

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGI-IDDDKLLRDIVI  774
               +IGSE+KL  +I +++E A  +I  + +      + DLLSRF+G   +  + LRDIVI
Sbjct  236   FFDIGSERKLKNSIAIVHEFANNIIRSRMEEKTENMEDDLLSRFIGNGKNSTEFLRDIVI  295

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRDT +SAL+ FFWLL+ HP+V        + IRA +GR +       +++++RD
Sbjct  296   SFILAGRDTTSSALSWFFWLLASHPKVEQNILKELESIRARNGRSVGATY---SFEELRD  352

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M+YL AA+ E++RL+PPV  DSK C NDD LPDGTFV K   VTYH YAMGRM+SIWG +
Sbjct  353   MHYLHAALSETLRLYPPVPVDSKACRNDDVLPDGTFVGKDWFVTYHAYAMGRMESIWGEN  412

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             C E+ PERWLEDG+++SEN++++PVF AGPR+CLGKDMA ++MKS+A ++I  F ++V  
Sbjct  413   CNEYLPERWLEDGIYRSENVFRFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFAVDVQH  472

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDRRP  168
             +    P     LT  ++ GL VR+ +R P
Sbjct  473   KD-TCPEKVLSLTLRIKDGLHVRVRERCP  500



>ref|XP_008346695.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
 ref|XP_008346696.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
Length=513

 Score =   422 bits (1086),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 222/463 (48%), Positives = 299/463 (65%), Gaps = 19/463 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQ  1338
             S+     NL DWY+ LL+ SP+ TI VH +G    V+TANP+NVE++L T F NFPKGK 
Sbjct  51    SFCKNQHNLLDWYTSLLSASPSQTIVVHRIGARRIVVTANPSNVEHILKTNFTNFPKGKP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
                 LGDLLG GIF VDGDLW  QRK+AS EF + S+R +  + +  EV  RL PLLE  
Sbjct  111   LTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEGRLIPLLEEV  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E++ VLD Q++L+ F+FD +CK S G DP CLDLS PV     AFD A+++SA RA   
Sbjct  171   AESQRVLDMQEILKMFAFDTVCKVSLGTDPFCLDLSRPVPPLVKAFDCAAEISARRATAP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC-----GGARDQSDLLSRFMG  813
                +WK+KR L+IGSEKKL EA+ L++    E+I+ KRK      G   +  D+LSR + 
Sbjct  231   LYLMWKMKRALSIGSEKKLREAVNLVHGSVHEIIQNKRKILERDEGERIESHDILSRLLL  290

Query  812   IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRI--RAESGRIMEPDQDL  639
                 ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP++T +I    E+  +     + 
Sbjct  291   AGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHKIVNEVENVVVQNNGTEK  350

Query  638   ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGR  459
               +  ++ M +L A++ E+MRL+PPV +DSK    D  LPDGT+V KG RVTY PY MGR
Sbjct  351   LGFDDLQKMRFLRASLCETMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYGMGR  410

Query  458   MDSIWGADCREFKPERWLE-----DG---VFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
             M  +WG D  EF P+RW +     DG   V K  + YK+PVFQAGPRVCLGK+MA ++MK
Sbjct  411   MKELWGKDRFEFNPDRWFDIEPGCDGDNKVLKFVSPYKFPVFQAGPRVCLGKEMAFIQMK  470

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V  +++R F+I  VC     P + P LTA + GGL V +  R
Sbjct  471   YVMASVLRRFEIRPVC-GEDRPVFVPLLTAHMAGGLKVLVRKR  512



>ref|XP_007134770.1| hypothetical protein PHAVU_010G074400g [Phaseolus vulgaris]
 gb|ESW06764.1| hypothetical protein PHAVU_010G074400g [Phaseolus vulgaris]
Length=498

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 294/456 (64%), Gaps = 14/456 (3%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L DWY+  + +SPT TI V  LG    V+TANP NVEY+L   F NFPKGK 
Sbjct  43    SFYQNRHRLLDWYTEHIAQSPTHTIVVQRLGARRTVVTANPYNVEYILKANFGNFPKGKP  102

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  ILGDLLG GIF VDG+LW+ QRK+AS EF + S++ +  + +  EV+ RL PLLE  
Sbjct  103   FTEILGDLLGCGIFNVDGELWQAQRKLASHEFSTRSLKDFIVKTLKEEVQHRLIPLLEQA  162

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
                  V+D QDVLRR +FD +CK S G DP CLDL+ P+     AFD AS++SA R  + 
Sbjct  163   SRENHVIDLQDVLRRLTFDTVCKVSLGYDPCCLDLNKPLPPLLTAFDTASEVSAARGASP  222

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFMGII  807
                VWKVKR+LN+GSEK L EA+ L++E   ++++ K+      G +  +DLL R +   
Sbjct  223   VFLVWKVKRMLNVGSEKALKEAVKLVHESVMKIVKAKKDEITSNGGKGGTDLLVRLLEAG  282

Query  806   DDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQ  627
              ++ ++RD+VIS ++AGRDT ++A+T  FWLLS+H  V + +  +     +   +   Y+
Sbjct  283   QEETVVRDMVISMIMAGRDTTSAAMTWLFWLLSKH-GVEEALLVKEVYCAKERSEGLDYE  341

Query  626   QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSI  447
              +++M  L A + ESMRL+PPV +DSK     D LPDGT VRKG RVTY PY MGRM+ +
Sbjct  342   CLKEMKLLKACLCESMRLYPPVAWDSKHAGFADVLPDGTHVRKGDRVTYFPYGMGRMEGL  401

Query  446   WGADCREFKPERWLED-----GVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALI  282
             WG DC EFKP+RW ++     GV K  N YK+PVFQAGPRVCLG++MA ++M+ V  +++
Sbjct  402   WGEDCCEFKPQRWFDEENVDKGVLKCVNPYKFPVFQAGPRVCLGREMAFIQMEYVVASIL  461

Query  281   RAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
               F I  V  S + PR+ P LTA + GG +VRI  R
Sbjct  462   NHFVISPV--SHEHPRFVPLLTAHMAGGFNVRIKLR  495



>ref|XP_011084785.1| PREDICTED: cytochrome P450 94B3-like [Sesamum indicum]
Length=468

 Score =   421 bits (1081),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/409 (51%), Positives = 279/409 (68%), Gaps = 5/409 (1%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++S T TI VH LG    ++TANP NVEY+L T F NFPKGK F  +LGD 
Sbjct  57    LLDWYTELLSQSETQTIVVHRLGAPRTIVTANPDNVEYILKTNFANFPKGKPFTELLGDF  116

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+ W  QRK+AS EF + S+R +  +++  EV +RL P+L+   EN  ++D
Sbjct  117   LGLGIFNVDGEKWSIQRKLASHEFTAKSLREFVVKVLEDEVESRLIPILDDAAENDRIID  176

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              Q+VLRRF+FD ICK S GMDP CLDLS P    AAAFD AS++SA R      AVWK+K
Sbjct  177   MQEVLRRFAFDTICKVSLGMDPLCLDLSRPPPPLAAAFDAASEISAMRGTAPVFAVWKLK  236

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDDKLLRDIVI  774
             R LN+G EK+L EA+ L++   +EMI  K+   G     DLLSRF+    DD+++RD+VI
Sbjct  237   RALNVGLEKELKEAVKLVHGCVDEMIRSKKGTMGGNSGGDLLSRFLESGLDDEMVRDMVI  296

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTAA  594
             SFL+AGRDT +SALT  FWLL+ H  +  ++  E   +    + L  +  ++ +N++ A 
Sbjct  297   SFLMAGRDTTSSALTWLFWLLTGHRGIEKQVVDEITSMKNGGEQLG-FDDLKGLNFIKAC  355

Query  593   IHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPE  414
             + ESMRL+PPV +DSK  + DD LPDGT V +G RVTY  Y MGRM+ +WG D  EF+PE
Sbjct  356   LCESMRLYPPVVWDSKHAVKDDVLPDGTPVYRGNRVTYFQYGMGRMEEVWGKDRLEFRPE  415

Query  413   RWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFD  270
             RWL E G+ K  + YK+ VFQAGPRVCLGK+MA ++MK V  +++R F+
Sbjct  416   RWLDESGMVKMVSPYKFAVFQAGPRVCLGKEMAFIQMKYVVASVLRRFE  464



>ref|XP_011070085.1| PREDICTED: cytochrome P450 94A1 [Sesamum indicum]
Length=504

 Score =   422 bits (1084),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/444 (48%), Positives = 301/444 (68%), Gaps = 9/444 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L+  PT T   H  G V   ITANP  VE+ML + FEN+PKG +F  +L D LG
Sbjct  57    DWSTGVLSGCPTNTAVFHRPGKVHGVITANPQIVEHMLKSNFENYPKGPRFRILLTDFLG  116

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             +GIF  DG+LW+ QRK AS EF + S+R++  E V  E++TRL P+LE       VLD Q
Sbjct  117   KGIFNTDGELWRIQRKTASYEFNTKSLRNFVMENVYVELQTRLIPILESAARTDRVLDVQ  176

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L RF+FDNICK +F +DPGCL       ++F  AF+ A+ LS+ R + A P+++ +K+
Sbjct  177   DILERFAFDNICKVAFNVDPGCLGGDGTAGAEFMQAFEDAATLSSGRFMYALPSLFAIKK  236

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDDD-KLLRDIVI  774
              LN+GSEKKL + I  ++E A+++I  + +    +   DLLSRF+   ++  + LRDIVI
Sbjct  237   FLNLGSEKKLRKYIATVHEFADKIIRTRLEEKAEKKDEDLLSRFIANSENSAEFLRDIVI  296

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLATYQQIRDMNY  606
             SF+LAGRDT +SAL+ FFWLLS  P+V +RI  E   I   +     ++ ++ ++R+M+Y
Sbjct  297   SFILAGRDTTSSALSWFFWLLSSRPDVEERILKELENIRRQNGKSIGEIYSFDELREMHY  356

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L AAI E+MRL+PPV  D+K C  +D LPDGT + K   ++YH +AMGRM+SIWG DC E
Sbjct  357   LHAAISEAMRLYPPVPVDTKACKENDILPDGTVIGKDWFISYHTFAMGRMESIWGEDCCE  416

Query  425   FKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESR  246
             FKPERW+E+G+ K E+ +KYPVF AGPR+CLGKDMA ++MKS+A +++  F ++V+ E+ 
Sbjct  417   FKPERWIENGICKQESPFKYPVFHAGPRMCLGKDMAYIQMKSIAASVLERFGMDVLLENG  476

Query  245   QMPRYAPGLTATVRGGLSVRITDR  174
               P     LT  ++GGL VR+ +R
Sbjct  477   NPPEPLLSLTLRMKGGLPVRVKER  500



>ref|XP_010026558.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
 gb|KCW83164.1| hypothetical protein EUGRSUZ_B00119 [Eucalyptus grandis]
Length=514

 Score =   422 bits (1085),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 300/464 (65%), Gaps = 21/464 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  52    SFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHVLKANFHNYPKGVP  111

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGDLLG GIF VDG LW  QRK+AS EF + S+R +   ++ AEV  RL PLL+ Y
Sbjct  112   FTSILGDLLGCGIFNVDGPLWSTQRKLASHEFSTHSLRDFVLRMLEAEVENRLLPLLQDY  171

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+L+RF+FD +C+ S G DP CLDLS P+     AF+ AS++ A RA + 
Sbjct  172   ADTDRTLDLQDLLKRFTFDTVCQVSLGTDPDCLDLSRPLPPLVTAFENASRICAMRATSP  231

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR L+IGSEKKL EA+ L++    ++I  ++K       DQ      DLLSRF
Sbjct  232   VYLVWKIKRALSIGSEKKLAEAVKLVHGDILDIIRNRKKKLLQENGDQQIKYDGDLLSRF  291

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD-QD  642
             +     ++++RD+VISF++AGRDT ++A+T  FWLL+++      I +E   I++     
Sbjct  292   LAAGHSEEMVRDMVISFVMAGRDTTSAAMTWLFWLLAQNSNAEQAIISEIDSILDQSCNK  351

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+PP+ +DSK    DD LPDGT VRKG RVTY PY MG
Sbjct  352   FLEFENLKEMKFLKACLCESMRLYPPITWDSKHATVDDVLPDGTPVRKGDRVTYFPYGMG  411

Query  461   RMDSIWGADCREFKPERWL-----EDGV---FKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             RM+ +WG D  EFKP+RWL     EDG     ++ + +KYPVFQAGPRVCLGK MA ++M
Sbjct  412   RMEELWGKDRLEFKPDRWLVGPGMEDGAKGELRAVSPFKYPVFQAGPRVCLGKQMAFIQM  471

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K V  +++R F+I  V E+   P + P LTA + GGL V +  R
Sbjct  472   KYVVASILRRFEIRPVLENG--PIFVPLLTAHMAGGLKVAVKKR  513



>ref|XP_009368544.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
 ref|XP_009375220.1| PREDICTED: cytochrome P450 94B3-like [Pyrus x bretschneideri]
Length=512

 Score =   422 bits (1084),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 301/462 (65%), Gaps = 18/462 (4%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQ  1338
             S+     NL DWY+ LL+ SP+ TI VH +G    V+TANP+NVE++L T F NFPKGK 
Sbjct  51    SFCKNQHNLLDWYTSLLSASPSQTIVVHRIGARRIVVTANPSNVEHILKTNFVNFPKGKP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
                 LGDLLG GIF VDGDLW  QRK+AS EF + S+R +  + +  EV  RL PLLE  
Sbjct  111   LTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSTKSLREFVVKTLEEEVEGRLIPLLEEA  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E++ VLD Q++L+ F+FD +CK S G DP CLDLS PV     AFD A+++SA RA   
Sbjct  171   AESQRVLDMQEILKMFAFDTVCKVSLGTDPFCLDLSRPVPPLVKAFDCAAEISARRARAP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC----GGARDQS-DLLSRFMG  813
                +WK+KR L+IGSEKKL EA+ L++    E+I+ K+K      G R +S D+LSR + 
Sbjct  231   LYLMWKMKRALSIGSEKKLREAVKLVHGSVHEIIQNKKKILQRDEGKRIESRDILSRLLL  290

Query  812   IIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRI--RAESGRIMEPDQDL  639
                 ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP++T +I    E+  +     + 
Sbjct  291   AGHGEEVVRDMVISFILAGRDTTSAAMTWLFWLLSKHPDITHKIVNEVENVVVQNNGTEK  350

Query  638   ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGR  459
               +  ++ M +L A++ E+MRL+PPV +DSK    D  LPDGT+V KG RVTY PY MGR
Sbjct  351   LGFDDLQKMRFLRASLCETMRLYPPVPWDSKHAEVDTVLPDGTWVGKGDRVTYFPYGMGR  410

Query  458   MDSIWGADCREFKPERWLE-------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKS  300
             M+ +WG D  EF P+RW +       D V K  + YK+PVFQAGPRVCLGK+MA ++MK 
Sbjct  411   MEELWGKDRFEFNPDRWFDIEPGCDGDRVLKFVSPYKFPVFQAGPRVCLGKEMAFIQMKY  470

Query  299   VAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             V  +++R F+I  VC     P + P LTA + GGL V +  R
Sbjct  471   VMASVLRRFEIRPVC-GEDRPAFVPLLTAHMAGGLKVLVRKR  511



>gb|AAL54884.1|AF092913_1 cytochrome P450-dependent fatty acid hydroxylase [Nicotiana tabacum]
Length=510

 Score =   421 bits (1083),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 213/453 (47%), Positives = 291/453 (64%), Gaps = 16/453 (4%)
 Frame = -1

Query  1493  HSNLCDWYSCLLNKSPTGT---IHVHVLGNVITANPANVEYMLTTKFENFPKGKQFASIL  1323
             H     W S ++  +P  T   I       + TANP+NV++ML T F+ + KG    + L
Sbjct  60    HDQRIKWISDIILSTPNLTFTLIRPLNFHTIFTANPSNVQHMLKTNFQVYQKGHNSNTTL  119

Query  1322  GDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENRE  1143
              D L  GIF VDGD+WK+QR++AS EF + S+R +   +V  E+  RL P+L     N+ 
Sbjct  120   KDFLSNGIFNVDGDIWKYQRQVASHEFNTRSLRKFVETVVDTELSERLIPILATAAANKT  179

Query  1142  VLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVW  963
             VLDFQD+L+RF+FDNICK +FG DPG L  SLP ++FA AF+ A +LS ER +   P +W
Sbjct  180   VLDFQDILQRFAFDNICKIAFGYDPGYLLPSLPEAEFAVAFEDAVRLSTERFILPFPLIW  239

Query  962   KVKRLLNIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFMGI-IDDDK  795
             K+KR LNIGSEKKL  A+  + E A+E++ +K+   K   + D +DLLSRF+     D+ 
Sbjct  240   KMKRALNIGSEKKLRFAVEQVREFAKEIVREKQRELKDKSSLDSADLLSRFLSTGHSDEN  299

Query  794   LLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRD  615
              + DIVISF+LAGRDT ++ALT FFWL+S+HPEV  +I  E G   E  + L  Y ++++
Sbjct  300   FVTDIVISFILAGRDTTSAALTWFFWLISKHPEVESQILKEIG---EKSESLLLYDEVKN  356

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M Y  A++ ESMR +PPV  D+K    DD LPDGTFV+KG RVTYHPYAMGR++ +WG D
Sbjct  357   MIYTHASLCESMRFYPPVPMDTKEATKDDILPDGTFVKKGNRVTYHPYAMGRVEKVWGKD  416

Query  434   CREFKPERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAF  273
               EF+PERWL+      +  F S++ Y YPVFQAGPRVCLGK+MA ++MK V   ++R F
Sbjct  417   WAEFRPERWLDKDEVTGNWTFVSKDAYTYPVFQAGPRVCLGKEMAFLQMKRVVAGVLRRF  476

Query  272   DIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              +  V E    P +   LTA ++    V I +R
Sbjct  477   KVVPVVEQGAEPVFISYLTAKMKEVFPVTIEER  509



>ref|XP_004136768.1| PREDICTED: cytochrome P450 94A1-like [Cucumis sativus]
 gb|KGN59417.1| hypothetical protein Csa_3G818260 [Cucumis sativus]
Length=511

 Score =   421 bits (1083),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 214/454 (47%), Positives = 301/454 (66%), Gaps = 13/454 (3%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFAS  1329
             +      DW + +L    T T      G V   ITANP  VE++L T+FEN+PKG++F S
Sbjct  53    LNRHRFLDWSTEVLRNCRTNTSVFKRPGKVHGVITANPLVVEHILKTQFENYPKGERFIS  112

Query  1328  ILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGEN  1149
             +L D LGRGIF  DG++WK QRK AS EF + S+R++  E V  E+++RL P+     E 
Sbjct  113   LLEDFLGRGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVRVEIQSRLLPIFGKACET  172

Query  1148  REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLS-LPVSKFAAAFDLASKLSAERAVTASP  972
               +LD QDVL RF+FDN+CK +F  DP CL       ++F  AF+ A+ LSA R + A P
Sbjct  173   ERILDLQDVLERFAFDNVCKLAFNYDPACLGGGGTSAAEFMRAFEDAANLSAGRFMYAFP  232

Query  971   AVWKVKRLLNIGSEKKLGEAIGLINELAEEMIE---QKRKCGGARDQSDLLSRFMGIIDD  801
              ++KVK+  NIGSEK L E+I ++++ AE++I    +++K     +  DLLSRFMG  ++
Sbjct  233   GLYKVKKFFNIGSEKTLNESIAIVHKFAEDIIHSRLEEKKTTQIENDQDLLSRFMGDQNN  292

Query  800   D-KLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLA  636
               + LRDI+ISF+LAGRDT +SALT FFW+LS   +V  +I AE   I    +    ++ 
Sbjct  293   SPQFLRDIIISFILAGRDTTSSALTWFFWILSSRHDVQQKILAELETIRTKARKEIGEMY  352

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
             ++ ++RDM+YL AAI E++RL+PPV  D+K C NDD LPDGTF+ K   VTYH YAMGRM
Sbjct  353   SFDELRDMHYLQAAISETLRLYPPVPVDTKACRNDDVLPDGTFIGKSWFVTYHTYAMGRM  412

Query  455   DSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
             +SIWG D  E+ PERWLE+GV K+E+ +++P+F AGPR+CLGKDMA ++MK +A A+I  
Sbjct  413   ESIWGKDYGEYSPERWLENGVCKTESPFRFPIFHAGPRMCLGKDMAYIQMKCIAAAVIEK  472

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             F++E+V E ++ P++   LT  +  GL V I  R
Sbjct  473   FEVEMV-EKKKSPKHLLSLTLRMENGLEVMIKKR  505



>ref|XP_006482030.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis]
Length=504

 Score =   421 bits (1082),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 216/449 (48%), Positives = 298/449 (66%), Gaps = 16/449 (4%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L   PTGT   +  G    VITANPANVE++L T FEN+PKG++F ++L D LG
Sbjct  56    DWSTEILKHCPTGTAIFYRPGKIHGVITANPANVEHILKTNFENYPKGQRFVTLLEDFLG  115

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
             RGIF  DG+LWK QRK AS EF + S+R++  + V  E  +RL P+L         LD Q
Sbjct  116   RGIFNSDGELWKVQRKTASYEFNTKSLRNFVMDSVRFETLSRLVPILTKASRTGLALDLQ  175

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDL-SLPVSKFAAAFDLASKLSAERAVTASPAVWKVKR  951
             D+L R++FDNICK +F  DPGCL       S+F  AF+ A+ LS+ R   A   +W VK+
Sbjct  176   DILERYAFDNICKVAFNFDPGCLGGDGTAGSEFMRAFEDAATLSSGRFRYAFRHMWSVKK  235

Query  950   LLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGI-IDDDKLLRDIVI  774
               +IGSE+KL  +I +++E A  +I  + +      + DLLSRF+G   +  + LRDIVI
Sbjct  236   FFDIGSERKLKNSIAIVHEFANNIIRSRMEEKTENMEDDLLSRFIGNGKNSTEFLRDIVI  295

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT-------DRIRAESGRIMEPDQDLATYQQIRD  615
             SF+LAGRDT +SAL+ FFWLL+ HP+V        + IRA +GR +       +++++RD
Sbjct  296   SFILAGRDTTSSALSWFFWLLASHPKVEQNILKELESIRARNGRSVGATY---SFEELRD  352

Query  614   MNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGAD  435
             M+YL AA+ E++RL+PPV  DSK C NDD LPDGTFV K   VTYH YAMGRM+SIWG +
Sbjct  353   MHYLHAALSETLRLYPPVPVDSKACRNDDVLPDGTFVGKDWFVTYHAYAMGRMESIWGEN  412

Query  434   CREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             C E+ PERWLEDG+++ EN++++PVF AGPR+CLGKDMA ++MKS+A ++I  F ++V  
Sbjct  413   CNEYLPERWLEDGIYRPENVFRFPVFHAGPRMCLGKDMAYIQMKSIAASVIERFVVDVQH  472

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDRRP  168
             +    P     LT  ++ GL VR+ +R P
Sbjct  473   KD-TCPEKVLSLTLRIKDGLHVRVRERCP  500



>ref|XP_009604998.1| PREDICTED: cytochrome P450 94B3-like [Nicotiana tomentosiformis]
Length=500

 Score =   420 bits (1079),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 292/444 (66%), Gaps = 10/444 (2%)
 Frame = -1

Query  1484  LCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQFASILGDL  1314
             L DWY+ LL++SPT TI V   G    +ITAN  NVE++L T F N+PKG+ F  ILGD 
Sbjct  57    LLDWYTELLSESPTQTILVQRFGAPRTIITANANNVEHILKTNFINYPKGQPFTEILGDF  116

Query  1313  LGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLD  1134
             LG GIF VDG+ W  QRK+AS EF + S+R +  + +   V TRL PLL+   ++ +VLD
Sbjct  117   LGMGIFNVDGERWNTQRKLASHEFSTKSLREFVVKTLEEVVETRLIPLLDQAAKSTKVLD  176

Query  1133  FQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVK  954
              QDVLRRF+FD ICK S G DP CLD    V     AFD AS+  A R +    AVWK K
Sbjct  177   LQDVLRRFAFDTICKVSLGTDPHCLDDLSHVPILVEAFDNASQACAMRGMAPIYAVWKSK  236

Query  953   RLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGARDQSDLLSRFMGIIDDDKLLRD  783
             R LN+GSEKKL E +  ++    E+IE+K++     G     DLLSR +    +D+++RD
Sbjct  237   RALNLGSEKKLKENVKRVHCCISEIIEKKKQKINENGDHKNMDLLSRLLIAGHEDEVVRD  296

Query  782   IVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYL  603
             +VISFL+AGRDT +SALT  FWL ++H +V + + +E   I   D+ L  +  +++M YL
Sbjct  297   MVISFLIAGRDTTSSALTWLFWLTTKHHDVKNEMISEITSINNGDKALE-FDDLKEMKYL  355

Query  602   TAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREF  423
              A ++ESMRL+PPV +DSK    DD LPDGT V+KG RVTY  Y MGRM+ IWG D  EF
Sbjct  356   QACLNESMRLYPPVAWDSKHAAKDDILPDGTRVQKGNRVTYFQYGMGRMEEIWGKDRLEF  415

Query  422   KPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESR  246
             KP+RWL E+GV KS   YK+PVFQAGPRVCLGK+MA  +MK V  +++R F+I+ V   +
Sbjct  416   KPDRWLDENGVSKSVCPYKFPVFQAGPRVCLGKEMAFTQMKYVLASVLRRFEIKPVNVDK  475

Query  245   QMPRYAPGLTATVRGGLSVRITDR  174
               P + P LTA + GG +VRI  R
Sbjct  476   --PVFVPLLTAHMAGGFNVRIYHR  497



>ref|XP_010045501.1| PREDICTED: cytochrome P450 94B3-like [Eucalyptus grandis]
Length=513

 Score =   420 bits (1080),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 219/464 (47%), Positives = 300/464 (65%), Gaps = 21/464 (5%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+    S L DWY+ LL++SPT TI +H LG    V+TANP NVE++L   F N+PKG  
Sbjct  51    SFYRNRSRLLDWYTDLLSRSPTQTIVIHRLGACRTVVTANPDNVEHVLKNNFHNYPKGAP  110

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F SILGD LG GIF VDG LW  QRK+AS EF + S+R +    + AEV  RL PLL+ Y
Sbjct  111   FTSILGDFLGCGIFNVDGPLWSTQRKLASHEFSTNSLRDFVVRTLEAEVGNRLLPLLQDY  170

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              +    LD QD+LRRF+FD +C+ S G DP CLDLS  +     AF+ AS++ A RA + 
Sbjct  171   ADTDRTLDLQDLLRRFAFDTVCQVSLGTDPDCLDLSRTLPPLVTAFENASRICATRANSP  230

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRK--CGGARDQS-----DLLSRF  819
                VWK+KR LNIGSEKKL EA+ L+++   ++I  ++K       DQ      DLLSRF
Sbjct  231   VYLVWKIKRGLNIGSEKKLSEAVKLVHDDIVDIIRNRKKKLLQENDDQQIKYDGDLLSRF  290

Query  818   MGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPD-QD  642
             + +   ++++RD+VISF++AGRDT ++A+T  FWLL+++      I +E   I++   ++
Sbjct  291   LAVGHSEEMVRDMVISFVMAGRDTTSAAITWLFWLLAQNSNAERAIVSEVDSILDRSYKN  350

Query  641   LATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMG  462
                ++ +++M +L A + ESMRL+PPV +DSK    DD LPDGT VRKG RVTY PY MG
Sbjct  351   CLDFEALKEMRFLKACLCESMRLYPPVAWDSKHAAADDVLPDGTPVRKGDRVTYFPYGMG  410

Query  461   RMDSIWGADCREFKPERWL--------EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEM  306
             RM  +WG D  EFKP+RWL         +G  ++ + YK+PVFQAGPRVCLGK+MA ++M
Sbjct  411   RMKELWGKDRLEFKPDRWLVGPGMEGGTEGELRAVSPYKFPVFQAGPRVCLGKEMAFIQM  470

Query  305   KSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             K V  ++++ F I  V E+R  P + P LTA + GGL V +  R
Sbjct  471   KYVVASILKRFVIRPVLENR--PVFVPLLTAHMAGGLKVAVKKR  512



>ref|XP_008368443.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 94B3-like [Malus 
domestica]
Length=510

 Score =   420 bits (1079),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 224/474 (47%), Positives = 302/474 (64%), Gaps = 23/474 (5%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEY  1380
             P+  C I      S +  EH NL DWY+ LL+ SP+ TI VH +G    V+T NP NVE+
Sbjct  44    PIIGCFI------SFYKNEH-NLLDWYASLLSGSPSQTIVVHRIGARRTVVTGNPXNVEH  96

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T F NFPK K     LGDLLG GIF VDGDLW  QRK+AS EF   S+R +    + 
Sbjct  97    ILKTNFANFPKXKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSIKSLREFVVNTLX  156

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              EV  RL PLLE   E+++VLD Q++LRRF+FD + K S G DP CLDL+ PV     AF
Sbjct  157   EEVEHRLIPLLEEAAESQKVLDMQEILRRFAFDTVSKVSLGSDPFCLDLTRPVPPLVKAF  216

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGA  849
             + A+++SA R+      +WK+KR L+IGSEKKL EA+ +++    E+I+ K+K     G 
Sbjct  217   ECAAEISARRSTAXLYLMWKIKRALSIGSEKKLKEAVKVVHGSVHEIIQNKKKVFERDGE  276

Query  848   RDQS-DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             R +S D+LSR +     ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP++T +I  E
Sbjct  277   RSESHDMLSRLLLAGHSEEVVRDMVISFILAGRDTTSAAMTWJFWLLSKHPDITHKIVNE  336

Query  671   SGRIMEPDQDLAT-YQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKG  495
                ++         +  ++ M +L A + ESMRL+PPV +DSK    D  LPDGT+V KG
Sbjct  337   VENVVVQRNGTGNGFDDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVGKG  396

Query  494   TRVTYHPYAMGRMDSIWGADCREFKPERWLE-------DGVFKSENLYKYPVFQAGPRVC  336
              RVTY PY MGRM+ +WG D  EF P+RW +       D V KS + YK+PVFQAGPRVC
Sbjct  397   DRVTYFPYGMGRMEELWGXDRFEFNPDRWFDIESGCAGDKVLKSVSPYKFPVFQAGPRVC  456

Query  335   LGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             LGK+MA ++M  V  +++R F+I  VC   Q P + P LTA + GGL V +  R
Sbjct  457   LGKEMAFIQMMYVMASVLRRFEIRPVCGEDQ-PAFVPLLTAHMAGGLKVLVRKR  509



>ref|XP_002979336.1| hypothetical protein SELMODRAFT_110688 [Selaginella moellendorffii]
 gb|EFJ19744.1| hypothetical protein SELMODRAFT_110688 [Selaginella moellendorffii]
Length=491

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 212/436 (49%), Positives = 289/436 (66%), Gaps = 9/436 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV--ITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             +W +  +  SP+ T      G+   IT NPA VE++L T FEN+PKG+     L DLLG 
Sbjct  54    EWSTEYVINSPSNTFTTGRFGSTFKITGNPATVEHILKTNFENYPKGEHLRQSLTDLLGD  113

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF VDG+LWK QR++AS EF + S+R +  + +A EV +RL P L     + + +D QD
Sbjct  114   GIFNVDGELWKIQRRLASFEFTTRSLREFLMDSLADEVHSRLLPTLASVSRDGKEIDLQD  173

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +  RF+FDNICK SFG+DP CLD S P  KFA AFD A+ LS  R     P VWK+ R L
Sbjct  174   LFMRFNFDNICKLSFGVDPACLDPSFPDVKFAQAFDKATTLSTLRFQKIHPLVWKLMRAL  233

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIID---DDKLLRDIVI  774
             N+G E++L E + ++NE A  +++++R+  G  +Q DLLSRF+G+      D+ LRDI+I
Sbjct  234   NVGPERELKEVLDVVNEFAVSVVQKRREEKGRVNQ-DLLSRFIGLDSTSFSDEFLRDIII  292

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLA-TYQQIRDMNYLTA  597
             SF+LAG+DT A +L+ FFWLLS HP V   I  + G I+    +   TY+++RDM YL A
Sbjct  293   SFVLAGKDTTAVSLSWFFWLLSNHPGVQQEIIRKVGSIVAKGSNRPFTYKELRDMVYLQA  352

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
             A+ ESMRL+PPV  D+K   N D LPDG  V KG +V+YH YA+GRM+S+WG DC EFKP
Sbjct  353   ALCESMRLYPPVPIDTKVVKNSDVLPDGNCVEKGMKVSYHVYAIGRMESLWGKDCLEFKP  412

Query  416   ERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMP  237
             ERW+ DG F   + +K+PVFQAGPRVCLGK+MA+++MK V  AL+  F++ VV   ++ P
Sbjct  413   ERWIHDGQFVEVSPFKFPVFQAGPRVCLGKEMAMLQMKYVVAALVPKFELVVV--GKEEP  470

Query  236   RYAPGLTATVRGGLSV  189
              Y   +T  ++ GL V
Sbjct  471   CYGINMTLIMKDGLPV  486



>ref|XP_004249121.2| PREDICTED: cytochrome P450 94A2 isoform X2 [Solanum lycopersicum]
Length=493

 Score =   419 bits (1076),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 299/445 (67%), Gaps = 12/445 (3%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFASILGDLLG  1308
             DW + +L+  PT T   H   NV   +TANP NVE+ML T FENFPKG +F + L DL G
Sbjct  50    DWMTDVLSNCPTNTAVFHRPVNVHGIMTANPLNVEHMLKTNFENFPKGFRFYTRLQDLFG  109

Query  1307  RGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQ  1128
              G+F VDG+ W+ QRK AS EF + S+R++  E    E+ TRL P+LE   +   ++D Q
Sbjct  110   DGLFNVDGESWRTQRKSASYEFSTRSLRNFVMETAQVEIHTRLIPILEEASQRGRIIDIQ  169

Query  1127  DVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRL  948
             D+L RF+FDNI K +F +D  CL  +   S+F  AFD+A+ LS+ R + A P ++K+K++
Sbjct  170   DILERFAFDNIIKLAFNVDANCLGGA--ESEFMQAFDIATTLSSGRFMYAIPFLYKIKKI  227

Query  947   LNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDD--DKLLRDIVI  774
             LNIGSEKKL E+I +++E A+ +I  + +    +   DLLSRFMG  ++   K LRDIVI
Sbjct  228   LNIGSEKKLQESIKVVHEFADNIINSRMEERDEKKDEDLLSRFMGDSNEVSAKFLRDIVI  287

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE----SGRIMEPDQDLATYQQIRDMNY  606
             SF+LAGRDT +SALT FFW+LS   ++  +I  E     GR  +   +   + ++R+M Y
Sbjct  288   SFILAGRDTTSSALTWFFWILSSRKDIEQKILEELVEVRGRNGKKIGEAYNFDELREMQY  347

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L AAI ESMRL+PPV  D++ CL D+ LPDGTF+ K   ++Y  Y+MGRM+++WG DC E
Sbjct  348   LHAAISESMRLYPPVPIDTRSCLKDEILPDGTFIGKDWFISYQTYSMGRMENLWGKDCCE  407

Query  425   FKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCES  249
             +KPERW  E+GV+K E+ +K+PVF AGPR+CLGKDMA ++MKS+A +++  F+ +V  E+
Sbjct  408   YKPERWFDENGVYKQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVLEMFEFDVQLEN  467

Query  248   RQMPRYAPGLTATVRGGLSVRITDR  174
              + P Y   LT  ++GGL V + +R
Sbjct  468   GKCPEYVLSLTLRMKGGLPVEVKER  492



>gb|AJD25220.1| cytochrome P450 CYP94B50 [Salvia miltiorrhiza]
Length=505

 Score =   419 bits (1077),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 221/463 (48%), Positives = 294/463 (63%), Gaps = 27/463 (6%)
 Frame = -1

Query  1508  SWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEYMLTTKFENFPKGKQ  1338
             S+      L  WY+ LL++S   TI VH LG    V+TANP NVEYML T F NFPKGK 
Sbjct  48    SFYKNRHRLLSWYTELLSESENQTIVVHRLGAPRTVVTANPDNVEYMLKTNFANFPKGKP  107

Query  1337  FASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFY  1158
             F  +LGD LG GIF VDG++W  QRK+AS EF + S+R +  +++  EV  RL P+LE  
Sbjct  108   FTELLGDFLGLGIFNVDGEMWSVQRKLASHEFSTKSLREFVVQVLRDEVAARLIPILENA  167

Query  1157  GENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTA  978
              E+  VLD Q+VLRRF+FD ICK S GMDP CLD+S P    ++AFD AS+LSA R    
Sbjct  168   AEDNGVLDMQEVLRRFAFDTICKVSLGMDPSCLDMSRPAPPLSSAFDAASELSAMRGAAP  227

Query  977   SPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGA------RDQSDLLSRFM  816
               AVWK+KR LN+G EK L +A+  +    +EMI  K++   A          DLLSRF+
Sbjct  228   VFAVWKLKRALNVGPEKDLKDAVRTVRGCVDEMIRCKKETMAAGGGGGGGGGGDLLSRFL  287

Query  815   GIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRH--------PEVTDRIRAESGRI  660
             G   + +++RD+VISFL+AGRDT ++ALT  FWLL+ H         E+ D      GR 
Sbjct  288   GAGMESEMVRDMVISFLMAGRDTTSAALTWLFWLLTWHRDAERRAVEEIGDGYGGSCGRE  347

Query  659   MEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTY  480
             +        +  +++MN++ A + E+MRL+PPV +DSK    DD LPDGT V +G RVTY
Sbjct  348   L-------GFDDLKEMNFVKACLCETMRLYPPVVWDSKHAARDDVLPDGTPVFRGNRVTY  400

Query  479   HPYAMGRMDSIWGADCREFKPERWLED-GVFKSENLYKYPVFQAGPRVCLGKDMALVEMK  303
              PY MGRM+++WG D   F+P+RWL+D G  K  + YK+PVFQAGPRVCLGK+MA ++MK
Sbjct  401   FPYGMGRMEALWGKDRLRFRPDRWLDDAGAVKMVSPYKFPVFQAGPRVCLGKEMAFIQMK  460

Query  302   SVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              V  +++  F  E+V    + P + P LTA + GG SVR+  R
Sbjct  461   YVVASVLARF--ELVPVRPEPPVFVPQLTAYMAGGFSVRVRRR  501



>gb|AAZ39645.1| cytochrome P450 monooxygenase [Petunia x hybrida]
Length=509

 Score =   419 bits (1076),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 208/447 (47%), Positives = 296/447 (66%), Gaps = 16/447 (4%)
 Frame = -1

Query  1475  WYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             W S ++  +P  T  +    N   + TANPANV++ML T F  + KG++ +S + D LG 
Sbjct  65    WISDIILSTPNLTFTLMRPLNFHTIFTANPANVQHMLKTNFHVYQKGEKSSSTVSDFLGN  124

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF ++G+ WK+QR++AS EF + S+R +   +V  E+  RL P+L     N+ VLDFQD
Sbjct  125   GIFNINGEKWKYQRQVASHEFNTRSLRKFVETVVDTELNERLIPILATAAANKIVLDFQD  184

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLL  945
             +L+RF+FDNICK +FG DPG L  SLP ++FA AF+ + +LS+ER     P +WK+KR L
Sbjct  185   ILQRFAFDNICKIAFGYDPGYLLPSLPQAEFAVAFEDSVRLSSERINVPFPLIWKIKRAL  244

Query  944   NIGSEKKLGEAIGLINELAEEMIEQKR---KCGGARDQSDLLSRFMGI-IDDDKLLRDIV  777
             +IGSEKKL  A+G + E A++++ +K+   K   + D +DLLSRF+     D+  + DIV
Sbjct  245   DIGSEKKLRIAVGKVREYAKKIVREKQSELKEKSSLDSADLLSRFLSTGHSDEDFVTDIV  304

Query  776   ISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQDLATYQQIRDMNYLTA  597
             ISF+LAGRDT ++ALT FFWL+S+HPEV  +I  E G   E  + +  Y ++++M Y  A
Sbjct  305   ISFILAGRDTTSAALTWFFWLVSKHPEVESQILKEIG---EKSETVVLYDEVKNMMYTHA  361

Query  596   AIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKP  417
             ++ ESMR +PPV  D+K    +D LPDGTFV+KGTRVTYHPYAMGR++ +WG D  EFKP
Sbjct  362   SLCESMRFYPPVPMDTKEATQNDILPDGTFVKKGTRVTYHPYAMGRVEKVWGKDWAEFKP  421

Query  416   ERWLE------DGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVC  255
             ERWL+      +  F S++ Y YPVFQAGPR+CLGK+MA ++MK V   +++ F +    
Sbjct  422   ERWLDINEVTGNCTFVSKDPYTYPVFQAGPRICLGKEMAFLQMKRVVAGVLQRFKVVPAV  481

Query  254   ESRQMPRYAPGLTATVRGGLSVRITDR  174
             E    P +   LTA ++GG  V I +R
Sbjct  482   EQGVEPEFISYLTAKMKGGFPVTIEER  508



>ref|XP_008341677.1| PREDICTED: cytochrome P450 94B3-like [Malus domestica]
Length=512

 Score =   418 bits (1075),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 224/476 (47%), Positives = 303/476 (64%), Gaps = 25/476 (5%)
 Frame = -1

Query  1550  PLCKCEICKAYLTSSWTMEHSNLCDWYSCLLNKSPTGTIHVHVLG---NVITANPANVEY  1380
             P+  C I      S +  EH NL DWY+ LL+ SP+ TI VH +G    V+T NP NVE+
Sbjct  44    PIIGCFI------SFYKNEH-NLLDWYASLLSGSPSQTIVVHRIGARRTVVTGNPXNVEH  96

Query  1379  MLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVA  1200
             +L T F NFPK K     LGDLLG GIF VDGDLW  QRK+AS EF   S+R +    + 
Sbjct  97    ILKTNFANFPKXKPLTEFLGDLLGCGIFNVDGDLWSTQRKLASHEFSIKSLREFVVNTLX  156

Query  1199  AEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAF  1020
              EV  RL PLLE   E+++VLD Q++LRRF+FD + K S G DP CLDL+ PV     AF
Sbjct  157   EEVEHRLIPLLEEAAESQKVLDMQEILRRFAFDTVSKVSLGSDPFCLDLTRPVPPLVKAF  216

Query  1019  DLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKC---GGA  849
             + A+++SA R+      +WK+KR L+IGSEKKL EA+ +++    E+I+ K+K     G 
Sbjct  217   ECAAEISARRSTAXLYLMWKIKRALSIGSEKKLKEAVKVVHGSVHEIIQNKKKVFERDGE  276

Query  848   RDQS-DLLSRFMGIIDDDKLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE  672
             R +S D+LSR +     ++++RD+VISF+LAGRDT ++A+T  FWLLS+HP++T +I  E
Sbjct  277   RSESHDMLSRLLLAGHSEEVVRDMVISFILAGRDTTSAAMTWJFWLLSKHPDITHKIVNE  336

Query  671   SGRIMEPDQDL---ATYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVR  501
                ++   +       +  ++ M +L A + ESMRL+PPV +DSK    D  LPDGT+V 
Sbjct  337   VENVVVRTKKWYGKLGFDDLQKMRFLRACLCESMRLYPPVPWDSKHAEVDTVLPDGTWVG  396

Query  500   KGTRVTYHPYAMGRMDSIWGADCREFKPERWLE-------DGVFKSENLYKYPVFQAGPR  342
             KG RVTY PY MGRM+ +WG D  EF P+RW +       D V KS + YK+PVFQAGPR
Sbjct  397   KGDRVTYFPYGMGRMEELWGXDRFEFNPDRWFDIESGCAGDKVLKSVSPYKFPVFQAGPR  456

Query  341   VCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             VCLGK+MA ++M  V  +++R F+I  VC   Q P + P LTA + GGL V +  R
Sbjct  457   VCLGKEMAFIQMMYVMASVLRRFEIRPVCGEDQ-PAFVPLLTAHMAGGLKVLVRKR  511



>ref|XP_004249120.1| PREDICTED: cytochrome P450 94A2 isoform X1 [Solanum lycopersicum]
Length=496

 Score =   417 bits (1073),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 300/452 (66%), Gaps = 12/452 (3%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLGN---VITANPANVEYMLTTKFENFPKGKQFAS  1329
             +      +W + +L+   T T   +  GN   V+TANP NVE+ML   FENFPKG +F +
Sbjct  46    LNRHQFLEWTTNVLSNCTTNTAVFYRPGNIHGVMTANPLNVEHMLKANFENFPKGFRFYT  105

Query  1328  ILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGEN  1149
              L D LG GIF VDG++WK QRK AS EF + S+R++  +    E+ TRL P+LE   + 
Sbjct  106   RLEDFLGDGIFNVDGEIWKIQRKSASYEFSTRSLRNFVMQTAQVEIHTRLIPILEEASQR  165

Query  1148  REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLSLPVSKFAAAFDLASKLSAERAVTASPA  969
               ++D QD+L RF+FDNI K +F +D  CL  +   S+F  AFD+A+ LS+ R + A P 
Sbjct  166   GRIIDIQDILERFAFDNIIKLAFNVDANCLGGA--ESEFMQAFDIATTLSSGRFMYAIPF  223

Query  968   VWKVKRLLNIGSEKKLGEAIGLINELAEEMIEQKRKCGGARDQSDLLSRFMGIIDD--DK  795
             ++K+K++LNIGSEKKL E+I +++E A+ +I  + +    +   DLLSRFMG  ++   K
Sbjct  224   LYKIKKILNIGSEKKLQESIKVVHEFADNIINSRMEERDEKKDEDLLSRFMGDSNEVSAK  283

Query  794   LLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAE----SGRIMEPDQDLATYQ  627
              LRDIVISF+LAGRDT +SALT FFW+LS   ++  +I  E     GR  +   +   + 
Sbjct  284   FLRDIVISFILAGRDTTSSALTWFFWILSSRKDIEQKILEELVEVRGRNGKKIGEAYNFD  343

Query  626   QIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSI  447
             ++R+M YL AAI ESMRL+PPV  D++ CL D+ LPDGTF+ K   ++Y  Y+MGRM+++
Sbjct  344   ELREMQYLHAAISESMRLYPPVPIDTRSCLKDEILPDGTFIGKDWFISYQTYSMGRMENL  403

Query  446   WGADCREFKPERWL-EDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFD  270
             WG DC E+KPERW  E+GV+K E+ +K+PVF AGPR+CLGKDMA ++MKS+A +++  F+
Sbjct  404   WGKDCCEYKPERWFDENGVYKQESPFKFPVFHAGPRMCLGKDMAYIQMKSIAASVLEMFE  463

Query  269   IEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
              +V  E+ + P Y   LT  ++GGL V + +R
Sbjct  464   FDVQLENGKCPEYVLSLTLRMKGGLPVEVKER  495



>ref|XP_010679200.1| PREDICTED: cytochrome P450 94A1-like [Beta vulgaris subsp. vulgaris]
Length=525

 Score =   418 bits (1075),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 224/494 (45%), Positives = 308/494 (62%), Gaps = 29/494 (6%)
 Frame = -1

Query  1568  SVSKLKPLCKC---EICKAY-----LTSSWTMEHSNLCDWYSCLLNKSPTGTIHVH-VLG  1416
             S S+ K  CK    E  KAY     L +    +      W + L++ SP  T  +H  LG
Sbjct  28    SSSQTKRTCKSTSFEFPKAYPIIGHLLAVLKQKKDERFRWLTSLVHNSPNSTFVMHRPLG  87

Query  1415  --NVITANPANVEYMLTTKFENFPKGKQFASILGDLLGRGIFAVDGDLWKFQRKMASREF  1242
               +++T NPANV+++L T+F  + KG    +IL DLLG GIF  DGD+WKFQR++AS EF
Sbjct  88    QKSILTGNPANVQHILKTRFPLYEKGPLHKTILEDLLGDGIFNADGDVWKFQRQVASHEF  147

Query  1241  GSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQDVLRRFSFDNICKFSFGMDPGC  1062
              + S+R++   +V  E+  RL P+L    +N+ VLD QD+L+RF+FDNICK +FG DP  
Sbjct  148   STKSLRNFVETVVDTELSDRLIPILSDAAKNQTVLDLQDILQRFTFDNICKIAFGYDPEY  207

Query  1061  LDLSLPVSKFAAAFDLASKLSAERAVTASPAVWKVKRLLNIGSEKKLGEAIGLINELAEE  882
             L  SLP +KFA AF+ A  +S +R  T  P  WK++R LNIGSEKKL EA+  I   A+ 
Sbjct  208   LSPSLPDAKFAVAFEDAVMISTQRFRTFFPITWKIRRFLNIGSEKKLKEAVSEIRNFAKS  267

Query  881   MIEQKRKCG-------GARDQSDLLSRFMGI-IDDDKLLRDIVISFLLAGRDTIASALTS  726
             ++ QK++          + +  DLLSRF+     D+  + DIVISF+LAGRDT +SALT 
Sbjct  268   LVSQKKQGMLKNLEGFPSSESEDLLSRFLKSGHSDENFVTDIVISFILAGRDTTSSALTW  327

Query  725   FFWLLSRHPEVTDRIRAE----SGRIMEPDQDLATYQQIRDMNYLTAAIHESMRLFPPVQ  558
             F+WLL ++  V + I  E     G+     +  +  ++++DM Y+ AA++ESMRL+PPV 
Sbjct  328   FYWLLYKNKHVEEEIIKEINKNRGKQSNKTEHSSVLEEVKDMVYIHAALYESMRLYPPVP  387

Query  557   FDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCREFKPERWLEDGV-----  393
              D+K    +D LPDGT V+KG+ VTYHPYAMGRM+SIWG D  E++PERWLE G      
Sbjct  388   LDTKQANANDVLPDGTLVQKGSWVTYHPYAMGRMESIWGIDWAEYRPERWLEVGTGEVNW  447

Query  392   -FKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESRQMPRYAPGLT  216
              F  ++ Y YPVFQAGPRVCLGKDMA ++MK V   ++  F +  V +    P Y P LT
Sbjct  448   KFVPKDPYSYPVFQAGPRVCLGKDMAFLQMKRVVAGILERFRVVPVVDDGFEPVYIPNLT  507

Query  215   ATVRGGLSVRITDR  174
             A ++GGL VR  +R
Sbjct  508   AKMQGGLQVRFEER  521



>ref|XP_004167155.1| PREDICTED: cytochrome P450 94A1-like [Cucumis sativus]
Length=511

 Score =   418 bits (1074),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 213/454 (47%), Positives = 300/454 (66%), Gaps = 13/454 (3%)
 Frame = -1

Query  1499  MEHSNLCDWYSCLLNKSPTGTIHVHVLGNV---ITANPANVEYMLTTKFENFPKGKQFAS  1329
             +      DW + +L    T T      G V   ITANP  VE++L T+FEN+PKG++F S
Sbjct  53    LNRHRFLDWSTEVLRNCRTNTSVFKRPGKVHGVITANPLVVEHILKTQFENYPKGERFIS  112

Query  1328  ILGDLLGRGIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGEN  1149
             +L D LGRGIF  DG++WK QRK AS EF + S+R++  E V  E+++RL P+     E 
Sbjct  113   LLEDFLGRGIFNSDGEIWKVQRKTASYEFNTKSLRNFVMENVRVEIQSRLLPIFGKACET  172

Query  1148  REVLDFQDVLRRFSFDNICKFSFGMDPGCLDLS-LPVSKFAAAFDLASKLSAERAVTASP  972
               +LD QDVL RF+FDN+CK +F  D  CL       ++F  AF+ A+ LSA R + A P
Sbjct  173   ERILDLQDVLERFAFDNVCKLAFNYDSACLGGGGTSAAEFMRAFEDAANLSAGRFMYAFP  232

Query  971   AVWKVKRLLNIGSEKKLGEAIGLINELAEEMIE---QKRKCGGARDQSDLLSRFMGIIDD  801
              ++KVK+  NIGSEK L E+I ++++ AE++I    +++K     +  DLLSRFMG  ++
Sbjct  233   GLYKVKKFFNIGSEKTLNESIAIVHKFAEDIIHSRLEEKKTTQIENDQDLLSRFMGDQNN  292

Query  800   D-KLLRDIVISFLLAGRDTIASALTSFFWLLSRHPEVTDRIRAESGRIMEPDQ----DLA  636
               + LRDI+ISF+LAGRDT +SALT FFW+LS   +V  +I AE   I    +    ++ 
Sbjct  293   SPQFLRDIIISFILAGRDTTSSALTWFFWILSSRHDVQQKILAELETIRTKARKEIGEMY  352

Query  635   TYQQIRDMNYLTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRM  456
             ++ ++RDM+YL AAI E++RL+PPV  D+K C NDD LPDGTF+ K   VTYH YAMGRM
Sbjct  353   SFDELRDMHYLQAAISETLRLYPPVPVDTKACRNDDVLPDGTFIGKSWFVTYHTYAMGRM  412

Query  455   DSIWGADCREFKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRA  276
             +SIWG D  E+ PERWLE+GV K+E+ +++P+F AGPR+CLGKDMA ++MK +A A+I  
Sbjct  413   ESIWGKDYGEYSPERWLENGVCKTESPFRFPIFHAGPRMCLGKDMAYIQMKCIAAAVIEK  472

Query  275   FDIEVVCESRQMPRYAPGLTATVRGGLSVRITDR  174
             F++E+V E ++ P++   LT  +  GL V I  R
Sbjct  473   FEVEMV-EKKKSPKHLLSLTLRMENGLEVMIKKR  505



>ref|XP_010247229.1| PREDICTED: cytochrome P450 94B3-like [Nelumbo nucifera]
Length=504

 Score =   417 bits (1072),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 213/444 (48%), Positives = 294/444 (66%), Gaps = 10/444 (2%)
 Frame = -1

Query  1478  DWYSCLLNKSPTGTIHVHVLG--NVITANPANVEYMLTTKFENFPKGKQFASILGDLLGR  1305
             DW S +L  SP  T      G   ++TANP NVE++L   F+N+PKG      L D LGR
Sbjct  58    DWTSDILCWSPNNTTAYCRPGMHGILTANPLNVEHILRNNFDNYPKGPSHFHTLKDFLGR  117

Query  1304  GIFAVDGDLWKFQRKMASREFGSVSIRSYAFEIVAAEVRTRLFPLLEFYGENREVLDFQD  1125
             GIF  DG++WK QRK+AS EF + S+RS+A   V  E++TRL PLL    E  +V+D QD
Sbjct  118   GIFNADGNIWKVQRKIASFEFNTKSLRSFAITNVKEEIQTRLVPLLRKTSELNQVVDMQD  177

Query  1124  VLRRFSFDNICKFSFGMDPGCLDLSLPV-SKFAAAFDLASKLSAERAVTASPAVWKVKRL  948
             +L RF+FDNICK +F +DPGCL       ++F  AFD AS LS  R     P  WK K+ 
Sbjct  178   ILERFAFDNICKLAFNVDPGCLGGDGTAGAEFMKAFDDASLLSVARFFDVHPLWWKTKKA  237

Query  947   LNIGSEKKLGEAIGLINELAEEMIEQK-RKCGGARDQSDLLSRFMGI-IDDDKLLRDIVI  774
             LNIGSE++L EAI ++++ ++ +I  +  + GG +   DLLSRF+   ++  + LRDIVI
Sbjct  238   LNIGSERRLREAIRMVHDFSDNIIRSRMEEEGGKQSTEDLLSRFVADDLNSPEFLRDIVI  297

Query  773   SFLLAGRDTIASALTSFFWLLSRHPEVT----DRIRAESGRIMEPDQDLATYQQIRDMNY  606
             SF+LAGRDT +S L  FFWLLS  P++     D +++   R  +   D  +++++R+M+Y
Sbjct  298   SFILAGRDTTSSTLAWFFWLLSSRPDIEHNILDELKSIRTRTRKEIGDAYSFEELREMHY  357

Query  605   LTAAIHESMRLFPPVQFDSKFCLNDDTLPDGTFVRKGTRVTYHPYAMGRMDSIWGADCRE  426
             L AAI E++RL+PPV  D+K CL DD LPDGT VRKG  VTYH YAMGRM+ IWG DCRE
Sbjct  358   LQAAISEALRLYPPVAMDTKVCLKDDVLPDGTSVRKGWVVTYHAYAMGRMECIWGKDCRE  417

Query  425   FKPERWLEDGVFKSENLYKYPVFQAGPRVCLGKDMALVEMKSVAVALIRAFDIEVVCESR  246
             F+PERWLE+G  + E+ +++  F AGPR+CLGKDMA ++MKS+A +++  F I+VV +  
Sbjct  418   FRPERWLENGSCRQESPFRFSAFHAGPRMCLGKDMAYIQMKSIAASVVERFHIDVV-DGL  476

Query  245   QMPRYAPGLTATVRGGLSVRITDR  174
             + P     LT  ++GGL VR+ +R
Sbjct  477   KCPELLLSLTIRMKGGLPVRVKER  500



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5191934777694